5EVEA

Crystal structure of amb a 8 in complex with poly-pro10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
SWQTYVDEHLMCDIEGTGQHLASAAIFGTDGNVWAKSSSFPEFKPDEINAIIKEFSEPGALAPTGLFLAGAKYMVIQGEPGAVIRGKKGAGGICIKKTGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Ambrosia artemisiifolia
molecule tags Allergen
molecule keywords Profilin
total genus 31
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5eveA00
2ACGA 3MSHA 2B95A 3T1SA 3NECA 1FIKA 2VK3A 2PRFA 1VEUA 3T1RA 2ZL1B 2HZ5A 3UB5P 2PBDP 3KYEA 5EV0A 4QWOA 1SZVA 4D60A 1PNEA 1Y4OA 2BTFP 1CJFA 1HLUP 3L7HA 2ZL1A 3NULA 3T12B 2PAVP 3T1QB 1K0KA 3U4LP 2JKFA 5FEGA 1VETB 3CPTB 4FTXA 2V8FA 1Z09A 5EM1A 3T1XA 4FUWA 4X25A 1CF0A 1CQAA 1F2KA 1PRQA 3LGOA 4X1MA 5EVEA 3MS6A 1VETA 3CPTA 1SKOB 1PFLA 1ACFA 4X1LA 1D1JA 3LEQA 5EM0A 5FDSA 2V8CA 2JKGA 1YPRA 1AWIA 2E8JA 1FILA 1A0KA 3CHWP 5FEFA 4ESPA 3DAVA 1VEUB 1G5UA 3D9YA 1SKOA 1J3WA 3L9KA
chains in the Genus database with same CATH superfamily
3VP0A 4KZBA 3C38A 1X0OA 3LY3A 3UB6A 3HBRA 1S4SA 4RYEA 1NWZA 2OSUA 3Q1FA 1MXOA 2JKRM 2KX6A 2ZBBA 1W63M 4GB7A 3IX8A 2VA0A 3V67A 1BLCA 2Q9NA 5DTKA 5HWTA 3W4PA 4WEJA 1CI9A 5M18A 4WUJA 1H8ZA 1RP5A 3MFXA 4WLAA 2ZL1B 1PW1A 1L0FA 1ZG6A 3TOIA 2CMNA 5HAPA 1LHYA 2QJ7A 5DKKA 3A3FA 3GTCA 4R3AA 2PD7A 2O9AA 3CG5A 1ESUA 3KYZA 1K56A 4MBHA 2Y2HA 1VEUA 1K4EA 1UWNX 3E2KA 2FFFB 1BULA 2UV0E 1I2WA 1K55A 1SDEA 4GDNA 5DF7A 3SH7A 3HLDA 5FATA 2PHYA 5F69A 2WADA 1IYSA 1P0ZA 4IUKA 5AQAA 1G5UA 1SKOA 2A3UA 4ARZB 3PBTA 4FCFA 4WM9A 4WEKA 3ZG9B 2WYXA 4BBVA 3T4KA 4ZBEA 3WS5A 3GVBA 3VOYA 2Z6CA 1IFQA 5GHXA 3VFFA 2FZ0A 3IT9A 4QU3A 1YLPA 3QNBA 4OOYA 3WS0A 3HVFA 4N1HA 2UWXA 4E6WA 3TG9A 2ZL1A 3ZG8B 4QJGA 4LENA 1MWTA 3N8LA 3BYDA 3BLSA 3AGDA 3PBNA 3SW1A 1XA7A 2ZQDA 4WZ5A 3L9KA 4U3TA 5CGXA 4NKPA 1HVBA 5KSCA 3P09A 4PAUA 5HD5A 3MZFA 4DJ3A 1EW0A 5FI7A 3C5AA 3ISGA 1PFLA 4S2OA 3CAXA 3N8SA 4XT2A 2PD8A 2GX5A 3WS4A 1WYCA 1PWCA 5HWWA 3MF0A 1Y4OA 4OVDA 2RL3A 2XFSA 5FQJA 2XR0A 3SS5A 5EOEA 4BENA 1MWRA 4JXGA 3RFBA 1OTIA 2PR5A 4DXBA 2VGLM 5TJJA 1FQGA 2PBDP 4II7A 4B9OA 5CTMA 4UA6A 2QWSA 4FH4A 3O87A 5D3OA 4EESA 3G6OA 2Z2MB 5EPHA 2HP6A 1SKOB 4O01A 3MKEA 4ARZA 1NY0A 3N4IA 1FCNA 1SKFA 1YSPA 4PM8A 1KVMA 2L0WA 1BUEA 3BECA 4RQ9A 5KSHA 3F1NB 1NRFA 3O86A 4I5SA 1W8QA 1SDNA 1G28A 4Y0UA 3N8RA 5FDHA 3BJNA 4BBUA 5TFQA 3B47A 1JWZA 1S0WA 4IUHA 2H5SA 4UAAA 3S22A 4YINA 5HAQA 4HH3A 4CLCB 5JYPA 4OKPA 3H7WA 3HUNA 4OQGA 3T4SA 3FV7A 1MWUA 4KG5A 3IXDA 1YMXA 3TE8A 4P87A 3BLMA 1OJ5A 2I72A 2KLIA 3C7VA 4C6YA 3PHYA 5IHVA 4IHQA 1PIOA 3ULFA 4BL3A 1MC0A 2HZ5A 3LYXA 4IVIA 4YWZA 3UB5P 1ODVA 4F3LB 1MBLA 2Y2GA 2JN7A 4GCZA 4LRZE 1PYYA 3UDIA 1IYQA 2HDRA 3V3SA 2V8CA 2VV7A 2C6WB 3WRTA 4EXOA 4RX2A 2ZMAA 3ZVTA 3PBQA 4HI4A 1C3BA 1BZAA 3LIEA 3SZTA 3G4PA 3SS3A 4MBFA 4PM6A 3O88A 5A90A 5FEGA 1MWSA 5EVLA 2JKFA 1ES2A 3CUEA 1GHPA 1PRQA 4S2PA 1VETA 5HL6A 1S1YA 4R6LA 3F1NA 1DRMA 3NC8A 4K08A 3LCEA 4GZBA 4XUZA 5CERA 1M6KA 4X55A 5DF8A 5A93A 1OTBA 3IH8A 3ZDJA 1TDGA 1Y54A 1CQAA 3BFDA 1E3UA 3BW6A 1GCEA 3T4OA 4NXEA 3BFGA 3GV9A 1TF1A 2H10A 1K4FA 4UQIS 1FOFA 4N9LA 3F1OA 3BFEA 2P9VB 2ZQ8A 3PTEA 4JGPA 2VGKA 1ES3A 1JVJA 3B33A 1HLUP 2LB5A 4ZTKA 3SH8A 3T1QB 4F3LA 3ZNYA 3Q7VB 1P97A 3NJAA 1GHIA 3PR6A 4P6ZM 1N9BA 2E8IA 3A0SA 5F1GA 5CEBA 3PBRA 2JE5A 3HL9A 2DMWA 3C4OA 2JKTI 2ZD8A 3H9WA 3NBLA 1S66L 2P08A 3TJZC 5EVEA 2OV5A 4JGQA 5GL9A 3K2NA 4KG6A 5E2EA 1GSXA 1AWIA 4WMCD 4LFUA 1T1AA 2R78A 1S4RA 2Y59A 5F68A 4E3KA 5FSRA 1EWZA 1JTGA 2Y2KA 5HPIA 2HDQA 5DTSA 5EM0A 1D7EA 1FILA 5IU1A 2QKPA 1O07A 2B5RA 1IELA 5GLBA 4ZJ3A 3T4JA 1IYPA 2ZC3B 4QWOA 2XA7S 4PKYG 4HP4A 3DTIA 1XJ6A 3G2YA 3RJUA 3TRCA 3QP1A 3OPLA 4E3IA 2EWWA 3CJMA 1FIKA 1ZTUA 2OWJA 3LIDA 3GDIA 2ZQ7A 3OZHA 4EETB 3IXHA 4P85A 5GLDA 5DFXA 1L0GA 4LLOB 4S2KA 2WZXA 4Q0HA 1K57C 1KDSA 3FWLA 2P9VA 1VEUB 2J80A 3ZGAB 3N6IA 3VFHA 3ZVWA 3IXBA 4R3BA 2ZC7A 4PPRA 4IEDA 3UPNA 4MN6A 1CEFA 5I5LA 1JTDA 1XFNA 3KSFA 1H5XA 3OLOA 2W3GA 3HJIA 3ZG5A 5FQMA 4R4RA 5A92A 4DE2A 1S6RA 2A24A 2VGJA 2Y2JA 3JVUA 5HPFA 1PZOA 3EQUA 4WZ5C 4DRTA 2WK0A 3RH8B 3R7WB 3G35A 3CPTB 1LI0A 4Y17A 3MZEA 5FI2A 3E4QA 4E6XA 4GNUA 2VX8A 5GLCA 1E4DA 4X68A 3IBRA 4E3LA 3NIAA 3MR0A 2QYBA 1ES5A 4IBRA 4XUXA 3DBAA 4OLGA 2XROA 1LSWA 4XXRA 1VB6A 2X02A 1XGJA 1ESIA 3SS4A 3RXXA 3VP2A 1NRJA 4FTXA 4I3JA 5CXWA 1DJAA 4CLCA 2PDRA 4OQIA 2V9AA 4KUKA 3A3JA 2VK3A 4O8GA 3MXRA 3UDFA 2PU2A 4AFIA 4EUZA 4GN2A 3GR2A 3CZDA 4FOFA 4X1MA 1I2SA 2HJEA 2XRNA 2GDNA 3LY4A 4RVAA 4R70A 4Y3IA 2EX9A 1PI5A 4GS9B 3KX0X 1F98A 3C2WA 3UE0A 3LEZA 3G31A 1Z09A 4S2LA 1K6RA 1DP6A 5J3WA 2B18A 2J9OA 2BLSA 3CPTA 3OOVA 4X6TA 1L3LA 4Y13A 2ZM2A 5CX7A 1HZOA 2PR6A 1G6OA 1BLSA 3FYZA 2JC7A 1CI8A 2ACGA 1N4OA 3PBSA 3UB9A 3ITAA 2IA2A 4B4ZA 4YOFA 2O9CA 5KZHA 3EEHA 4D60A 2BTFP 3PAEA 1GA9A 2C5WB 4Y0OA 5CGWA 1H3QA 2Y4AA 1W7FA 3UY6A 3LFVA 5FAQA 1KGGA 1OMEA 4MCWA 2Y55A 3E4OA 4JXWA 5G4YA 3A0RA 1OTEA 1WYBA 5G4ZA 4MBKA 3BQ8A 3UE3A 3KYEA 4BBTA 4L9EA 2IWCA 1LSXA 3VSLA 1Y28A 4ZDXA 3OPHA 2HF6A 2MJ6A 4WN5A 4R1GA 1KGFA 4JLFA 3G30A 5EVID 1N9LA 1TD5A 1YPRA 3PXPA 3BY9A 4P6ZS 3S4XA 2J3TD 1G6AA 2V1ZA 2WKRA 4U0XA 4IBXA 4OONA 3C7UA 4R0QA 3Q7ZA 5M19A 2KDKA 2W3HA 3T1XA 3DTMA 4N9KA 3WWXA 1FCOA 1EROA 2GZAA 1UGUA 5EFWA 2EFXA 3IWQA 2OOLA 5E43A 2JBFA 3QP2A 1KE0A 4JBFA 4OOMA 1LL8A 3UMDA 2OAP1 3FG8A 4GW9A 1PW8A 2Y91A 2Y2PA 4EWFA 3BFFA 5F6AA 1YQSA 3VOZA 1VQQA 1CF0A 3OBFA 1KDWA 3OCLA 4I38A 4EEPA 2J9PA 2O9BA 1EI5A 3CMZA 4I3IA 1NJ4A 3VSKA 2ZM8A 3P01A 4DDSA 4CLCE 3BFCA 3F1PB 1Q2PA 5E2GA 2X01A 1SZVA 4LRXC 5FQQA 1ZC2A 1VETB 4L9FA 4OPYA 1K54C 5TBMB 4GOGA 1ERQA 5L8MA 1K6SA 4WL9A 1QMEA 2E8JA 2XQZA 1ALQA 1VHMA 3M2KA 4JXVA 2OAQ1 1P9WA 5AVEA 3Q81A 4NXBA 3MZDA 3VE4A 3VE3A 2XD1A 4BMWA 3M6BA 1F9IA 3E4PA 2EX6A 5HZHA 2O99A 3FPVA 4KZAA 2Y2IA 3NOTC 3EGXC 2V0UA 4U0TA 5HAIA 3LEQA 5GLAA 5E2FA 2Y2MA 4GKUA 3IX3A 4RX3A 3DWKA 3D9YA 2B95A 2X71A 1LT0A 4PM5A 4H6JB 1K38A 3E98A 3NULA 4QB8A 1KVLA 3LUQA 1F2KA 1E25A 3UB7A 1KE4A 5DJTA 4NG2A 2JKGA 4KZ9A 4K0WA 1A0KA 3CHWP 3IF6B 4D2OA 3LO7A 2XSSA 3T50A 4QHCA 5L09A 2BASA 2WGVA 1BSGA 4QY6A 2WKIA 4LPZA 4NXFA 1OJGA 3Q07A 4BL2A 5DJUA 4BD1A 4WF0A 5AJGA 3C4PA 4E3JA 4Y5FA 2QHKA 4FD8A 4UA9A 3F1OB 1YLZA 3IWIA 3UMEA 3ZCZA 4KQRA 3A3EA 1WA9A 3HLEA 3G34A 1T18A 1O7EA 4HQAA 2YKHA 2QMIA 5MC7A 3HLBA 5TGFA 2D01A 5FQ9A 3V39A 2ZQCA 3S7OA 3MQ0A 1L0DA 4O0PA 4OH0A 1BLHA 2P7JA 4G3KA 1BT5A 5LBRA 5HD3A 2V0WA 4LRYC 2A2LA 1DJCA 5FASA 4DE0A 3EWKA 2Y2QA 1NZUA 4DDYA 2ZLYA 2H0TA 4JKTA 3IXGA 4KZ3A 3LR4A 4H6JA 5GHYA 3D4FA 2XFTA 2RCXA 3LGOA 2XLNA 4GD6A 1GA0A 4HIAA 4BD0A 2IWBA 2J7VA 2Y2OA 2HPBA 4Y0TA 4JXSA 3GQZA 4NK3A 4MNRA 4EBPA 4JPMA 3UE6A 4S2NA 3BWLA 2V1BA 4S2IA 3PBOA 5FAPA 2HV1A 3IH9A 4FSFA 3MMHA 4B93A 5J8XA 1K54A 3UPPA 3GSGA 4M4XA 3D3OA 4UQIM 3KYQA 1XGIA 4HEFA 4OQHA 1YAXA 1T19A 4MEZA 5EV0A 1OT6A 3BQAA 1GSVA 2VLGA 4GD8A 2Y8HA 4LV3A 3U4LP 1SHVA 4B4XA 1MPLA 1IEMA 4X25A 4KZ4A 4G3WA 1XJ4A 1RGYA 2BG1A 4R3JA 4KG2A 3B3XA 2XH9A 5J7EA 2ZC5B 1JWVA 3MXSA 3MQOA 4YNRA 1BLPA 3BRMA 4DE3A 5HARA 3UE1A 4OP5A 4DJ2A 1I5QA 2W1TA 3MXQA 3E0YA 2M7UA 2NUTC 3CI6A 1T1BA 5E2HA 5CHJA 1K56D 2XK1A 3M2JA 3C8CA 4X56A 5A91A 1DP9A 2WGWB 1K0KA 3A3IA 1YLYA 1NYMA 3UPOA 2OLUA 3T4LA 1PZPA 2A49A 4X1LA 1D1JA 5F1FA 2YKFA 2JKTM 1BYWA 2NUPC 1MKIA 4LV1A 3IF6C 5HDDA 1XJ2A 4DXCA 4HHDA 2FH5A 3IWOA 3KO6A 4PM9A 3SH9A 3V50A 4KZ8A 3TW8A 4CQHA 4XT2B 2WKEA 1YM1A 3P98A 5HW3A 5HSQA 2WKPA 2W3EA 3MQQA 1IYOA 2FFYA 1J3WA 4YFMA 4H8RA 4UA7A 3HREA 3IQAA 3GECA 5CGSA 4E04A 4G3VA 2G7UA 2WAEA 3CLOA 1NXYA 2WZZA 4PMAA 5TBMA 1T1CA 5FEFA 3B42A 3VV4A 2VJWA 4JF6A 2PT7A 5C5KA 1NLYA 3CWFA 3IHAA 2CC1A 4IJGA 2J3WA 2ZMVA 3NCKA 4GHIB 4JF5A 3VMAA 1H0MA 2DNSA 5G18A 3FPWA 1XJ3A 5EVIC 3HJKA 4GS9A 4HBTA 1W5DA 3H7WB 4DMZA 4ESPA 1H8YA 4B88A 3BM6A 3HLWA 3UO9A 3L7HA 1YSQA 5EOOA 3EGDC 4MLLA 4KUOA 1ONGA 3UDXA 3ZNTA 3S7PA 3CITA 3IF5A 2W1RA 2G2WA 4KZ7A 1U60A 2Z6DA 2WGWA 3G2ZA 3IF6A 4KENB 3IS2A 5F83A 4Y2FA 2IWDA 3I7JA 4LCMA 2ZQ9A 4GJ4A 1W8YA 4NETA 4Q0JA 1UWPX 5AQ7A 4JGOA 1FSYA 3FKVA 2VGLS 1XKZA 1OT9A 1HD8A 1PWGA 1XP4A 2ZJ9A 4Y15A 1ZHHB 2VV8A 2R9XA 4QPRA 3S7QA 4EU0A 3LI9A 4GLQA 3LIBA 1LL9A 1KGEA 3OCNA 3FZCA 3BEBA 1MY8A 4C3QA 4WYYA 2PU4A 1GHMA 4Z9QA 2W3DA 1NYYA 4IVKA 3Q7VA 1W63Q 1K55C 1ZKJA 1ES4A 3A0VA 4LV2A 3T1RA 1LSVA 4BJPA 4KQDA 2J3TC 3R4KA 1MKMA 2EX2A 3PAGA 4S2MA 1MZUA 3WS2A 1XA1A 4HP9A 3VP4A 1YLJA 1BTLA 2GNXA 3NECA 3MSHA 4C75A 2EA9A 4HJ3A 5HDSA 4UEYA 2DCFA 4R4SA 5DVAA 1QMFA 3QNCA 3NI9A 2WAFA 1LL5A 2L1MA 5EM1A 4EBNA 2P74A 3HUOA 3QP4A 2G2UA 3V3RA 4QY5A 1ACFA 2OWHA 2Q0OA 2XDMA 4F94A 2WKHA 3QP8A 1YMSA 3H82A 2Z2LB 1OTAA 4HOIA 2WGIA 1ZG4A 4WELA 4NEED 2ZM0A 1DP8A 1VM1A 3W8KA 3LR5A 4OPQA 1TS7A 4WZ4A 5EE8A 4ME4A 3HLFA 4A5RA 4DKIA 1PI4A 2ZQAA 3IHBA 2WUQA 5CTNA 2VEAA 2D02A 3RTYA 4ZJ2A 4E3MA 1TS6A 3C30A 1FR1A 4OQ0A 4CJNA 1IKGA 4I3AA 5IS1A 2PAVP 5U47A 3VOLA 5I94A 2W3FA 2KOIA 5FQIA 5EVIA 2Y2LA 3A3DA 4X53A 3NOPC 4R23A 3NDEA 1YT4A 4OLDA 5TR7A 1HTZA 2QPNA 1PNEA 3EEAA 4HBUA 5J4EA 2ZC4B 2ZOHA 5BOHA 1KE3A 2K7SA 1IOUA 2J8YA 3V5MA 3WS1A 2Q9MA 3JPUA 3OPPA 2DRWA 4MN5A 3HCYA 2JCHA 2HJ9C 2P04A 2W27A 2B02A 3OC2A 1XXMA 3MKFA 1FR6A 2PYRA 3O3VA 2JKRI 4DN0A 1YLWA 3IX4A 3S7NA 2HDSA 5FDSA 2V2FF 1PWDA 3HUMA 5CEDA 5FL3A 2EXAA 3CUEC 1XFQA 5DFYA 5KIZA 3T4QA 4EUVA 2A24B 3MJQA 3KSGA 2W1TB 2V20A 1G68A 4L0LA 3DWZA 3EOIA 4ETZA 4CLCC 3G32A 3ZQ5A 4OOLA 4P6BA 2VKSA 2ZC6B 2EWVA 2JHEA 1RCJA 5CHUA 2L4RA 4EEUA 4JF4A 5CHMA 3BY8A 4K91A 2INWA 1FSWA 4Q0IA 3W2ZA 3IS2B 1E3UD 1L2SA 3UB8A 1FCMA 5HFOA 3MS6A 4I39A 5L2FA 3LICA 4LV0A 4Q8IA 1TS8A 2Y79A 5DF9A 3DW0A 4EBLA 1CK3A 3ZYTA 3R7WA 2EFUA 2XD5A 4O7DA 3LR3A 5JYOA 2EXBA 2XF3A 4X69A 5HX9A 3QP5A 5EVIB 1AXBA 1LI9A 3ZG7B 4KZ6A 4HJ4A 3EQVA 1SCWA 4KZ5A 4HJ6A 4Z1WA 4N92A 3KSHA 5L07A 1S1ZA 4FUWA 1N9OA 1TEMA 1XX2A 4KQOA 3LR0A 4PKYA 4WMCA 4K0XA 1L0EA 1V9YA 5KMWA 1D06A 1DY6A 1YKDA 4ZRRA 4EQ1A 4OP8A 4BLMA 4DF6A 1JNUA 3QP6A 3W4OA 1KOUA 4DE1A 3ITBA 3DTEA 4OPRA 5FAOA 3DAVA 3T4TA 2V1AA 3T1SA 3ZG0A 2XGNA 3LIAA 3K3DA 4BWIA 1DJBA 4MN7A 3PYPA 1OTDA 4PHTA 5L10A 1K25A 5AVFA 3AGEA 3MBZA 5A8BA 1P9RA 5F5YA 4EQIA 1H8MA 1XPBA 3E2LA 2PRFA 5FQKA 1Z6FA 4MMNA 3RXWA 3SOIA 2V8FA 1YLTA 1J9MA 3O5YA 2QZ6A 4KQQA 1NLZA 4UHUA 4ID4A 4BQMA 3Q82A 3AGFA 1N9NA 5AQBA 2M7VA 3NY4A 4OPZA 3WRZA 4PM7A 4EW7A 3GMWA 4WBGA 5F82A 1IKIA 5DKLA 4GHIA 1STZA 3LIFA 5EECA 3N7WA 2HGVA 3D72A 1W79A 5CECA 5IT5A 1RGZA 2K31A 1F5MA 4LCLA 2K2NA 2Y2NA 3W4QA 4M3KA 1CEGA 1WE4A 1GSWA 4E3OA 2QJ5A 3F1PA 2OLVA 1K57A 3VP1A 2XA7M 3HLCA 3MFDA 2AVXA 4EERA 5GHZA 1NZOA 3ICYA 4S2NC 1JWPA 1TDLA 3P7NA 2ZOIA 3ZFZA 4Y7PA 4E3NA 4NXGA 2R9WA 3FC7A 4ZAMA 4GDBA 5AQ9A 3JYIA 5DTTA 4CLCD 3M6HA 2EX8A 5HWVA 2VV6A 4R38A 4JGRA 5CRFA 3VP3A 3DTKA 3OPRA 3TSGA 3NDGA 2HDUA 3LI8A 1LLBA 3U2AA 3UN7A 3FKWA 3NHQA 4EV4A 1Q2QA 4S2JA 5M1AA 5EUAA 2ZMFA 1ERMA 3H82B 4HESA 2O0YA 2HP9A 2HP5A 2M1CA 4LGWA 4RA7A 1ONHA 5FA7A 3JVVA 3K3CA 2LB9A 4L9GA 4P0MA 3T12B 3KSIA 4N1XA 1V9ZA 4MDZA 2PBYA 2VZWA 2XEPA 2GJ3A 2W0NA 1S67L 3IBJA 4CPKA 1TS0A 2I9VA 4HNBA 2PYPA 3QHYA 3HLGA 5K5BA 3ZHHA 1TVFA 4HH2A 4QD4A 3NOUC 5HDCA 1CJFA 2WKQA 5HL1A 4FH2A 2H28A 4ETXA 4ZJ1A 3S1YA 3UNWA 5FI6A 1M40A 4HY8A 2H0YA 1OPXA 3GRJA
chains in the Genus database with same CATH topology
2ACGA 3MSHA 2B95A 3T1SA 3NECA 1FIKA 2VK3A 2PRFA 1VEUA 3T1RA 2ZL1B 2HZ5A 3UB5P 2PBDP 3KYEA 5EV0A 4QWOA 1SZVA 4D60A 1PNEA 1Y4OA 2BTFP 1CJFA 1HLUP 3L7HA 2ZL1A 3NULA 3T12B 2PAVP 3T1QB 1K0KA 3U4LP 2JKFA 5FEGA 1VETB 3CPTB 4FTXA 2V8FA 1Z09A 5EM1A 3T1XA 4FUWA 4X25A 1CF0A 1CQAA 1F2KA 1PRQA 3LGOA 4X1MA 5EVEA 3MS6A 1VETA 3CPTA 1SKOB 1PFLA 1ACFA 4X1LA 1D1JA 3LEQA 5EM0A 5FDSA 2V8CA 2JKGA 1YPRA 1AWIA 2E8JA 1FILA 1A0KA 3CHWP 5FEFA 4ESPA 3DAVA 1VEUB 1G5UA 3D9YA 1SKOA 1J3WA 3L9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACG A;  3MSH A;  2B95 A;  3T1S A;  3NEC A;  1FIK A;  2VK3 A;  2PRF A;  1VEU A;  3T1R A;  2ZL1 B;  2HZ5 A;  3UB5 P;  2PBD P;  3KYE A;  5EV0 A;  4QWO A;  1SZV A;  4D60 A;  1PNE A;  1Y4O A;  2BTF P;  1CJF A;  1HLU P;  3L7H A;  2ZL1 A;  3NUL A;  3T12 B;  2PAV P;  3T1Q B;  1K0K A;  3U4L P;  2JKF A;  5FEG A;  1VET B;  3CPT B;  4FTX A;  2V8F A;  1Z09 A;  5EM1 A;  3T1X A;  4FUW A;  4X25 A;  1CF0 A;  1CQA A;  1F2K A;  1PRQ A;  3LGO A;  4X1M A;  5EVE A;  3MS6 A;  1VET A;  3CPT A;  1SKO B;  1PFL A;  1ACF A;  4X1L A;  1D1J A;  3LEQ A;  5EM0 A;  5FDS A;  2V8C A;  2JKG A;  1YPR A;  1AWI A;  2E8J A;  1FIL A;  1A0K A;  3CHW P;  5FEF A;  4ESP A;  3DAV A;  1VEU B;  1G5U A;  3D9Y A;  1SKO A;  1J3W A;  3L9K A; 
#chains in the Genus database with same CATH topology
 3VP0 A;  4KZB A;  3C38 A;  1X0O A;  3LY3 A;  3UB6 A;  3HBR A;  1S4S A;  4RYE A;  1NWZ A;  2OSU A;  3Q1F A;  1MXO A;  2JKR M;  2KX6 A;  2ZBB A;  1W63 M;  4GB7 A;  3IX8 A;  2VA0 A;  3V67 A;  1BLC A;  2Q9N A;  5DTK A;  5HWT A;  3W4P A;  4WEJ A;  1CI9 A;  5M18 A;  4WUJ A;  1H8Z A;  1RP5 A;  3MFX A;  4WLA A;  2ZL1 B;  1PW1 A;  1L0F A;  1ZG6 A;  3TOI A;  2CMN A;  5HAP A;  1LHY A;  2QJ7 A;  5DKK A;  3A3F A;  3GTC A;  4R3A A;  2PD7 A;  2O9A A;  3CG5 A;  1ESU A;  3KYZ A;  1K56 A;  4MBH A;  2Y2H A;  1VEU A;  1K4E A;  1UWN X;  3E2K A;  2FFF B;  1BUL A;  2UV0 E;  1I2W A;  1K55 A;  1SDE A;  4GDN A;  5DF7 A;  3SH7 A;  3HLD A;  5FAT A;  2PHY A;  5F69 A;  2WAD A;  1IYS A;  1P0Z A;  4IUK A;  5AQA A;  1G5U A;  1SKO A;  2A3U A;  4ARZ B;  3PBT A;  4FCF A;  4WM9 A;  4WEK A;  3ZG9 B;  2WYX A;  4BBV A;  3T4K A;  4ZBE A;  3WS5 A;  3GVB A;  3VOY A;  2Z6C A;  1IFQ A;  5GHX A;  3VFF A;  2FZ0 A;  3IT9 A;  4QU3 A;  1YLP A;  3QNB A;  4OOY A;  3WS0 A;  3HVF A;  4N1H A;  2UWX A;  4E6W A;  3TG9 A;  2ZL1 A;  3ZG8 B;  4QJG A;  4LEN A;  1MWT A;  3N8L A;  3BYD A;  3BLS A;  3AGD A;  3PBN A;  3SW1 A;  1XA7 A;  2ZQD A;  4WZ5 A;  3L9K A;  4U3T A;  5CGX A;  4NKP A;  1HVB A;  5KSC A;  3P09 A;  4PAU A;  5HD5 A;  3MZF A;  4DJ3 A;  1EW0 A;  5FI7 A;  3C5A A;  3ISG A;  1PFL A;  4S2O A;  3CAX A;  3N8S A;  4XT2 A;  2PD8 A;  2GX5 A;  3WS4 A;  1WYC A;  1PWC A;  5HWW A;  3MF0 A;  1Y4O A;  4OVD A;  2RL3 A;  2XFS A;  5FQJ A;  2XR0 A;  3SS5 A;  5EOE A;  4BEN A;  1MWR A;  4JXG A;  3RFB A;  1OTI A;  2PR5 A;  4DXB A;  2VGL M;  5TJJ A;  1FQG A;  2PBD P;  4II7 A;  4B9O A;  5CTM A;  4UA6 A;  2QWS A;  4FH4 A;  3O87 A;  5D3O A;  4EES A;  3G6O A;  2Z2M B;  5EPH A;  2HP6 A;  1SKO B;  4O01 A;  3MKE A;  4ARZ A;  1NY0 A;  3N4I A;  1FCN A;  1SKF A;  1YSP A;  4PM8 A;  1KVM A;  2L0W A;  1BUE A;  3BEC A;  4RQ9 A;  5KSH A;  3F1N B;  1NRF A;  3O86 A;  4I5S A;  1W8Q A;  1SDN A;  1G28 A;  4Y0U A;  3N8R A;  5FDH A;  3BJN A;  4BBU A;  5TFQ A;  3B47 A;  1JWZ A;  1S0W A;  4IUH A;  2H5S A;  4UAA A;  3S22 A;  4YIN A;  5HAQ A;  4HH3 A;  4CLC B;  5JYP A;  4OKP A;  3H7W A;  3HUN A;  4OQG A;  3T4S A;  3FV7 A;  1MWU A;  4KG5 A;  3IXD A;  1YMX A;  3TE8 A;  4P87 A;  3BLM A;  1OJ5 A;  2I72 A;  2KLI A;  3C7V A;  4C6Y A;  3PHY A;  5IHV A;  4IHQ A;  1PIO A;  3ULF A;  4BL3 A;  1MC0 A;  2HZ5 A;  3LYX A;  4IVI A;  4YWZ A;  3UB5 P;  1ODV A;  4F3L B;  1MBL A;  2Y2G A;  2JN7 A;  4GCZ A;  4LRZ E;  1PYY A;  3UDI A;  1IYQ A;  2HDR A;  3V3S A;  2V8C A;  2VV7 A;  2C6W B;  3WRT A;  4EXO A;  4RX2 A;  2ZMA A;  3ZVT A;  3PBQ A;  4HI4 A;  1C3B A;  1BZA A;  3LIE A;  3SZT A;  3G4P A;  3SS3 A;  4MBF A;  4PM6 A;  3O88 A;  5A90 A;  5FEG A;  1MWS A;  5EVL A;  2JKF A;  1ES2 A;  3CUE A;  1GHP A;  1PRQ A;  4S2P A;  1VET A;  5HL6 A;  1S1Y A;  4R6L A;  3F1N A;  1DRM A;  3NC8 A;  4K08 A;  3LCE A;  4GZB A;  4XUZ A;  5CER A;  1M6K A;  4X55 A;  5DF8 A;  5A93 A;  1OTB A;  3IH8 A;  3ZDJ A;  1TDG A;  1Y54 A;  1CQA A;  3BFD A;  1E3U A;  3BW6 A;  1GCE A;  3T4O A;  4NXE A;  3BFG A;  3GV9 A;  1TF1 A;  2H10 A;  1K4F A;  4UQI S;  1FOF A;  4N9L A;  3F1O A;  3BFE A;  2P9V B;  2ZQ8 A;  3PTE A;  4JGP A;  2VGK A;  1ES3 A;  1JVJ A;  3B33 A;  1HLU P;  2LB5 A;  4ZTK A;  3SH8 A;  3T1Q B;  4F3L A;  3ZNY A;  3Q7V B;  1P97 A;  3NJA A;  1GHI A;  3PR6 A;  4P6Z M;  1N9B A;  2E8I A;  3A0S A;  5F1G A;  5CEB A;  3PBR A;  2JE5 A;  3HL9 A;  2DMW A;  3C4O A;  2JKT I;  2ZD8 A;  3H9W A;  3NBL A;  1S66 L;  2P08 A;  3TJZ C;  5EVE A;  2OV5 A;  4JGQ A;  5GL9 A;  3K2N A;  4KG6 A;  5E2E A;  1GSX A;  1AWI A;  4WMC D;  4LFU A;  1T1A A;  2R78 A;  1S4R A;  2Y59 A;  5F68 A;  4E3K A;  5FSR A;  1EWZ A;  1JTG A;  2Y2K A;  5HPI A;  2HDQ A;  5DTS A;  5EM0 A;  1D7E A;  1FIL A;  5IU1 A;  2QKP A;  1O07 A;  2B5R A;  1IEL A;  5GLB A;  4ZJ3 A;  3T4J A;  1IYP A;  2ZC3 B;  4QWO A;  2XA7 S;  4PKY G;  4HP4 A;  3DTI A;  1XJ6 A;  3G2Y A;  3RJU A;  3TRC A;  3QP1 A;  3OPL A;  4E3I A;  2EWW A;  3CJM A;  1FIK A;  1ZTU A;  2OWJ A;  3LID A;  3GDI A;  2ZQ7 A;  3OZH A;  4EET B;  3IXH A;  4P85 A;  5GLD A;  5DFX A;  1L0G A;  4LLO B;  4S2K A;  2WZX A;  4Q0H A;  1K57 C;  1KDS A;  3FWL A;  2P9V A;  1VEU B;  2J80 A;  3ZGA B;  3N6I A;  3VFH A;  3ZVW A;  3IXB A;  4R3B A;  2ZC7 A;  4PPR A;  4IED A;  3UPN A;  4MN6 A;  1CEF A;  5I5L A;  1JTD A;  1XFN A;  3KSF A;  1H5X A;  3OLO A;  2W3G A;  3HJI A;  3ZG5 A;  5FQM A;  4R4R A;  5A92 A;  4DE2 A;  1S6R A;  2A24 A;  2VGJ A;  2Y2J A;  3JVU A;  5HPF A;  1PZO A;  3EQU A;  4WZ5 C;  4DRT A;  2WK0 A;  3RH8 B;  3R7W B;  3G35 A;  3CPT B;  1LI0 A;  4Y17 A;  3MZE A;  5FI2 A;  3E4Q A;  4E6X A;  4GNU A;  2VX8 A;  5GLC A;  1E4D A;  4X68 A;  3IBR A;  4E3L A;  3NIA A;  3MR0 A;  2QYB A;  1ES5 A;  4IBR A;  4XUX A;  3DBA A;  4OLG A;  2XRO A;  1LSW A;  4XXR A;  1VB6 A;  2X02 A;  1XGJ A;  1ESI A;  3SS4 A;  3RXX A;  3VP2 A;  1NRJ A;  4FTX A;  4I3J A;  5CXW A;  1DJA A;  4CLC A;  2PDR A;  4OQI A;  2V9A A;  4KUK A;  3A3J A;  2VK3 A;  4O8G A;  3MXR A;  3UDF A;  2PU2 A;  4AFI A;  4EUZ A;  4GN2 A;  3GR2 A;  3CZD A;  4FOF A;  4X1M A;  1I2S A;  2HJE A;  2XRN A;  2GDN A;  3LY4 A;  4RVA A;  4R70 A;  4Y3I A;  2EX9 A;  1PI5 A;  4GS9 B;  3KX0 X;  1F98 A;  3C2W A;  3UE0 A;  3LEZ A;  3G31 A;  1Z09 A;  4S2L A;  1K6R A;  1DP6 A;  5J3W A;  2B18 A;  2J9O A;  2BLS A;  3CPT A;  3OOV A;  4X6T A;  1L3L A;  4Y13 A;  2ZM2 A;  5CX7 A;  1HZO A;  2PR6 A;  1G6O A;  1BLS A;  3FYZ A;  2JC7 A;  1CI8 A;  2ACG A;  1N4O A;  3PBS A;  3UB9 A;  3ITA A;  2IA2 A;  4B4Z A;  4YOF A;  2O9C A;  5KZH A;  3EEH A;  4D60 A;  2BTF P;  3PAE A;  1GA9 A;  2C5W B;  4Y0O A;  5CGW A;  1H3Q A;  2Y4A A;  1W7F A;  3UY6 A;  3LFV A;  5FAQ A;  1KGG A;  1OME A;  4MCW A;  2Y55 A;  3E4O A;  4JXW A;  5G4Y A;  3A0R A;  1OTE A;  1WYB A;  5G4Z A;  4MBK A;  3BQ8 A;  3UE3 A;  3KYE A;  4BBT A;  4L9E A;  2IWC A;  1LSX A;  3VSL A;  1Y28 A;  4ZDX A;  3OPH A;  2HF6 A;  2MJ6 A;  4WN5 A;  4R1G A;  1KGF A;  4JLF A;  3G30 A;  5EVI D;  1N9L A;  1TD5 A;  1YPR A;  3PXP A;  3BY9 A;  4P6Z S;  3S4X A;  2J3T D;  1G6A A;  2V1Z A;  2WKR A;  4U0X A;  4IBX A;  4OON A;  3C7U A;  4R0Q A;  3Q7Z A;  5M19 A;  2KDK A;  2W3H A;  3T1X A;  3DTM A;  4N9K A;  3WWX A;  1FCO A;  1ERO A;  2GZA A;  1UGU A;  5EFW A;  2EFX A;  3IWQ A;  2OOL A;  5E43 A;  2JBF A;  3QP2 A;  1KE0 A;  4JBF A;  4OOM A;  1LL8 A;  3UMD A;  2OAP 1;  3FG8 A;  4GW9 A;  1PW8 A;  2Y91 A;  2Y2P A;  4EWF A;  3BFF A;  5F6A A;  1YQS A;  3VOZ A;  1VQQ A;  1CF0 A;  3OBF A;  1KDW A;  3OCL A;  4I38 A;  4EEP A;  2J9P A;  2O9B A;  1EI5 A;  3CMZ A;  4I3I A;  1NJ4 A;  3VSK A;  2ZM8 A;  3P01 A;  4DDS A;  4CLC E;  3BFC A;  3F1P B;  1Q2P A;  5E2G A;  2X01 A;  1SZV A;  4LRX C;  5FQQ A;  1ZC2 A;  1VET B;  4L9F A;  4OPY A;  1K54 C;  5TBM B;  4GOG A;  1ERQ A;  5L8M A;  1K6S A;  4WL9 A;  1QME A;  2E8J A;  2XQZ A;  1ALQ A;  1VHM A;  3M2K A;  4JXV A;  2OAQ 1;  1P9W A;  5AVE A;  3Q81 A;  4NXB A;  3MZD A;  3VE4 A;  3VE3 A;  2XD1 A;  4BMW A;  3M6B A;  1F9I A;  3E4P A;  2EX6 A;  5HZH A;  2O99 A;  3FPV A;  4KZA A;  2Y2I A;  3NOT C;  3EGX C;  2V0U A;  4U0T A;  5HAI A;  3LEQ A;  5GLA A;  5E2F A;  2Y2M A;  4GKU A;  3IX3 A;  4RX3 A;  3DWK A;  3D9Y A;  2B95 A;  2X71 A;  1LT0 A;  4PM5 A;  4H6J B;  1K38 A;  3E98 A;  3NUL A;  4QB8 A;  1KVL A;  3LUQ A;  1F2K A;  1E25 A;  3UB7 A;  1KE4 A;  5DJT A;  4NG2 A;  2JKG A;  4KZ9 A;  4K0W A;  1A0K A;  3CHW P;  3IF6 B;  4D2O A;  3LO7 A;  2XSS A;  3T50 A;  4QHC A;  5L09 A;  2BAS A;  2WGV A;  1BSG A;  4QY6 A;  2WKI A;  4LPZ A;  4NXF A;  1OJG A;  3Q07 A;  4BL2 A;  5DJU A;  4BD1 A;  4WF0 A;  5AJG A;  3C4P A;  4E3J A;  4Y5F A;  2QHK A;  4FD8 A;  4UA9 A;  3F1O B;  1YLZ A;  3IWI A;  3UME A;  3ZCZ A;  4KQR A;  3A3E A;  1WA9 A;  3HLE A;  3G34 A;  1T18 A;  1O7E A;  4HQA A;  2YKH A;  2QMI A;  5MC7 A;  3HLB A;  5TGF A;  2D01 A;  5FQ9 A;  3V39 A;  2ZQC A;  3S7O A;  3MQ0 A;  1L0D A;  4O0P A;  4OH0 A;  1BLH A;  2P7J A;  4G3K A;  1BT5 A;  5LBR A;  5HD3 A;  2V0W A;  4LRY C;  2A2L A;  1DJC A;  5FAS A;  4DE0 A;  3EWK A;  2Y2Q A;  1NZU A;  4DDY A;  2ZLY A;  2H0T A;  4JKT A;  3IXG A;  4KZ3 A;  3LR4 A;  4H6J A;  5GHY A;  3D4F A;  2XFT A;  2RCX A;  3LGO A;  2XLN A;  4GD6 A;  1GA0 A;  4HIA A;  4BD0 A;  2IWB A;  2J7V A;  2Y2O A;  2HPB A;  4Y0T A;  4JXS A;  3GQZ A;  4NK3 A;  4MNR A;  4EBP A;  4JPM A;  3UE6 A;  4S2N A;  3BWL A;  2V1B A;  4S2I A;  3PBO A;  5FAP A;  2HV1 A;  3IH9 A;  4FSF A;  3MMH A;  4B93 A;  5J8X A;  1K54 A;  3UPP A;  3GSG A;  4M4X A;  3D3O A;  4UQI M;  3KYQ A;  1XGI A;  4HEF A;  4OQH A;  1YAX A;  1T19 A;  4MEZ A;  5EV0 A;  1OT6 A;  3BQA A;  1GSV A;  2VLG A;  4GD8 A;  2Y8H A;  4LV3 A;  3U4L P;  1SHV A;  4B4X A;  1MPL A;  1IEM A;  4X25 A;  4KZ4 A;  4G3W A;  1XJ4 A;  1RGY A;  2BG1 A;  4R3J A;  4KG2 A;  3B3X A;  2XH9 A;  5J7E A;  2ZC5 B;  1JWV A;  3MXS A;  3MQO A;  4YNR A;  1BLP A;  3BRM A;  4DE3 A;  5HAR A;  3UE1 A;  4OP5 A;  4DJ2 A;  1I5Q A;  2W1T A;  3MXQ A;  3E0Y A;  2M7U A;  2NUT C;  3CI6 A;  1T1B A;  5E2H A;  5CHJ A;  1K56 D;  2XK1 A;  3M2J A;  3C8C A;  4X56 A;  5A91 A;  1DP9 A;  2WGW B;  1K0K A;  3A3I A;  1YLY A;  1NYM A;  3UPO A;  2OLU A;  3T4L A;  1PZP A;  2A49 A;  4X1L A;  1D1J A;  5F1F A;  2YKF A;  2JKT M;  1BYW A;  2NUP C;  1MKI A;  4LV1 A;  3IF6 C;  5HDD A;  1XJ2 A;  4DXC A;  4HHD A;  2FH5 A;  3IWO A;  3KO6 A;  4PM9 A;  3SH9 A;  3V50 A;  4KZ8 A;  3TW8 A;  4CQH A;  4XT2 B;  2WKE A;  1YM1 A;  3P98 A;  5HW3 A;  5HSQ A;  2WKP A;  2W3E A;  3MQQ A;  1IYO A;  2FFY A;  1J3W A;  4YFM A;  4H8R A;  4UA7 A;  3HRE A;  3IQA A;  3GEC A;  5CGS A;  4E04 A;  4G3V A;  2G7U A;  2WAE A;  3CLO A;  1NXY A;  2WZZ A;  4PMA A;  5TBM A;  1T1C A;  5FEF A;  3B42 A;  3VV4 A;  2VJW A;  4JF6 A;  2PT7 A;  5C5K A;  1NLY A;  3CWF A;  3IHA A;  2CC1 A;  4IJG A;  2J3W A;  2ZMV A;  3NCK A;  4GHI B;  4JF5 A;  3VMA A;  1H0M A;  2DNS A;  5G18 A;  3FPW A;  1XJ3 A;  5EVI C;  3HJK A;  4GS9 A;  4HBT A;  1W5D A;  3H7W B;  4DMZ A;  4ESP A;  1H8Y A;  4B88 A;  3BM6 A;  3HLW A;  3UO9 A;  3L7H A;  1YSQ A;  5EOO A;  3EGD C;  4MLL A;  4KUO A;  1ONG A;  3UDX A;  3ZNT A;  3S7P A;  3CIT A;  3IF5 A;  2W1R A;  2G2W A;  4KZ7 A;  1U60 A;  2Z6D A;  2WGW A;  3G2Z A;  3IF6 A;  4KEN B;  3IS2 A;  5F83 A;  4Y2F A;  2IWD A;  3I7J A;  4LCM A;  2ZQ9 A;  4GJ4 A;  1W8Y A;  4NET A;  4Q0J A;  1UWP X;  5AQ7 A;  4JGO A;  1FSY A;  3FKV A;  2VGL S;  1XKZ A;  1OT9 A;  1HD8 A;  1PWG A;  1XP4 A;  2ZJ9 A;  4Y15 A;  1ZHH B;  2VV8 A;  2R9X A;  4QPR A;  3S7Q A;  4EU0 A;  3LI9 A;  4GLQ A;  3LIB A;  1LL9 A;  1KGE A;  3OCN A;  3FZC A;  3BEB A;  1MY8 A;  4C3Q A;  4WYY A;  2PU4 A;  1GHM A;  4Z9Q A;  2W3D A;  1NYY A;  4IVK A;  3Q7V A;  1W63 Q;  1K55 C;  1ZKJ A;  1ES4 A;  3A0V A;  4LV2 A;  3T1R A;  1LSV A;  4BJP A;  4KQD A;  2J3T C;  3R4K A;  1MKM A;  2EX2 A;  3PAG A;  4S2M A;  1MZU A;  3WS2 A;  1XA1 A;  4HP9 A;  3VP4 A;  1YLJ A;  1BTL A;  2GNX A;  3NEC A;  3MSH A;  4C75 A;  2EA9 A;  4HJ3 A;  5HDS A;  4UEY A;  2DCF A;  4R4S A;  5DVA A;  1QMF A;  3QNC A;  3NI9 A;  2WAF A;  1LL5 A;  2L1M A;  5EM1 A;  4EBN A;  2P74 A;  3HUO A;  3QP4 A;  2G2U A;  3V3R A;  4QY5 A;  1ACF A;  2OWH A;  2Q0O A;  2XDM A;  4F94 A;  2WKH A;  3QP8 A;  1YMS A;  3H82 A;  2Z2L B;  1OTA A;  4HOI A;  2WGI A;  1ZG4 A;  4WEL A;  4NEE D;  2ZM0 A;  1DP8 A;  1VM1 A;  3W8K A;  3LR5 A;  4OPQ A;  1TS7 A;  4WZ4 A;  5EE8 A;  4ME4 A;  3HLF A;  4A5R A;  4DKI A;  1PI4 A;  2ZQA A;  3IHB A;  2WUQ A;  5CTN A;  2VEA A;  2D02 A;  3RTY A;  4ZJ2 A;  4E3M A;  1TS6 A;  3C30 A;  1FR1 A;  4OQ0 A;  4CJN A;  1IKG A;  4I3A A;  5IS1 A;  2PAV P;  5U47 A;  3VOL A;  5I94 A;  2W3F A;  2KOI A;  5FQI A;  5EVI A;  2Y2L A;  3A3D A;  4X53 A;  3NOP C;  4R23 A;  3NDE A;  1YT4 A;  4OLD A;  5TR7 A;  1HTZ A;  2QPN A;  1PNE A;  3EEA A;  4HBU A;  5J4E A;  2ZC4 B;  2ZOH A;  5BOH A;  1KE3 A;  2K7S A;  1IOU A;  2J8Y A;  3V5M A;  3WS1 A;  2Q9M A;  3JPU A;  3OPP A;  2DRW A;  4MN5 A;  3HCY A;  2JCH A;  2HJ9 C;  2P04 A;  2W27 A;  2B02 A;  3OC2 A;  1XXM A;  3MKF A;  1FR6 A;  2PYR A;  3O3V A;  2JKR I;  4DN0 A;  1YLW A;  3IX4 A;  3S7N A;  2HDS A;  5FDS A;  2V2F F;  1PWD A;  3HUM A;  5CED A;  5FL3 A;  2EXA A;  3CUE C;  1XFQ A;  5DFY A;  5KIZ A;  3T4Q A;  4EUV A;  2A24 B;  3MJQ A;  3KSG A;  2W1T B;  2V20 A;  1G68 A;  4L0L A;  3DWZ A;  3EOI A;  4ETZ A;  4CLC C;  3G32 A;  3ZQ5 A;  4OOL A;  4P6B A;  2VKS A;  2ZC6 B;  2EWV A;  2JHE A;  1RCJ A;  5CHU A;  2L4R A;  4EEU A;  4JF4 A;  5CHM A;  3BY8 A;  4K91 A;  2INW A;  1FSW A;  4Q0I A;  3W2Z A;  3IS2 B;  1E3U D;  1L2S A;  3UB8 A;  1FCM A;  5HFO A;  3MS6 A;  4I39 A;  5L2F A;  3LIC A;  4LV0 A;  4Q8I A;  1TS8 A;  2Y79 A;  5DF9 A;  3DW0 A;  4EBL A;  1CK3 A;  3ZYT A;  3R7W A;  2EFU A;  2XD5 A;  4O7D A;  3LR3 A;  5JYO A;  2EXB A;  2XF3 A;  4X69 A;  5HX9 A;  3QP5 A;  5EVI B;  1AXB A;  1LI9 A;  3ZG7 B;  4KZ6 A;  4HJ4 A;  3EQV A;  1SCW A;  4KZ5 A;  4HJ6 A;  4Z1W A;  4N92 A;  3KSH A;  5L07 A;  1S1Z A;  4FUW A;  1N9O A;  1TEM A;  1XX2 A;  4KQO A;  3LR0 A;  4PKY A;  4WMC A;  4K0X A;  1L0E A;  1V9Y A;  5KMW A;  1D06 A;  1DY6 A;  1YKD A;  4ZRR A;  4EQ1 A;  4OP8 A;  4BLM A;  4DF6 A;  1JNU A;  3QP6 A;  3W4O A;  1KOU A;  4DE1 A;  3ITB A;  3DTE A;  4OPR A;  5FAO A;  3DAV A;  3T4T A;  2V1A A;  3T1S A;  3ZG0 A;  2XGN A;  3LIA A;  3K3D A;  4BWI A;  1DJB A;  4MN7 A;  3PYP A;  1OTD A;  4PHT A;  5L10 A;  1K25 A;  5AVF A;  3AGE A;  3MBZ A;  5A8B A;  1P9R A;  5F5Y A;  4EQI A;  1H8M A;  1XPB A;  3E2L A;  2PRF A;  5FQK A;  1Z6F A;  4MMN A;  3RXW A;  3SOI A;  2V8F A;  1YLT A;  1J9M A;  3O5Y A;  2QZ6 A;  4KQQ A;  1NLZ A;  4UHU A;  4ID4 A;  4BQM A;  3Q82 A;  3AGF A;  1N9N A;  5AQB A;  2M7V A;  3NY4 A;  4OPZ A;  3WRZ A;  4PM7 A;  4EW7 A;  3GMW A;  4WBG A;  5F82 A;  1IKI A;  5DKL A;  4GHI A;  1STZ A;  3LIF A;  5EEC A;  3N7W A;  2HGV A;  3D72 A;  1W79 A;  5CEC A;  5IT5 A;  1RGZ A;  2K31 A;  1F5M A;  4LCL A;  2K2N A;  2Y2N A;  3W4Q A;  4M3K A;  1CEG A;  1WE4 A;  1GSW A;  4E3O A;  2QJ5 A;  3F1P A;  2OLV A;  1K57 A;  3VP1 A;  2XA7 M;  3HLC A;  3MFD A;  2AVX A;  4EER A;  5GHZ A;  1NZO A;  3ICY A;  4S2N C;  1JWP A;  1TDL A;  3P7N A;  2ZOI A;  3ZFZ A;  4Y7P A;  4E3N A;  4NXG A;  2R9W A;  3FC7 A;  4ZAM A;  4GDB A;  5AQ9 A;  3JYI A;  5DTT A;  4CLC D;  3M6H A;  2EX8 A;  5HWV A;  2VV6 A;  4R38 A;  4JGR A;  5CRF A;  3VP3 A;  3DTK A;  3OPR A;  3TSG A;  3NDG A;  2HDU A;  3LI8 A;  1LLB A;  3U2A A;  3UN7 A;  3FKW A;  3NHQ A;  4EV4 A;  1Q2Q A;  4S2J A;  5M1A A;  5EUA A;  2ZMF A;  1ERM A;  3H82 B;  4HES A;  2O0Y A;  2HP9 A;  2HP5 A;  2M1C A;  4LGW A;  4RA7 A;  1ONH A;  5FA7 A;  3JVV A;  3K3C A;  2LB9 A;  4L9G A;  4P0M A;  3T12 B;  3KSI A;  4N1X A;  1V9Z A;  4MDZ A;  2PBY A;  2VZW A;  2XEP A;  2GJ3 A;  2W0N A;  1S67 L;  3IBJ A;  4CPK A;  1TS0 A;  2I9V A;  4HNB A;  2PYP A;  3QHY A;  3HLG A;  5K5B A;  3ZHH A;  1TVF A;  4HH2 A;  4QD4 A;  3NOU C;  5HDC A;  1CJF A;  2WKQ A;  5HL1 A;  4FH2 A;  2H28 A;  4ETX A;  4ZJ1 A;  3S1Y A;  3UNW A;  5FI6 A;  1M40 A;  4HY8 A;  2H0Y A;  1OPX A;  3GRJ A; 
#chains in the Genus database with same CATH homology
 2ACG A;  3MSH A;  2B95 A;  3T1S A;  3NEC A;  1FIK A;  2VK3 A;  2PRF A;  1VEU A;  3T1R A;  2ZL1 B;  2HZ5 A;  3UB5 P;  2PBD P;  3KYE A;  5EV0 A;  4QWO A;  1SZV A;  4D60 A;  1PNE A;  1Y4O A;  2BTF P;  1CJF A;  1HLU P;  3L7H A;  2ZL1 A;  3NUL A;  3T12 B;  2PAV P;  3T1Q B;  1K0K A;  3U4L P;  2JKF A;  5FEG A;  1VET B;  3CPT B;  4FTX A;  2V8F A;  1Z09 A;  5EM1 A;  3T1X A;  4FUW A;  4X25 A;  1CF0 A;  1CQA A;  1F2K A;  1PRQ A;  3LGO A;  4X1M A;  5EVE A;  3MS6 A;  1VET A;  3CPT A;  1SKO B;  1PFL A;  1ACF A;  4X1L A;  1D1J A;  3LEQ A;  5EM0 A;  5FDS A;  2V8C A;  2JKG A;  1YPR A;  1AWI A;  2E8J A;  1FIL A;  1A0K A;  3CHW P;  5FEF A;  4ESP A;  3DAV A;  1VEU B;  1G5U A;  3D9Y A;  1SKO A;  1J3W A;  3L9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...