5EVEA

Crystal structure of amb a 8 in complex with poly-pro10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
SWQTYVDEHLMCDIEGTGQHLASAAIFGTDGNVWAKSSSFPEFKPDEINAIIKEFSEPGALAPTGLFLAGAKYMVIQGEPGAVIRGKKGAGGICIKKTGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Ambrosia artemisiifolia
molecule tags Allergen
total genus 31
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5eveA00
3L9KA 2PBDP 2ZL1A 1FIKA 2PAVP 3KYEA 3NULA 1VETB 4D60A 3T1RA 3MSHA 3T1QB 2VK3A 5EM0A 5EM1A 3MS6A 1SKOB 1PFLA 3CPTA 3LEQA 4FTXA 1FILA 5FEFA 3T1SA 3LGOA 1D1JA 1PRQA 3D9YA 3U4LP 2BTFP 2ZL1B 1VEUA 1J3WA 3NECA 1CQAA 3DAVA 5EV0A 4X1LA 1VETA 3L7HA 1G5UA 2ACGA 3T1XA 1HLUP 3CHWP 3UB5P 1Y4OA 1ACFA 2E8JA 1Z09A 3T12B 1AWIA 5EVEA 1F2KA 2HZ5A 1VEUB 2PRFA 1SZVA 2JKGA 2V8FA 4X1MA 5FDSA 1YPRA 2V8CA 5FEGA 2B95A 2JKFA 1A0KA 1SKOA 3CPTB 4X25A 1CF0A 4QWOA 1PNEA 4ESPA 4FUWA 1CJFA 1K0KA
chains in the Genus database with same CATH superfamily
2Y2LA 1MY8A 3T4OA 3O88A 4KG5A 1KVLA 2ZL1A 1XJ3A 1U60A 2ZC3B 3IWOA 4DKIA 4CLCC 2K31A 5FQIA 1K55C 3ZFZA 5CECA 3NC8A 2ZM8A 4GOGA 1TDLA 4HP4A 1SDNA 4GHIA 1YKDA 3T1QB 2O99A 3CI6A 2WKRA 1NYMA 5A91A 1FR1A 4R3AA 5HWVA 1FILA 1MWUA 3JYIA 5L07A 4LRXC 2Y2HA 1XJ6A 3Q7ZA 3QHYA 4KQDA 1UGUA 2PYRA 4X1LA 2NUTC 4OOLA 4BL2A 3A3DA 3LIBA 2DMWA 4QY5A 3FPWA 4QPRA 2HP9A 3VMAA 5CHUA 4RX2A 1LL9A 1Z09A 4UA6A 3VP2A 3R4KA 5FQKA 2WYXA 2GNXA 1S66L 3D3OA 3G2YA 4I39A 5HL6A 3LI8A 3BFEA 1FCOA 1M6KA 3WS1A 4GD6A 2W3FA 5GL9A 4X1MA 5KSCA 3BYDA 4GD8A 5C5KA 1W79A 3UN7A 1K38A 3B42A 1JWZA 3GECA 3BQAA 1MBLA 1OPXA 3A0VA 1LHYA 2EX6A 4WBGA 1XPBA 1PNEA 3BFDA 1FCNA 4MLLA 1CK3A 3NCKA 2PDRA 2D01A 2QJ7A 1GCEA 3P98A 1XGJA 5DTSA 1CI8A 3MXRA 3U2AA 3S7QA 4I38A 3UB9A 5HWTA 2EX2A 4NEED 1KGFA 4MCWA 1CI9A 5LBRA 1PW8A 3C30A 1XX2A 3UPOA 2WADA 1PI5A 5EUAA 3GVBA 5K5BA 2Y2IA 1L3LA 4Q0JA 3UPNA 1ES2A 4Y0UA 5F83A 3R7WA 3TE8A 2QZ6A 3IS2B 1Y4OA 3H82A 2XFSA 2HGVA 5FI6A 3T12B 5EPHA 3KSIA 3ICYA 2Y2JA 2ZC4B 1MWSA 3MQ0A 5U47A 5DKKA 1T18A 3HUOA 3PHYA 3SH8A 3KX0X 4BLMA 1FSWA 4HI4A 4E3MA 4UA9A 5EECA 3VP3A 2R9XA 3GV9A 5E2GA 1TDGA 3N7WA 3LIDA 1G6AA 5HWWA 1PIOA 4EXOA 3UE1A 2WKEA 3VFHA 5FATA 1JVJA 5EVLA 5HAPA 3WS2A 2PBDP 3IXHA 3E4QA 4IVKA 2XROA 4PM6A 2VGKA 3FWLA 3QP5A 1ZC2A 5DF9A 4GS9B 4L0LA 2Y59A 3VOLA 1KGGA 4LCMA 5DVAA 3C8CA 4R3JA 4NXFA 4HHDA 3IX3A 4FTXA 1NLYA 4JF6A 5KSHA 1D1JA 3GDIA 5DTKA 4D2OA 5IHVA 2V1BA 3BECA 4BMWA 2QPNA 2WUQA 1CQAA 1UWNX 4X69A 1NLZA 1NRFA 2OAP1 3H9WA 1L0GA 2ACGA 3IF6C 1HLUP 5CXWA 5L8MA 4HP9A 4QB8A 3UNWA 4P6ZM 4HJ6A 5HDDA 3P7NA 1YLTA 1T1BA 3T4SA 3MZEA 1XJ2A 1IYSA 1LI0A 1Q2PA 2KLIA 3UE3A 3PBNA 1VEUB 5FQQA 3DTMA 4OPRA 5FAPA 3B3XA 2V8FA 1PWDA 1SCWA 4JGQA 3B47A 4H6JA 1KOUA 3WS5A 3RXWA 4CLCE 2JKFA 4KQQA 2OLUA 5FAQA 4X25A 5EVID 2WKHA 3NI9A 1W8YA 1DP8A 2P04A 1ONHA 2Y2NA 4PM5A 2HDUA 2HDRA 4II7A 4PM7A 2O9CA 5HX9A 4Y13A 4LRYC 3UB8A 2Y91A 3CG5A 3MSHA 2O9BA 3G31A 1LLBA 2JC7A 1ERQA 1NXYA 3HLEA 4GZBA 5EVIA 4O7DA 3V3SA 3UDFA 1DJCA 3PYPA 1TEMA 1VHMA 3E2KA 5DTTA 4WLAA 4L9FA 1DP6A 1PRQA 1P0ZA 5G4ZA 3SOIA 1ERMA 3D9YA 3U4LP 2Y2MA 5JYOA 3NECA 4G3VA 1XJ4A 4JF4A 1SKFA 4XT2A 5HD5A 1RCJA 3ZYTA 4EEPA 3H7WA 4S2MA 4O8GA 3IH8A 3VP1A 4WL9A 1E4DA 3BY9A 4UHUA 4S2OA 1N9BA 4LRZE 4N9LA 1NJ4A 4FH2A 3O5YA 2XEPA 1VB6A 4WMCD 3ZNTA 2Z2MB 1VQQA 1JTGA 4I5SA 3NJAA 3IF5A 1T19A 2JN7A 2IWBA 3ZG5A 4ZAMA 2V1AA 3DTKA 4E6XA 1TVFA 2V0UA 1A0KA 5A90A 1ZG6A 4OKPA 3IWIA 4PPRA 2W27A 2VV6A 1LSVA 4BD0A 1V9ZA 2ZMVA 3PBTA 1FIKA 1KDWA 4WMCA 4DF6A 1E3UD 3HVFA 3VFFA 3HCYA 4WELA 3BLMA 3ITBA 1K25A 1ZKJA 3B33A 1F98A 2YKFA 2ZC7A 2VK3A 1L0EA 2Y2KA 4MEZA 4Y3IA 3AGEA 4OONA 2WKQA 3KSGA 3HUMA 4RYEA 3DW0A 1D06A 3CUEA 3BY8A 1PWGA 1OTEA 2GZAA 1OTIA 4GDBA 4OQGA 2P9VB 2PR5A 3MZDA 4JXGA 4Q0HA 4OQHA 3VE4A 3A3IA 1LL5A 1ES4A 2Y79A 3LR3A 2W1RA 3E0YA 4OLDA 1XFQA 2EX8A 1IEMA 4NXBA 4BWIA 3MQOA 1K57A 3EEAA 3P09A 4EUVA 1BLHA 1F2KA 4LCLA 4M3KA 3LIFA 4BBVA 2XRNA 4S2LA 5AJGA 1MXOA 5FASA 4DE2A 3HL9A 2WKPA 1IELA 3IH9A 3EOIA 2XD5A 4Q8IA 4B93A 1JWVA 3E2LA 1PYYA 3DTEA 2PBYA 3VV4A 3M2JA 1XP4A 1L0FA 1YLJA 3L9KA 3C7UA 4PKYA 3GMWA 4O01A 4GNUA 4JXVA 4DE0A 5AQAA 2B02A 3T4QA 2M7UA 1MC0A 2GDNA 2ZBBA 3T4LA 2I9VA 4CPKA 3EEHA 4JGOA 3IXBA 1S67L 5IS1A 4M4XA 2ZC6B 5HL1A 2XSSA 4X68A 3EQUA 4S2KA 2Y2PA 4KG2A 3MFXA 4ME4A 3UMEA 1G6OA 3SS3A 3NBLA 4NG2A 1N9OA 5GHXA 2ZJ9A 4N92A 3NOUC 1FOFA 1LSWA 2JKTM 2WZZA 1G5UA 2PT7A 5L10A 4OPYA 3A3JA 4JXSA 4X53A 3AGFA 1TS7A 2PD7A 4R0QA 2HDQA 1OMEA 1SDEA 3HLCA 3ISGA 2FFFB 3OPPA 3UPPA 2Y2OA 4BQMA 3ZHHA 3ITAA 3VP0A 2PRFA 3S7PA 3SZTA 1ES5A 3ZGAB 5IT5A 2P74A 5FL3A 3OPHA 2WZXA 3FKVA 4K08A 5IU1A 4LPZA 2EWVA 3IX4A 4DMZA 1K54C 4UQIS 2IWDA 3FYZA 1YMXA 5J4EA 1YM1A 4EW7A 3UB6A 4R3BA 3NDGA 1Y54A 3KYEA 3BJNA 3LR0A 4JGPA 1OJ5A 1OTAA 5G4YA 3IXGA 5FQ9A 4X6TA 4E04A 1PZPA 1G28A 2ZQ9A 2HDSA 3D4FA 1YLWA 3MS6A 1YQSA 1O7EA 2A24B 5FA7A 3FV7A 3T4KA 4LV0A 1GHMA 1H3QA 3CAXA 2L4RA 3DWKA 2W1TB 5DKLA 1J3WA 2J3TC 1HVBA 4PMAA 1EI5A 5TR7A 1RGZA 2JKRM 3DWZA 3T4JA 2KX6A 4KUKA 4HQAA 4E6WA 5EVIC 4QHCA 2Z6DA 1P9RA 2NUPC 2Z6CA 5KMWA 2G2UA 1QMEA 4EQIA 4MNRA 5AQBA 3KSHA 3RXXA 4HIAA 3TOIA 3N4IA 3UE6A 5TJJA 5GLCA 3PR6A 3CITA 2Q9MA 4GKUA 2PYPA 2HP5A 4ESPA 2VA0A 4P6BA 1DJBA 4R70A 5HAIA 2VGLM 3PAEA 4R4RA 2G7UA 4S2PA 2HV1A 1Z6FA 2O9AA 2VGJA 3MXSA 2R9WA 5F1GA 2QHKA 5CGSA 1F5MA 1KE3A 4CLCD 5G18A 1TS8A 3F1PB 4DDSA 4KZ8A 2XFTA 4WZ5A 4LENA 2P08A 1SKOB 5MC7A 3Q82A 5I5LA 4L9EA 2A3UA 5GLDA 5E43A 2W0NA 3ZG8B 3LFVA 1IYOA 4ZJ3A 3BFCA 3N8SA 1YLPA 1K4EA 1KVMA 3M6BA 5AVEA 1K6RA 4KZ3A 3ZG7B 1DP9A 2G2WA 4CLCA 4DRTA 1NY0A 3IX8A 1K55A 3A0RA 3IF6B 3ZVTA 3EGXC 3VOZA 5TFQA 2RL3A 1O07A 2X02A 2XA7S 4ARZB 1K6SA 2E8JA 1GA9A 3O3VA 4IBRA 4UAAA 2H28A 4X56A 3GSGA 5HZHA 1TF1A 2QJ5A 2HZ5A 3M6HA 1NZOA 1WYBA 4HH2A 4PHTA 4KZ7A 3RTYA 3W4OA 1VM1A 4HJ3A 4WUJA 5CEBA 2DNSA 3C38A 1S1YA 4WF0A 1YLZA 2C6WB 1CJFA 4GDNA 2VLGA 2RCXA 4QU3A 2WGIA 4PM8A 2R78A 4LV3A 4D60A 2Y2GA 3CZDA 4ZJ1A 5L09A 2XDMA 4KZ5A 1IYPA 4XUXA 2GJ3A 3ULFA 2VZWA 1MZUA 3PAGA 5CERA 1XA1A 4QY6A 5TBMB 5F6AA 3FKWA 4PM9A 4YWZA 2W3GA 2PU4A 3IQAA 1EWZA 4S2NC 3W4PA 1ESIA 2ZL1B 5CGWA 2V1ZA 2B18A 3C7VA 5CGXA 1NZUA 4HBTA 2Y55A 4GHIB 3PBOA 5DF8A 1FCMA 3CHWP 3ZG0A 2FH5A 5M19A 4ZDXA 3BEBA 4FD8A 4EUZA 4DDYA 5A93A 4UEYA 3OLOA 4N9KA 3NOTC 5FQJA 2C5WB 1ESUA 1T1CA 2V2FF 4WN5A 3JPUA 3MF0A 4N1HA 2V9AA 2W1TA 3G32A 2H5SA 1H8MA 2FFYA 4DJ2A 4KQRA 1XFNA 4I3AA 4I3IA 3S22A 4U0TA 4PAUA 3EWKA 5I94A 3ZQ5A 4E3LA 1V9YA 5FAOA 1W63Q 4FUWA 1OTDA 1I2WA 4YFMA 2M7VA 3QP8A 2W3HA 5A8BA 4HEFA 1IOUA 2AVXA 5CTMA 3N8RA 3S4XA 1S6RA 3HLDA 4KZ4A 3BWLA 3NULA 2ZOHA 2XQZA 4P0MA 5CHMA 1ZTUA 4GN2A 3ZG9B 4DE1A 5HDSA 3NDEA 3TRCA 3W4QA 1QMFA 3IS2A 3BFFA 4AFIA 4IUHA 1IKIA 1WYCA 1MWTA 3CLOA 4YNRA 1FSYA 5HFOA 3OPRA 2HJ9C 2XD1A 4WEJA 3K3DA 3V5MA 4F3LB 5FEFA 5GHYA 3NIAA 3PBQA 4O0PA 4H8RA 2Y2QA 2P7JA 5FDHA 4B4ZA 5EV0A 2QWSA 3C2WA 5FI7A 4RVAA 5F82A 3HLWA 4OH0A 1ALQA 5JYPA 4Y0OA 3MFDA 3ZNYA 2VKSA 1SHVA 4ZBEA 3CMZA 3MJQA 3S7OA 1GSWA 5HDCA 1X0OA 4KUOA 2OV5A 5D3OA 5A92A 1OT9A 4OP5A 4E3IA 4G3WA 3GR2A 2X71A 4MBFA 3SS4A 2V0WA 1H0MA 4GS9A 4XXRA 2OLVA 5DFXA 4KQOA 5TGFA 4WZ4A 3R7WB 3C4PA 3FC7A 4OQ0A 4KG6A 3IF6A 5HD3A 3PBRA 2PHYA 1L2SA 3KYZA 3G35A 3TW8A 3GRJA 2Y8HA 2E8IA 1BUEA 4B88A 2XR0A 2H0YA 1N4OA 4IEDA 3BQ8A 1S0WA 3V3RA 4KENB 3FPVA 3WRZA 1T1AA 2PAVP 3BW6A 5HPFA 1D7EA 1VETB 5EE8A 5DF7A 3Q7VB 3BLSA 3AGDA 4R4SA 5HPIA 3SH9A 1W5DA 4EQ1A 2LB5A 4IHQA 4P6ZS 3OC2A 1BSGA 1PFLA 1KDSA 2CMNA 5E2EA 1MKMA 2ZM0A 4JPMA 4OLGA 2OSUA 2JBFA 1XKZA 3JVVA 3N8LA 1L0DA 1PW1A 2OWHA 3QP2A 4MDZA 2M1CA 2BTFP 1VEUA 3IHAA 2L0WA 1UWPX 4R1GA 4ETZA 1GSXA 4JBFA 1BTLA 4NK3A 1PI4A 3HLBA 1C3BA 2DCFA 3FG8A 4R6LA 1ODVA 4WZ5C 4ZTKA 1N9NA 4S2JA 3C5AA 2ZQDA 5DFYA 3OCNA 2WGVA 3SH7A 1KE0A 5TBMA 2HP6A 5HARA 3Q81A 4OPQA 2CC1A 4BD1A 3ZVWA 4NXGA 3LR5A 3LYXA 5F68A 3HJIA 3LIAA 4NKPA 4OPZA 5FDSA 4E3KA 2K2NA 4E3NA 5FEGA 2B95A 5DJTA 4KZBA 4I3JA 2A2LA 4R23A 4JF5A 5FQMA 1ZHHB 1PZOA 2L1MA 3F1NB 4G3KA 2XF3A 2A49A 1ES3A 2VEAA 1ZG4A 3KO6A 1TD5A 1BULA 3DBAA 1YSQA 2O0YA 4P85A 3RFBA 4HOIA 1LI9A 4EEUA 1M40A 4FH4A 4GJ4A 1GHPA 2JCHA 5CTNA 4BENA 4H6JB 2XGNA 3S1YA 4K0XA 2QKPA 3QP1A 4GW9A 3LEQA 4N1XA 4R38A 3V50A 3PTEA 3T1SA 1BYWA 2JKTI 2J7VA 5EOOA 4HY8A 1IFQA 3MR0A 1F9IA 3JVUA 3DAVA 1BLPA 1FQGA 3L7HA 5AQ7A 4YOFA 5F69A 3HLFA 4DXBA 3Q1FA 4OVDA 3UE0A 2OWJA 4EBLA 5EVIB 1ACFA 3G6OA 1AWIA 1PWCA 4MN7A 5EVEA 4EBNA 1S1ZA 4F3LA 3G4PA 4HBUA 4MMNA 1NWZA 1AXBA 1YT4A 4LGWA 1EROA 1KE4A 2W3EA 4XT2B 4MN6A 3NHQA 3H7WB 3N6IA 2X01A 4Y5FA 1JWPA 4JLFA 3LY4A 2WKIA 3W2ZA 1BLCA 5FI2A 5EFWA 3MXQA 2J9PA 1Q2QA 2XK1A 1G68A 2P9VA 3KYQA 3ZDJA 3DTIA 4B9OA 4X55A 3W8KA 4EV4A 3T1RA 1MKIA 4MBHA 4WEKA 4EESA 4FCFA 3M2KA 4QJGA 1STZA 5HSQA 2HPBA 3MBZA 3F1OB 3G2ZA 4C3QA 1YLYA 3LO7A 5E2FA 4IUKA 3LGOA 3OZHA 2Z2LB 4JGRA 2JKRI 3A0SA 1H8ZA 3VP4A 5J7EA 3LUQA 4FSFA 3MZFA 1TS0A 2IWCA 4EERA 3QNCA 1VETA 3O86A 2BLSA 1Y28A 4HESA 3VSLA 3Q7VA 3VOYA 4OP8A 1K56D 3IBJA 4B4XA 3T1XA 4Z1WA 1OTBA 1W8QA 3Q07A 2J8YA 3WRTA 2PR6A 3WS4A 1LL8A 1RP5A 1I2SA 2XLNA 2JHEA 3BFGA 3QP4A 4HNBA 4DN0A 2YKHA 3UDXA 2EWWA 5GHZA 3EQVA 3CWFA 2QMIA 3HUNA 1K56A 1BT5A 4GB7A 4OQIA 5KZHA 4CJNA 3CPTB 2ZD8A 4QD4A 3CUEC 2EFUA 2XH9A 5E2HA 2HJEA 2UV0E 4EWFA 2J80A 2LB9A 4RA7A 2ZQ7A 4DXCA 3RH8B 4P87A 5GLAA 1MWRA 2ZOIA 1DRMA 1LT0A 3V39A 3CJMA 3E4OA 4HH3A 2EFXA 1HD8A 4C75A 4DJ3A 1K57C 1DJAA 2ZMAA 4RX3A 1HZOA 2WK0A 4WM9A 1N9LA 2VV7A 4LV2A 1XA7A 3F1NA 1K54A 3QP6A 3K3CA 4E3JA 3MMHA 4F94A 4K0WA 2MJ6A 3SS5A 4Q0IA 1S4RA 3HREA 3KSFA 3UO9A 3ZCZA 2VJWA 3TSGA 1EW0A 2J3TD 2WGWB 4S2IA 4ETXA 5HW3A 1NYYA 2H10A 3SW1A 5AQ9A 4OOYA 3UB5P 2OAQ1 5FSRA 4NETA 5M18A 5EOEA 3IT9A 3EGDC 1WA9A 3D72A 2ZQ8A 1YMSA 1YAXA 1IYQA 4KZ9A 2HF6A 2Q9NA 4BBTA 1LSXA 4BJPA 2ZLYA 2H0TA 4JKTA 2D02A 3LY3A 1DY6A 3OOVA 3G30A 5BOHA 5DJUA 2PD8A 3LICA 1GSVA 3LIEA 5CX7A 2V20A 3T4TA 3VSKA 4Y7PA 3I7JA 4Y2FA 2QYBA 1P97A 4MBKA 5F5YA 2A24A 1RGYA 4QWOA 4LFUA 5CHJA 2DRWA 5CEDA 3K2NA 2JE5A 4U0XA 2K7SA 4KZAA 4HJ4A 4E3OA 3IXDA 1BZAA 4XUZA 2WAEA 2W3DA 3IWQA 1P9WA 4Y0TA 4YINA 2ZQAA 3A3EA 1CEFA 3TG9A 1YSPA 1W7FA 3UB7A 3LR4A 2VV8A 2OOLA 4UA7A 5F1FA 2ZC5B 4C6YA 2INWA 4UQIM 4EETB 3NOPC 4DE3A 1H5XA 2IA2A 1W63M 3IHBA 4EU0A 1IKGA 2ZQCA 3PBSA 3GQZA 3BRMA 1H8YA 1GA0A 3HLGA 4NXEA 3RJUA 4ZRRA 4WYYA 3LEZA 5GLBA 3OCLA 3A3FA 1FR6A 1MPLA 2FZ0A 4IBXA 1WE4A 3S7NA 2VGLS 2J9OA 3OBFA 3F1OA 4Y15A 4CQHA 2BASA 3T50A 1I5QA 1KGEA 4KZ6A 4LLOB 1SZVA 2JKGA 3F1PA 3TJZC 2V8CA 4IVIA 5J3WA 3HBRA 2EXBA 3MQQA 1SKOA 3LCEA 4Z9QA 2EXAA 4K91A 2GX5A 1S4SA 4A5RA 2Y4AA 1JTDA 2ZM2A 1ONGA 2KDKA 4BL3A 3IBRA 3FZCA 1OJGA 2UWXA 4FOFA 3WS0A 2J3WA 2Q0OA 1E3UA 3PXPA 4Y17A 3LI9A 1CEGA 4LV1A 3H82B 5EM0A 4GCZA 5EM1A 3HJKA 1XXMA 4BBUA 5L2FA 4ID4A 4ARZA 4EBPA 3CPTA 4GLQA 3GTCA 2B5RA 2I72A 2PU2A 1HTZA 5AVFA 2KOIA 4U3TA 3OPLA 2EX9A 3UMDA 2VX8A 3WWXA 3G34A 3O87A 4OOMA 4PKYG 2EA9A 2ZMFA 3VE3A 1BLSA 5J8XA 1NRJA 1GHIA 5KIZA 1TS6A 1OT6A 2BG1A 4JXWA 4MN5A 1J9MA 3V67A 3BM6A 4S2NA 1K4FA 3E4PA 3P01A 2WAFA 1JNUA 5CRFA 4L9GA 1E25A 1YPRA 4CLCB 4ZJ2A 2WGWA 3QNBA 1XGIA 4IJGA 3UY6A 5M1AA 4RQ9A 3UDIA 1CF0A 5HAQA 3MKFA 3E98A 3MKEA 3NY4A 2XA7M 1K0KA 3C4OA
chains in the Genus database with same CATH topology
3L9KA 2PBDP 2ZL1A 1FIKA 2PAVP 3KYEA 3NULA 1VETB 4D60A 3T1RA 3MSHA 3T1QB 2VK3A 5EM0A 5EM1A 3MS6A 1SKOB 1PFLA 3CPTA 3LEQA 4FTXA 1FILA 5FEFA 3T1SA 3LGOA 1D1JA 1PRQA 3D9YA 3U4LP 2BTFP 2ZL1B 1VEUA 1J3WA 3NECA 1CQAA 3DAVA 5EV0A 4X1LA 1VETA 3L7HA 1G5UA 2ACGA 3T1XA 1HLUP 3CHWP 3UB5P 1Y4OA 1ACFA 2E8JA 1Z09A 3T12B 1AWIA 5EVEA 1F2KA 2HZ5A 1VEUB 2PRFA 1SZVA 2JKGA 2V8FA 4X1MA 5FDSA 1YPRA 2V8CA 5FEGA 2B95A 2JKFA 1A0KA 1SKOA 3CPTB 4X25A 1CF0A 4QWOA 1PNEA 4ESPA 4FUWA 1CJFA 1K0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9K A;  2PBD P;  2ZL1 A;  1FIK A;  2PAV P;  3KYE A;  3NUL A;  1VET B;  4D60 A;  3T1R A;  3MSH A;  3T1Q B;  2VK3 A;  5EM0 A;  5EM1 A;  3MS6 A;  1SKO B;  1PFL A;  3CPT A;  3LEQ A;  4FTX A;  1FIL A;  5FEF A;  3T1S A;  3LGO A;  1D1J A;  1PRQ A;  3D9Y A;  3U4L P;  2BTF P;  2ZL1 B;  1VEU A;  1J3W A;  3NEC A;  1CQA A;  3DAV A;  5EV0 A;  4X1L A;  1VET A;  3L7H A;  1G5U A;  2ACG A;  3T1X A;  1HLU P;  3CHW P;  3UB5 P;  1Y4O A;  1ACF A;  2E8J A;  1Z09 A;  3T12 B;  1AWI A;  5EVE A;  1F2K A;  2HZ5 A;  1VEU B;  2PRF A;  1SZV A;  2JKG A;  2V8F A;  4X1M A;  5FDS A;  1YPR A;  2V8C A;  5FEG A;  2B95 A;  2JKF A;  1A0K A;  1SKO A;  3CPT B;  4X25 A;  1CF0 A;  4QWO A;  1PNE A;  4ESP A;  4FUW A;  1CJF A;  1K0K A; 
#chains in the Genus database with same CATH topology
 2Y2L A;  1MY8 A;  3T4O A;  3O88 A;  4KG5 A;  1KVL A;  2ZL1 A;  1XJ3 A;  1U60 A;  2ZC3 B;  3IWO A;  4DKI A;  4CLC C;  2K31 A;  5FQI A;  1K55 C;  3ZFZ A;  5CEC A;  3NC8 A;  2ZM8 A;  4GOG A;  1TDL A;  4HP4 A;  1SDN A;  4GHI A;  1YKD A;  3T1Q B;  2O99 A;  3CI6 A;  2WKR A;  1NYM A;  5A91 A;  1FR1 A;  4R3A A;  5HWV A;  1FIL A;  1MWU A;  3JYI A;  5L07 A;  4LRX C;  2Y2H A;  1XJ6 A;  3Q7Z A;  3QHY A;  4KQD A;  1UGU A;  2PYR A;  4X1L A;  2NUT C;  4OOL A;  4BL2 A;  3A3D A;  3LIB A;  2DMW A;  4QY5 A;  3FPW A;  4QPR A;  2HP9 A;  3VMA A;  5CHU A;  4RX2 A;  1LL9 A;  1Z09 A;  4UA6 A;  3VP2 A;  3R4K A;  5FQK A;  2WYX A;  2GNX A;  1S66 L;  3D3O A;  3G2Y A;  4I39 A;  5HL6 A;  3LI8 A;  3BFE A;  1FCO A;  1M6K A;  3WS1 A;  4GD6 A;  2W3F A;  5GL9 A;  4X1M A;  5KSC A;  3BYD A;  4GD8 A;  5C5K A;  1W79 A;  3UN7 A;  1K38 A;  3B42 A;  1JWZ A;  3GEC A;  3BQA A;  1MBL A;  1OPX A;  3A0V A;  1LHY A;  2EX6 A;  4WBG A;  1XPB A;  1PNE A;  3BFD A;  1FCN A;  4MLL A;  1CK3 A;  3NCK A;  2PDR A;  2D01 A;  2QJ7 A;  1GCE A;  3P98 A;  1XGJ A;  5DTS A;  1CI8 A;  3MXR A;  3U2A A;  3S7Q A;  4I38 A;  3UB9 A;  5HWT A;  2EX2 A;  4NEE D;  1KGF A;  4MCW A;  1CI9 A;  5LBR A;  1PW8 A;  3C30 A;  1XX2 A;  3UPO A;  2WAD A;  1PI5 A;  5EUA A;  3GVB A;  5K5B A;  2Y2I A;  1L3L A;  4Q0J A;  3UPN A;  1ES2 A;  4Y0U A;  5F83 A;  3R7W A;  3TE8 A;  2QZ6 A;  3IS2 B;  1Y4O A;  3H82 A;  2XFS A;  2HGV A;  5FI6 A;  3T12 B;  5EPH A;  3KSI A;  3ICY A;  2Y2J A;  2ZC4 B;  1MWS A;  3MQ0 A;  5U47 A;  5DKK A;  1T18 A;  3HUO A;  3PHY A;  3SH8 A;  3KX0 X;  4BLM A;  1FSW A;  4HI4 A;  4E3M A;  4UA9 A;  5EEC A;  3VP3 A;  2R9X A;  3GV9 A;  5E2G A;  1TDG A;  3N7W A;  3LID A;  1G6A A;  5HWW A;  1PIO A;  4EXO A;  3UE1 A;  2WKE A;  3VFH A;  5FAT A;  1JVJ A;  5EVL A;  5HAP A;  3WS2 A;  2PBD P;  3IXH A;  3E4Q A;  4IVK A;  2XRO A;  4PM6 A;  2VGK A;  3FWL A;  3QP5 A;  1ZC2 A;  5DF9 A;  4GS9 B;  4L0L A;  2Y59 A;  3VOL A;  1KGG A;  4LCM A;  5DVA A;  3C8C A;  4R3J A;  4NXF A;  4HHD A;  3IX3 A;  4FTX A;  1NLY A;  4JF6 A;  5KSH A;  1D1J A;  3GDI A;  5DTK A;  4D2O A;  5IHV A;  2V1B A;  3BEC A;  4BMW A;  2QPN A;  2WUQ A;  1CQA A;  1UWN X;  4X69 A;  1NLZ A;  1NRF A;  2OAP 1;  3H9W A;  1L0G A;  2ACG A;  3IF6 C;  1HLU P;  5CXW A;  5L8M A;  4HP9 A;  4QB8 A;  3UNW A;  4P6Z M;  4HJ6 A;  5HDD A;  3P7N A;  1YLT A;  1T1B A;  3T4S A;  3MZE A;  1XJ2 A;  1IYS A;  1LI0 A;  1Q2P A;  2KLI A;  3UE3 A;  3PBN A;  1VEU B;  5FQQ A;  3DTM A;  4OPR A;  5FAP A;  3B3X A;  2V8F A;  1PWD A;  1SCW A;  4JGQ A;  3B47 A;  4H6J A;  1KOU A;  3WS5 A;  3RXW A;  4CLC E;  2JKF A;  4KQQ A;  2OLU A;  5FAQ A;  4X25 A;  5EVI D;  2WKH A;  3NI9 A;  1W8Y A;  1DP8 A;  2P04 A;  1ONH A;  2Y2N A;  4PM5 A;  2HDU A;  2HDR A;  4II7 A;  4PM7 A;  2O9C A;  5HX9 A;  4Y13 A;  4LRY C;  3UB8 A;  2Y91 A;  3CG5 A;  3MSH A;  2O9B A;  3G31 A;  1LLB A;  2JC7 A;  1ERQ A;  1NXY A;  3HLE A;  4GZB A;  5EVI A;  4O7D A;  3V3S A;  3UDF A;  1DJC A;  3PYP A;  1TEM A;  1VHM A;  3E2K A;  5DTT A;  4WLA A;  4L9F A;  1DP6 A;  1PRQ A;  1P0Z A;  5G4Z A;  3SOI A;  1ERM A;  3D9Y A;  3U4L P;  2Y2M A;  5JYO A;  3NEC A;  4G3V A;  1XJ4 A;  4JF4 A;  1SKF A;  4XT2 A;  5HD5 A;  1RCJ A;  3ZYT A;  4EEP A;  3H7W A;  4S2M A;  4O8G A;  3IH8 A;  3VP1 A;  4WL9 A;  1E4D A;  3BY9 A;  4UHU A;  4S2O A;  1N9B A;  4LRZ E;  4N9L A;  1NJ4 A;  4FH2 A;  3O5Y A;  2XEP A;  1VB6 A;  4WMC D;  3ZNT A;  2Z2M B;  1VQQ A;  1JTG A;  4I5S A;  3NJA A;  3IF5 A;  1T19 A;  2JN7 A;  2IWB A;  3ZG5 A;  4ZAM A;  2V1A A;  3DTK A;  4E6X A;  1TVF A;  2V0U A;  1A0K A;  5A90 A;  1ZG6 A;  4OKP A;  3IWI A;  4PPR A;  2W27 A;  2VV6 A;  1LSV A;  4BD0 A;  1V9Z A;  2ZMV A;  3PBT A;  1FIK A;  1KDW A;  4WMC A;  4DF6 A;  1E3U D;  3HVF A;  3VFF A;  3HCY A;  4WEL A;  3BLM A;  3ITB A;  1K25 A;  1ZKJ A;  3B33 A;  1F98 A;  2YKF A;  2ZC7 A;  2VK3 A;  1L0E A;  2Y2K A;  4MEZ A;  4Y3I A;  3AGE A;  4OON A;  2WKQ A;  3KSG A;  3HUM A;  4RYE A;  3DW0 A;  1D06 A;  3CUE A;  3BY8 A;  1PWG A;  1OTE A;  2GZA A;  1OTI A;  4GDB A;  4OQG A;  2P9V B;  2PR5 A;  3MZD A;  4JXG A;  4Q0H A;  4OQH A;  3VE4 A;  3A3I A;  1LL5 A;  1ES4 A;  2Y79 A;  3LR3 A;  2W1R A;  3E0Y A;  4OLD A;  1XFQ A;  2EX8 A;  1IEM A;  4NXB A;  4BWI A;  3MQO A;  1K57 A;  3EEA A;  3P09 A;  4EUV A;  1BLH A;  1F2K A;  4LCL A;  4M3K A;  3LIF A;  4BBV A;  2XRN A;  4S2L A;  5AJG A;  1MXO A;  5FAS A;  4DE2 A;  3HL9 A;  2WKP A;  1IEL A;  3IH9 A;  3EOI A;  2XD5 A;  4Q8I A;  4B93 A;  1JWV A;  3E2L A;  1PYY A;  3DTE A;  2PBY A;  3VV4 A;  3M2J A;  1XP4 A;  1L0F A;  1YLJ A;  3L9K A;  3C7U A;  4PKY A;  3GMW A;  4O01 A;  4GNU A;  4JXV A;  4DE0 A;  5AQA A;  2B02 A;  3T4Q A;  2M7U A;  1MC0 A;  2GDN A;  2ZBB A;  3T4L A;  2I9V A;  4CPK A;  3EEH A;  4JGO A;  3IXB A;  1S67 L;  5IS1 A;  4M4X A;  2ZC6 B;  5HL1 A;  2XSS A;  4X68 A;  3EQU A;  4S2K A;  2Y2P A;  4KG2 A;  3MFX A;  4ME4 A;  3UME A;  1G6O A;  3SS3 A;  3NBL A;  4NG2 A;  1N9O A;  5GHX A;  2ZJ9 A;  4N92 A;  3NOU C;  1FOF A;  1LSW A;  2JKT M;  2WZZ A;  1G5U A;  2PT7 A;  5L10 A;  4OPY A;  3A3J A;  4JXS A;  4X53 A;  3AGF A;  1TS7 A;  2PD7 A;  4R0Q A;  2HDQ A;  1OME A;  1SDE A;  3HLC A;  3ISG A;  2FFF B;  3OPP A;  3UPP A;  2Y2O A;  4BQM A;  3ZHH A;  3ITA A;  3VP0 A;  2PRF A;  3S7P A;  3SZT A;  1ES5 A;  3ZGA B;  5IT5 A;  2P74 A;  5FL3 A;  3OPH A;  2WZX A;  3FKV A;  4K08 A;  5IU1 A;  4LPZ A;  2EWV A;  3IX4 A;  4DMZ A;  1K54 C;  4UQI S;  2IWD A;  3FYZ A;  1YMX A;  5J4E A;  1YM1 A;  4EW7 A;  3UB6 A;  4R3B A;  3NDG A;  1Y54 A;  3KYE A;  3BJN A;  3LR0 A;  4JGP A;  1OJ5 A;  1OTA A;  5G4Y A;  3IXG A;  5FQ9 A;  4X6T A;  4E04 A;  1PZP A;  1G28 A;  2ZQ9 A;  2HDS A;  3D4F A;  1YLW A;  3MS6 A;  1YQS A;  1O7E A;  2A24 B;  5FA7 A;  3FV7 A;  3T4K A;  4LV0 A;  1GHM A;  1H3Q A;  3CAX A;  2L4R A;  3DWK A;  2W1T B;  5DKL A;  1J3W A;  2J3T C;  1HVB A;  4PMA A;  1EI5 A;  5TR7 A;  1RGZ A;  2JKR M;  3DWZ A;  3T4J A;  2KX6 A;  4KUK A;  4HQA A;  4E6W A;  5EVI C;  4QHC A;  2Z6D A;  1P9R A;  2NUP C;  2Z6C A;  5KMW A;  2G2U A;  1QME A;  4EQI A;  4MNR A;  5AQB A;  3KSH A;  3RXX A;  4HIA A;  3TOI A;  3N4I A;  3UE6 A;  5TJJ A;  5GLC A;  3PR6 A;  3CIT A;  2Q9M A;  4GKU A;  2PYP A;  2HP5 A;  4ESP A;  2VA0 A;  4P6B A;  1DJB A;  4R70 A;  5HAI A;  2VGL M;  3PAE A;  4R4R A;  2G7U A;  4S2P A;  2HV1 A;  1Z6F A;  2O9A A;  2VGJ A;  3MXS A;  2R9W A;  5F1G A;  2QHK A;  5CGS A;  1F5M A;  1KE3 A;  4CLC D;  5G18 A;  1TS8 A;  3F1P B;  4DDS A;  4KZ8 A;  2XFT A;  4WZ5 A;  4LEN A;  2P08 A;  1SKO B;  5MC7 A;  3Q82 A;  5I5L A;  4L9E A;  2A3U A;  5GLD A;  5E43 A;  2W0N A;  3ZG8 B;  3LFV A;  1IYO A;  4ZJ3 A;  3BFC A;  3N8S A;  1YLP A;  1K4E A;  1KVM A;  3M6B A;  5AVE A;  1K6R A;  4KZ3 A;  3ZG7 B;  1DP9 A;  2G2W A;  4CLC A;  4DRT A;  1NY0 A;  3IX8 A;  1K55 A;  3A0R A;  3IF6 B;  3ZVT A;  3EGX C;  3VOZ A;  5TFQ A;  2RL3 A;  1O07 A;  2X02 A;  2XA7 S;  4ARZ B;  1K6S A;  2E8J A;  1GA9 A;  3O3V A;  4IBR A;  4UAA A;  2H28 A;  4X56 A;  3GSG A;  5HZH A;  1TF1 A;  2QJ5 A;  2HZ5 A;  3M6H A;  1NZO A;  1WYB A;  4HH2 A;  4PHT A;  4KZ7 A;  3RTY A;  3W4O A;  1VM1 A;  4HJ3 A;  4WUJ A;  5CEB A;  2DNS A;  3C38 A;  1S1Y A;  4WF0 A;  1YLZ A;  2C6W B;  1CJF A;  4GDN A;  2VLG A;  2RCX A;  4QU3 A;  2WGI A;  4PM8 A;  2R78 A;  4LV3 A;  4D60 A;  2Y2G A;  3CZD A;  4ZJ1 A;  5L09 A;  2XDM A;  4KZ5 A;  1IYP A;  4XUX A;  2GJ3 A;  3ULF A;  2VZW A;  1MZU A;  3PAG A;  5CER A;  1XA1 A;  4QY6 A;  5TBM B;  5F6A A;  3FKW A;  4PM9 A;  4YWZ A;  2W3G A;  2PU4 A;  3IQA A;  1EWZ A;  4S2N C;  3W4P A;  1ESI A;  2ZL1 B;  5CGW A;  2V1Z A;  2B18 A;  3C7V A;  5CGX A;  1NZU A;  4HBT A;  2Y55 A;  4GHI B;  3PBO A;  5DF8 A;  1FCM A;  3CHW P;  3ZG0 A;  2FH5 A;  5M19 A;  4ZDX A;  3BEB A;  4FD8 A;  4EUZ A;  4DDY A;  5A93 A;  4UEY A;  3OLO A;  4N9K A;  3NOT C;  5FQJ A;  2C5W B;  1ESU A;  1T1C A;  2V2F F;  4WN5 A;  3JPU A;  3MF0 A;  4N1H A;  2V9A A;  2W1T A;  3G32 A;  2H5S A;  1H8M A;  2FFY A;  4DJ2 A;  4KQR A;  1XFN A;  4I3A A;  4I3I A;  3S22 A;  4U0T A;  4PAU A;  3EWK A;  5I94 A;  3ZQ5 A;  4E3L A;  1V9Y A;  5FAO A;  1W63 Q;  4FUW A;  1OTD A;  1I2W A;  4YFM A;  2M7V A;  3QP8 A;  2W3H A;  5A8B A;  4HEF A;  1IOU A;  2AVX A;  5CTM A;  3N8R A;  3S4X A;  1S6R A;  3HLD A;  4KZ4 A;  3BWL A;  3NUL A;  2ZOH A;  2XQZ A;  4P0M A;  5CHM A;  1ZTU A;  4GN2 A;  3ZG9 B;  4DE1 A;  5HDS A;  3NDE A;  3TRC A;  3W4Q A;  1QMF A;  3IS2 A;  3BFF A;  4AFI A;  4IUH A;  1IKI A;  1WYC A;  1MWT A;  3CLO A;  4YNR A;  1FSY A;  5HFO A;  3OPR A;  2HJ9 C;  2XD1 A;  4WEJ A;  3K3D A;  3V5M A;  4F3L B;  5FEF A;  5GHY A;  3NIA A;  3PBQ A;  4O0P A;  4H8R A;  2Y2Q A;  2P7J A;  5FDH A;  4B4Z A;  5EV0 A;  2QWS A;  3C2W A;  5FI7 A;  4RVA A;  5F82 A;  3HLW A;  4OH0 A;  1ALQ A;  5JYP A;  4Y0O A;  3MFD A;  3ZNY A;  2VKS A;  1SHV A;  4ZBE A;  3CMZ A;  3MJQ A;  3S7O A;  1GSW A;  5HDC A;  1X0O A;  4KUO A;  2OV5 A;  5D3O A;  5A92 A;  1OT9 A;  4OP5 A;  4E3I A;  4G3W A;  3GR2 A;  2X71 A;  4MBF A;  3SS4 A;  2V0W A;  1H0M A;  4GS9 A;  4XXR A;  2OLV A;  5DFX A;  4KQO A;  5TGF A;  4WZ4 A;  3R7W B;  3C4P A;  3FC7 A;  4OQ0 A;  4KG6 A;  3IF6 A;  5HD3 A;  3PBR A;  2PHY A;  1L2S A;  3KYZ A;  3G35 A;  3TW8 A;  3GRJ A;  2Y8H A;  2E8I A;  1BUE A;  4B88 A;  2XR0 A;  2H0Y A;  1N4O A;  4IED A;  3BQ8 A;  1S0W A;  3V3R A;  4KEN B;  3FPV A;  3WRZ A;  1T1A A;  2PAV P;  3BW6 A;  5HPF A;  1D7E A;  1VET B;  5EE8 A;  5DF7 A;  3Q7V B;  3BLS A;  3AGD A;  4R4S A;  5HPI A;  3SH9 A;  1W5D A;  4EQ1 A;  2LB5 A;  4IHQ A;  4P6Z S;  3OC2 A;  1BSG A;  1PFL A;  1KDS A;  2CMN A;  5E2E A;  1MKM A;  2ZM0 A;  4JPM A;  4OLG A;  2OSU A;  2JBF A;  1XKZ A;  3JVV A;  3N8L A;  1L0D A;  1PW1 A;  2OWH A;  3QP2 A;  4MDZ A;  2M1C A;  2BTF P;  1VEU A;  3IHA A;  2L0W A;  1UWP X;  4R1G A;  4ETZ A;  1GSX A;  4JBF A;  1BTL A;  4NK3 A;  1PI4 A;  3HLB A;  1C3B A;  2DCF A;  3FG8 A;  4R6L A;  1ODV A;  4WZ5 C;  4ZTK A;  1N9N A;  4S2J A;  3C5A A;  2ZQD A;  5DFY A;  3OCN A;  2WGV A;  3SH7 A;  1KE0 A;  5TBM A;  2HP6 A;  5HAR A;  3Q81 A;  4OPQ A;  2CC1 A;  4BD1 A;  3ZVW A;  4NXG A;  3LR5 A;  3LYX A;  5F68 A;  3HJI A;  3LIA A;  4NKP A;  4OPZ A;  5FDS A;  4E3K A;  2K2N A;  4E3N A;  5FEG A;  2B95 A;  5DJT A;  4KZB A;  4I3J A;  2A2L A;  4R23 A;  4JF5 A;  5FQM A;  1ZHH B;  1PZO A;  2L1M A;  3F1N B;  4G3K A;  2XF3 A;  2A49 A;  1ES3 A;  2VEA A;  1ZG4 A;  3KO6 A;  1TD5 A;  1BUL A;  3DBA A;  1YSQ A;  2O0Y A;  4P85 A;  3RFB A;  4HOI A;  1LI9 A;  4EEU A;  1M40 A;  4FH4 A;  4GJ4 A;  1GHP A;  2JCH A;  5CTN A;  4BEN A;  4H6J B;  2XGN A;  3S1Y A;  4K0X A;  2QKP A;  3QP1 A;  4GW9 A;  3LEQ A;  4N1X A;  4R38 A;  3V50 A;  3PTE A;  3T1S A;  1BYW A;  2JKT I;  2J7V A;  5EOO A;  4HY8 A;  1IFQ A;  3MR0 A;  1F9I A;  3JVU A;  3DAV A;  1BLP A;  1FQG A;  3L7H A;  5AQ7 A;  4YOF A;  5F69 A;  3HLF A;  4DXB A;  3Q1F A;  4OVD A;  3UE0 A;  2OWJ A;  4EBL A;  5EVI B;  1ACF A;  3G6O A;  1AWI A;  1PWC A;  4MN7 A;  5EVE A;  4EBN A;  1S1Z A;  4F3L A;  3G4P A;  4HBU A;  4MMN A;  1NWZ A;  1AXB A;  1YT4 A;  4LGW A;  1ERO A;  1KE4 A;  2W3E A;  4XT2 B;  4MN6 A;  3NHQ A;  3H7W B;  3N6I A;  2X01 A;  4Y5F A;  1JWP A;  4JLF A;  3LY4 A;  2WKI A;  3W2Z A;  1BLC A;  5FI2 A;  5EFW A;  3MXQ A;  2J9P A;  1Q2Q A;  2XK1 A;  1G68 A;  2P9V A;  3KYQ A;  3ZDJ A;  3DTI A;  4B9O A;  4X55 A;  3W8K A;  4EV4 A;  3T1R A;  1MKI A;  4MBH A;  4WEK A;  4EES A;  4FCF A;  3M2K A;  4QJG A;  1STZ A;  5HSQ A;  2HPB A;  3MBZ A;  3F1O B;  3G2Z A;  4C3Q A;  1YLY A;  3LO7 A;  5E2F A;  4IUK A;  3LGO A;  3OZH A;  2Z2L B;  4JGR A;  2JKR I;  3A0S A;  1H8Z A;  3VP4 A;  5J7E A;  3LUQ A;  4FSF A;  3MZF A;  1TS0 A;  2IWC A;  4EER A;  3QNC A;  1VET A;  3O86 A;  2BLS A;  1Y28 A;  4HES A;  3VSL A;  3Q7V A;  3VOY A;  4OP8 A;  1K56 D;  3IBJ A;  4B4X A;  3T1X A;  4Z1W A;  1OTB A;  1W8Q A;  3Q07 A;  2J8Y A;  3WRT A;  2PR6 A;  3WS4 A;  1LL8 A;  1RP5 A;  1I2S A;  2XLN A;  2JHE A;  3BFG A;  3QP4 A;  4HNB A;  4DN0 A;  2YKH A;  3UDX A;  2EWW A;  5GHZ A;  3EQV A;  3CWF A;  2QMI A;  3HUN A;  1K56 A;  1BT5 A;  4GB7 A;  4OQI A;  5KZH A;  4CJN A;  3CPT B;  2ZD8 A;  4QD4 A;  3CUE C;  2EFU A;  2XH9 A;  5E2H A;  2HJE A;  2UV0 E;  4EWF A;  2J80 A;  2LB9 A;  4RA7 A;  2ZQ7 A;  4DXC A;  3RH8 B;  4P87 A;  5GLA A;  1MWR A;  2ZOI A;  1DRM A;  1LT0 A;  3V39 A;  3CJM A;  3E4O A;  4HH3 A;  2EFX A;  1HD8 A;  4C75 A;  4DJ3 A;  1K57 C;  1DJA A;  2ZMA A;  4RX3 A;  1HZO A;  2WK0 A;  4WM9 A;  1N9L A;  2VV7 A;  4LV2 A;  1XA7 A;  3F1N A;  1K54 A;  3QP6 A;  3K3C A;  4E3J A;  3MMH A;  4F94 A;  4K0W A;  2MJ6 A;  3SS5 A;  4Q0I A;  1S4R A;  3HRE A;  3KSF A;  3UO9 A;  3ZCZ A;  2VJW A;  3TSG A;  1EW0 A;  2J3T D;  2WGW B;  4S2I A;  4ETX A;  5HW3 A;  1NYY A;  2H10 A;  3SW1 A;  5AQ9 A;  4OOY A;  3UB5 P;  2OAQ 1;  5FSR A;  4NET A;  5M18 A;  5EOE A;  3IT9 A;  3EGD C;  1WA9 A;  3D72 A;  2ZQ8 A;  1YMS A;  1YAX A;  1IYQ A;  4KZ9 A;  2HF6 A;  2Q9N A;  4BBT A;  1LSX A;  4BJP A;  2ZLY A;  2H0T A;  4JKT A;  2D02 A;  3LY3 A;  1DY6 A;  3OOV A;  3G30 A;  5BOH A;  5DJU A;  2PD8 A;  3LIC A;  1GSV A;  3LIE A;  5CX7 A;  2V20 A;  3T4T A;  3VSK A;  4Y7P A;  3I7J A;  4Y2F A;  2QYB A;  1P97 A;  4MBK A;  5F5Y A;  2A24 A;  1RGY A;  4QWO A;  4LFU A;  5CHJ A;  2DRW A;  5CED A;  3K2N A;  2JE5 A;  4U0X A;  2K7S A;  4KZA A;  4HJ4 A;  4E3O A;  3IXD A;  1BZA A;  4XUZ A;  2WAE A;  2W3D A;  3IWQ A;  1P9W A;  4Y0T A;  4YIN A;  2ZQA A;  3A3E A;  1CEF A;  3TG9 A;  1YSP A;  1W7F A;  3UB7 A;  3LR4 A;  2VV8 A;  2OOL A;  4UA7 A;  5F1F A;  2ZC5 B;  4C6Y A;  2INW A;  4UQI M;  4EET B;  3NOP C;  4DE3 A;  1H5X A;  2IA2 A;  1W63 M;  3IHB A;  4EU0 A;  1IKG A;  2ZQC A;  3PBS A;  3GQZ A;  3BRM A;  1H8Y A;  1GA0 A;  3HLG A;  4NXE A;  3RJU A;  4ZRR A;  4WYY A;  3LEZ A;  5GLB A;  3OCL A;  3A3F A;  1FR6 A;  1MPL A;  2FZ0 A;  4IBX A;  1WE4 A;  3S7N A;  2VGL S;  2J9O A;  3OBF A;  3F1O A;  4Y15 A;  4CQH A;  2BAS A;  3T50 A;  1I5Q A;  1KGE A;  4KZ6 A;  4LLO B;  1SZV A;  2JKG A;  3F1P A;  3TJZ C;  2V8C A;  4IVI A;  5J3W A;  3HBR A;  2EXB A;  3MQQ A;  1SKO A;  3LCE A;  4Z9Q A;  2EXA A;  4K91 A;  2GX5 A;  1S4S A;  4A5R A;  2Y4A A;  1JTD A;  2ZM2 A;  1ONG A;  2KDK A;  4BL3 A;  3IBR A;  3FZC A;  1OJG A;  2UWX A;  4FOF A;  3WS0 A;  2J3W A;  2Q0O A;  1E3U A;  3PXP A;  4Y17 A;  3LI9 A;  1CEG A;  4LV1 A;  3H82 B;  5EM0 A;  4GCZ A;  5EM1 A;  3HJK A;  1XXM A;  4BBU A;  5L2F A;  4ID4 A;  4ARZ A;  4EBP A;  3CPT A;  4GLQ A;  3GTC A;  2B5R A;  2I72 A;  2PU2 A;  1HTZ A;  5AVF A;  2KOI A;  4U3T A;  3OPL A;  2EX9 A;  3UMD A;  2VX8 A;  3WWX A;  3G34 A;  3O87 A;  4OOM A;  4PKY G;  2EA9 A;  2ZMF A;  3VE3 A;  1BLS A;  5J8X A;  1NRJ A;  1GHI A;  5KIZ A;  1TS6 A;  1OT6 A;  2BG1 A;  4JXW A;  4MN5 A;  1J9M A;  3V67 A;  3BM6 A;  4S2N A;  1K4F A;  3E4P A;  3P01 A;  2WAF A;  1JNU A;  5CRF A;  4L9G A;  1E25 A;  1YPR A;  4CLC B;  4ZJ2 A;  2WGW A;  3QNB A;  1XGI A;  4IJG A;  3UY6 A;  5M1A A;  4RQ9 A;  3UDI A;  1CF0 A;  5HAQ A;  3MKF A;  3E98 A;  3MKE A;  3NY4 A;  2XA7 M;  1K0K A;  3C4O A; 
#chains in the Genus database with same CATH homology
 3L9K A;  2PBD P;  2ZL1 A;  1FIK A;  2PAV P;  3KYE A;  3NUL A;  1VET B;  4D60 A;  3T1R A;  3MSH A;  3T1Q B;  2VK3 A;  5EM0 A;  5EM1 A;  3MS6 A;  1SKO B;  1PFL A;  3CPT A;  3LEQ A;  4FTX A;  1FIL A;  5FEF A;  3T1S A;  3LGO A;  1D1J A;  1PRQ A;  3D9Y A;  3U4L P;  2BTF P;  2ZL1 B;  1VEU A;  1J3W A;  3NEC A;  1CQA A;  3DAV A;  5EV0 A;  4X1L A;  1VET A;  3L7H A;  1G5U A;  2ACG A;  3T1X A;  1HLU P;  3CHW P;  3UB5 P;  1Y4O A;  1ACF A;  2E8J A;  1Z09 A;  3T12 B;  1AWI A;  5EVE A;  1F2K A;  2HZ5 A;  1VEU B;  2PRF A;  1SZV A;  2JKG A;  2V8F A;  4X1M A;  5FDS A;  1YPR A;  2V8C A;  5FEG A;  2B95 A;  2JKF A;  1A0K A;  1SKO A;  3CPT B;  4X25 A;  1CF0 A;  4QWO A;  1PNE A;  4ESP A;  4FUW A;  1CJF A;  1K0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...