5EVEA

Crystal structure of amb a 8 in complex with poly-pro10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
b'SWQTYVDEHLMCDIEGTGQHLASAAIFGTDGNVWAKSSSFPEFKPDEINAIIKEFSEPGALAPTGLFLAGAKYMVIQGEPGAVIRGKKGAGGICIKKTGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Ambrosia artemisiifolia
molecule tags Allergen
total genus 31
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5eveA00
3U4LP 1YPRA 1VEUB 2PBDP 1Z09A 1K0KA 2JKGA 3NULA 3LEQA 5EM1A 1VETB 4X25A 1AWIA 2ACGA 1FIKA 1CF0A 4ESPA 3CPTB 4D60A 1PRQA 3DAVA 3D9YA 4X1MA 1F2KA 3CHWP 1PFLA 1Y4OA 3T12B 3L7HA 2ZL1B 1A0KA 4FTXA 1HLUP 1SZVA 1PNEA 2JKFA 1CQAA 2V8CA 1ACFA 3CPTA 5EM0A 2HZ5A 5FEFA 2V8FA 1VEUA 5FEGA 3T1RA 1CJFA 1VETA 1SKOB 4X1LA 2PAVP 1FILA 2PRFA 2B95A 1D1JA 3T1QB 3MSHA 1J3WA 3L9KA 3NECA 2E8JA 5EVEA 4QWOA 5FDSA 3T1SA 3LGOA 3T1XA 2ZL1A 3KYEA 2BTFP 3UB5P 3MS6A 5EV0A 1G5UA 1SKOA 2VK3A 4FUWA
chains in the Genus database with same CATH superfamily
1E4DA 2VGLS 3A0VA 5EM1A 3BY9A 1UWPX 3GECA 3MXQA 1RGYA 1XFQA 2XD1A 3CPTB 3SOIA 3OZHA 4XUZA 1J9MA 4F94A 3MBZA 5FQQA 1PFLA 1YLZA 2PD7A 3OPHA 2P9VB 5AVFA 2ZL1B 2JKFA 5CERA 4EBPA 1PZPA 4ETZA 5DFYA 4B4XA 4A5RA 5DTSA 5GLBA 1L3LA 4E3MA 1XA1A 1TS8A 5DTTA 3BFCA 4GHIB 4EEUA 4KG5A 2HZ5A 1LHYA 3UE0A 5E2EA 5BOHA 5EOEA 2RCXA 3B47A 5FI2A 4PKYG 1JTGA 1PZOA 2M7VA 2WYXA 3FV7A 5CTNA 3JVUA 3IF5A 3VOZA 5HPFA 2O9AA 1ERMA 2HPBA 2EX2A 3S7OA 1Q2PA 2R78A 2IA2A 2C5WB 4LGWA 1K25A 2ZQDA 1NYYA 5J7EA 3NECA 4Y0OA 3CITA 5FDHA 5EVEA 5DF8A 3GSGA 5I94A 3N6IA 2WKIA 4S2NA 2ZM8A 4JF5A 1SKFA 4EUZA 4S2IA 4EW7A 3ICYA 4FH4A 4JGQA 3T50A 4KZ8A 3T4QA 5KZHA 3BY8A 2O0YA 4RX2A 2YKFA 2Y2HA 5JYOA 4FUWA 3F1OA 5FAOA 3HLCA 4P85A 5GHZA 5KIZA 3QP8A 3RXWA 5FI6A 4EETB 1IKGA 4E6WA 2KDKA 4KENB 1T1AA 2X02A 4ESPA 3FZCA 3ZG0A 1OT9A 2IWDA 5CGWA 2EFXA 3G30A 4I3AA 1XJ2A 4MEZA 5FQ9A 1G28A 4LV2A 1Y28A 5F1GA 4HJ3A 1XJ4A 5HARA 5HSQA 4Z1WA 5G4YA 4EESA 4NXFA 3G4PA 1K54A 3EOIA 3FG8A 1S6RA 1ZG6A 2HP5A 3A3DA 1MWSA 4LENA 3OCNA 5FI7A 4PKYA 2WGIA 2LB9A 4JPMA 4WEJA 5K5BA 1VEUA 4BBVA 1L2SA 3VP4A 4E3LA 3RH8B 1O7EA 5E2GA 4LCMA 4I39A 1W8YA 1ES3A 2R9XA 4R70A 3RXXA 3MQ0A 4R38A 5DFXA 2BG1A 2VGKA 2E8IA 3KYEA 3GRJA 2WGVA 5F1FA 3LI8A 4BENA 2J80A 5DTKA 4OOYA 1W8QA 2P7JA 3C8CA 2FZ0A 5CGSA 1V9YA 3UB9A 4EU0A 4RYEA 2D02A 4ZTKA 4GW9A 3AGDA 1H8ZA 3FKVA 4LV0A 3VV4A 4GDBA 4JKTA 2HP6A 4ME4A 3P98A 4ID4A 1YMXA 2A2LA 3NHQA 3ZNYA 3H82A 1IELA 1GSXA 4PM5A 1I2WA 2QPNA 1T18A 4H6JA 1YLWA 4WMCD 3A3FA 1YSPA 4PAUA 1BULA 4P87A 4DF6A 2ZMAA 3BEBA 3PBQA 4Y2FA 1E3UD 5L8MA 5HPIA 4KZ6A 1OTBA 4MCWA 3RJUA 1KE4A 3LCEA 2HDUA 3BFEA 2EXBA 3DTKA 2I72A 1XJ6A 1H8YA 4MLLA 2KX6A 3TRCA 4WZ5C 5L09A 1ESUA 3IQAA 3NIAA 1FCOA 3S4XA 4G3WA 2W1TB 5GLAA 1BLPA 3EGXC 2VGJA 4OH0A 2W27A 5DF7A 3AGFA 1GHMA 2HV1A 1GA0A 3G34A 3UB8A 4PMAA 2JKRI 1AXBA 5A92A 5KSCA 3DWKA 1ES4A 5FDSA 3UO9A 1LI0A 2WKHA 1XXMA 2P9VA 5HZHA 1EROA 3WS5A 2ZL1A 3GDIA 4EWFA 4U0TA 1G6AA 4P6BA 2NUTC 5A8BA 4P0MA 4OPZA 2FFYA 4BD1A 5EOOA 1DP6A 4HHDA 1KGGA 2KOIA 4GHIA 1FQGA 1VETB 3LR5A 1DJCA 1MBLA 1SDEA 3HVFA 2ZMVA 4OQ0A 5FL3A 3PHYA 3Q7VB 3TE8A 4N9KA 2HDSA 1N4OA 2IWCA 3T4JA 2VKSA 5EVID 2FFFB 3NOUC 3T4TA 4EUVA 1A0KA 3SH7A 4U3TA 4Y3IA 4GD6A 4K91A 3NDGA 3BWLA 4OLDA 1K4EA 3UDIA 5M19A 1W79A 2L1MA 3CLOA 4WUJA 2VJWA 5CGXA 3W4QA 2JN7A 2Z6DA 4NEED 4GCZA 2W3EA 3PYPA 2Y2KA 4KZBA 3TJZC 4HJ6A 1CJFA 4ZJ2A 4UAAA 1MZUA 1JVJA 4ARZA 3QP1A 4UA7A 3IWIA 3HLBA 4OONA 4PM7A 5HDSA 1BT5A 5EVIA 1ZHHB 1G6OA 4WM9A 3A0SA 3OOVA 5DJTA 3OCLA 5FQMA 2WKRA 3V5MA 4B4ZA 1SDNA 1CI8A 4E3OA 4L9EA 4QPRA 4PHTA 5M18A 1FR6A 4N92A 2GDNA 1GHPA 1K38A 3IH8A 3WS2A 2B5RA 3HREA 2W3DA 3IXBA 4GS9B 1AWIA 3MZEA 5AJGA 3W8KA 3DTIA 3MMHA 4YOFA 3VFHA 3VMAA 3S1YA 4Z9QA 3S7PA 1NLZA 4KG6A 3NOTC 2DMWA 3SZTA 5HAPA 4E04A 2R9WA 3A0RA 2PYPA 1XFNA 3FC7A 3TG9A 5FQJA 1PNEA 3IX8A 5GLDA 4CLCB 3LR4A 5CECA 1NZOA 2ZC3B 4JBFA 2PYRA 4LLOB 3WRZA 1GCEA 3M6BA 4I38A 3V3RA 3N4IA 1GA9A 5HAQA 2Z6CA 2XR0A 4E3NA 2Z2LB 3ZG8B 2OLVA 4RA7A 3P09A 5F83A 3E4QA 1UGUA 3UB6A 5DKKA 3PBSA 2WZXA 2JKRM 5IHVA 3IF6B 3DBAA 3O88A 2Q9MA 5EUAA 1OJ5A 1OTIA 1F9IA 3T1XA 3HCYA 3UPNA 1IYQA 3Q1FA 1TDGA 3IXGA 4E3IA 1ZC2A 3DW0A 2Y2JA 4UHUA 4QHCA 3LEQA 4LCLA 1L0GA 4S2NC 2J9OA 2PU2A 1TS0A 5EFWA 1O07A 4D60A 5GL9A 5GHYA 2L4RA 5AQ7A 3WRTA 4KZ9A 1NZUA 2UV0E 2W1TA 1FSWA 3G2ZA 4HP9A 3K3CA 3ZVTA 5TR7A 1RCJA 3BRMA 1CQAA 3TSGA 1ZKJA 2OWJA 4X69A 3OBFA 3SH9A 1MC0A 3W4OA 4WF0A 4XT2A 3E2KA 1IYOA 2MJ6A 2OAP1 1VHMA 4LFUA 3BQAA 3NBLA 3CUEA 2Y2PA 3WWXA 1IFQA 3PBNA 4KZAA 1PI5A 5AQAA 3F1NB 1K54C 3GQZA 3EGDC 1VETA 1JWVA 2EX6A 2PR5A 4KUKA 5EVLA 3Q07A 5F82A 3Q7VA 3B42A 5F6AA 2WK0A 1OMEA 4OPRA 1H3QA 3HLEA 5CXWA 4UQIS 1WYCA 4WYYA 3LO7A 3IS2B 3R4KA 2WZZA 1MWRA 1MPLA 4Y13A 1LI9A 3HUOA 3GVBA 1DRMA 4HOIA 4OPQA 4ZRRA 3HLWA 5EV0A 2GNXA 1DJBA 3C4OA 1LLBA 2VK3A 3IBJA 2ZC7A 4JF6A 3E4PA 3PBTA 3O87A 3F1PB 3OC2A 3SH8A 1TS7A 1FIKA 3KX0X 1PRQA 1YSQA 2JCHA 3D9YA 1ODVA 3MKFA 3UPPA 1F2KA 4HEFA 5HD3A 5HWWA 4NXEA 3ZQ5A 3TW8A 1CEFA 4QJGA 4UEYA 4CLCD 5DJUA 3M6HA 4I3IA 4ARZB 2V2FF 3PBRA 4UA6A 2Y2OA 4IVIA 4Q0JA 1XPBA 4M3KA 5EVIB 4NXGA 2G2UA 3SW1A 4ZBEA 3LEZA 1ZTUA 4WLAA 2VV7A 4KZ5A 1K56D 1CK3A 2Y79A 2HF6A 2OAQ1 2PU4A 2V20A 3LR3A 3KSGA 2X01A 2WKPA 5FASA 2J3TD 4FD8A 2XD5A 4GS9A 2AVXA 3NOPC 2ZBBA 1DP9A 2QJ5A 1S4SA 2ZJ9A 3RFBA 5FQIA 3MSHA 1JNUA 1LL8A 2IWBA 4HNBA 4BJPA 4EXOA 1NYMA 2OSUA 5TFQA 1STZA 1NRFA 3T1SA 1ALQA 2EX9A 3WS4A 3Q7ZA 2XF3A 3IX4A 3S7NA 4CLCA 1YT4A 5HL1A 1TF1A 3ULFA 3MS6A 4OQGA 1K6SA 5FSRA 3V67A 3LY4A 1N9BA 3LY3A 4EQIA 4ZDXA 3HLGA 5L2FA 1Q2QA 5G18A 1WYBA 2BLSA 2ZQ7A 2HGVA 2OLUA 2K7SA 3ZG7B 2XA7M 2P08A 4LRZE 4GB7A 3MXRA 4RQ9A 1VB6A 4X1MA 4S2PA 5DF9A 1Z6FA 1T1BA 4N1XA 2PD8A 3QP6A 2Y55A 3OPLA 4DJ2A 2W0NA 4DXBA 2PR6A 1OPXA 1OJGA 5HFOA 3NI9A 2J9PA 4WELA 3IF6A 3MFXA 3MKEA 3GR2A 2V1ZA 3S7QA 4KQOA 2XROA 1PWGA 2EWVA 5KMWA 4DE2A 1U60A 4HI4A 3BQ8A 5HX9A 3EWKA 2WADA 3O3VA 4MMNA 4EBNA 3ITAA 1TS6A 1N9OA 3B33A 1NXYA 3IX3A 4CLCE 3UY6A 1CEGA 4P6ZS 2ZD8A 3OLOA 5I5LA 1BZAA 1KGEA 5EECA 4N1HA 1KE3A 2A24B 5HAIA 3E4OA 4NK3A 1KVLA 4MN7A 3C7UA 2E8JA 2V0WA 2XGNA 1K55C 4DDYA 4MDZA 1L0DA 3UB5P 5FA7A 5CHJA 4O01A 5CHMA 5EVIC 2Q0OA 2HJ9C 2Y2LA 1LT0A 4G3KA 3JPUA 4E3JA 4WN5A 4H8RA 5AQBA 3HJKA 2V9AA 2WAEA 5E2HA 4XT2B 3LFVA 1D7EA 4WMCA 2M1CA 4JGRA 4C6YA 4JF4A 4EBLA 3LI9A 2JE5A 3UMEA 3F1NA 5HDDA 5C5KA 3P01A 5F68A 1E3UA 1RGZA 2EX8A 2ZC6B 3IH9A 4DN0A 1H8MA 3SS3A 5EPHA 4GJ4A 3VOLA 4KQRA 3T4KA 1HLUP 4R23A 3V39A 3FWLA 1BLHA 1W63Q 1NJ4A 2QMIA 1CI9A 2INWA 2ZMFA 4KUOA 2ZQCA 3ZFZA 2ZLYA 3KYQA 3IS2A 3V3SA 3PAGA 3VE3A 1F98A 1NLYA 4EERA 5A91A 3SS5A 4BL2A 3Q82A 1YKDA 2O9BA 3W2ZA 4QU3A 3F1PA 4FSFA 1K57C 3CI6A 3IT9A 4R3BA 4OVDA 1M40A 4R3AA 3VOYA 3T4LA 3T1QB 3L9KA 1PW8A 2XSSA 2ZM2A 3LGOA 4Y17A 5D3OA 4IBXA 5J3WA 4KQQA 1K55A 3ZNTA 3VP1A 1G5UA 1ESIA 2ZC4B 2Y2GA 1XGIA 2XEPA 4G3VA 2V1AA 3I7JA 3C30A 4GNUA 5A93A 2ZQ8A 3IWQA 2DNSA 2BASA 2XFSA 4BWIA 2ACGA 1LL9A 4HBTA 5F69A 3IHAA 4NETA 3JVVA 4Y15A 4FH2A 2WGWB 3HL9A 3A3IA 1P9WA 3MR0A 4FTXA 2Y2MA 4HBUA 2ZOIA 4II7A 4RX3A 5GLCA 3R7WA 3C2WA 2G2WA 4R4SA 1MKMA 2K31A 5EE8A 3U2AA 4C3QA 3ITBA 3KYZA 4BBUA 2X71A 3LIFA 2XK1A 4YWZA 1T19A 4LPZA 4PPRA 3MQQA 5M1AA 1NY0A 4HH2A 4MBFA 3HUNA 2QHKA 4QY5A 5U47A 3PXPA 1VM1A 2Y2IA 3KSFA 5HWTA 2CC1A 3V50A 2OV5A 4ZJ1A 2HP9A 3MZDA 2NUPC 4S2MA 4MN5A 1XA7A 3MJQA 1BLSA 2EA9A 4OOMA 2PRFA 3BECA 1K57A 2QYBA 4Y5FA 3CUEC 3UNWA 5MC7A 3H7WB 4OP8A 3E98A 1I5QA 3EQVA 1WA9A 3CZDA 1K6RA 4BMWA 5LBRA 1UWNX 2ZQAA 4XUXA 1YM1A 2XA7S 5L07A 2ZM0A 5FATA 1KOUA 3LIAA 2XH9A 4ETXA 4JXVA 3DWZA 3T4SA 3BLMA 1HD8A 4PM9A 3PTEA 4IUHA 5DKLA 3UE3A 2JKTI 4AFIA 4CPKA 4WL9A 4HJ4A 1XJ3A 3KSIA 5KSHA 3BLSA 4O8GA 3L7HA 4BQMA 2PT7A 2A24A 1XGJA 4HIAA 1PWCA 3N8LA 1P97A 3EQUA 3C5AA 3UE1A 3A3JA 3ZGAB 4BLMA 1LSVA 3NDEA 1G68A 4JGPA 2V8FA 1IYPA 1S1YA 4K08A 3LIDA 4WEKA 5F5YA 4PM8A 1OT6A 4JLFA 3K2NA 3KO6A 1PIOA 1PW1A 1EW0A 1P9RA 5HD5A 3ZG9B 4NXBA 4K0XA 3FPVA 4IEDA 3VE4A 1KDWA 4X55A 1FSYA 1WE4A 2ZQ9A 4Y7PA 3BFGA 2VLGA 2BTFP 2HDRA 4Y0TA 4E3KA 4LRYC 1Y54A 5IT5A 5AVEA 3UN7A 3N8RA 3UDXA 3ZVWA 4GN2A 1DY6A 2JKGA 2OOLA 1IEMA 1YLPA 3D72A 4LV3A 4GDNA 4CLCC 1PWDA 1V9ZA 1CF0A 5CX7A 3HLDA 1W63M 2WAFA 5JYPA 1S1ZA 2QKPA 4ZAMA 1S0WA 3VSKA 4FOFA 1T1CA 4EEPA 2EFUA 3T12B 2JBFA 1L0FA 4QB8A 3VP0A 3UB7A 2DRWA 3P7NA 3MFDA 3BW6A 3G31A 3G6OA 5HL6A 1IKIA 1JTDA 5CEDA 2J3TC 3NC8A 3GTCA 2VEAA 4HH3A 4ZJ3A 3HLFA 2W3HA 4KZ3A 1ZG4A 3O86A 2QZ6A 3OPPA 4GZBA 3IF6C 4DXCA 1OTEA 3HJIA 4KG2A 5CTMA 1EWZA 1PI4A 4RVAA 3UMDA 3G32A 5J8XA 4KQDA 2PAVP 2PHYA 4QY6A 1HZOA 2WKEA 5TJJA 1D1JA 4L9GA 2D01A 2WGWA 3AGEA 1YLTA 4IBRA 1QMFA 3QP5A 4R0QA 3Q81A 1P0ZA 4HQAA 4Q8IA 5J4EA 3PBOA 4YINA 4DE0A 2VX8A 5CEBA 3MXSA 2HDQA 1SKOA 5CRFA 1YPRA 2H0TA 3N7WA 1KVMA 4O7DA 3R7WB 4I5SA 1HVBA 1F5MA 2JKTM 2O99A 3DAVA 4F3LB 1BUEA 1MY8A 3CHWP 4DKIA 3M2KA 4OOLA 1KE0A 3LUQA 3C7VA 5TGFA 3DTEA 2Y4AA 3H7WA 4I3JA 1K56A 3VSLA 3HUMA 4WZ4A 2CMNA 2JC7A 3HBRA 3BJNA 1YAXA 1H5XA 2I9VA 2ZC5B 3UE6A 5DVAA 1C3BA 2A3UA 4JXWA 4X53A 5HDCA 1PYYA 4OKPA 3OPRA 4DRTA 2J3WA 5E2FA 3BYDA 5E43A 1NWZA 4E6XA 1XKZA 1NRJA 1ERQA 3PAEA 4OPYA 4O0PA 2PBYA 3G35A 1FILA 3NCKA 3IBRA 4UA9A 3BM6A 2B18A 5HWVA 3ZCZA 1KDSA 4OP5A 1N9LA 4FCFA 1TEMA 1M6KA 1JWZA 3RTYA 1JWPA 3D3OA 4MN6A 2GZAA 3CMZA 4D2OA 4IVKA 4X6TA 3QNCA 4KZ4A 1DP8A 3U4LP 4YNRA 2GX5A 3H9WA 2DCFA 1LSXA 2V0UA 1GSWA 2P74A 2GJ3A 4S2KA 4MBKA 2XRNA 2Y2NA 1BLCA 4BD0A 2HJEA 4BBTA 4Y0UA 5FAQA 3BFFA 2VGLM 1IYSA 1ES5A 1Y4OA 4LRXC 2P04A 1S4RA 3C38A 5TBMA 5CHUA 1SZVA 4NKPA 4C75A 3ZG5A 5HW3A 1YMSA 1ACFA 1MKIA 5FAPA 2WKQA 1MWUA 3UDFA 3CPTA 5EM0A 4JXSA 4B88A 2VZWA 4R4RA 4S2JA 2UWXA 1XP4A 1ONGA 4CQHA 3NJAA 2H5SA 2B02A 3T1RA 1YLJA 4X1LA 3W4PA 4IUKA 4UQIM 3FYZA 2EWWA 3IXDA 4GOGA 4L9FA 1TDLA 3GMWA 5G4ZA 4S2LA 1ONHA 2XQZA 3C4PA 2KLIA 3PR6A 1FCMA 4M4XA 4IHQA 3CAXA 4GLQA 2QWSA 3G2YA 3LYXA 4HESA 2H0YA 4R1GA 3QP4A 3QHYA 3IWOA 3QNBA 2Y59A 1K0KA 3NULA 3EEAA 3CG5A 5L10A 3D4FA 1H0MA 2A49A 3LICA 3ISGA 2OWHA 3SS4A 1S66L 2W3GA 2XLNA 3B3XA 3N8SA 2J8YA 1FR1A 4KZ7A 4DE3A 4WZ5A 1N9NA 2V8CA 1HTZA 1OTAA 3BFDA 1FCNA 4PM6A 4S2OA 2V1BA 1OTDA 3F1OB 4EV4A 5GHXA 4X68A 4BL3A 1BYWA 4L0LA 1MWTA 3MQOA 4Q0IA 5FEFA 1EI5A 2VV6A 4OQHA 4OLGA 4B93A 3ZDJA 4CJNA 3LR0A 1SKOB 1ES2A 4K0WA 3LIEA 1BTLA 1LSWA 2B95A 3ZHHA 4DE1A 4F3LA 3DTMA 2PDRA 2Y2QA 5AQ9A 1VQQA 3NY4A 5A90A 1XX2A 4N9LA 4X56A 3E2LA 1KGFA 3FPWA 4NG2A 1X0OA 1MXOA 1QMEA 4JXGA 1VEUB 2PBDP 1Z09A 2K2NA 2FH5A 1L0EA 3FKWA 1GSVA 3O5YA 4X25A 3WS1A 4Q0HA 1K4FA 2W1RA 2XFTA 2L0WA 2VA0A 2QJ7A 5IS1A 1BSGA 1I2SA 3ZYTA 3T4OA 3K3DA 3E0YA 4WBGA 2H10A 2RL3A 1S67L 3MF0A 4B9OA 2M7UA 3WS0A 4QD4A 4YFMA 2H28A 4DMZA 4DJ3A 1FOFA 3UPOA 2G7UA 1D06A 4MBHA 1IOUA 1TD5A 2YKHA 4JGOA 3IHBA 4HY8A 4R6LA 3TOIA 2Q9NA 2LB5A 2VV8A 4GD8A 1TVFA 3KSHA 2JHEA 3M2JA 2WUQA 4P6ZM 1W7FA 5FEGA 2Y8HA 1GHIA 3LIBA 4LV1A 4HP4A 2C6WB 1SCWA 3GV9A 3H82B 3MZFA 3A3EA 2Z2MB 1YQSA 2ZOHA 2O9CA 4H6JB 1LL5A 2XDMA 3CJMA 1E25A 1SHVA 1J3WA 3VFFA 2Y91A 2J7VA 4GKUA 4QWOA 3IXHA 2EXAA 4OQIA 2W3FA 3CWFA 4IJGA 5IU1A 4EQ1A 3S22A 1W5DA 3VP3A 4DDSA 4R3JA 1YLYA 3EEHA 4U0XA 3VP2A 1DJAA 1RP5A 3JYIA 5FQKA 4MNRA 3QP2A 5TBMB 4XXRA
chains in the Genus database with same CATH topology
3U4LP 1YPRA 1VEUB 2PBDP 1Z09A 1K0KA 2JKGA 3NULA 3LEQA 5EM1A 1VETB 4X25A 1AWIA 2ACGA 1FIKA 1CF0A 4ESPA 3CPTB 4D60A 1PRQA 3DAVA 3D9YA 4X1MA 1F2KA 3CHWP 1PFLA 1Y4OA 3T12B 3L7HA 2ZL1B 1A0KA 4FTXA 1HLUP 1SZVA 1PNEA 2JKFA 1CQAA 2V8CA 1ACFA 3CPTA 5EM0A 2HZ5A 5FEFA 2V8FA 1VEUA 5FEGA 3T1RA 1CJFA 1VETA 1SKOB 4X1LA 2PAVP 1FILA 2PRFA 2B95A 1D1JA 3T1QB 3MSHA 1J3WA 3L9KA 3NECA 2E8JA 5EVEA 4QWOA 5FDSA 3T1SA 3LGOA 3T1XA 2ZL1A 3KYEA 2BTFP 3UB5P 3MS6A 5EV0A 1G5UA 1SKOA 2VK3A 4FUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4L P;  1YPR A;  1VEU B;  2PBD P;  1Z09 A;  1K0K A;  2JKG A;  3NUL A;  3LEQ A;  5EM1 A;  1VET B;  4X25 A;  1AWI A;  2ACG A;  1FIK A;  1CF0 A;  4ESP A;  3CPT B;  4D60 A;  1PRQ A;  3DAV A;  3D9Y A;  4X1M A;  1F2K A;  3CHW P;  1PFL A;  1Y4O A;  3T12 B;  3L7H A;  2ZL1 B;  1A0K A;  4FTX A;  1HLU P;  1SZV A;  1PNE A;  2JKF A;  1CQA A;  2V8C A;  1ACF A;  3CPT A;  5EM0 A;  2HZ5 A;  5FEF A;  2V8F A;  1VEU A;  5FEG A;  3T1R A;  1CJF A;  1VET A;  1SKO B;  4X1L A;  2PAV P;  1FIL A;  2PRF A;  2B95 A;  1D1J A;  3T1Q B;  3MSH A;  1J3W A;  3L9K A;  3NEC A;  2E8J A;  5EVE A;  4QWO A;  5FDS A;  3T1S A;  3LGO A;  3T1X A;  2ZL1 A;  3KYE A;  2BTF P;  3UB5 P;  3MS6 A;  5EV0 A;  1G5U A;  1SKO A;  2VK3 A;  4FUW A; 
#chains in the Genus database with same CATH topology
 1E4D A;  2VGL S;  3A0V A;  5EM1 A;  3BY9 A;  1UWP X;  3GEC A;  3MXQ A;  1RGY A;  1XFQ A;  2XD1 A;  3CPT B;  3SOI A;  3OZH A;  4XUZ A;  1J9M A;  4F94 A;  3MBZ A;  5FQQ A;  1PFL A;  1YLZ A;  2PD7 A;  3OPH A;  2P9V B;  5AVF A;  2ZL1 B;  2JKF A;  5CER A;  4EBP A;  1PZP A;  4ETZ A;  5DFY A;  4B4X A;  4A5R A;  5DTS A;  5GLB A;  1L3L A;  4E3M A;  1XA1 A;  1TS8 A;  5DTT A;  3BFC A;  4GHI B;  4EEU A;  4KG5 A;  2HZ5 A;  1LHY A;  3UE0 A;  5E2E A;  5BOH A;  5EOE A;  2RCX A;  3B47 A;  5FI2 A;  4PKY G;  1JTG A;  1PZO A;  2M7V A;  2WYX A;  3FV7 A;  5CTN A;  3JVU A;  3IF5 A;  3VOZ A;  5HPF A;  2O9A A;  1ERM A;  2HPB A;  2EX2 A;  3S7O A;  1Q2P A;  2R78 A;  2IA2 A;  2C5W B;  4LGW A;  1K25 A;  2ZQD A;  1NYY A;  5J7E A;  3NEC A;  4Y0O A;  3CIT A;  5FDH A;  5EVE A;  5DF8 A;  3GSG A;  5I94 A;  3N6I A;  2WKI A;  4S2N A;  2ZM8 A;  4JF5 A;  1SKF A;  4EUZ A;  4S2I A;  4EW7 A;  3ICY A;  4FH4 A;  4JGQ A;  3T50 A;  4KZ8 A;  3T4Q A;  5KZH A;  3BY8 A;  2O0Y A;  4RX2 A;  2YKF A;  2Y2H A;  5JYO A;  4FUW A;  3F1O A;  5FAO A;  3HLC A;  4P85 A;  5GHZ A;  5KIZ A;  3QP8 A;  3RXW A;  5FI6 A;  4EET B;  1IKG A;  4E6W A;  2KDK A;  4KEN B;  1T1A A;  2X02 A;  4ESP A;  3FZC A;  3ZG0 A;  1OT9 A;  2IWD A;  5CGW A;  2EFX A;  3G30 A;  4I3A A;  1XJ2 A;  4MEZ A;  5FQ9 A;  1G28 A;  4LV2 A;  1Y28 A;  5F1G A;  4HJ3 A;  1XJ4 A;  5HAR A;  5HSQ A;  4Z1W A;  5G4Y A;  4EES A;  4NXF A;  3G4P A;  1K54 A;  3EOI A;  3FG8 A;  1S6R A;  1ZG6 A;  2HP5 A;  3A3D A;  1MWS A;  4LEN A;  3OCN A;  5FI7 A;  4PKY A;  2WGI A;  2LB9 A;  4JPM A;  4WEJ A;  5K5B A;  1VEU A;  4BBV A;  1L2S A;  3VP4 A;  4E3L A;  3RH8 B;  1O7E A;  5E2G A;  4LCM A;  4I39 A;  1W8Y A;  1ES3 A;  2R9X A;  4R70 A;  3RXX A;  3MQ0 A;  4R38 A;  5DFX A;  2BG1 A;  2VGK A;  2E8I A;  3KYE A;  3GRJ A;  2WGV A;  5F1F A;  3LI8 A;  4BEN A;  2J80 A;  5DTK A;  4OOY A;  1W8Q A;  2P7J A;  3C8C A;  2FZ0 A;  5CGS A;  1V9Y A;  3UB9 A;  4EU0 A;  4RYE A;  2D02 A;  4ZTK A;  4GW9 A;  3AGD A;  1H8Z A;  3FKV A;  4LV0 A;  3VV4 A;  4GDB A;  4JKT A;  2HP6 A;  4ME4 A;  3P98 A;  4ID4 A;  1YMX A;  2A2L A;  3NHQ A;  3ZNY A;  3H82 A;  1IEL A;  1GSX A;  4PM5 A;  1I2W A;  2QPN A;  1T18 A;  4H6J A;  1YLW A;  4WMC D;  3A3F A;  1YSP A;  4PAU A;  1BUL A;  4P87 A;  4DF6 A;  2ZMA A;  3BEB A;  3PBQ A;  4Y2F A;  1E3U D;  5L8M A;  5HPI A;  4KZ6 A;  1OTB A;  4MCW A;  3RJU A;  1KE4 A;  3LCE A;  2HDU A;  3BFE A;  2EXB A;  3DTK A;  2I72 A;  1XJ6 A;  1H8Y A;  4MLL A;  2KX6 A;  3TRC A;  4WZ5 C;  5L09 A;  1ESU A;  3IQA A;  3NIA A;  1FCO A;  3S4X A;  4G3W A;  2W1T B;  5GLA A;  1BLP A;  3EGX C;  2VGJ A;  4OH0 A;  2W27 A;  5DF7 A;  3AGF A;  1GHM A;  2HV1 A;  1GA0 A;  3G34 A;  3UB8 A;  4PMA A;  2JKR I;  1AXB A;  5A92 A;  5KSC A;  3DWK A;  1ES4 A;  5FDS A;  3UO9 A;  1LI0 A;  2WKH A;  1XXM A;  2P9V A;  5HZH A;  1ERO A;  3WS5 A;  2ZL1 A;  3GDI A;  4EWF A;  4U0T A;  1G6A A;  4P6B A;  2NUT C;  5A8B A;  4P0M A;  4OPZ A;  2FFY A;  4BD1 A;  5EOO A;  1DP6 A;  4HHD A;  1KGG A;  2KOI A;  4GHI A;  1FQG A;  1VET B;  3LR5 A;  1DJC A;  1MBL A;  1SDE A;  3HVF A;  2ZMV A;  4OQ0 A;  5FL3 A;  3PHY A;  3Q7V B;  3TE8 A;  4N9K A;  2HDS A;  1N4O A;  2IWC A;  3T4J A;  2VKS A;  5EVI D;  2FFF B;  3NOU C;  3T4T A;  4EUV A;  1A0K A;  3SH7 A;  4U3T A;  4Y3I A;  4GD6 A;  4K91 A;  3NDG A;  3BWL A;  4OLD A;  1K4E A;  3UDI A;  5M19 A;  1W79 A;  2L1M A;  3CLO A;  4WUJ A;  2VJW A;  5CGX A;  3W4Q A;  2JN7 A;  2Z6D A;  4NEE D;  4GCZ A;  2W3E A;  3PYP A;  2Y2K A;  4KZB A;  3TJZ C;  4HJ6 A;  1CJF A;  4ZJ2 A;  4UAA A;  1MZU A;  1JVJ A;  4ARZ A;  3QP1 A;  4UA7 A;  3IWI A;  3HLB A;  4OON A;  4PM7 A;  5HDS A;  1BT5 A;  5EVI A;  1ZHH B;  1G6O A;  4WM9 A;  3A0S A;  3OOV A;  5DJT A;  3OCL A;  5FQM A;  2WKR A;  3V5M A;  4B4Z A;  1SDN A;  1CI8 A;  4E3O A;  4L9E A;  4QPR A;  4PHT A;  5M18 A;  1FR6 A;  4N92 A;  2GDN A;  1GHP A;  1K38 A;  3IH8 A;  3WS2 A;  2B5R A;  3HRE A;  2W3D A;  3IXB A;  4GS9 B;  1AWI A;  3MZE A;  5AJG A;  3W8K A;  3DTI A;  3MMH A;  4YOF A;  3VFH A;  3VMA A;  3S1Y A;  4Z9Q A;  3S7P A;  1NLZ A;  4KG6 A;  3NOT C;  2DMW A;  3SZT A;  5HAP A;  4E04 A;  2R9W A;  3A0R A;  2PYP A;  1XFN A;  3FC7 A;  3TG9 A;  5FQJ A;  1PNE A;  3IX8 A;  5GLD A;  4CLC B;  3LR4 A;  5CEC A;  1NZO A;  2ZC3 B;  4JBF A;  2PYR A;  4LLO B;  3WRZ A;  1GCE A;  3M6B A;  4I38 A;  3V3R A;  3N4I A;  1GA9 A;  5HAQ A;  2Z6C A;  2XR0 A;  4E3N A;  2Z2L B;  3ZG8 B;  2OLV A;  4RA7 A;  3P09 A;  5F83 A;  3E4Q A;  1UGU A;  3UB6 A;  5DKK A;  3PBS A;  2WZX A;  2JKR M;  5IHV A;  3IF6 B;  3DBA A;  3O88 A;  2Q9M A;  5EUA A;  1OJ5 A;  1OTI A;  1F9I A;  3T1X A;  3HCY A;  3UPN A;  1IYQ A;  3Q1F A;  1TDG A;  3IXG A;  4E3I A;  1ZC2 A;  3DW0 A;  2Y2J A;  4UHU A;  4QHC A;  3LEQ A;  4LCL A;  1L0G A;  4S2N C;  2J9O A;  2PU2 A;  1TS0 A;  5EFW A;  1O07 A;  4D60 A;  5GL9 A;  5GHY A;  2L4R A;  5AQ7 A;  3WRT A;  4KZ9 A;  1NZU A;  2UV0 E;  2W1T A;  1FSW A;  3G2Z A;  4HP9 A;  3K3C A;  3ZVT A;  5TR7 A;  1RCJ A;  3BRM A;  1CQA A;  3TSG A;  1ZKJ A;  2OWJ A;  4X69 A;  3OBF A;  3SH9 A;  1MC0 A;  3W4O A;  4WF0 A;  4XT2 A;  3E2K A;  1IYO A;  2MJ6 A;  2OAP 1;  1VHM A;  4LFU A;  3BQA A;  3NBL A;  3CUE A;  2Y2P A;  3WWX A;  1IFQ A;  3PBN A;  4KZA A;  1PI5 A;  5AQA A;  3F1N B;  1K54 C;  3GQZ A;  3EGD C;  1VET A;  1JWV A;  2EX6 A;  2PR5 A;  4KUK A;  5EVL A;  3Q07 A;  5F82 A;  3Q7V A;  3B42 A;  5F6A A;  2WK0 A;  1OME A;  4OPR A;  1H3Q A;  3HLE A;  5CXW A;  4UQI S;  1WYC A;  4WYY A;  3LO7 A;  3IS2 B;  3R4K A;  2WZZ A;  1MWR A;  1MPL A;  4Y13 A;  1LI9 A;  3HUO A;  3GVB A;  1DRM A;  4HOI A;  4OPQ A;  4ZRR A;  3HLW A;  5EV0 A;  2GNX A;  1DJB A;  3C4O A;  1LLB A;  2VK3 A;  3IBJ A;  2ZC7 A;  4JF6 A;  3E4P A;  3PBT A;  3O87 A;  3F1P B;  3OC2 A;  3SH8 A;  1TS7 A;  1FIK A;  3KX0 X;  1PRQ A;  1YSQ A;  2JCH A;  3D9Y A;  1ODV A;  3MKF A;  3UPP A;  1F2K A;  4HEF A;  5HD3 A;  5HWW A;  4NXE A;  3ZQ5 A;  3TW8 A;  1CEF A;  4QJG A;  4UEY A;  4CLC D;  5DJU A;  3M6H A;  4I3I A;  4ARZ B;  2V2F F;  3PBR A;  4UA6 A;  2Y2O A;  4IVI A;  4Q0J A;  1XPB A;  4M3K A;  5EVI B;  4NXG A;  2G2U A;  3SW1 A;  4ZBE A;  3LEZ A;  1ZTU A;  4WLA A;  2VV7 A;  4KZ5 A;  1K56 D;  1CK3 A;  2Y79 A;  2HF6 A;  2OAQ 1;  2PU4 A;  2V20 A;  3LR3 A;  3KSG A;  2X01 A;  2WKP A;  5FAS A;  2J3T D;  4FD8 A;  2XD5 A;  4GS9 A;  2AVX A;  3NOP C;  2ZBB A;  1DP9 A;  2QJ5 A;  1S4S A;  2ZJ9 A;  3RFB A;  5FQI A;  3MSH A;  1JNU A;  1LL8 A;  2IWB A;  4HNB A;  4BJP A;  4EXO A;  1NYM A;  2OSU A;  5TFQ A;  1STZ A;  1NRF A;  3T1S A;  1ALQ A;  2EX9 A;  3WS4 A;  3Q7Z A;  2XF3 A;  3IX4 A;  3S7N A;  4CLC A;  1YT4 A;  5HL1 A;  1TF1 A;  3ULF A;  3MS6 A;  4OQG A;  1K6S A;  5FSR A;  3V67 A;  3LY4 A;  1N9B A;  3LY3 A;  4EQI A;  4ZDX A;  3HLG A;  5L2F A;  1Q2Q A;  5G18 A;  1WYB A;  2BLS A;  2ZQ7 A;  2HGV A;  2OLU A;  2K7S A;  3ZG7 B;  2XA7 M;  2P08 A;  4LRZ E;  4GB7 A;  3MXR A;  4RQ9 A;  1VB6 A;  4X1M A;  4S2P A;  5DF9 A;  1Z6F A;  1T1B A;  4N1X A;  2PD8 A;  3QP6 A;  2Y55 A;  3OPL A;  4DJ2 A;  2W0N A;  4DXB A;  2PR6 A;  1OPX A;  1OJG A;  5HFO A;  3NI9 A;  2J9P A;  4WEL A;  3IF6 A;  3MFX A;  3MKE A;  3GR2 A;  2V1Z A;  3S7Q A;  4KQO A;  2XRO A;  1PWG A;  2EWV A;  5KMW A;  4DE2 A;  1U60 A;  4HI4 A;  3BQ8 A;  5HX9 A;  3EWK A;  2WAD A;  3O3V A;  4MMN A;  4EBN A;  3ITA A;  1TS6 A;  1N9O A;  3B33 A;  1NXY A;  3IX3 A;  4CLC E;  3UY6 A;  1CEG A;  4P6Z S;  2ZD8 A;  3OLO A;  5I5L A;  1BZA A;  1KGE A;  5EEC A;  4N1H A;  1KE3 A;  2A24 B;  5HAI A;  3E4O A;  4NK3 A;  1KVL A;  4MN7 A;  3C7U A;  2E8J A;  2V0W A;  2XGN A;  1K55 C;  4DDY A;  4MDZ A;  1L0D A;  3UB5 P;  5FA7 A;  5CHJ A;  4O01 A;  5CHM A;  5EVI C;  2Q0O A;  2HJ9 C;  2Y2L A;  1LT0 A;  4G3K A;  3JPU A;  4E3J A;  4WN5 A;  4H8R A;  5AQB A;  3HJK A;  2V9A A;  2WAE A;  5E2H A;  4XT2 B;  3LFV A;  1D7E A;  4WMC A;  2M1C A;  4JGR A;  4C6Y A;  4JF4 A;  4EBL A;  3LI9 A;  2JE5 A;  3UME A;  3F1N A;  5HDD A;  5C5K A;  3P01 A;  5F68 A;  1E3U A;  1RGZ A;  2EX8 A;  2ZC6 B;  3IH9 A;  4DN0 A;  1H8M A;  3SS3 A;  5EPH A;  4GJ4 A;  3VOL A;  4KQR A;  3T4K A;  1HLU P;  4R23 A;  3V39 A;  3FWL A;  1BLH A;  1W63 Q;  1NJ4 A;  2QMI A;  1CI9 A;  2INW A;  2ZMF A;  4KUO A;  2ZQC A;  3ZFZ A;  2ZLY A;  3KYQ A;  3IS2 A;  3V3S A;  3PAG A;  3VE3 A;  1F98 A;  1NLY A;  4EER A;  5A91 A;  3SS5 A;  4BL2 A;  3Q82 A;  1YKD A;  2O9B A;  3W2Z A;  4QU3 A;  3F1P A;  4FSF A;  1K57 C;  3CI6 A;  3IT9 A;  4R3B A;  4OVD A;  1M40 A;  4R3A A;  3VOY A;  3T4L A;  3T1Q B;  3L9K A;  1PW8 A;  2XSS A;  2ZM2 A;  3LGO A;  4Y17 A;  5D3O A;  4IBX A;  5J3W A;  4KQQ A;  1K55 A;  3ZNT A;  3VP1 A;  1G5U A;  1ESI A;  2ZC4 B;  2Y2G A;  1XGI A;  2XEP A;  4G3V A;  2V1A A;  3I7J A;  3C30 A;  4GNU A;  5A93 A;  2ZQ8 A;  3IWQ A;  2DNS A;  2BAS A;  2XFS A;  4BWI A;  2ACG A;  1LL9 A;  4HBT A;  5F69 A;  3IHA A;  4NET A;  3JVV A;  4Y15 A;  4FH2 A;  2WGW B;  3HL9 A;  3A3I A;  1P9W A;  3MR0 A;  4FTX A;  2Y2M A;  4HBU A;  2ZOI A;  4II7 A;  4RX3 A;  5GLC A;  3R7W A;  3C2W A;  2G2W A;  4R4S A;  1MKM A;  2K31 A;  5EE8 A;  3U2A A;  4C3Q A;  3ITB A;  3KYZ A;  4BBU A;  2X71 A;  3LIF A;  2XK1 A;  4YWZ A;  1T19 A;  4LPZ A;  4PPR A;  3MQQ A;  5M1A A;  1NY0 A;  4HH2 A;  4MBF A;  3HUN A;  2QHK A;  4QY5 A;  5U47 A;  3PXP A;  1VM1 A;  2Y2I A;  3KSF A;  5HWT A;  2CC1 A;  3V50 A;  2OV5 A;  4ZJ1 A;  2HP9 A;  3MZD A;  2NUP C;  4S2M A;  4MN5 A;  1XA7 A;  3MJQ A;  1BLS A;  2EA9 A;  4OOM A;  2PRF A;  3BEC A;  1K57 A;  2QYB A;  4Y5F A;  3CUE C;  3UNW A;  5MC7 A;  3H7W B;  4OP8 A;  3E98 A;  1I5Q A;  3EQV A;  1WA9 A;  3CZD A;  1K6R A;  4BMW A;  5LBR A;  1UWN X;  2ZQA A;  4XUX A;  1YM1 A;  2XA7 S;  5L07 A;  2ZM0 A;  5FAT A;  1KOU A;  3LIA A;  2XH9 A;  4ETX A;  4JXV A;  3DWZ A;  3T4S A;  3BLM A;  1HD8 A;  4PM9 A;  3PTE A;  4IUH A;  5DKL A;  3UE3 A;  2JKT I;  4AFI A;  4CPK A;  4WL9 A;  4HJ4 A;  1XJ3 A;  3KSI A;  5KSH A;  3BLS A;  4O8G A;  3L7H A;  4BQM A;  2PT7 A;  2A24 A;  1XGJ A;  4HIA A;  1PWC A;  3N8L A;  1P97 A;  3EQU A;  3C5A A;  3UE1 A;  3A3J A;  3ZGA B;  4BLM A;  1LSV A;  3NDE A;  1G68 A;  4JGP A;  2V8F A;  1IYP A;  1S1Y A;  4K08 A;  3LID A;  4WEK A;  5F5Y A;  4PM8 A;  1OT6 A;  4JLF A;  3K2N A;  3KO6 A;  1PIO A;  1PW1 A;  1EW0 A;  1P9R A;  5HD5 A;  3ZG9 B;  4NXB A;  4K0X A;  3FPV A;  4IED A;  3VE4 A;  1KDW A;  4X55 A;  1FSY A;  1WE4 A;  2ZQ9 A;  4Y7P A;  3BFG A;  2VLG A;  2BTF P;  2HDR A;  4Y0T A;  4E3K A;  4LRY C;  1Y54 A;  5IT5 A;  5AVE A;  3UN7 A;  3N8R A;  3UDX A;  3ZVW A;  4GN2 A;  1DY6 A;  2JKG A;  2OOL A;  1IEM A;  1YLP A;  3D72 A;  4LV3 A;  4GDN A;  4CLC C;  1PWD A;  1V9Z A;  1CF0 A;  5CX7 A;  3HLD A;  1W63 M;  2WAF A;  5JYP A;  1S1Z A;  2QKP A;  4ZAM A;  1S0W A;  3VSK A;  4FOF A;  1T1C A;  4EEP A;  2EFU A;  3T12 B;  2JBF A;  1L0F A;  4QB8 A;  3VP0 A;  3UB7 A;  2DRW A;  3P7N A;  3MFD A;  3BW6 A;  3G31 A;  3G6O A;  5HL6 A;  1IKI A;  1JTD A;  5CED A;  2J3T C;  3NC8 A;  3GTC A;  2VEA A;  4HH3 A;  4ZJ3 A;  3HLF A;  2W3H A;  4KZ3 A;  1ZG4 A;  3O86 A;  2QZ6 A;  3OPP A;  4GZB A;  3IF6 C;  4DXC A;  1OTE A;  3HJI A;  4KG2 A;  5CTM A;  1EWZ A;  1PI4 A;  4RVA A;  3UMD A;  3G32 A;  5J8X A;  4KQD A;  2PAV P;  2PHY A;  4QY6 A;  1HZO A;  2WKE A;  5TJJ A;  1D1J A;  4L9G A;  2D01 A;  2WGW A;  3AGE A;  1YLT A;  4IBR A;  1QMF A;  3QP5 A;  4R0Q A;  3Q81 A;  1P0Z A;  4HQA A;  4Q8I A;  5J4E A;  3PBO A;  4YIN A;  4DE0 A;  2VX8 A;  5CEB A;  3MXS A;  2HDQ A;  1SKO A;  5CRF A;  1YPR A;  2H0T A;  3N7W A;  1KVM A;  4O7D A;  3R7W B;  4I5S A;  1HVB A;  1F5M A;  2JKT M;  2O99 A;  3DAV A;  4F3L B;  1BUE A;  1MY8 A;  3CHW P;  4DKI A;  3M2K A;  4OOL A;  1KE0 A;  3LUQ A;  3C7V A;  5TGF A;  3DTE A;  2Y4A A;  3H7W A;  4I3J A;  1K56 A;  3VSL A;  3HUM A;  4WZ4 A;  2CMN A;  2JC7 A;  3HBR A;  3BJN A;  1YAX A;  1H5X A;  2I9V A;  2ZC5 B;  3UE6 A;  5DVA A;  1C3B A;  2A3U A;  4JXW A;  4X53 A;  5HDC A;  1PYY A;  4OKP A;  3OPR A;  4DRT A;  2J3W A;  5E2F A;  3BYD A;  5E43 A;  1NWZ A;  4E6X A;  1XKZ A;  1NRJ A;  1ERQ A;  3PAE A;  4OPY A;  4O0P A;  2PBY A;  3G35 A;  1FIL A;  3NCK A;  3IBR A;  4UA9 A;  3BM6 A;  2B18 A;  5HWV A;  3ZCZ A;  1KDS A;  4OP5 A;  1N9L A;  4FCF A;  1TEM A;  1M6K A;  1JWZ A;  3RTY A;  1JWP A;  3D3O A;  4MN6 A;  2GZA A;  3CMZ A;  4D2O A;  4IVK A;  4X6T A;  3QNC A;  4KZ4 A;  1DP8 A;  3U4L P;  4YNR A;  2GX5 A;  3H9W A;  2DCF A;  1LSX A;  2V0U A;  1GSW A;  2P74 A;  2GJ3 A;  4S2K A;  4MBK A;  2XRN A;  2Y2N A;  1BLC A;  4BD0 A;  2HJE A;  4BBT A;  4Y0U A;  5FAQ A;  3BFF A;  2VGL M;  1IYS A;  1ES5 A;  1Y4O A;  4LRX C;  2P04 A;  1S4R A;  3C38 A;  5TBM A;  5CHU A;  1SZV A;  4NKP A;  4C75 A;  3ZG5 A;  5HW3 A;  1YMS A;  1ACF A;  1MKI A;  5FAP A;  2WKQ A;  1MWU A;  3UDF A;  3CPT A;  5EM0 A;  4JXS A;  4B88 A;  2VZW A;  4R4R A;  4S2J A;  2UWX A;  1XP4 A;  1ONG A;  4CQH A;  3NJA A;  2H5S A;  2B02 A;  3T1R A;  1YLJ A;  4X1L A;  3W4P A;  4IUK A;  4UQI M;  3FYZ A;  2EWW A;  3IXD A;  4GOG A;  4L9F A;  1TDL A;  3GMW A;  5G4Z A;  4S2L A;  1ONH A;  2XQZ A;  3C4P A;  2KLI A;  3PR6 A;  1FCM A;  4M4X A;  4IHQ A;  3CAX A;  4GLQ A;  2QWS A;  3G2Y A;  3LYX A;  4HES A;  2H0Y A;  4R1G A;  3QP4 A;  3QHY A;  3IWO A;  3QNB A;  2Y59 A;  1K0K A;  3NUL A;  3EEA A;  3CG5 A;  5L10 A;  3D4F A;  1H0M A;  2A49 A;  3LIC A;  3ISG A;  2OWH A;  3SS4 A;  1S66 L;  2W3G A;  2XLN A;  3B3X A;  3N8S A;  2J8Y A;  1FR1 A;  4KZ7 A;  4DE3 A;  4WZ5 A;  1N9N A;  2V8C A;  1HTZ A;  1OTA A;  3BFD A;  1FCN A;  4PM6 A;  4S2O A;  2V1B A;  1OTD A;  3F1O B;  4EV4 A;  5GHX A;  4X68 A;  4BL3 A;  1BYW A;  4L0L A;  1MWT A;  3MQO A;  4Q0I A;  5FEF A;  1EI5 A;  2VV6 A;  4OQH A;  4OLG A;  4B93 A;  3ZDJ A;  4CJN A;  3LR0 A;  1SKO B;  1ES2 A;  4K0W A;  3LIE A;  1BTL A;  1LSW A;  2B95 A;  3ZHH A;  4DE1 A;  4F3L A;  3DTM A;  2PDR A;  2Y2Q A;  5AQ9 A;  1VQQ A;  3NY4 A;  5A90 A;  1XX2 A;  4N9L A;  4X56 A;  3E2L A;  1KGF A;  3FPW A;  4NG2 A;  1X0O A;  1MXO A;  1QME A;  4JXG A;  1VEU B;  2PBD P;  1Z09 A;  2K2N A;  2FH5 A;  1L0E A;  3FKW A;  1GSV A;  3O5Y A;  4X25 A;  3WS1 A;  4Q0H A;  1K4F A;  2W1R A;  2XFT A;  2L0W A;  2VA0 A;  2QJ7 A;  5IS1 A;  1BSG A;  1I2S A;  3ZYT A;  3T4O A;  3K3D A;  3E0Y A;  4WBG A;  2H10 A;  2RL3 A;  1S67 L;  3MF0 A;  4B9O A;  2M7U A;  3WS0 A;  4QD4 A;  4YFM A;  2H28 A;  4DMZ A;  4DJ3 A;  1FOF A;  3UPO A;  2G7U A;  1D06 A;  4MBH A;  1IOU A;  1TD5 A;  2YKH A;  4JGO A;  3IHB A;  4HY8 A;  4R6L A;  3TOI A;  2Q9N A;  2LB5 A;  2VV8 A;  4GD8 A;  1TVF A;  3KSH A;  2JHE A;  3M2J A;  2WUQ A;  4P6Z M;  1W7F A;  5FEG A;  2Y8H A;  1GHI A;  3LIB A;  4LV1 A;  4HP4 A;  2C6W B;  1SCW A;  3GV9 A;  3H82 B;  3MZF A;  3A3E A;  2Z2M B;  1YQS A;  2ZOH A;  2O9C A;  4H6J B;  1LL5 A;  2XDM A;  3CJM A;  1E25 A;  1SHV A;  1J3W A;  3VFF A;  2Y91 A;  2J7V A;  4GKU A;  4QWO A;  3IXH A;  2EXA A;  4OQI A;  2W3F A;  3CWF A;  4IJG A;  5IU1 A;  4EQ1 A;  3S22 A;  1W5D A;  3VP3 A;  4DDS A;  4R3J A;  1YLY A;  3EEH A;  4U0X A;  3VP2 A;  1DJA A;  1RP5 A;  3JYI A;  5FQK A;  4MNR A;  3QP2 A;  5TBM B;  4XXR A; 
#chains in the Genus database with same CATH homology
 3U4L P;  1YPR A;  1VEU B;  2PBD P;  1Z09 A;  1K0K A;  2JKG A;  3NUL A;  3LEQ A;  5EM1 A;  1VET B;  4X25 A;  1AWI A;  2ACG A;  1FIK A;  1CF0 A;  4ESP A;  3CPT B;  4D60 A;  1PRQ A;  3DAV A;  3D9Y A;  4X1M A;  1F2K A;  3CHW P;  1PFL A;  1Y4O A;  3T12 B;  3L7H A;  2ZL1 B;  1A0K A;  4FTX A;  1HLU P;  1SZV A;  1PNE A;  2JKF A;  1CQA A;  2V8C A;  1ACF A;  3CPT A;  5EM0 A;  2HZ5 A;  5FEF A;  2V8F A;  1VEU A;  5FEG A;  3T1R A;  1CJF A;  1VET A;  1SKO B;  4X1L A;  2PAV P;  1FIL A;  2PRF A;  2B95 A;  1D1J A;  3T1Q B;  3MSH A;  1J3W A;  3L9K A;  3NEC A;  2E8J A;  5EVE A;  4QWO A;  5FDS A;  3T1S A;  3LGO A;  3T1X A;  2ZL1 A;  3KYE A;  2BTF P;  3UB5 P;  3MS6 A;  5EV0 A;  1G5U A;  1SKO A;  2VK3 A;  4FUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...