5EVIA

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
356
structure length
350
Chain Sequence
AALDTLVQTEARKVMQENNITGLSIAITRHGQQFYNYGVASATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFKAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDQTLYAQGYNTLDEPVRVNPGILAAEAYGVKSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVKLAYRILQHAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 100
structure length 350
sequence length 356
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviA00
2H0TA 3N7WA 4RX3A 2WKIA 2PBYA 3G34A 3V3RA 2Y2HA 4LV3A 3N8LA 3MFDA 3S4XA 4GOGA 5A91A 3E2LA 1K57A 2IWCA 5F1GA 3O87A 2Q9MA 1KE4A 3Q82A 5FQJA 5EE8A 2WKHA 2XF3A 4JBFA 5CGSA 5A93A 5E43A 2HDQA 5A90A 1LL9A 5HW3A 2Y59A 3CMZA 1KDSA 4PMAA 3VP0A 4JF6A 3DWZA 4IVIA 3NDEA 1NYMA 3Q1FA 1VM1A 2E8IA 4E3KA 3IXGA 1ES4A 2EFXA 4H8RA 2XDMA 1NY0A 3CG5A 1TVFA 4N92A 2OV5A 4E3MA 2J8YA 1G6AA 3C4OA 4PM8A 1KGGA 1E4DA 3MXRA 4KZAA 1W79A 4MBFA 1BZAA 2ZC3B 1RGZA 3A3EA 4N9KA 4JLFA 1CEGA 3OCNA 4DE0A 4IBRA 4WM9A 1PW1A 5HAIA 2OSUA 4KG2A 1YMXA 2OLUA 3PBOA 4KQRA 4JXVA 4E3LA 3Q7ZA 3DTMA 2ZM2A 4KZ9A 4DE1A 2VGJA 2Z2LB 4YFMA 3OCLA 3RXWA 5HAPA 1ES3A 2HDRA 1IEMA 2ZC4B 1XXMA 5CRFA 1FCOA 1GHMA 2FFFB 5AQAA 4DKIA 2HPBA 5DF9A 4GDBA 5EVIC 3I7JA 2Q9NA 5HARA 3W4PA 2WKEA 1H8ZA 2ZM0A 3HUOA 4PM9A 1DJAA 3EQUA 4UA7A 3SH7A 3W8KA 3UN7A 3ISGA 1XP4A 2P9VB 5CXWA 1DY6A 5IHVA 3WS4A 3GR2A 2G2WA 3HUMA 3W4QA 2Y2KA 1NRFA 5FI7A 4ZJ1A 3BEBA 4MBHA 5A92A 4DDSA 5CTNA 4FH4A 4L0LA 4WZ5C 4Y0UA 4XUZA 1XA7A 3ITAA 3NIAA 1L0FA 5FQMA 3BECA 2V20A 3VOZA 4DE2A 4KQOA 3FV7A 1CI9A 4OOYA 5E2FA 3VFFA 4CJNA 5F82A 3BRMA 4FD8A 2PU2A 3G35A 3IWOA 4OLGA 1TDLA 3OPPA 1K6SA 3PBTA 3C4PA 4BL3A 1K4FA 1SHVA 3IF5A 4JF4A 5FQQA 2JE5A 5FQ9A 4UA6A 4BD0A 1BSGA 5GHXA 3IH8A 1E25A 5TFQA 1YLZA 1K38A 3WS0A 3BFDA 2ZMAA 3C7UA 4X56A 4M3KA 2XD5A 4PM6A 4WBGA 1YLWA 5FAOA 4RX2A 4Y7PA 3A3IA 4OP5A 4B4XA 3IQAA 1HTZA 2GDNA 3BYDA 2ZD8A 5EVIA 4EBNA 4LV0A 3IXDA 3NC8A 3LY4A 4HESA 2Y2OA 4N1XA 3VP2A 3WRTA 3AGDA 3QHYA 3SS5A 4B88A 5HAQA 2J7VA 5HX9A 3G31A 3IXBA 4OH0A 2Y2JA 1YM1A 4DRTA 1CI8A 4E3OA 5CEBA 3QNBA 1ZG6A 3NI9A 4RA7A 5CERA 5HL1A 4X69A 5GHZA 1TDGA 3MZFA 5G18A 3SH8A 4ZJ3A 2QPNA 3IHAA 1MXOA 4KENB 1QMEA 4IVKA 3VSKA 2C6WB 4E3JA 5KSCA 1PI5A 4C3QA 1WE4A 3BFGA 2IWBA 3ITBA 2RL3A 4OONA 2R9WA 4S2IA 3FKWA 2ZC6B 4KZ6A 4LENA 3ZG7B 2Y2QA 3WS1A 4K0XA 1HD8A 2WUQA 1K56A 2WZZA 1K55C 1KVMA 2R9XA 1BLCA 2IWDA 3MZDA 4QY5A 1XX2A 5F1FA 2EX2A 1IYPA 4R3BA 4NK3A 4CPKA 5FI6A 4KZ7A 4UA9A 1LLBA 3MXSA 4E3IA 4OPZA 1BULA 4N9LA 2OLVA 4K0WA 1MWSA 1YMSA 3S1YA 3HUNA 3HVFA 1U60A 2V2FF 1HZOA 1GA0A 1MBLA 2ZM8A 4JXSA 1XGJA 3LEZA 4OQIA 1IKIA 3MKFA 3DW0A 4P0MA 5DF7A 5FQIA 1EROA 1W7FA 3G2YA 5DTSA 1FCNA 4S2PA 5CGXA 5TR7A 4R3JA 4KZ5A 1Q2QA 5E2GA 2ZJ9A 5FAPA 4PM5A 4KZBA 4E6WA 3TOIA 4GD8A 2JCHA 1GCEA 4GKUA 3A3DA 1ESIA 1W5DA 1XGIA 2G2UA 3G30A 3HLGA 3UE1A 1HVBA 3O86A 4WZ4A 4ZBEA 5EUAA 1GHIA 3DWKA 1ZC2A 2EXBA 1SKFA 4JXWA 1RP5A 3UNWA 2XGNA 5HFOA 1ZG4A 3WRZA 3GV9A 1W8QA 3M6BA 2FFYA 1EWZA 3OZHA 4S2OA 1PWDA 4X55A 2ZC7A 5M19A 1SDEA 3BFFA 3IF6A 3VOYA 1K55A 3QNCA 3JYIA 2H10A 2XQZA 4Y0TA 2Z2MB 3IWQA 3PAGA 4UHUA 4FH2A 3V39A 4EWFA 4WMCA 4HBUA 1IYQA 3V5MA 4S2JA 4BJPA 3PBSA 5CHJA 3M2JA 1I2WA 1KGEA 4NETA 3RXXA 5EVID 3OC2A 5DTKA 4OOMA 3ZG5A 2ZC5B 5FATA 3LCEA 3TG9A 3PTEA 2J9OA 1CEFA 1PYYA 3NBLA 1YT4A 4MEZA 4OOLA 5EVIB 2P74A 4OP8A 4JXGA 2XLNA 5CGWA 1KE0A 3A3FA 4KZ3A 4R4SA 5EECA 3IXHA 3GTCA 5CECA 1FQGA 1JWZA 4OLDA 3VP3A 4EBLA 5KMWA 1I2SA 4RVAA 4UAAA 1Y54A 4R23A 3V50A 1LI9A 1Q2PA 4B4ZA 4ZDXA 1PZPA 1MWRA 3UDFA 1ERQA 1NXYA 1EI5A 3Q7VA 1MWUA 2X01A 3SOIA 4X6TA 3VFHA 5CTMA 1K56D 1PZOA 4KG5A 4LCLA 1BTLA 3ZG8B 1PIOA 1L0DA 3WS5A 4BD1A 3C7VA 4JPMA 3CZDA 3ZGAB 1BT5A 1GHPA 1KDWA 1OMEA 4DE3A 3AGEA 3TSGA 4K91A 4QY6A 1ESUA 4LV1A 4P87A 2H5SA 5CEDA 2HP5A 4QJGA 1MY8A 2EXAA 3UE3A 3ZHHA 1JWVA 3BLMA 4KG6A 2RCXA 4OQ0A 3ZCZA 3ZDJA 2WGWA 5CHUA 1YLYA 2CC1A 3M6HA 4BLMA 5FAQA 4GDNA 4IBXA 1JTDA 4Z9QA 1GA9A 5F83A 1E3UA 3ZNTA 2Y2LA 2XFSA 4XXRA 5FASA 5TGFA 1ZKJA 3FWLA 3BFCA 3NY4A 1K6RA 5FDHA 3IHBA 3GVBA 1H8YA 1K54C 4ZJ2A 3VP4A 4D2OA 4E3NA 4S2NA 5EOEA 4GB7A 1YLJA 4WEJA 4JF5A 5GL9A 4MBKA 4C6YA 2A49A 1BLSA 2HDSA 3HLBA 3N4IA 1PI4A 1JWPA 4S2MA 1FCMA 2H0YA 5AQ9A 3IF6C 3ZVTA 1RGYA 3CJMA 4DF6A 2DRWA 2WADA 3OPLA 5EPHA 4F94A 3IH9A 5M1AA 1PW8A 4WELA 2Y2GA 4DDYA 2HP9A 4OPYA 4A5RA 3PBNA 3MZEA 4WMCD 5FSRA 4QB8A 3HREA 3IF6B 4LCMA 4GN2A 3S22A 5DTTA 2ZQ7A 2ZQDA 5AQBA 5M18A 4XUXA 5GLDA 3FYZA 3MKEA 4QHCA 4OPRA 4PM7A 4EBPA 1IYOA 4R1GA 4RYEA 1NYYA 1L2SA 2V1ZA 3IWIA 3VP1A 1XPBA 3HBRA 5FA7A 5E2EA 4MLLA 1O07A 3M2KA 2WZXA 2Y55A 4KZ4A 4WYYA 1AXBA 2ZQ8A 2JC7A 3GSGA 4U3TA 3ZG9B 1MWTA 1XKZA 3UY6A 3ZVWA 4Y0OA 1KGFA 3C5AA 1K54A 2XEPA 1ES5A 3LY3A 3Q81A 5BOHA 3UDIA 2XR0A 1SDNA 1S0WA 4BENA 5GLAA 5E2HA 3UPNA 4OVDA 3V3SA 4X53A 1IYSA 1I5QA 1FSYA 3N8SA 3Q7VB 1NJ4A 3PBQA 3N8RA 1N4OA 1TEMA 2BG1A 3NDGA 3BM6A 1SCWA 3ZNYA 1LL5A 3OPRA 3PAEA 2XFTA 1O7EA 4GNUA 4P85A 4KQQA 1VQQA 4Q8IA 1JTGA 3HLWA 3G4PA 3GMWA 4S2LA 1MPLA 1M40A 4QD4A 1ALQA 4EUZA 1K25A 3HLFA 2WK0A 1K4EA 1J9MA 1E3UD 2QMIA 2X71A 3FZCA 1RCJA 2WGWB 2ZQCA 3SS3A 3A3JA 5FI2A 4BQMA 2DCFA 4X68A 2HDUA 4R0QA 3VSLA 1YLPA 1BLHA 1PWCA 5FQKA 4E6XA 2XD1A 5D3OA 4OPQA 4WEKA 4S2NC 1M6KA 2BLSA 1FR1A 3W4OA 2WGIA 4FCFA 1FOFA 4JKTA 4C75A 5GLBA 4EQIA 4MNRA 2J9PA 4U0XA 2ZLYA 3UPPA 3HLEA 2DNSA 4GD6A 4HBTA 4DXBA 1KE3A 2VGKA 3D4FA 3WS2A 4ZAMA 2HP6A 1IKGA 2Y2MA 5I94A 3Q07A 3B3XA 3O88A 1YQSA 2Y2NA 1DJCA 1LHYA 4S2KA 5U47A 4YINA 1CK3A 3G2ZA 4P6BA 3P98A 1L0EA 1S6RA 3AGFA 5DF8A 3OPHA 2EFUA 2EX8A 1C3BA 1N9BA 4R4RA 3GRJA 3SH9A 4N1HA 5L2FA 3G32A 2ZQ9A 1IELA 3RJUA 2B5RA 3UO9A 1XA1A 2EX9A 3EQVA 3LO7A 3IT9A 1H5XA 2Y91A 5JYPA 5GHYA 1K57C 1ERMA 4OQGA 4BL2A 1QMFA 2EX6A 3BFEA 3VMAA 3ZFZA 1Z6FA 2X02A 2JBFA 4IEDA 3N6IA 5AQ7A 5EVLA 5J8XA 2WGVA 2Y2IA 5CHMA 3BLSA 4ID4A 4OQHA 4GZBA 1G68A 3UE0A 1PWGA 3HLCA 5KZHA 2ZQAA 3UPOA 2Y4AA 1ES2A 3E2KA 4KZ8A 4OKPA 3UDXA 4U0TA 1FR6A 3NCKA 1ONGA 3SS4A 5GLCA 1WYCA 2P9VA 5KSHA 1BLPA 2A3UA 5EOOA 1DJBA 4QU3A 4HEFA 3FKVA 4DXCA 3P09A 4LV2A 1MKIA 1LI0A 1NZUA 2XH9A 3ZG0A 2WAEA 1JVJA 1NZOA 2C5WB 4EV4A 3WWXA 4ZTKA 5JYOA 3HL9A 3MBZA 2I72A 1WYBA 2XK1A 1BUEA 1YLTA 3HLDA 4FSFA 1ONHA 4PPRA 3O3VA 5DVAA 1L0GA 1FSWA 1W8YA 2WYXA 2QZ6A 2WAFA 3GQZA 2Y2PA 3PBRA 2PU4A 4WZ5A 2UWXA 4O7DA 1KVLA
chains in the Genus database with same CATH superfamily
3N7WA 4E04A 2WKIA 2PBYA 3G34A 4LFUA 3F1OB 2PRFA 1K57A 2IWCA 5F1GA 3O87A 5F69A 4JBFA 5A93A 1F2KA 2Y59A 1MKMA 5FL3A 2KLIA 4JF6A 3DWZA 5A8BA 1LSVA 3IXGA 2EFXA 1TVFA 2OV5A 1KGGA 4MBFA 4KZAA 2P08A 3UMEA 1BZAA 1RGZA 3BJNA 3LGOA 4N9KA 4XT2B 1ODVA 4WF0A 4DE0A 4IBRA 4KQRA 4E3LA 3EGDC 2Z2LB 3QP8A 3H9WA 5HAPA 3LR5A 3VV4A 5CRFA 2FFFB 5HWVA 2XRNA 3KSHA 2HPBA 1V9ZA 4GDBA 5EVIC 2WKEA 3HUOA 2ZM0A 3SH7A 3W8KA 4ZRRA 5CXWA 3GR2A 2Y2KA 5FI7A 1KOUA 1DRMA 5CTNA 3L7HA 4XUZA 3ITAA 3NIAA 3BECA 3VOZA 4FUWA 4KQOA 1CI9A 4OOYA 5E2FA 4FD8A 2PU2A 3JVVA 1K6SA 3PBTA 3RH8B 2OWJA 2VV6A 3E4PA 5TFQA 2ZL1B 3IX4A 4IHQA 1LT0A 2ZMAA 4Y7PA 3A3IA 2GDNA 4LV0A 4MMNA 4HESA 2Y2OA 3VP2A 4HIAA 3QHYA 4YNRA 3T1RA 2GZAA 2Y2JA 4DRTA 1ZG6A 4RA7A 5HL1A 5GHZA 4EUVA 5G18A 2BTFP 4IVKA 2C6WB 4C3QA 3BFGA 3ITBA 2D01A 4S2IA 1WA9A 4O0PA 3SZTA 4LENA 4KZ6A 4F3LB 3ZG7B 3ZQ5A 2Y2QA 4H6JB 1KVMA 2IWDA 2R9XA 3LR3A 5DKKA 3BWLA 4CPKA 5HWTA 3MXSA 4E3IA 1SZVA 4G3KA 3HVFA 2J3TC 4HNBA 1HZOA 2VGLM 3DTIA 3LEZA 3T4KA 3F1NB 5DF7A 3DW0A 3H82A 4P0MA 1L3LA 4O8GA 4R3JA 2W0NA 2ZJ9A 4PAUA 1W63Q 3TOIA 2JCHA 4GKUA 3H7WA 2G2UA 3UE1A 3HLGA 4B93A 4WZ4A 3K3CA 3K2NA 3UNWA 3WRZA 1VETA 3UB9A 3OZHA 1PWDA 3BFFA 3VOYA 1G28A 1K55A 3JYIA 4Y0TA 4UEYA 3PAGA 3S7QA 1D7EA 4D60A 3RXXA 3OC2A 5DTKA 3NULA 2J9OA 2UV0E 4MEZA 5EVIB 4GS9B 2W3FA 2XLNA 4Y2FA 1KE0A 4KZ3A 3GTCA 4OLDA 4R3AA 3NJAA 4UAAA 3R7WA 3JPUA 4R23A 3V50A 4ZDXA 2LB5A 3P7NA 3UDFA 3Q7VA 2CMNA 3LR0A 3CHWP 1K56D 3T50A 4LCLA 2B95A 4Y15A 3C7VA 3IBRA 3CZDA 3ZGAB 1KDWA 5CEDA 4G3VA 2OOLA 4GW9A 1MY8A 2EXAA 3UE3A 3BLMA 5DFYA 3ZCZA 5CHUA 1EW0A 3NOUC 2YKHA 5F83A 4Z9QA 3ZNTA 2XFSA 4HHDA 3U2AA 5FEGA 3DAVA 1TS7A 3QP6A 4ZJ2A 3VP4A 4E3NA 5GL9A 4MBKA 2A49A 1BLSA 3N4IA 1JWPA 1FCMA 2H0YA 5AQ9A 3T1XA 5EPHA 1JNUA 4DJ2A 3LFVA 3IH9A 2W27A 1S1ZA 3IF6B 3U4LP 4LCMA 2ZQ7A 1Y28A 5AQBA 5GLDA 1CJFA 4PM7A 1YKDA 3MQ0A 4EEPA 2V1ZA 3IWIA 2KDKA 5FA7A 2Y55A 3E4OA 4KZ4A 4Y13A 1AXBA 2JC7A 1MWTA 3UY6A 4EXOA 4QWOA 4Y0OA 2VV7A 3S7NA 1ES5A 5BOHA 4BENA 1YSPA 4IJGA 3E98A 3ZNYA 4RQ9A 1O7EA 4P85A 1JTGA 1MPLA 1K25A 2W1RA 2QMIA 2X71A 3SS3A 5FI2A 4X68A 4R0QA 1YSQA 3VSLA 1P97A 5D3OA 4OPQA 3O5YA 4FCFA 1FOFA 4C75A 3DBAA 4CLCD 3PXPA 4YWZA 2PAVP 2VZWA 4GD6A 4DXBA 1KE3A 2Y2MA 3B47A 1UWPX 3O88A 4FTXA 2Y2NA 4XT2A 1CK3A 1L0EA 1NWZA 2EX8A 3GRJA 5L2FA 2B5RA 3LO7A 5JYPA 1QMFA 4DJ3A 2V0WA 2WGVA 5CHMA 2Y2IA 4OQHA 4GZBA 1G68A 5FEFA 3UPOA 1FR6A 3NCKA 2PD8A 5GLCA 1BLPA 4O01A 1DJBA 4DXCA 3FKVA 1VEUB 2L4RA 2WAEA 4EV4A 5JYOA 3MBZA 2XK1A 4WUJA 1YLTA 3HLDA 1ONHA 1FSWA 4Y17A 2O9CA 2PU4A 2UWXA 1KVLA 5EM1A 3B42A 2Y2HA 3CUEA 4LV3A 3IX8A 3N8LA 3S4XA 2KX6A 3E2LA 2ZL1A 3MFXA 2R78A 2NUPC 3B33A 5EE8A 2XF3A 1G5UA 3LIAA 3DTKA 5E43A 5LBRA 1LL9A 4P6ZM 4PMAA 1A0KA 2AVXA 4IVIA 3SW1A 4HH2A 2G7UA 2E8IA 1SKOB 4E3KA 3QP5A 4N92A 2K2NA 4E3MA 1G6AA 4PM8A 3D72A 1OJ5A 3MXRA 4F3LA 1PW1A 4KG2A 4H6JA 4JXVA 2HF6A 3Q7ZA 3DTMA 4DE1A 3TE8A 3FPWA 2HDRA 1XXMA 1GHMA 5AQAA 4L9FA 3F1NA 1PNEA 2Q9NA 5HARA 1XFNA 3W4PA 4PM9A 1DJAA 4UA7A 3UN7A 1DY6A 2EWWA 3HUMA 3W4QA 1NRFA 3UB5P 4I3IA 4EEUA 1XA7A 2QYBA 5EM0A 3FV7A 3VFFA 5F82A 5IU1A 3CUEC 2V1BA 3IWOA 1TDLA 3UB7A 3IF5A 5FQQA 1T1BA 3TW8A 4UA6A 2V8CA 5GHXA 3JVUA 4Y3IA 1DP9A 2W3DA 2PHYA 1F9IA 4RX2A 3IQAA 3KSGA 5EVIA 4GS9A 3IXDA 3LY4A 4N1XA 1D06A 5HAQA 2J7VA 3K3DA 1CI8A 5CEBA 2P04A 1TDGA 3MZFA 1OTAA 1FIKA 2A24B 2QPNA 1MXOA 1WE4A 2RL3A 2R9WA 1S4SA 1DP8A 1UGUA 3D9YA 2JKGA 4K0XA 1HD8A 3MZDA 1XX2A 3C30A 4R3BA 4KZ7A 5FDSA 4OPZA 2Q0OA 2OLVA 1NLYA 3HUNA 1U60A 2V2FF 3E4QA 4BBVA 1XGJA 4LRZE 5FQIA 3CPTB 2QKPA 1W7FA 3C38A 3G2YA 3MXQA 4BBTA 1FCNA 5CGXA 2W3HA 2H28A 1CF0A 5E2GA 1XJ2A 3CAXA 1PFLA 1W5DA 1GSXA 3O86A 3OLOA 5EUAA 2K7SA 2QJ7A 5HFOA 1ZG4A 3CI6A 5M19A 1T19A 3C8CA 3IF6A 1Z09A 1S66L 4WMCA 4S2JA 4BJPA 2JN7A 3T1QB 4NETA 3CLOA 5FATA 3LCEA 3TG9A 1CEFA 2J80A 1NRJA 1YT4A 4OP8A 1XJ3A 4JXGA 5CGWA 4R4SA 5EECA 1FQGA 1OTDA 1JWZA 3OBFA 5AVFA 1LI9A 3GECA 4I5SA 1ERQA 5EV0A 2W1TB 4L9EA 4CLCB 5L09A 1EI5A 2X01A 3SOIA 2E8JA 4KG5A 3OOVA 1BTLA 2K31A 3ZG8B 3WS5A 4BD1A 4JPMA 5AJGA 1BT5A 1GHPA 4K91A 2PYRA 2H5SA 3ZHHA 2RCXA 3CWFA 4OQ0A 2VEAA 3ZDJA 1NLZA 1YLYA 2CC1A 1JTDA 1LL8A 1GA9A 4XXRA 3NY4A 5HPIA 4IUHA 1K6RA 5FDHA 4ESPA 1OTBA 4M4XA 2QJ5A 1K54C 4D2OA 4JGQA 4GB7A 4JF5A 3HLBA 1PI4A 4S2MA 3ZVTA 3IF6C 2DRWA 3FC7A 4F94A 2M1CA 1PW8A 2HJ9C 2HP9A 4A5RA 3PBNA 4LLOB 5FSRA 4QB8A 3ZYTA 4QHCA 4MDZA 4EBPA 1OTEA 2ZMFA 3W2ZA 4DN0A 5HDCA 5E2EA 4HJ6A 1H3QA 3KYZA 2WZXA 2FH5A 4U3TA 5HWWA 1VEUA 1KGFA 2XEPA 3LY3A 3UDIA 2XR0A 1SDNA 1TF1A 3UPNA 1MC0A 3N8SA 2D02A 1NJ4A 3N8RA 1N4OA 3NDGA 3CITA 4PHTA 4G3WA 4Q0IA 4Q8IA 3LIFA 4S2LA 2O9AA 3FG8A 4Y5FA 4QD4A 4HI4A 5K5BA 1J9MA 3FZCA 1YAXA 3A3JA 2HDUA 4R6LA 2VX8A 5EVEA 2NUTC 4UQIS 2Z6DA 1BLHA 4E6XA 2P7JA 1SKOA 1S1YA 3UPPA 3R4KA 3T4TA 4B9OA 3T4QA 3D4FA 5I94A 4LRXC 1YQSA 1T1AA 5U47A 4S2KA 4YINA 4P6BA 2WKRA 4R70A 1S6RA 3AGFA 3OPHA 4NEED 3HJKA 3E0YA 3SH9A 4N1HA 3UO9A 2EX9A 2Y91A 1ERMA 4IEDA 5EVLA 5AQ7A 1ZHHB 2PD7A 4PKYG 3ULFA 3IS2B 2A3UA 5HPFA 3P09A 3KSIA 1MKIA 1LI0A 2M7VA 2XH9A 1XFQA 3EWKA 2C5WB 4ZTKA 2I72A 2YKFA 5DVAA 4PPRA 3RTYA 2QZ6A 3GQZA 2Y2PA 4WZ5A 1UWNX 5IHVA 2H0TA 2XA7S 4HJ3A 3V3RA 3IX3A 3MFDA 4GOGA 5A91A 2VLGA 5F6AA 3Q82A 5FQJA 3P01A 4ME4A 2HDQA 4AFIA 3UE6A 3CMZA 3T12B 3VE3A 3NOPC 1NYMA 1VM1A 3A0RA 1ES4A 2XDMA 1T1CA 2A24A 2J8YA 3C4OA 4GCZA 1E4DA 4NXEA 2ZC3B 3F1OA 3A3EA 1CEGA 4WM9A 5HAIA 4LPZA 3T1SA 1TS0A 4CLCE 3ICYA 2ZC4B 1FCOA 3EEAA 5TJJA 4DKIA 5MC7A 5DF9A 3CPTA 4I38A 4GHIB 1H8ZA 3ISGA 2P9VB 2VA0A 4II7A 4ZJ1A 3BEBA 5A92A 4LGWA 4FH4A 4WZ5C 4Y0UA 5FQMA 4KUOA 4CJNA 3BRMA 3G35A 2XSSA 4OLGA 3OPPA 1K4FA 1SHVA 5F68A 2JE5A 4ARZB 2PDRA 4BD0A 1BSGA 3UB8A 1YLZA 3BFDA 3C7UA 1TS6A 4M3KA 1YLWA 5FAOA 3LIEA 3BYDA 2ZD8A 3MMHA 5G4ZA 4EBNA 3NC8A 3WRTA 3MS6A 4EESA 3G31A 4OH0A 5G4YA 1YM1A 3NI9A 1D1JA 4X69A 4HP9A 3LIBA 3SH8A 3T4SA 4KENB 2W1TA 4CLCA 5KSCA 1PI5A 4R38A 3FKWA 3UMDA 2HZ5A 3H7WB 3WS1A 1CQAA 2QWSA 3VE4A 5F1FA 2EX2A 1XJ4A 5FI6A 1LLBA 3PR6A 1BULA 4K0WA 1YMSA 3S1YA 4WN5A 4OQIA 3MKFA 1EROA 5DTSA 4S2PA 4WL9A 5TR7A 5FAPA 3F1PB 3MQQA 3T4JA 4E6WA 3NHQA 3HJIA 3G30A 1HVBA 4ZBEA 5HSQA 2V9AA 4JXWA 1RP5A 5J7EA 3M6BA 2FFYA 1EWZA 4I3AA 4S2OA 4X55A 2ZC7A 3MQOA 1V9YA 3QNCA 2H10A 2XQZA 4YOFA 3V39A 4FH2A 4EQ1A 3PBSA 5CHJA 5CX7A 5EVID 4OOMA 4I3JA 1PYYA 3NBLA 2IA2A 3D3OA 1H0MA 3A3FA 3IXHA 1X0OA 4NXGA 4CLCC 1I2SA 4RVAA 1Y54A 5TBMB 1Q2PA 4B4ZA 1IFQA 3DTEA 1NXYA 1MWUA 5CTMA 1PZOA 1P0ZA 1L0DA 5L8MA 4NKPA 3V67A 1OMEA 3AGEA 4JGRA 3TSGA 4QY6A 1ESUA 4LV1A 4P87A 2HP5A 3EGXC 1JWVA 1P9WA 3M6HA 4BLMA 4IBXA 1E3UA 2QHKA 3MR0A 2L1MA 2Y2LA 3L9KA 3FWLA 3BFCA 3KYQA 3IHBA 1J3WA 4K08A 4S2NA 2PR6A 4WEJA 2WKQA 4C6YA 3LYXA 2HDSA 2WKPA 2HGVA 1W63M 1OPXA 1RGYA 2WADA 5M1AA 4WELA 2Y2GA 1FILA 3MZEA 4WMCD 5HDSA 3HREA 4GN2A 3S22A 3RFBA 2J3TD 4XUXA 3FYZA 3LR4A 3MKEA 1IYOA 2B18A 3IS2A 4MLLA 3M2KA 4EETB 5HZHA 1XKZA 4HY8A 2OAQ1 3C5AA 1K54A 1IOUA 3S7PA 3IBJA 4HH3A 5GLAA 4OVDA 1IYSA 1I5QA 1FSYA 3PBQA 2VKSA 3BM6A 1SCWA 3OPRA 3PAEA 2O0YA 5F5YA 4KQQA 3HLWA 2HJEA 3GMWA 2L0WA 1ALQA 4EUZA 4BQMA 2WGWB 2DCFA 3TRCA 2EWVA 1PWCA 2XD1A 4S2NC 5EFWA 3W4OA 4JKTA 5GLBA 4BWIA 3VOLA 2J9PA 4U0XA 2ZLYA 3KO6A 3HLEA 4HBTA 2VGKA 4ZAMA 1IKGA 3Q07A 1DJCA 1LHYA 3P98A 5IT5A 3LICA 3NECA 3MJQA 2Y8HA 1N9BA 2ZQ9A 1IELA 3RJUA 1XA1A 3EQVA 4NG2A 4BBUA 1OJGA 5GHYA 1K57C 4BL2A 3BFEA 3A0VA 3ZFZA 2JBFA 2JKTI 3N6IA 5J8XA 3PHYA 4ID4A 4HP4A 5HD5A 1PWGA 3HLCA 4GJ4A 5KZHA 1ES2A 3KX0X 4OKPA 2FZ0A 4GHIA 1ONGA 4CQHA 2P9VA 5KSHA 5HD3A 4QU3A 4HEFA 1NZUA 3ZG0A 3HL9A 1WYBA 4NXFA 4WLAA 4FSFA 4EERA 1L0GA 1ZTUA 1W8YA 2WAFA 1BYWA 4O7DA 4LV2A 4RX3A 4Z1WA 4ARZA 4GLQA 1HLUP 2JHEA 2Q9MA 1KE4A 3LI8A 2V0UA 2WKHA 3QP2A 5CGSA 3MSHA 5A90A 2GJ3A 5HW3A 5AVEA 1KDSA 2VGLS 2VJWA 3VP0A 5DKLA 2HV1A 2OWHA 3NDEA 3Q1FA 4H8RA 5HL6A 4IUKA 1NY0A 3CG5A 1W79A 4JLFA 3OCNA 2OSUA 1YMXA 2OLUA 3PBOA 4EW7A 3NOTC 3EOIA 2ZM2A 4KZ9A 3BY9A 4I39A 2VGJA 4MN6A 4YFMA 3OCLA 2GX5A 2ZOHA 3RXWA 3KYEA 1ES3A 1IEMA 1P9RA 4UQIM 3G6OA 3GDIA 3I7JA 3MF0A 3EQUA 1N9OA 1XP4A 3WS4A 3F1PA 2G2WA 4HJ4A 4MBHA 4DDSA 1N9NA 4L0LA 4EU0A 1K0KA 1L0FA 1TD5A 1LSXA 2V20A 5DJUA 4DE2A 2MJ6A 3HCYA 3C4PA 4BL3A 4JF4A 4BMWA 5FQ9A 1XJ6A 5DJTA 5C5KA 3IH8A 1E25A 1K38A 3WS0A 4X56A 2ACGA 2XD5A 4PM6A 4WBGA 4LRYC 4OP5A 4B4XA 1HTZA 3AGDA 3SS5A 4B88A 5HX9A 3IXBA 4E3OA 3QNBA 5CERA 4L9GA 5TBMA 4ZJ3A 2O9BA 1OT9A 3IHAA 1QMEA 2XA7M 3VSKA 4E3JA 3EEHA 2IWBA 3QP1A 4OONA 4QPRA 2ZC6B 2WUQA 4QY5A 1K56A 2WZZA 1K55C 1BLCA 3BY8A 1IYPA 4ETXA 4NK3A 2JKRM 4UA9A 4X1LA 5DFXA 4N9LA 1PRQA 1MWSA 1GA0A 1MBLA 2ZM8A 4JXSA 1IKIA 3LIDA 4MN7A 5I5LA 1VHMA 4KZ5A 1Q2QA 4JGPA 4PM5A 4KZBA 3UB6A 4GD8A 1GCEA 2VK3A 3A3DA 1ESIA 1XGIA 3LUQA 1GHIA 3DWKA 1ZC2A 2EXBA 1SKFA 2BASA 3FPVA 2XGNA 3GV9A 1W8QA 1SDEA 5HDDA 1H8MA 2Z2MB 3IWQA 4UHUA 4EWFA 2J3WA 4HBUA 1IYQA 3T4OA 3V5MA 2A2LA 3M2JA 1I2WA 1KGEA 3ZG5A 2ZC5B 4OOLA 2P74A 5CECA 3VP3A 4EBLA 5KMWA 4FOFA 1PZPA 1MWRA 1Y4OA 2VV8A 2I9VA 4X6TA 3VFHA 1DP6A 2V8FA 1PIOA 4ETZA 4DE3A 4QJGA 2XROA 3KSFA 5L07A 4KG6A 2OAP1 3BQAA 2W3EA 1AWIA 2WGWA 2PT7A 5FAQA 4GDNA 3H82B 5FASA 5TGFA 1ZKJA 3GVBA 1H8YA 1G6OA 2ZBBA 1F98A 5EOEA 1YLJA 2JKRI 1N9LA 1VB6A 4KQDA 4DMZA 3CJMA 4DF6A 3OPLA 2W3GA 3C2WA 3LEQA 1VETB 4DDYA 4OPYA 2ZMVA 4NXBA 1OTIA 5DTTA 2ZQDA 4KUKA 2INWA 5M18A 1OT6A 3BQ8A 4OPRA 2PR5A 4Q0HA 4R1GA 4RYEA 1NYYA 1L2SA 3VP1A 1XPBA 3HBRA 5L10A 1O07A 4WYYA 2ZQ8A 5KIZA 3GSGA 2O99A 3ZG9B 4P6ZS 3ZVWA 3Q81A 3R7WB 3LI9A 1F5MA 1S0WA 5E2HA 1S4RA 3V3SA 4X53A 3Q7VB 1TEMA 2BG1A 4MCWA 2B02A 1LL5A 4MN5A 2XFTA 4GNUA 3BW6A 1VQQA 3G4PA 1T18A 3QP4A 1M40A 1TS8A 3HLFA 2WK0A 1K4EA 1E3UD 1RCJA 2ZQCA 1YLPA 5FQKA 2V1AA 2ZOIA 4PKYA 4WEKA 1M6KA 2BLSA 1FR1A 2WGIA 4EQIA 1STZA 4MNRA 2PBDP 2GNXA 4HOIA 2DNSA 3WS2A 2HP6A 1GSWA 3B3XA 1GSVA 5IS1A 2M7UA 3G2ZA 1LSWA 2JKFA 5DF8A 4Q0JA 2EFUA 2DMWA 1C3BA 4R4RA 3A0SA 1YPRA 2Y79A 3G32A 4X1MA 5J3WA 5J4EA 3IT9A 1H5XA 4OQGA 2EX6A 3VMAA 1Z6FA 2X02A 2EA9A 3PYPA 3BLSA 3UE0A 2KOIA 4HQAA 2ZQAA 2Y4AA 3TJZC 3E2KA 4KZ8A 1S67L 3UDXA 4U0TA 3SS4A 1WYCA 2Z6CA 2JKTM 5EOOA 1ACFA 3T4LA 1JVJA 1NZOA 3WWXA 3S7OA 2LB9A 4X25A 1BUEA 2PYPA 3O3VA 1MZUA 2WYXA 3PBRA 4JGOA 3PTEA
chains in the Genus database with same CATH topology
2H0TA 3N7WA 4RX3A 2WKIA 2PBYA 3G34A 3V3RA 2Y2HA 4LV3A 3N8LA 3MFDA 3S4XA 4GOGA 5A91A 3E2LA 1K57A 2IWCA 5F1GA 3O87A 2Q9MA 1KE4A 3Q82A 5FQJA 5EE8A 2WKHA 2XF3A 4JBFA 5CGSA 5A93A 5E43A 2HDQA 5A90A 1LL9A 5HW3A 2Y59A 3CMZA 1KDSA 4PMAA 3VP0A 4JF6A 3DWZA 4IVIA 3NDEA 1NYMA 3Q1FA 1VM1A 2E8IA 4E3KA 3IXGA 1ES4A 2EFXA 4H8RA 2XDMA 1NY0A 3CG5A 1TVFA 4N92A 2OV5A 4E3MA 2J8YA 1G6AA 3C4OA 4PM8A 1KGGA 1E4DA 3MXRA 4KZAA 1W79A 4MBFA 1BZAA 2ZC3B 1RGZA 3A3EA 4N9KA 4JLFA 1CEGA 3OCNA 4DE0A 4IBRA 4WM9A 1PW1A 5HAIA 2OSUA 4KG2A 1YMXA 2OLUA 3PBOA 4KQRA 4JXVA 4E3LA 3Q7ZA 3DTMA 2ZM2A 4KZ9A 4DE1A 2VGJA 2Z2LB 4YFMA 3OCLA 3RXWA 5HAPA 1ES3A 2HDRA 1IEMA 2ZC4B 1XXMA 5CRFA 1FCOA 1GHMA 2FFFB 5AQAA 4DKIA 2HPBA 5DF9A 4GDBA 5EVIC 3I7JA 2Q9NA 5HARA 3W4PA 2WKEA 1H8ZA 2ZM0A 3HUOA 4PM9A 1DJAA 3EQUA 4UA7A 3SH7A 3W8KA 3UN7A 3ISGA 1XP4A 2P9VB 5CXWA 1DY6A 5IHVA 3WS4A 3GR2A 2G2WA 3HUMA 3W4QA 2Y2KA 1NRFA 5FI7A 4ZJ1A 3BEBA 4MBHA 5A92A 4DDSA 5CTNA 4FH4A 4L0LA 4WZ5C 4Y0UA 4XUZA 1XA7A 3ITAA 3NIAA 1L0FA 5FQMA 3BECA 2V20A 3VOZA 4DE2A 4KQOA 3FV7A 1CI9A 4OOYA 5E2FA 3VFFA 4CJNA 5F82A 3BRMA 4FD8A 2PU2A 3G35A 3IWOA 4OLGA 1TDLA 3OPPA 1K6SA 3PBTA 3C4PA 4BL3A 1K4FA 1SHVA 3IF5A 4JF4A 5FQQA 2JE5A 5FQ9A 4UA6A 4BD0A 1BSGA 5GHXA 3IH8A 1E25A 5TFQA 1YLZA 1K38A 3WS0A 3BFDA 2ZMAA 3C7UA 4X56A 4M3KA 2XD5A 4PM6A 4WBGA 1YLWA 5FAOA 4RX2A 4Y7PA 3A3IA 4OP5A 4B4XA 3IQAA 1HTZA 2GDNA 3BYDA 2ZD8A 5EVIA 4EBNA 4LV0A 3IXDA 3NC8A 3LY4A 4HESA 2Y2OA 4N1XA 3VP2A 3WRTA 3AGDA 3QHYA 3SS5A 4B88A 5HAQA 2J7VA 5HX9A 3G31A 3IXBA 4OH0A 2Y2JA 1YM1A 4DRTA 1CI8A 4E3OA 5CEBA 3QNBA 1ZG6A 3NI9A 4RA7A 5CERA 5HL1A 4X69A 5GHZA 1TDGA 3MZFA 5G18A 3SH8A 4ZJ3A 2QPNA 3IHAA 1MXOA 4KENB 1QMEA 4IVKA 3VSKA 2C6WB 4E3JA 5KSCA 1PI5A 4C3QA 1WE4A 3BFGA 2IWBA 3ITBA 2RL3A 4OONA 2R9WA 4S2IA 3FKWA 2ZC6B 4KZ6A 4LENA 3ZG7B 2Y2QA 3WS1A 4K0XA 1HD8A 2WUQA 1K56A 2WZZA 1K55C 1KVMA 2R9XA 1BLCA 2IWDA 3MZDA 4QY5A 1XX2A 5F1FA 2EX2A 1IYPA 4R3BA 4NK3A 4CPKA 5FI6A 4KZ7A 4UA9A 1LLBA 3MXSA 4E3IA 4OPZA 1BULA 4N9LA 2OLVA 4K0WA 1MWSA 1YMSA 3S1YA 3HUNA 3HVFA 1U60A 2V2FF 1HZOA 1GA0A 1MBLA 2ZM8A 4JXSA 1XGJA 3LEZA 4OQIA 1IKIA 3MKFA 3DW0A 4P0MA 5DF7A 5FQIA 1EROA 1W7FA 3G2YA 5DTSA 1FCNA 4S2PA 5CGXA 5TR7A 4R3JA 4KZ5A 1Q2QA 5E2GA 2ZJ9A 5FAPA 4PM5A 4KZBA 4E6WA 3TOIA 4GD8A 2JCHA 1GCEA 4GKUA 3A3DA 1ESIA 1W5DA 1XGIA 2G2UA 3G30A 3HLGA 3UE1A 1HVBA 3O86A 4WZ4A 4ZBEA 5EUAA 1GHIA 3DWKA 1ZC2A 2EXBA 1SKFA 4JXWA 1RP5A 3UNWA 2XGNA 5HFOA 1ZG4A 3WRZA 3GV9A 1W8QA 3M6BA 2FFYA 1EWZA 3OZHA 4S2OA 1PWDA 4X55A 2ZC7A 5M19A 1SDEA 3BFFA 3IF6A 3VOYA 1K55A 3QNCA 3JYIA 2H10A 2XQZA 4Y0TA 2Z2MB 3IWQA 3PAGA 4UHUA 4FH2A 3V39A 4EWFA 4WMCA 4HBUA 1IYQA 3V5MA 4S2JA 4BJPA 3PBSA 5CHJA 3M2JA 1I2WA 1KGEA 4NETA 3RXXA 5EVID 3OC2A 5DTKA 4OOMA 3ZG5A 2ZC5B 5FATA 3LCEA 3TG9A 3PTEA 2J9OA 1CEFA 1PYYA 3NBLA 1YT4A 4MEZA 4OOLA 5EVIB 2P74A 4OP8A 4JXGA 2XLNA 5CGWA 1KE0A 3A3FA 4KZ3A 4R4SA 5EECA 3IXHA 3GTCA 5CECA 1FQGA 1JWZA 4OLDA 3VP3A 4EBLA 5KMWA 1I2SA 4RVAA 4UAAA 1Y54A 4R23A 3V50A 1LI9A 1Q2PA 4B4ZA 4ZDXA 1PZPA 1MWRA 3UDFA 1ERQA 1NXYA 1EI5A 3Q7VA 1MWUA 2X01A 3SOIA 4X6TA 3VFHA 5CTMA 1K56D 1PZOA 4KG5A 4LCLA 1BTLA 3ZG8B 1PIOA 1L0DA 3WS5A 4BD1A 3C7VA 4JPMA 3CZDA 3ZGAB 1BT5A 1GHPA 1KDWA 1OMEA 4DE3A 3AGEA 3TSGA 4K91A 4QY6A 1ESUA 4LV1A 4P87A 2H5SA 5CEDA 2HP5A 4QJGA 1MY8A 2EXAA 3UE3A 3ZHHA 1JWVA 3BLMA 4KG6A 2RCXA 4OQ0A 3ZCZA 3ZDJA 2WGWA 5CHUA 1YLYA 2CC1A 3M6HA 4BLMA 5FAQA 4GDNA 4IBXA 1JTDA 4Z9QA 1GA9A 5F83A 1E3UA 3ZNTA 2Y2LA 2XFSA 4XXRA 5FASA 5TGFA 1ZKJA 3FWLA 3BFCA 3NY4A 1K6RA 5FDHA 3IHBA 3GVBA 1H8YA 1K54C 4ZJ2A 3VP4A 4D2OA 4E3NA 4S2NA 5EOEA 4GB7A 1YLJA 4WEJA 4JF5A 5GL9A 4MBKA 4C6YA 2A49A 1BLSA 2HDSA 3HLBA 3N4IA 1PI4A 1JWPA 4S2MA 1FCMA 2H0YA 5AQ9A 3IF6C 3ZVTA 1RGYA 3CJMA 4DF6A 2DRWA 2WADA 3OPLA 5EPHA 4F94A 3IH9A 5M1AA 1PW8A 4WELA 2Y2GA 4DDYA 2HP9A 4OPYA 4A5RA 3PBNA 3MZEA 4WMCD 5FSRA 4QB8A 3HREA 3IF6B 4LCMA 4GN2A 3S22A 5DTTA 2ZQ7A 2ZQDA 5AQBA 5M18A 4XUXA 5GLDA 3FYZA 3MKEA 4QHCA 4OPRA 4PM7A 4EBPA 1IYOA 4R1GA 4RYEA 1NYYA 1L2SA 2V1ZA 3IWIA 3VP1A 1XPBA 3HBRA 5FA7A 5E2EA 4MLLA 1O07A 3M2KA 2WZXA 2Y55A 4KZ4A 4WYYA 1AXBA 2ZQ8A 2JC7A 3GSGA 4U3TA 3ZG9B 1MWTA 1XKZA 3UY6A 3ZVWA 4Y0OA 1KGFA 3C5AA 1K54A 2XEPA 1ES5A 3LY3A 3Q81A 5BOHA 3UDIA 2XR0A 1SDNA 1S0WA 4BENA 5GLAA 5E2HA 3UPNA 4OVDA 3V3SA 4X53A 1IYSA 1I5QA 1FSYA 3N8SA 3Q7VB 1NJ4A 3PBQA 3N8RA 1N4OA 1TEMA 2BG1A 3NDGA 3BM6A 1SCWA 3ZNYA 1LL5A 3OPRA 3PAEA 2XFTA 1O7EA 4GNUA 4P85A 4KQQA 1VQQA 4Q8IA 1JTGA 3HLWA 3G4PA 3GMWA 4S2LA 1MPLA 1M40A 4QD4A 1ALQA 4EUZA 1K25A 3HLFA 2WK0A 1K4EA 1J9MA 1E3UD 2QMIA 2X71A 3FZCA 1RCJA 2WGWB 2ZQCA 3SS3A 3A3JA 5FI2A 4BQMA 2DCFA 4X68A 2HDUA 4R0QA 3VSLA 1YLPA 1BLHA 1PWCA 5FQKA 4E6XA 2XD1A 5D3OA 4OPQA 4WEKA 4S2NC 1M6KA 2BLSA 1FR1A 3W4OA 2WGIA 4FCFA 1FOFA 4JKTA 4C75A 5GLBA 4EQIA 4MNRA 2J9PA 4U0XA 2ZLYA 3UPPA 3HLEA 2DNSA 4GD6A 4HBTA 4DXBA 1KE3A 2VGKA 3D4FA 3WS2A 4ZAMA 2HP6A 1IKGA 2Y2MA 5I94A 3Q07A 3B3XA 3O88A 1YQSA 2Y2NA 1DJCA 1LHYA 4S2KA 5U47A 4YINA 1CK3A 3G2ZA 4P6BA 3P98A 1L0EA 1S6RA 3AGFA 5DF8A 3OPHA 2EFUA 2EX8A 1C3BA 1N9BA 4R4RA 3GRJA 3SH9A 4N1HA 5L2FA 3G32A 2ZQ9A 1IELA 3RJUA 2B5RA 3UO9A 1XA1A 2EX9A 3EQVA 3LO7A 3IT9A 1H5XA 2Y91A 5JYPA 5GHYA 1K57C 1ERMA 4OQGA 4BL2A 1QMFA 2EX6A 3BFEA 3VMAA 3ZFZA 1Z6FA 2X02A 2JBFA 4IEDA 3N6IA 5AQ7A 5EVLA 5J8XA 2WGVA 2Y2IA 5CHMA 3BLSA 4ID4A 4OQHA 4GZBA 1G68A 3UE0A 1PWGA 3HLCA 5KZHA 2ZQAA 3UPOA 2Y4AA 1ES2A 3E2KA 4KZ8A 4OKPA 3UDXA 4U0TA 1FR6A 3NCKA 1ONGA 3SS4A 5GLCA 1WYCA 2P9VA 5KSHA 1BLPA 2A3UA 5EOOA 1DJBA 4QU3A 4HEFA 3FKVA 4DXCA 3P09A 4LV2A 1MKIA 1LI0A 1NZUA 2XH9A 3ZG0A 2WAEA 1JVJA 1NZOA 2C5WB 4EV4A 3WWXA 4ZTKA 5JYOA 3HL9A 3MBZA 2I72A 1WYBA 2XK1A 1BUEA 1YLTA 3HLDA 4FSFA 1ONHA 4PPRA 3O3VA 5DVAA 1L0GA 1FSWA 1W8YA 2WYXA 2QZ6A 2WAFA 3GQZA 2Y2PA 3PBRA 2PU4A 4WZ5A 2UWXA 4O7DA 1KVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0T A;  3N7W A;  4RX3 A;  2WKI A;  2PBY A;  3G34 A;  3V3R A;  2Y2H A;  4LV3 A;  3N8L A;  3MFD A;  3S4X A;  4GOG A;  5A91 A;  3E2L A;  1K57 A;  2IWC A;  5F1G A;  3O87 A;  2Q9M A;  1KE4 A;  3Q82 A;  5FQJ A;  5EE8 A;  2WKH A;  2XF3 A;  4JBF A;  5CGS A;  5A93 A;  5E43 A;  2HDQ A;  5A90 A;  1LL9 A;  5HW3 A;  2Y59 A;  3CMZ A;  1KDS A;  4PMA A;  3VP0 A;  4JF6 A;  3DWZ A;  4IVI A;  3NDE A;  1NYM A;  3Q1F A;  1VM1 A;  2E8I A;  4E3K A;  3IXG A;  1ES4 A;  2EFX A;  4H8R A;  2XDM A;  1NY0 A;  3CG5 A;  1TVF A;  4N92 A;  2OV5 A;  4E3M A;  2J8Y A;  1G6A A;  3C4O A;  4PM8 A;  1KGG A;  1E4D A;  3MXR A;  4KZA A;  1W79 A;  4MBF A;  1BZA A;  2ZC3 B;  1RGZ A;  3A3E A;  4N9K A;  4JLF A;  1CEG A;  3OCN A;  4DE0 A;  4IBR A;  4WM9 A;  1PW1 A;  5HAI A;  2OSU A;  4KG2 A;  1YMX A;  2OLU A;  3PBO A;  4KQR A;  4JXV A;  4E3L A;  3Q7Z A;  3DTM A;  2ZM2 A;  4KZ9 A;  4DE1 A;  2VGJ A;  2Z2L B;  4YFM A;  3OCL A;  3RXW A;  5HAP A;  1ES3 A;  2HDR A;  1IEM A;  2ZC4 B;  1XXM A;  5CRF A;  1FCO A;  1GHM A;  2FFF B;  5AQA A;  4DKI A;  2HPB A;  5DF9 A;  4GDB A;  5EVI C;  3I7J A;  2Q9N A;  5HAR A;  3W4P A;  2WKE A;  1H8Z A;  2ZM0 A;  3HUO A;  4PM9 A;  1DJA A;  3EQU A;  4UA7 A;  3SH7 A;  3W8K A;  3UN7 A;  3ISG A;  1XP4 A;  2P9V B;  5CXW A;  1DY6 A;  5IHV A;  3WS4 A;  3GR2 A;  2G2W A;  3HUM A;  3W4Q A;  2Y2K A;  1NRF A;  5FI7 A;  4ZJ1 A;  3BEB A;  4MBH A;  5A92 A;  4DDS A;  5CTN A;  4FH4 A;  4L0L A;  4WZ5 C;  4Y0U A;  4XUZ A;  1XA7 A;  3ITA A;  3NIA A;  1L0F A;  5FQM A;  3BEC A;  2V20 A;  3VOZ A;  4DE2 A;  4KQO A;  3FV7 A;  1CI9 A;  4OOY A;  5E2F A;  3VFF A;  4CJN A;  5F82 A;  3BRM A;  4FD8 A;  2PU2 A;  3G35 A;  3IWO A;  4OLG A;  1TDL A;  3OPP A;  1K6S A;  3PBT A;  3C4P A;  4BL3 A;  1K4F A;  1SHV A;  3IF5 A;  4JF4 A;  5FQQ A;  2JE5 A;  5FQ9 A;  4UA6 A;  4BD0 A;  1BSG A;  5GHX A;  3IH8 A;  1E25 A;  5TFQ A;  1YLZ A;  1K38 A;  3WS0 A;  3BFD A;  2ZMA A;  3C7U A;  4X56 A;  4M3K A;  2XD5 A;  4PM6 A;  4WBG A;  1YLW A;  5FAO A;  4RX2 A;  4Y7P A;  3A3I A;  4OP5 A;  4B4X A;  3IQA A;  1HTZ A;  2GDN A;  3BYD A;  2ZD8 A;  5EVI A;  4EBN A;  4LV0 A;  3IXD A;  3NC8 A;  3LY4 A;  4HES A;  2Y2O A;  4N1X A;  3VP2 A;  3WRT A;  3AGD A;  3QHY A;  3SS5 A;  4B88 A;  5HAQ A;  2J7V A;  5HX9 A;  3G31 A;  3IXB A;  4OH0 A;  2Y2J A;  1YM1 A;  4DRT A;  1CI8 A;  4E3O A;  5CEB A;  3QNB A;  1ZG6 A;  3NI9 A;  4RA7 A;  5CER A;  5HL1 A;  4X69 A;  5GHZ A;  1TDG A;  3MZF A;  5G18 A;  3SH8 A;  4ZJ3 A;  2QPN A;  3IHA A;  1MXO A;  4KEN B;  1QME A;  4IVK A;  3VSK A;  2C6W B;  4E3J A;  5KSC A;  1PI5 A;  4C3Q A;  1WE4 A;  3BFG A;  2IWB A;  3ITB A;  2RL3 A;  4OON A;  2R9W A;  4S2I A;  3FKW A;  2ZC6 B;  4KZ6 A;  4LEN A;  3ZG7 B;  2Y2Q A;  3WS1 A;  4K0X A;  1HD8 A;  2WUQ A;  1K56 A;  2WZZ A;  1K55 C;  1KVM A;  2R9X A;  1BLC A;  2IWD A;  3MZD A;  4QY5 A;  1XX2 A;  5F1F A;  2EX2 A;  1IYP A;  4R3B A;  4NK3 A;  4CPK A;  5FI6 A;  4KZ7 A;  4UA9 A;  1LLB A;  3MXS A;  4E3I A;  4OPZ A;  1BUL A;  4N9L A;  2OLV A;  4K0W A;  1MWS A;  1YMS A;  3S1Y A;  3HUN A;  3HVF A;  1U60 A;  2V2F F;  1HZO A;  1GA0 A;  1MBL A;  2ZM8 A;  4JXS A;  1XGJ A;  3LEZ A;  4OQI A;  1IKI A;  3MKF A;  3DW0 A;  4P0M A;  5DF7 A;  5FQI A;  1ERO A;  1W7F A;  3G2Y A;  5DTS A;  1FCN A;  4S2P A;  5CGX A;  5TR7 A;  4R3J A;  4KZ5 A;  1Q2Q A;  5E2G A;  2ZJ9 A;  5FAP A;  4PM5 A;  4KZB A;  4E6W A;  3TOI A;  4GD8 A;  2JCH A;  1GCE A;  4GKU A;  3A3D A;  1ESI A;  1W5D A;  1XGI A;  2G2U A;  3G30 A;  3HLG A;  3UE1 A;  1HVB A;  3O86 A;  4WZ4 A;  4ZBE A;  5EUA A;  1GHI A;  3DWK A;  1ZC2 A;  2EXB A;  1SKF A;  4JXW A;  1RP5 A;  3UNW A;  2XGN A;  5HFO A;  1ZG4 A;  3WRZ A;  3GV9 A;  1W8Q A;  3M6B A;  2FFY A;  1EWZ A;  3OZH A;  4S2O A;  1PWD A;  4X55 A;  2ZC7 A;  5M19 A;  1SDE A;  3BFF A;  3IF6 A;  3VOY A;  1K55 A;  3QNC A;  3JYI A;  2H10 A;  2XQZ A;  4Y0T A;  2Z2M B;  3IWQ A;  3PAG A;  4UHU A;  4FH2 A;  3V39 A;  4EWF A;  4WMC A;  4HBU A;  1IYQ A;  3V5M A;  4S2J A;  4BJP A;  3PBS A;  5CHJ A;  3M2J A;  1I2W A;  1KGE A;  4NET A;  3RXX A;  5EVI D;  3OC2 A;  5DTK A;  4OOM A;  3ZG5 A;  2ZC5 B;  5FAT A;  3LCE A;  3TG9 A;  3PTE A;  2J9O A;  1CEF A;  1PYY A;  3NBL A;  1YT4 A;  4MEZ A;  4OOL A;  5EVI B;  2P74 A;  4OP8 A;  4JXG A;  2XLN A;  5CGW A;  1KE0 A;  3A3F A;  4KZ3 A;  4R4S A;  5EEC A;  3IXH A;  3GTC A;  5CEC A;  1FQG A;  1JWZ A;  4OLD A;  3VP3 A;  4EBL A;  5KMW A;  1I2S A;  4RVA A;  4UAA A;  1Y54 A;  4R23 A;  3V50 A;  1LI9 A;  1Q2P A;  4B4Z A;  4ZDX A;  1PZP A;  1MWR A;  3UDF A;  1ERQ A;  1NXY A;  1EI5 A;  3Q7V A;  1MWU A;  2X01 A;  3SOI A;  4X6T A;  3VFH A;  5CTM A;  1K56 D;  1PZO A;  4KG5 A;  4LCL A;  1BTL A;  3ZG8 B;  1PIO A;  1L0D A;  3WS5 A;  4BD1 A;  3C7V A;  4JPM A;  3CZD A;  3ZGA B;  1BT5 A;  1GHP A;  1KDW A;  1OME A;  4DE3 A;  3AGE A;  3TSG A;  4K91 A;  4QY6 A;  1ESU A;  4LV1 A;  4P87 A;  2H5S A;  5CED A;  2HP5 A;  4QJG A;  1MY8 A;  2EXA A;  3UE3 A;  3ZHH A;  1JWV A;  3BLM A;  4KG6 A;  2RCX A;  4OQ0 A;  3ZCZ A;  3ZDJ A;  2WGW A;  5CHU A;  1YLY A;  2CC1 A;  3M6H A;  4BLM A;  5FAQ A;  4GDN A;  4IBX A;  1JTD A;  4Z9Q A;  1GA9 A;  5F83 A;  1E3U A;  3ZNT A;  2Y2L A;  2XFS A;  4XXR A;  5FAS A;  5TGF A;  1ZKJ A;  3FWL A;  3BFC A;  3NY4 A;  1K6R A;  5FDH A;  3IHB A;  3GVB A;  1H8Y A;  1K54 C;  4ZJ2 A;  3VP4 A;  4D2O A;  4E3N A;  4S2N A;  5EOE A;  4GB7 A;  1YLJ A;  4WEJ A;  4JF5 A;  5GL9 A;  4MBK A;  4C6Y A;  2A49 A;  1BLS A;  2HDS A;  3HLB A;  3N4I A;  1PI4 A;  1JWP A;  4S2M A;  1FCM A;  2H0Y A;  5AQ9 A;  3IF6 C;  3ZVT A;  1RGY A;  3CJM A;  4DF6 A;  2DRW A;  2WAD A;  3OPL A;  5EPH A;  4F94 A;  3IH9 A;  5M1A A;  1PW8 A;  4WEL A;  2Y2G A;  4DDY A;  2HP9 A;  4OPY A;  4A5R A;  3PBN A;  3MZE A;  4WMC D;  5FSR A;  4QB8 A;  3HRE A;  3IF6 B;  4LCM A;  4GN2 A;  3S22 A;  5DTT A;  2ZQ7 A;  2ZQD A;  5AQB A;  5M18 A;  4XUX A;  5GLD A;  3FYZ A;  3MKE A;  4QHC A;  4OPR A;  4PM7 A;  4EBP A;  1IYO A;  4R1G A;  4RYE A;  1NYY A;  1L2S A;  2V1Z A;  3IWI A;  3VP1 A;  1XPB A;  3HBR A;  5FA7 A;  5E2E A;  4MLL A;  1O07 A;  3M2K A;  2WZX A;  2Y55 A;  4KZ4 A;  4WYY A;  1AXB A;  2ZQ8 A;  2JC7 A;  3GSG A;  4U3T A;  3ZG9 B;  1MWT A;  1XKZ A;  3UY6 A;  3ZVW A;  4Y0O A;  1KGF A;  3C5A A;  1K54 A;  2XEP A;  1ES5 A;  3LY3 A;  3Q81 A;  5BOH A;  3UDI A;  2XR0 A;  1SDN A;  1S0W A;  4BEN A;  5GLA A;  5E2H A;  3UPN A;  4OVD A;  3V3S A;  4X53 A;  1IYS A;  1I5Q A;  1FSY A;  3N8S A;  3Q7V B;  1NJ4 A;  3PBQ A;  3N8R A;  1N4O A;  1TEM A;  2BG1 A;  3NDG A;  3BM6 A;  1SCW A;  3ZNY A;  1LL5 A;  3OPR A;  3PAE A;  2XFT A;  1O7E A;  4GNU A;  4P85 A;  4KQQ A;  1VQQ A;  4Q8I A;  1JTG A;  3HLW A;  3G4P A;  3GMW A;  4S2L A;  1MPL A;  1M40 A;  4QD4 A;  1ALQ A;  4EUZ A;  1K25 A;  3HLF A;  2WK0 A;  1K4E A;  1J9M A;  1E3U D;  2QMI A;  2X71 A;  3FZC A;  1RCJ A;  2WGW B;  2ZQC A;  3SS3 A;  3A3J A;  5FI2 A;  4BQM A;  2DCF A;  4X68 A;  2HDU A;  4R0Q A;  3VSL A;  1YLP A;  1BLH A;  1PWC A;  5FQK A;  4E6X A;  2XD1 A;  5D3O A;  4OPQ A;  4WEK A;  4S2N C;  1M6K A;  2BLS A;  1FR1 A;  3W4O A;  2WGI A;  4FCF A;  1FOF A;  4JKT A;  4C75 A;  5GLB A;  4EQI A;  4MNR A;  2J9P A;  4U0X A;  2ZLY A;  3UPP A;  3HLE A;  2DNS A;  4GD6 A;  4HBT A;  4DXB A;  1KE3 A;  2VGK A;  3D4F A;  3WS2 A;  4ZAM A;  2HP6 A;  1IKG A;  2Y2M A;  5I94 A;  3Q07 A;  3B3X A;  3O88 A;  1YQS A;  2Y2N A;  1DJC A;  1LHY A;  4S2K A;  5U47 A;  4YIN A;  1CK3 A;  3G2Z A;  4P6B A;  3P98 A;  1L0E A;  1S6R A;  3AGF A;  5DF8 A;  3OPH A;  2EFU A;  2EX8 A;  1C3B A;  1N9B A;  4R4R A;  3GRJ A;  3SH9 A;  4N1H A;  5L2F A;  3G32 A;  2ZQ9 A;  1IEL A;  3RJU A;  2B5R A;  3UO9 A;  1XA1 A;  2EX9 A;  3EQV A;  3LO7 A;  3IT9 A;  1H5X A;  2Y91 A;  5JYP A;  5GHY A;  1K57 C;  1ERM A;  4OQG A;  4BL2 A;  1QMF A;  2EX6 A;  3BFE A;  3VMA A;  3ZFZ A;  1Z6F A;  2X02 A;  2JBF A;  4IED A;  3N6I A;  5AQ7 A;  5EVL A;  5J8X A;  2WGV A;  2Y2I A;  5CHM A;  3BLS A;  4ID4 A;  4OQH A;  4GZB A;  1G68 A;  3UE0 A;  1PWG A;  3HLC A;  5KZH A;  2ZQA A;  3UPO A;  2Y4A A;  1ES2 A;  3E2K A;  4KZ8 A;  4OKP A;  3UDX A;  4U0T A;  1FR6 A;  3NCK A;  1ONG A;  3SS4 A;  5GLC A;  1WYC A;  2P9V A;  5KSH A;  1BLP A;  2A3U A;  5EOO A;  1DJB A;  4QU3 A;  4HEF A;  3FKV A;  4DXC A;  3P09 A;  4LV2 A;  1MKI A;  1LI0 A;  1NZU A;  2XH9 A;  3ZG0 A;  2WAE A;  1JVJ A;  1NZO A;  2C5W B;  4EV4 A;  3WWX A;  4ZTK A;  5JYO A;  3HL9 A;  3MBZ A;  2I72 A;  1WYB A;  2XK1 A;  1BUE A;  1YLT A;  3HLD A;  4FSF A;  1ONH A;  4PPR A;  3O3V A;  5DVA A;  1L0G A;  1FSW A;  1W8Y A;  2WYX A;  2QZ6 A;  2WAF A;  3GQZ A;  2Y2P A;  3PBR A;  2PU4 A;  4WZ5 A;  2UWX A;  4O7D A;  1KVL A; 
#chains in the Genus database with same CATH topology
 3N7W A;  4E04 A;  2WKI A;  2PBY A;  3G34 A;  4LFU A;  3F1O B;  2PRF A;  1K57 A;  2IWC A;  5F1G A;  3O87 A;  5F69 A;  4JBF A;  5A93 A;  1F2K A;  2Y59 A;  1MKM A;  5FL3 A;  2KLI A;  4JF6 A;  3DWZ A;  5A8B A;  1LSV A;  3IXG A;  2EFX A;  1TVF A;  2OV5 A;  1KGG A;  4MBF A;  4KZA A;  2P08 A;  3UME A;  1BZA A;  1RGZ A;  3BJN A;  3LGO A;  4N9K A;  4XT2 B;  1ODV A;  4WF0 A;  4DE0 A;  4IBR A;  4KQR A;  4E3L A;  3EGD C;  2Z2L B;  3QP8 A;  3H9W A;  5HAP A;  3LR5 A;  3VV4 A;  5CRF A;  2FFF B;  5HWV A;  2XRN A;  3KSH A;  2HPB A;  1V9Z A;  4GDB A;  5EVI C;  2WKE A;  3HUO A;  2ZM0 A;  3SH7 A;  3W8K A;  4ZRR A;  5CXW A;  3GR2 A;  2Y2K A;  5FI7 A;  1KOU A;  1DRM A;  5CTN A;  3L7H A;  4XUZ A;  3ITA A;  3NIA A;  3BEC A;  3VOZ A;  4FUW A;  4KQO A;  1CI9 A;  4OOY A;  5E2F A;  4FD8 A;  2PU2 A;  3JVV A;  1K6S A;  3PBT A;  3RH8 B;  2OWJ A;  2VV6 A;  3E4P A;  5TFQ A;  2ZL1 B;  3IX4 A;  4IHQ A;  1LT0 A;  2ZMA A;  4Y7P A;  3A3I A;  2GDN A;  4LV0 A;  4MMN A;  4HES A;  2Y2O A;  3VP2 A;  4HIA A;  3QHY A;  4YNR A;  3T1R A;  2GZA A;  2Y2J A;  4DRT A;  1ZG6 A;  4RA7 A;  5HL1 A;  5GHZ A;  4EUV A;  5G18 A;  2BTF P;  4IVK A;  2C6W B;  4C3Q A;  3BFG A;  3ITB A;  2D01 A;  4S2I A;  1WA9 A;  4O0P A;  3SZT A;  4LEN A;  4KZ6 A;  4F3L B;  3ZG7 B;  3ZQ5 A;  2Y2Q A;  4H6J B;  1KVM A;  2IWD A;  2R9X A;  3LR3 A;  5DKK A;  3BWL A;  4CPK A;  5HWT A;  3MXS A;  4E3I A;  1SZV A;  4G3K A;  3HVF A;  2J3T C;  4HNB A;  1HZO A;  2VGL M;  3DTI A;  3LEZ A;  3T4K A;  3F1N B;  5DF7 A;  3DW0 A;  3H82 A;  4P0M A;  1L3L A;  4O8G A;  4R3J A;  2W0N A;  2ZJ9 A;  4PAU A;  1W63 Q;  3TOI A;  2JCH A;  4GKU A;  3H7W A;  2G2U A;  3UE1 A;  3HLG A;  4B93 A;  4WZ4 A;  3K3C A;  3K2N A;  3UNW A;  3WRZ A;  1VET A;  3UB9 A;  3OZH A;  1PWD A;  3BFF A;  3VOY A;  1G28 A;  1K55 A;  3JYI A;  4Y0T A;  4UEY A;  3PAG A;  3S7Q A;  1D7E A;  4D60 A;  3RXX A;  3OC2 A;  5DTK A;  3NUL A;  2J9O A;  2UV0 E;  4MEZ A;  5EVI B;  4GS9 B;  2W3F A;  2XLN A;  4Y2F A;  1KE0 A;  4KZ3 A;  3GTC A;  4OLD A;  4R3A A;  3NJA A;  4UAA A;  3R7W A;  3JPU A;  4R23 A;  3V50 A;  4ZDX A;  2LB5 A;  3P7N A;  3UDF A;  3Q7V A;  2CMN A;  3LR0 A;  3CHW P;  1K56 D;  3T50 A;  4LCL A;  2B95 A;  4Y15 A;  3C7V A;  3IBR A;  3CZD A;  3ZGA B;  1KDW A;  5CED A;  4G3V A;  2OOL A;  4GW9 A;  1MY8 A;  2EXA A;  3UE3 A;  3BLM A;  5DFY A;  3ZCZ A;  5CHU A;  1EW0 A;  3NOU C;  2YKH A;  5F83 A;  4Z9Q A;  3ZNT A;  2XFS A;  4HHD A;  3U2A A;  5FEG A;  3DAV A;  1TS7 A;  3QP6 A;  4ZJ2 A;  3VP4 A;  4E3N A;  5GL9 A;  4MBK A;  2A49 A;  1BLS A;  3N4I A;  1JWP A;  1FCM A;  2H0Y A;  5AQ9 A;  3T1X A;  5EPH A;  1JNU A;  4DJ2 A;  3LFV A;  3IH9 A;  2W27 A;  1S1Z A;  3IF6 B;  3U4L P;  4LCM A;  2ZQ7 A;  1Y28 A;  5AQB A;  5GLD A;  1CJF A;  4PM7 A;  1YKD A;  3MQ0 A;  4EEP A;  2V1Z A;  3IWI A;  2KDK A;  5FA7 A;  2Y55 A;  3E4O A;  4KZ4 A;  4Y13 A;  1AXB A;  2JC7 A;  1MWT A;  3UY6 A;  4EXO A;  4QWO A;  4Y0O A;  2VV7 A;  3S7N A;  1ES5 A;  5BOH A;  4BEN A;  1YSP A;  4IJG A;  3E98 A;  3ZNY A;  4RQ9 A;  1O7E A;  4P85 A;  1JTG A;  1MPL A;  1K25 A;  2W1R A;  2QMI A;  2X71 A;  3SS3 A;  5FI2 A;  4X68 A;  4R0Q A;  1YSQ A;  3VSL A;  1P97 A;  5D3O A;  4OPQ A;  3O5Y A;  4FCF A;  1FOF A;  4C75 A;  3DBA A;  4CLC D;  3PXP A;  4YWZ A;  2PAV P;  2VZW A;  4GD6 A;  4DXB A;  1KE3 A;  2Y2M A;  3B47 A;  1UWP X;  3O88 A;  4FTX A;  2Y2N A;  4XT2 A;  1CK3 A;  1L0E A;  1NWZ A;  2EX8 A;  3GRJ A;  5L2F A;  2B5R A;  3LO7 A;  5JYP A;  1QMF A;  4DJ3 A;  2V0W A;  2WGV A;  5CHM A;  2Y2I A;  4OQH A;  4GZB A;  1G68 A;  5FEF A;  3UPO A;  1FR6 A;  3NCK A;  2PD8 A;  5GLC A;  1BLP A;  4O01 A;  1DJB A;  4DXC A;  3FKV A;  1VEU B;  2L4R A;  2WAE A;  4EV4 A;  5JYO A;  3MBZ A;  2XK1 A;  4WUJ A;  1YLT A;  3HLD A;  1ONH A;  1FSW A;  4Y17 A;  2O9C A;  2PU4 A;  2UWX A;  1KVL A;  5EM1 A;  3B42 A;  2Y2H A;  3CUE A;  4LV3 A;  3IX8 A;  3N8L A;  3S4X A;  2KX6 A;  3E2L A;  2ZL1 A;  3MFX A;  2R78 A;  2NUP C;  3B33 A;  5EE8 A;  2XF3 A;  1G5U A;  3LIA A;  3DTK A;  5E43 A;  5LBR A;  1LL9 A;  4P6Z M;  4PMA A;  1A0K A;  2AVX A;  4IVI A;  3SW1 A;  4HH2 A;  2G7U A;  2E8I A;  1SKO B;  4E3K A;  3QP5 A;  4N92 A;  2K2N A;  4E3M A;  1G6A A;  4PM8 A;  3D72 A;  1OJ5 A;  3MXR A;  4F3L A;  1PW1 A;  4KG2 A;  4H6J A;  4JXV A;  2HF6 A;  3Q7Z A;  3DTM A;  4DE1 A;  3TE8 A;  3FPW A;  2HDR A;  1XXM A;  1GHM A;  5AQA A;  4L9F A;  3F1N A;  1PNE A;  2Q9N A;  5HAR A;  1XFN A;  3W4P A;  4PM9 A;  1DJA A;  4UA7 A;  3UN7 A;  1DY6 A;  2EWW A;  3HUM A;  3W4Q A;  1NRF A;  3UB5 P;  4I3I A;  4EEU A;  1XA7 A;  2QYB A;  5EM0 A;  3FV7 A;  3VFF A;  5F82 A;  5IU1 A;  3CUE C;  2V1B A;  3IWO A;  1TDL A;  3UB7 A;  3IF5 A;  5FQQ A;  1T1B A;  3TW8 A;  4UA6 A;  2V8C A;  5GHX A;  3JVU A;  4Y3I A;  1DP9 A;  2W3D A;  2PHY A;  1F9I A;  4RX2 A;  3IQA A;  3KSG A;  5EVI A;  4GS9 A;  3IXD A;  3LY4 A;  4N1X A;  1D06 A;  5HAQ A;  2J7V A;  3K3D A;  1CI8 A;  5CEB A;  2P04 A;  1TDG A;  3MZF A;  1OTA A;  1FIK A;  2A24 B;  2QPN A;  1MXO A;  1WE4 A;  2RL3 A;  2R9W A;  1S4S A;  1DP8 A;  1UGU A;  3D9Y A;  2JKG A;  4K0X A;  1HD8 A;  3MZD A;  1XX2 A;  3C30 A;  4R3B A;  4KZ7 A;  5FDS A;  4OPZ A;  2Q0O A;  2OLV A;  1NLY A;  3HUN A;  1U60 A;  2V2F F;  3E4Q A;  4BBV A;  1XGJ A;  4LRZ E;  5FQI A;  3CPT B;  2QKP A;  1W7F A;  3C38 A;  3G2Y A;  3MXQ A;  4BBT A;  1FCN A;  5CGX A;  2W3H A;  2H28 A;  1CF0 A;  5E2G A;  1XJ2 A;  3CAX A;  1PFL A;  1W5D A;  1GSX A;  3O86 A;  3OLO A;  5EUA A;  2K7S A;  2QJ7 A;  5HFO A;  1ZG4 A;  3CI6 A;  5M19 A;  1T19 A;  3C8C A;  3IF6 A;  1Z09 A;  1S66 L;  4WMC A;  4S2J A;  4BJP A;  2JN7 A;  3T1Q B;  4NET A;  3CLO A;  5FAT A;  3LCE A;  3TG9 A;  1CEF A;  2J80 A;  1NRJ A;  1YT4 A;  4OP8 A;  1XJ3 A;  4JXG A;  5CGW A;  4R4S A;  5EEC A;  1FQG A;  1OTD A;  1JWZ A;  3OBF A;  5AVF A;  1LI9 A;  3GEC A;  4I5S A;  1ERQ A;  5EV0 A;  2W1T B;  4L9E A;  4CLC B;  5L09 A;  1EI5 A;  2X01 A;  3SOI A;  2E8J A;  4KG5 A;  3OOV A;  1BTL A;  2K31 A;  3ZG8 B;  3WS5 A;  4BD1 A;  4JPM A;  5AJG A;  1BT5 A;  1GHP A;  4K91 A;  2PYR A;  2H5S A;  3ZHH A;  2RCX A;  3CWF A;  4OQ0 A;  2VEA A;  3ZDJ A;  1NLZ A;  1YLY A;  2CC1 A;  1JTD A;  1LL8 A;  1GA9 A;  4XXR A;  3NY4 A;  5HPI A;  4IUH A;  1K6R A;  5FDH A;  4ESP A;  1OTB A;  4M4X A;  2QJ5 A;  1K54 C;  4D2O A;  4JGQ A;  4GB7 A;  4JF5 A;  3HLB A;  1PI4 A;  4S2M A;  3ZVT A;  3IF6 C;  2DRW A;  3FC7 A;  4F94 A;  2M1C A;  1PW8 A;  2HJ9 C;  2HP9 A;  4A5R A;  3PBN A;  4LLO B;  5FSR A;  4QB8 A;  3ZYT A;  4QHC A;  4MDZ A;  4EBP A;  1OTE A;  2ZMF A;  3W2Z A;  4DN0 A;  5HDC A;  5E2E A;  4HJ6 A;  1H3Q A;  3KYZ A;  2WZX A;  2FH5 A;  4U3T A;  5HWW A;  1VEU A;  1KGF A;  2XEP A;  3LY3 A;  3UDI A;  2XR0 A;  1SDN A;  1TF1 A;  3UPN A;  1MC0 A;  3N8S A;  2D02 A;  1NJ4 A;  3N8R A;  1N4O A;  3NDG A;  3CIT A;  4PHT A;  4G3W A;  4Q0I A;  4Q8I A;  3LIF A;  4S2L A;  2O9A A;  3FG8 A;  4Y5F A;  4QD4 A;  4HI4 A;  5K5B A;  1J9M A;  3FZC A;  1YAX A;  3A3J A;  2HDU A;  4R6L A;  2VX8 A;  5EVE A;  2NUT C;  4UQI S;  2Z6D A;  1BLH A;  4E6X A;  2P7J A;  1SKO A;  1S1Y A;  3UPP A;  3R4K A;  3T4T A;  4B9O A;  3T4Q A;  3D4F A;  5I94 A;  4LRX C;  1YQS A;  1T1A A;  5U47 A;  4S2K A;  4YIN A;  4P6B A;  2WKR A;  4R70 A;  1S6R A;  3AGF A;  3OPH A;  4NEE D;  3HJK A;  3E0Y A;  3SH9 A;  4N1H A;  3UO9 A;  2EX9 A;  2Y91 A;  1ERM A;  4IED A;  5EVL A;  5AQ7 A;  1ZHH B;  2PD7 A;  4PKY G;  3ULF A;  3IS2 B;  2A3U A;  5HPF A;  3P09 A;  3KSI A;  1MKI A;  1LI0 A;  2M7V A;  2XH9 A;  1XFQ A;  3EWK A;  2C5W B;  4ZTK A;  2I72 A;  2YKF A;  5DVA A;  4PPR A;  3RTY A;  2QZ6 A;  3GQZ A;  2Y2P A;  4WZ5 A;  1UWN X;  5IHV A;  2H0T A;  2XA7 S;  4HJ3 A;  3V3R A;  3IX3 A;  3MFD A;  4GOG A;  5A91 A;  2VLG A;  5F6A A;  3Q82 A;  5FQJ A;  3P01 A;  4ME4 A;  2HDQ A;  4AFI A;  3UE6 A;  3CMZ A;  3T12 B;  3VE3 A;  3NOP C;  1NYM A;  1VM1 A;  3A0R A;  1ES4 A;  2XDM A;  1T1C A;  2A24 A;  2J8Y A;  3C4O A;  4GCZ A;  1E4D A;  4NXE A;  2ZC3 B;  3F1O A;  3A3E A;  1CEG A;  4WM9 A;  5HAI A;  4LPZ A;  3T1S A;  1TS0 A;  4CLC E;  3ICY A;  2ZC4 B;  1FCO A;  3EEA A;  5TJJ A;  4DKI A;  5MC7 A;  5DF9 A;  3CPT A;  4I38 A;  4GHI B;  1H8Z A;  3ISG A;  2P9V B;  2VA0 A;  4II7 A;  4ZJ1 A;  3BEB A;  5A92 A;  4LGW A;  4FH4 A;  4WZ5 C;  4Y0U A;  5FQM A;  4KUO A;  4CJN A;  3BRM A;  3G35 A;  2XSS A;  4OLG A;  3OPP A;  1K4F A;  1SHV A;  5F68 A;  2JE5 A;  4ARZ B;  2PDR A;  4BD0 A;  1BSG A;  3UB8 A;  1YLZ A;  3BFD A;  3C7U A;  1TS6 A;  4M3K A;  1YLW A;  5FAO A;  3LIE A;  3BYD A;  2ZD8 A;  3MMH A;  5G4Z A;  4EBN A;  3NC8 A;  3WRT A;  3MS6 A;  4EES A;  3G31 A;  4OH0 A;  5G4Y A;  1YM1 A;  3NI9 A;  1D1J A;  4X69 A;  4HP9 A;  3LIB A;  3SH8 A;  3T4S A;  4KEN B;  2W1T A;  4CLC A;  5KSC A;  1PI5 A;  4R38 A;  3FKW A;  3UMD A;  2HZ5 A;  3H7W B;  3WS1 A;  1CQA A;  2QWS A;  3VE4 A;  5F1F A;  2EX2 A;  1XJ4 A;  5FI6 A;  1LLB A;  3PR6 A;  1BUL A;  4K0W A;  1YMS A;  3S1Y A;  4WN5 A;  4OQI A;  3MKF A;  1ERO A;  5DTS A;  4S2P A;  4WL9 A;  5TR7 A;  5FAP A;  3F1P B;  3MQQ A;  3T4J A;  4E6W A;  3NHQ A;  3HJI A;  3G30 A;  1HVB A;  4ZBE A;  5HSQ A;  2V9A A;  4JXW A;  1RP5 A;  5J7E A;  3M6B A;  2FFY A;  1EWZ A;  4I3A A;  4S2O A;  4X55 A;  2ZC7 A;  3MQO A;  1V9Y A;  3QNC A;  2H10 A;  2XQZ A;  4YOF A;  3V39 A;  4FH2 A;  4EQ1 A;  3PBS A;  5CHJ A;  5CX7 A;  5EVI D;  4OOM A;  4I3J A;  1PYY A;  3NBL A;  2IA2 A;  3D3O A;  1H0M A;  3A3F A;  3IXH A;  1X0O A;  4NXG A;  4CLC C;  1I2S A;  4RVA A;  1Y54 A;  5TBM B;  1Q2P A;  4B4Z A;  1IFQ A;  3DTE A;  1NXY A;  1MWU A;  5CTM A;  1PZO A;  1P0Z A;  1L0D A;  5L8M A;  4NKP A;  3V67 A;  1OME A;  3AGE A;  4JGR A;  3TSG A;  4QY6 A;  1ESU A;  4LV1 A;  4P87 A;  2HP5 A;  3EGX C;  1JWV A;  1P9W A;  3M6H A;  4BLM A;  4IBX A;  1E3U A;  2QHK A;  3MR0 A;  2L1M A;  2Y2L A;  3L9K A;  3FWL A;  3BFC A;  3KYQ A;  3IHB A;  1J3W A;  4K08 A;  4S2N A;  2PR6 A;  4WEJ A;  2WKQ A;  4C6Y A;  3LYX A;  2HDS A;  2WKP A;  2HGV A;  1W63 M;  1OPX A;  1RGY A;  2WAD A;  5M1A A;  4WEL A;  2Y2G A;  1FIL A;  3MZE A;  4WMC D;  5HDS A;  3HRE A;  4GN2 A;  3S22 A;  3RFB A;  2J3T D;  4XUX A;  3FYZ A;  3LR4 A;  3MKE A;  1IYO A;  2B18 A;  3IS2 A;  4MLL A;  3M2K A;  4EET B;  5HZH A;  1XKZ A;  4HY8 A;  2OAQ 1;  3C5A A;  1K54 A;  1IOU A;  3S7P A;  3IBJ A;  4HH3 A;  5GLA A;  4OVD A;  1IYS A;  1I5Q A;  1FSY A;  3PBQ A;  2VKS A;  3BM6 A;  1SCW A;  3OPR A;  3PAE A;  2O0Y A;  5F5Y A;  4KQQ A;  3HLW A;  2HJE A;  3GMW A;  2L0W A;  1ALQ A;  4EUZ A;  4BQM A;  2WGW B;  2DCF A;  3TRC A;  2EWV A;  1PWC A;  2XD1 A;  4S2N C;  5EFW A;  3W4O A;  4JKT A;  5GLB A;  4BWI A;  3VOL A;  2J9P A;  4U0X A;  2ZLY A;  3KO6 A;  3HLE A;  4HBT A;  2VGK A;  4ZAM A;  1IKG A;  3Q07 A;  1DJC A;  1LHY A;  3P98 A;  5IT5 A;  3LIC A;  3NEC A;  3MJQ A;  2Y8H A;  1N9B A;  2ZQ9 A;  1IEL A;  3RJU A;  1XA1 A;  3EQV A;  4NG2 A;  4BBU A;  1OJG A;  5GHY A;  1K57 C;  4BL2 A;  3BFE A;  3A0V A;  3ZFZ A;  2JBF A;  2JKT I;  3N6I A;  5J8X A;  3PHY A;  4ID4 A;  4HP4 A;  5HD5 A;  1PWG A;  3HLC A;  4GJ4 A;  5KZH A;  1ES2 A;  3KX0 X;  4OKP A;  2FZ0 A;  4GHI A;  1ONG A;  4CQH A;  2P9V A;  5KSH A;  5HD3 A;  4QU3 A;  4HEF A;  1NZU A;  3ZG0 A;  3HL9 A;  1WYB A;  4NXF A;  4WLA A;  4FSF A;  4EER A;  1L0G A;  1ZTU A;  1W8Y A;  2WAF A;  1BYW A;  4O7D A;  4LV2 A;  4RX3 A;  4Z1W A;  4ARZ A;  4GLQ A;  1HLU P;  2JHE A;  2Q9M A;  1KE4 A;  3LI8 A;  2V0U A;  2WKH A;  3QP2 A;  5CGS A;  3MSH A;  5A90 A;  2GJ3 A;  5HW3 A;  5AVE A;  1KDS A;  2VGL S;  2VJW A;  3VP0 A;  5DKL A;  2HV1 A;  2OWH A;  3NDE A;  3Q1F A;  4H8R A;  5HL6 A;  4IUK A;  1NY0 A;  3CG5 A;  1W79 A;  4JLF A;  3OCN A;  2OSU A;  1YMX A;  2OLU A;  3PBO A;  4EW7 A;  3NOT C;  3EOI A;  2ZM2 A;  4KZ9 A;  3BY9 A;  4I39 A;  2VGJ A;  4MN6 A;  4YFM A;  3OCL A;  2GX5 A;  2ZOH A;  3RXW A;  3KYE A;  1ES3 A;  1IEM A;  1P9R A;  4UQI M;  3G6O A;  3GDI A;  3I7J A;  3MF0 A;  3EQU A;  1N9O A;  1XP4 A;  3WS4 A;  3F1P A;  2G2W A;  4HJ4 A;  4MBH A;  4DDS A;  1N9N A;  4L0L A;  4EU0 A;  1K0K A;  1L0F A;  1TD5 A;  1LSX A;  2V20 A;  5DJU A;  4DE2 A;  2MJ6 A;  3HCY A;  3C4P A;  4BL3 A;  4JF4 A;  4BMW A;  5FQ9 A;  1XJ6 A;  5DJT A;  5C5K A;  3IH8 A;  1E25 A;  1K38 A;  3WS0 A;  4X56 A;  2ACG A;  2XD5 A;  4PM6 A;  4WBG A;  4LRY C;  4OP5 A;  4B4X A;  1HTZ A;  3AGD A;  3SS5 A;  4B88 A;  5HX9 A;  3IXB A;  4E3O A;  3QNB A;  5CER A;  4L9G A;  5TBM A;  4ZJ3 A;  2O9B A;  1OT9 A;  3IHA A;  1QME A;  2XA7 M;  3VSK A;  4E3J A;  3EEH A;  2IWB A;  3QP1 A;  4OON A;  4QPR A;  2ZC6 B;  2WUQ A;  4QY5 A;  1K56 A;  2WZZ A;  1K55 C;  1BLC A;  3BY8 A;  1IYP A;  4ETX A;  4NK3 A;  2JKR M;  4UA9 A;  4X1L A;  5DFX A;  4N9L A;  1PRQ A;  1MWS A;  1GA0 A;  1MBL A;  2ZM8 A;  4JXS A;  1IKI A;  3LID A;  4MN7 A;  5I5L A;  1VHM A;  4KZ5 A;  1Q2Q A;  4JGP A;  4PM5 A;  4KZB A;  3UB6 A;  4GD8 A;  1GCE A;  2VK3 A;  3A3D A;  1ESI A;  1XGI A;  3LUQ A;  1GHI A;  3DWK A;  1ZC2 A;  2EXB A;  1SKF A;  2BAS A;  3FPV A;  2XGN A;  3GV9 A;  1W8Q A;  1SDE A;  5HDD A;  1H8M A;  2Z2M B;  3IWQ A;  4UHU A;  4EWF A;  2J3W A;  4HBU A;  1IYQ A;  3T4O A;  3V5M A;  2A2L A;  3M2J A;  1I2W A;  1KGE A;  3ZG5 A;  2ZC5 B;  4OOL A;  2P74 A;  5CEC A;  3VP3 A;  4EBL A;  5KMW A;  4FOF A;  1PZP A;  1MWR A;  1Y4O A;  2VV8 A;  2I9V A;  4X6T A;  3VFH A;  1DP6 A;  2V8F A;  1PIO A;  4ETZ A;  4DE3 A;  4QJG A;  2XRO A;  3KSF A;  5L07 A;  4KG6 A;  2OAP 1;  3BQA A;  2W3E A;  1AWI A;  2WGW A;  2PT7 A;  5FAQ A;  4GDN A;  3H82 B;  5FAS A;  5TGF A;  1ZKJ A;  3GVB A;  1H8Y A;  1G6O A;  2ZBB A;  1F98 A;  5EOE A;  1YLJ A;  2JKR I;  1N9L A;  1VB6 A;  4KQD A;  4DMZ A;  3CJM A;  4DF6 A;  3OPL A;  2W3G A;  3C2W A;  3LEQ A;  1VET B;  4DDY A;  4OPY A;  2ZMV A;  4NXB A;  1OTI A;  5DTT A;  2ZQD A;  4KUK A;  2INW A;  5M18 A;  1OT6 A;  3BQ8 A;  4OPR A;  2PR5 A;  4Q0H A;  4R1G A;  4RYE A;  1NYY A;  1L2S A;  3VP1 A;  1XPB A;  3HBR A;  5L10 A;  1O07 A;  4WYY A;  2ZQ8 A;  5KIZ A;  3GSG A;  2O99 A;  3ZG9 B;  4P6Z S;  3ZVW A;  3Q81 A;  3R7W B;  3LI9 A;  1F5M A;  1S0W A;  5E2H A;  1S4R A;  3V3S A;  4X53 A;  3Q7V B;  1TEM A;  2BG1 A;  4MCW A;  2B02 A;  1LL5 A;  4MN5 A;  2XFT A;  4GNU A;  3BW6 A;  1VQQ A;  3G4P A;  1T18 A;  3QP4 A;  1M40 A;  1TS8 A;  3HLF A;  2WK0 A;  1K4E A;  1E3U D;  1RCJ A;  2ZQC A;  1YLP A;  5FQK A;  2V1A A;  2ZOI A;  4PKY A;  4WEK A;  1M6K A;  2BLS A;  1FR1 A;  2WGI A;  4EQI A;  1STZ A;  4MNR A;  2PBD P;  2GNX A;  4HOI A;  2DNS A;  3WS2 A;  2HP6 A;  1GSW A;  3B3X A;  1GSV A;  5IS1 A;  2M7U A;  3G2Z A;  1LSW A;  2JKF A;  5DF8 A;  4Q0J A;  2EFU A;  2DMW A;  1C3B A;  4R4R A;  3A0S A;  1YPR A;  2Y79 A;  3G32 A;  4X1M A;  5J3W A;  5J4E A;  3IT9 A;  1H5X A;  4OQG A;  2EX6 A;  3VMA A;  1Z6F A;  2X02 A;  2EA9 A;  3PYP A;  3BLS A;  3UE0 A;  2KOI A;  4HQA A;  2ZQA A;  2Y4A A;  3TJZ C;  3E2K A;  4KZ8 A;  1S67 L;  3UDX A;  4U0T A;  3SS4 A;  1WYC A;  2Z6C A;  2JKT M;  5EOO A;  1ACF A;  3T4L A;  1JVJ A;  1NZO A;  3WWX A;  3S7O A;  2LB9 A;  4X25 A;  1BUE A;  2PYP A;  3O3V A;  1MZU A;  2WYX A;  3PBR A;  4JGO A;  3PTE A; 
#chains in the Genus database with same CATH homology
 2H0T A;  3N7W A;  4RX3 A;  2WKI A;  2PBY A;  3G34 A;  3V3R A;  2Y2H A;  4LV3 A;  3N8L A;  3MFD A;  3S4X A;  4GOG A;  5A91 A;  3E2L A;  1K57 A;  2IWC A;  5F1G A;  3O87 A;  2Q9M A;  1KE4 A;  3Q82 A;  5FQJ A;  5EE8 A;  2WKH A;  2XF3 A;  4JBF A;  5CGS A;  5A93 A;  5E43 A;  2HDQ A;  5A90 A;  1LL9 A;  5HW3 A;  2Y59 A;  3CMZ A;  1KDS A;  4PMA A;  3VP0 A;  4JF6 A;  3DWZ A;  4IVI A;  3NDE A;  1NYM A;  3Q1F A;  1VM1 A;  2E8I A;  4E3K A;  3IXG A;  1ES4 A;  2EFX A;  4H8R A;  2XDM A;  1NY0 A;  3CG5 A;  1TVF A;  4N92 A;  2OV5 A;  4E3M A;  2J8Y A;  1G6A A;  3C4O A;  4PM8 A;  1KGG A;  1E4D A;  3MXR A;  4KZA A;  1W79 A;  4MBF A;  1BZA A;  2ZC3 B;  1RGZ A;  3A3E A;  4N9K A;  4JLF A;  1CEG A;  3OCN A;  4DE0 A;  4IBR A;  4WM9 A;  1PW1 A;  5HAI A;  2OSU A;  4KG2 A;  1YMX A;  2OLU A;  3PBO A;  4KQR A;  4JXV A;  4E3L A;  3Q7Z A;  3DTM A;  2ZM2 A;  4KZ9 A;  4DE1 A;  2VGJ A;  2Z2L B;  4YFM A;  3OCL A;  3RXW A;  5HAP A;  1ES3 A;  2HDR A;  1IEM A;  2ZC4 B;  1XXM A;  5CRF A;  1FCO A;  1GHM A;  2FFF B;  5AQA A;  4DKI A;  2HPB A;  5DF9 A;  4GDB A;  5EVI C;  3I7J A;  2Q9N A;  5HAR A;  3W4P A;  2WKE A;  1H8Z A;  2ZM0 A;  3HUO A;  4PM9 A;  1DJA A;  3EQU A;  4UA7 A;  3SH7 A;  3W8K A;  3UN7 A;  3ISG A;  1XP4 A;  2P9V B;  5CXW A;  1DY6 A;  5IHV A;  3WS4 A;  3GR2 A;  2G2W A;  3HUM A;  3W4Q A;  2Y2K A;  1NRF A;  5FI7 A;  4ZJ1 A;  3BEB A;  4MBH A;  5A92 A;  4DDS A;  5CTN A;  4FH4 A;  4L0L A;  4WZ5 C;  4Y0U A;  4XUZ A;  1XA7 A;  3ITA A;  3NIA A;  1L0F A;  5FQM A;  3BEC A;  2V20 A;  3VOZ A;  4DE2 A;  4KQO A;  3FV7 A;  1CI9 A;  4OOY A;  5E2F A;  3VFF A;  4CJN A;  5F82 A;  3BRM A;  4FD8 A;  2PU2 A;  3G35 A;  3IWO A;  4OLG A;  1TDL A;  3OPP A;  1K6S A;  3PBT A;  3C4P A;  4BL3 A;  1K4F A;  1SHV A;  3IF5 A;  4JF4 A;  5FQQ A;  2JE5 A;  5FQ9 A;  4UA6 A;  4BD0 A;  1BSG A;  5GHX A;  3IH8 A;  1E25 A;  5TFQ A;  1YLZ A;  1K38 A;  3WS0 A;  3BFD A;  2ZMA A;  3C7U A;  4X56 A;  4M3K A;  2XD5 A;  4PM6 A;  4WBG A;  1YLW A;  5FAO A;  4RX2 A;  4Y7P A;  3A3I A;  4OP5 A;  4B4X A;  3IQA A;  1HTZ A;  2GDN A;  3BYD A;  2ZD8 A;  5EVI A;  4EBN A;  4LV0 A;  3IXD A;  3NC8 A;  3LY4 A;  4HES A;  2Y2O A;  4N1X A;  3VP2 A;  3WRT A;  3AGD A;  3QHY A;  3SS5 A;  4B88 A;  5HAQ A;  2J7V A;  5HX9 A;  3G31 A;  3IXB A;  4OH0 A;  2Y2J A;  1YM1 A;  4DRT A;  1CI8 A;  4E3O A;  5CEB A;  3QNB A;  1ZG6 A;  3NI9 A;  4RA7 A;  5CER A;  5HL1 A;  4X69 A;  5GHZ A;  1TDG A;  3MZF A;  5G18 A;  3SH8 A;  4ZJ3 A;  2QPN A;  3IHA A;  1MXO A;  4KEN B;  1QME A;  4IVK A;  3VSK A;  2C6W B;  4E3J A;  5KSC A;  1PI5 A;  4C3Q A;  1WE4 A;  3BFG A;  2IWB A;  3ITB A;  2RL3 A;  4OON A;  2R9W A;  4S2I A;  3FKW A;  2ZC6 B;  4KZ6 A;  4LEN A;  3ZG7 B;  2Y2Q A;  3WS1 A;  4K0X A;  1HD8 A;  2WUQ A;  1K56 A;  2WZZ A;  1K55 C;  1KVM A;  2R9X A;  1BLC A;  2IWD A;  3MZD A;  4QY5 A;  1XX2 A;  5F1F A;  2EX2 A;  1IYP A;  4R3B A;  4NK3 A;  4CPK A;  5FI6 A;  4KZ7 A;  4UA9 A;  1LLB A;  3MXS A;  4E3I A;  4OPZ A;  1BUL A;  4N9L A;  2OLV A;  4K0W A;  1MWS A;  1YMS A;  3S1Y A;  3HUN A;  3HVF A;  1U60 A;  2V2F F;  1HZO A;  1GA0 A;  1MBL A;  2ZM8 A;  4JXS A;  1XGJ A;  3LEZ A;  4OQI A;  1IKI A;  3MKF A;  3DW0 A;  4P0M A;  5DF7 A;  5FQI A;  1ERO A;  1W7F A;  3G2Y A;  5DTS A;  1FCN A;  4S2P A;  5CGX A;  5TR7 A;  4R3J A;  4KZ5 A;  1Q2Q A;  5E2G A;  2ZJ9 A;  5FAP A;  4PM5 A;  4KZB A;  4E6W A;  3TOI A;  4GD8 A;  2JCH A;  1GCE A;  4GKU A;  3A3D A;  1ESI A;  1W5D A;  1XGI A;  2G2U A;  3G30 A;  3HLG A;  3UE1 A;  1HVB A;  3O86 A;  4WZ4 A;  4ZBE A;  5EUA A;  1GHI A;  3DWK A;  1ZC2 A;  2EXB A;  1SKF A;  4JXW A;  1RP5 A;  3UNW A;  2XGN A;  5HFO A;  1ZG4 A;  3WRZ A;  3GV9 A;  1W8Q A;  3M6B A;  2FFY A;  1EWZ A;  3OZH A;  4S2O A;  1PWD A;  4X55 A;  2ZC7 A;  5M19 A;  1SDE A;  3BFF A;  3IF6 A;  3VOY A;  1K55 A;  3QNC A;  3JYI A;  2H10 A;  2XQZ A;  4Y0T A;  2Z2M B;  3IWQ A;  3PAG A;  4UHU A;  4FH2 A;  3V39 A;  4EWF A;  4WMC A;  4HBU A;  1IYQ A;  3V5M A;  4S2J A;  4BJP A;  3PBS A;  5CHJ A;  3M2J A;  1I2W A;  1KGE A;  4NET A;  3RXX A;  5EVI D;  3OC2 A;  5DTK A;  4OOM A;  3ZG5 A;  2ZC5 B;  5FAT A;  3LCE A;  3TG9 A;  3PTE A;  2J9O A;  1CEF A;  1PYY A;  3NBL A;  1YT4 A;  4MEZ A;  4OOL A;  5EVI B;  2P74 A;  4OP8 A;  4JXG A;  2XLN A;  5CGW A;  1KE0 A;  3A3F A;  4KZ3 A;  4R4S A;  5EEC A;  3IXH A;  3GTC A;  5CEC A;  1FQG A;  1JWZ A;  4OLD A;  3VP3 A;  4EBL A;  5KMW A;  1I2S A;  4RVA A;  4UAA A;  1Y54 A;  4R23 A;  3V50 A;  1LI9 A;  1Q2P A;  4B4Z A;  4ZDX A;  1PZP A;  1MWR A;  3UDF A;  1ERQ A;  1NXY A;  1EI5 A;  3Q7V A;  1MWU A;  2X01 A;  3SOI A;  4X6T A;  3VFH A;  5CTM A;  1K56 D;  1PZO A;  4KG5 A;  4LCL A;  1BTL A;  3ZG8 B;  1PIO A;  1L0D A;  3WS5 A;  4BD1 A;  3C7V A;  4JPM A;  3CZD A;  3ZGA B;  1BT5 A;  1GHP A;  1KDW A;  1OME A;  4DE3 A;  3AGE A;  3TSG A;  4K91 A;  4QY6 A;  1ESU A;  4LV1 A;  4P87 A;  2H5S A;  5CED A;  2HP5 A;  4QJG A;  1MY8 A;  2EXA A;  3UE3 A;  3ZHH A;  1JWV A;  3BLM A;  4KG6 A;  2RCX A;  4OQ0 A;  3ZCZ A;  3ZDJ A;  2WGW A;  5CHU A;  1YLY A;  2CC1 A;  3M6H A;  4BLM A;  5FAQ A;  4GDN A;  4IBX A;  1JTD A;  4Z9Q A;  1GA9 A;  5F83 A;  1E3U A;  3ZNT A;  2Y2L A;  2XFS A;  4XXR A;  5FAS A;  5TGF A;  1ZKJ A;  3FWL A;  3BFC A;  3NY4 A;  1K6R A;  5FDH A;  3IHB A;  3GVB A;  1H8Y A;  1K54 C;  4ZJ2 A;  3VP4 A;  4D2O A;  4E3N A;  4S2N A;  5EOE A;  4GB7 A;  1YLJ A;  4WEJ A;  4JF5 A;  5GL9 A;  4MBK A;  4C6Y A;  2A49 A;  1BLS A;  2HDS A;  3HLB A;  3N4I A;  1PI4 A;  1JWP A;  4S2M A;  1FCM A;  2H0Y A;  5AQ9 A;  3IF6 C;  3ZVT A;  1RGY A;  3CJM A;  4DF6 A;  2DRW A;  2WAD A;  3OPL A;  5EPH A;  4F94 A;  3IH9 A;  5M1A A;  1PW8 A;  4WEL A;  2Y2G A;  4DDY A;  2HP9 A;  4OPY A;  4A5R A;  3PBN A;  3MZE A;  4WMC D;  5FSR A;  4QB8 A;  3HRE A;  3IF6 B;  4LCM A;  4GN2 A;  3S22 A;  5DTT A;  2ZQ7 A;  2ZQD A;  5AQB A;  5M18 A;  4XUX A;  5GLD A;  3FYZ A;  3MKE A;  4QHC A;  4OPR A;  4PM7 A;  4EBP A;  1IYO A;  4R1G A;  4RYE A;  1NYY A;  1L2S A;  2V1Z A;  3IWI A;  3VP1 A;  1XPB A;  3HBR A;  5FA7 A;  5E2E A;  4MLL A;  1O07 A;  3M2K A;  2WZX A;  2Y55 A;  4KZ4 A;  4WYY A;  1AXB A;  2ZQ8 A;  2JC7 A;  3GSG A;  4U3T A;  3ZG9 B;  1MWT A;  1XKZ A;  3UY6 A;  3ZVW A;  4Y0O A;  1KGF A;  3C5A A;  1K54 A;  2XEP A;  1ES5 A;  3LY3 A;  3Q81 A;  5BOH A;  3UDI A;  2XR0 A;  1SDN A;  1S0W A;  4BEN A;  5GLA A;  5E2H A;  3UPN A;  4OVD A;  3V3S A;  4X53 A;  1IYS A;  1I5Q A;  1FSY A;  3N8S A;  3Q7V B;  1NJ4 A;  3PBQ A;  3N8R A;  1N4O A;  1TEM A;  2BG1 A;  3NDG A;  3BM6 A;  1SCW A;  3ZNY A;  1LL5 A;  3OPR A;  3PAE A;  2XFT A;  1O7E A;  4GNU A;  4P85 A;  4KQQ A;  1VQQ A;  4Q8I A;  1JTG A;  3HLW A;  3G4P A;  3GMW A;  4S2L A;  1MPL A;  1M40 A;  4QD4 A;  1ALQ A;  4EUZ A;  1K25 A;  3HLF A;  2WK0 A;  1K4E A;  1J9M A;  1E3U D;  2QMI A;  2X71 A;  3FZC A;  1RCJ A;  2WGW B;  2ZQC A;  3SS3 A;  3A3J A;  5FI2 A;  4BQM A;  2DCF A;  4X68 A;  2HDU A;  4R0Q A;  3VSL A;  1YLP A;  1BLH A;  1PWC A;  5FQK A;  4E6X A;  2XD1 A;  5D3O A;  4OPQ A;  4WEK A;  4S2N C;  1M6K A;  2BLS A;  1FR1 A;  3W4O A;  2WGI A;  4FCF A;  1FOF A;  4JKT A;  4C75 A;  5GLB A;  4EQI A;  4MNR A;  2J9P A;  4U0X A;  2ZLY A;  3UPP A;  3HLE A;  2DNS A;  4GD6 A;  4HBT A;  4DXB A;  1KE3 A;  2VGK A;  3D4F A;  3WS2 A;  4ZAM A;  2HP6 A;  1IKG A;  2Y2M A;  5I94 A;  3Q07 A;  3B3X A;  3O88 A;  1YQS A;  2Y2N A;  1DJC A;  1LHY A;  4S2K A;  5U47 A;  4YIN A;  1CK3 A;  3G2Z A;  4P6B A;  3P98 A;  1L0E A;  1S6R A;  3AGF A;  5DF8 A;  3OPH A;  2EFU A;  2EX8 A;  1C3B A;  1N9B A;  4R4R A;  3GRJ A;  3SH9 A;  4N1H A;  5L2F A;  3G32 A;  2ZQ9 A;  1IEL A;  3RJU A;  2B5R A;  3UO9 A;  1XA1 A;  2EX9 A;  3EQV A;  3LO7 A;  3IT9 A;  1H5X A;  2Y91 A;  5JYP A;  5GHY A;  1K57 C;  1ERM A;  4OQG A;  4BL2 A;  1QMF A;  2EX6 A;  3BFE A;  3VMA A;  3ZFZ A;  1Z6F A;  2X02 A;  2JBF A;  4IED A;  3N6I A;  5AQ7 A;  5EVL A;  5J8X A;  2WGV A;  2Y2I A;  5CHM A;  3BLS A;  4ID4 A;  4OQH A;  4GZB A;  1G68 A;  3UE0 A;  1PWG A;  3HLC A;  5KZH A;  2ZQA A;  3UPO A;  2Y4A A;  1ES2 A;  3E2K A;  4KZ8 A;  4OKP A;  3UDX A;  4U0T A;  1FR6 A;  3NCK A;  1ONG A;  3SS4 A;  5GLC A;  1WYC A;  2P9V A;  5KSH A;  1BLP A;  2A3U A;  5EOO A;  1DJB A;  4QU3 A;  4HEF A;  3FKV A;  4DXC A;  3P09 A;  4LV2 A;  1MKI A;  1LI0 A;  1NZU A;  2XH9 A;  3ZG0 A;  2WAE A;  1JVJ A;  1NZO A;  2C5W B;  4EV4 A;  3WWX A;  4ZTK A;  5JYO A;  3HL9 A;  3MBZ A;  2I72 A;  1WYB A;  2XK1 A;  1BUE A;  1YLT A;  3HLD A;  4FSF A;  1ONH A;  4PPR A;  3O3V A;  5DVA A;  1L0G A;  1FSW A;  1W8Y A;  2WYX A;  2QZ6 A;  2WAF A;  3GQZ A;  2Y2P A;  3PBR A;  2PU4 A;  4WZ5 A;  2UWX A;  4O7D A;  1KVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...