5EVIB

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
359
structure length
353
Chain Sequence
NSAALDTLVQTEARKVMQENNITGLSIAITRHGQQFYNYGVASKATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFKAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDQTLYAQGYNTLDEPVRVNPGILAAEAYGVSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNKTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVLAYRILQHAEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 102
structure length 353
sequence length 359
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviB00
3OPPA 4BENA 5FA7A 2ZQ9A 5EE8A 1XGIA 5HAIA 3LCEA 4H8RA 4ZJ3A 4HEFA 3IWOA 4B88A 2Y2HA 3ZDJA 1IYQA 2Y2MA 1ALQA 1PW1A 5CXWA 1NXYA 3UE1A 5FQIA 3NIAA 2DNSA 1GHPA 3NY4A 4WEKA 2HP9A 4P85A 2FFYA 4R3BA 2HPBA 4PPRA 1K25A 1XGJA 3M6HA 3W8KA 1PWCA 4ZJ1A 5GHZA 3CG5A 4GDNA 1MKIA 4JXVA 1CEGA 2JC7A 3Q7ZA 3PAGA 3N8RA 2J8YA 4HESA 1J9MA 3B3XA 4KZ9A 4OH0A 4U0TA 3UNWA 3GTCA 3OPHA 4X53A 3WS4A 3ZGAB 2B5RA 2UWXA 3G32A 4JXGA 5FASA 2XQZA 5BOHA 3NDGA 4KQQA 4RYEA 3Q7VA 3O88A 2WKEA 2BLSA 3MFDA 3A3EA 4OOLA 4Z9QA 4EUZA 1W8YA 3P98A 1M40A 4S2KA 4RA7A 3S1YA 2PBYA 4JXSA 4LCLA 2WGWA 2V1ZA 2XEPA 4UA9A 2WZXA 4S2OA 1DJCA 4S2LA 2Y2JA 2ZQDA 1YT4A 2OV5A 5E2EA 5HAQA 1L0GA 4LCMA 1TEMA 3LY3A 2RCXA 4KQOA 1NZUA 3G4PA 1SHVA 1L0DA 2A49A 1FCNA 1LLBA 2XD5A 4E3LA 5M19A 3CJMA 3N8LA 5HL1A 1YLJA 2WK0A 4IEDA 5EOOA 3MZDA 3C4PA 3VOZA 4LENA 2RL3A 4LV2A 1PI5A 3NDEA 4FSFA 4C3QA 3DWZA 1WE4A 1GHIA 1K57C 3IF6A 1S0WA 2R9WA 5E2HA 3LEZA 2HDQA 2XD1A 4N92A 4X69A 3UY6A 1Q2PA 1BSGA 1YLYA 1W5DA 3SS4A 2WZZA 2WKIA 1H8ZA 1FCOA 3UE3A 2H0TA 3ZG9B 3ZG0A 5KZHA 4WEJA 5CHMA 2EX9A 1CK3A 2XFTA 4Y0TA 4D2OA 1MWUA 5FI6A 5E2GA 2X01A 3A3FA 4DF6A 2P9VB 4OLDA 4KZ7A 2ZC6B 5F1GA 1I2WA 1TVFA 1ZKJA 4FD8A 4P0MA 4E6WA 4ZTKA 5CTNA 4Y0OA 3IWIA 4RX2A 3ZHHA 2PU2A 4Y0UA 4DE1A 5TR7A 3S22A 3SS5A 5EPHA 4GZBA 5CGXA 2Z2LB 5EUAA 4KG2A 2XGNA 4R1GA 2I72A 3FV7A 1BULA 1QMEA 4XXRA 4JPMA 1XP4A 2XR0A 2CC1A 3MXRA 2ZQ8A 4UA6A 1FOFA 4WBGA 2ZC3B 5CHUA 2ZC4B 4R0QA 3BFCA 1ES2A 1K54C 3AGDA 2V20A 1ES5A 4BD0A 1E3UA 5CERA 2XFSA 1CI9A 4R4SA 1M6KA 4DDYA 1BLCA 3TSGA 2H5SA 5HX9A 4KG5A 1JWVA 3OPLA 5FQ9A 1H5XA 2GDNA 2H10A 2IWBA 1XA7A 1JTGA 1MWTA 4YINA 1HTZA 2C6WB 4K0XA 1PWGA 1WYCA 4GD6A 1MPLA 4R3JA 1FSYA 4KZBA 2E8IA 3P09A 3FKVA 4MLLA 1N4OA 3HLBA 3OPRA 2IWCA 2Y2OA 4PM8A 3GRJA 3IXHA 1ONHA 1KDWA 2ZQ7A 1JWZA 4UHUA 3BRMA 3C4OA 3GR2A 5FI7A 4WZ5A 1EWZA 1KGGA 1FQGA 1GHMA 4OQHA 5EVIA 3ZFZA 3BLMA 1GA0A 4KZ8A 4BJPA 1CI8A 3G2ZA 3ITAA 4WZ4A 5AQ9A 1JWPA 1MWRA 3ZVTA 3PBOA 4KQRA 4NETA 3TG9A 4ZJ2A 1TDGA 3VP2A 3NC8A 3RJUA 2G2WA 4RVAA 2X02A 4WMCA 4C6YA 3MZEA 3UPPA 2R9XA 3VP0A 5FAPA 4DDSA 3LY4A 3M2JA 3Q7VB 3ISGA 1K55C 5HW3A 1L2SA 3A3IA 3A3DA 3HUNA 3HREA 4GKUA 4EBLA 2OLVA 2WGWB 4N9KA 1I5QA 3O87A 1FR6A 2OSUA 3Q81A 4GDBA 1JVJA 4X6TA 4DKIA 1YM1A 3PBNA 3ZG8B 3ZCZA 5JYPA 4IBRA 2ZM0A 1MY8A 4S2NC 3IQAA 4PM6A 1K4FA 2Y2NA 2EX6A 3SOIA 1BLPA 1IYSA 1K38A 1K4EA 4PMAA 4OPZA 3IXDA 3W4QA 1JTDA 5GLAA 1W8QA 3TOIA 1YLPA 4M3KA 2Y2KA 4S2PA 4YFMA 3VSLA 3V5MA 2VGJA 5GHXA 5I94A 3UDFA 1FSWA 1ESUA 2QMIA 5E43A 5GLBA 3WRZA 3VFHA 3HLCA 3G35A 5U47A 2QPNA 4P87A 3MBZA 5EOEA 4S2IA 2C5WB 3OC2A 1XPBA 4JBFA 3VSKA 5KSCA 1KVMA 3CZDA 3C7VA 1W79A 3PAEA 4E3OA 2XH9A 3MKEA 3AGEA 4KZ5A 1BLHA 5EECA 5M1AA 3VP3A 1PW8A 1K6RA 4IBXA 5KSHA 3FYZA 3WS1A 1VQQA 4MBKA 4WELA 4QJGA 2EXBA 3A3JA 3IXBA 3QNCA 5JYOA 1O7EA 4B4ZA 1K6SA 4Q8IA 4OP8A 1HZOA 2EXAA 3QNBA 5AQBA 4B4XA 3HLFA 1KE3A 3RXXA 3RXWA 3HUOA 1XX2A 3O86A 2HDRA 5TFQA 4DE0A 3PBRA 3OCNA 3VP4A 3DWKA 3UE0A 1E3UD 2Y91A 4OOYA 1SDNA 3BFDA 3HUMA 2XDMA 3PBTA 3WS5A 5CHJA 3UO9A 4KG6A 1LL9A 3DW0A 4BQMA 3VMAA 5CEDA 3N8SA 4RX3A 1Y54A 1BLSA 1K56D 3VFFA 4EV4A 1KE0A 1IYPA 4KZ4A 3D4FA 3BM6A 4E3IA 1IELA 5DTTA 4QHCA 3BFEA 1YLTA 4DE3A 2DCFA 1O07A 4UAAA 1I2SA 5E2FA 2EX2A 2WAFA 4JF6A 3PTEA 1YQSA 4OVDA 1NRFA 4JF5A 4E6XA 5DTKA 5FAOA 5DVAA 2ZQAA 3JYIA 2JE5A 4OLGA 2ZC5B 2V2FF 2Y2IA 4R4RA 4O7DA 3IXGA 4DXCA 1KDSA 1XKZA 2WADA 2DRWA 3UN7A 1GCEA 1YMSA 2IWDA 3C5AA 3WWXA 2P9VA 1WYBA 4EQIA 4BD1A 1U60A 3O3VA 1PZPA 2Y2GA 4KZ6A 1BT5A 2ZMAA 5G18A 2OLUA 3GQZA 4WMCD 4K0WA 1RGYA 1NY0A 3N6IA 2HP6A 3IHBA 3IF5A 1W7FA 5AQ7A 2J7VA 2XLNA 3ZVWA 5FDHA 1NYMA 1G68A 4OONA 1XXMA 1LI9A 1ERQA 4ZDXA 4U0XA 4X68A 3E2LA 3GSGA 2ZC7A 4HBTA 4R23A 3IF6C 3UDXA 5FQKA 1NJ4A 1SKFA 3VP1A 3HVFA 1NZOA 2Y2QA 3EQUA 4CPKA 3BLSA 1K57A 2WGIA 3OZHA 4QD4A 5FQQA 2Y59A 4DXBA 3BYDA 1GA9A 4GOGA 4ZAMA 4K91A 5A93A 2WGVA 1LL5A 4WYYA 2P74A 3HBRA 3HLDA 2Q9MA 4N1XA 5F83A 2ZJ9A 2HDSA 3SH8A 1MWSA 4OQ0A 1ES3A 1N9BA 5L2FA 5CECA 4S2MA 3V3RA 4QY5A 2H0YA 3V50A 4JXWA 3ZNTA 3SS3A 4X56A 3EQVA 4N9LA 1VM1A 3W4PA 3GV9A 5HAPA 4OPQA 1E25A 1EROA 5F1FA 4EBNA 5IHVA 1PZOA 1ONGA 4OQIA 4FH4A 3IWQA 1TDLA 4GD8A 1KGEA 3LO7A 4N1HA 3MKFA 5CGSA 1IEMA 5F82A 3N7WA 4GNUA 5FQMA 3IH9A 2ZM2A 4ID4A 5DTSA 5GL9A 2Q9NA 4QB8A 5CRFA 2WAEA 1YLWA 1RCJA 1FCMA 3IH8A 4LV1A 4Y7PA 4E3MA 2FFFB 4PM5A 3IT9A 3HLGA 2J9OA 3IF6B 3V39A 4PM9A 2HP5A 5GHYA 2ZD8A 3I7JA 4BL3A 3SH9A 3FWLA 1IYOA 3N4IA 4MEZA 3HLEA 4UA7A 1K54A 1RGZA 1KGFA 3GVBA 4XUXA 3AGFA 3IHAA 4NK3A 5FQJA 4OPRA 5M18A 2WKHA 3QHYA 3FZCA 3SH7A 3M6BA 4QU3A 4BL2A 3NI9A 1CEFA 2WYXA 4C75A 1ES4A 1PI4A 2ZLYA 1HVBA 3ITBA 1QMFA 4MNRA 3FKWA 4IVKA 4F94A 1ESIA 4S2JA 4P6BA 1SCWA 3V3SA 3C7UA 3ZNYA 5HARA 3NBLA 1AXBA 1H8YA 2Y2LA 4WZ5C 1RP5A 1L0FA 5EVIC 1LHYA 1BUEA 2ZQCA 4JLFA 3WRTA 1YMXA 4E3JA 3PBSA 2PU4A 4GN2A 2Y2PA 3UPOA 4LV0A 5FATA 5A92A 2A3UA 3G31A 4E3KA 1OMEA 3WS0A 3W4OA 4X55A 1IKGA 4GB7A 4OOMA 3G2YA 4JKTA 4OKPA 5A90A 5KMWA 5HFOA 2JBFA 2XF3A 2EFUA 2BG1A 4A5RA 2J9PA 1L0EA 1Q2QA 5DF8A 4MBFA 3PBQA 1G6AA 3CMZA 3MXSA 5FSRA 2EFXA 3HL9A 4L0LA 4EBPA 1IKIA 1KE4A 5DF7A 3Q1FA 1K55A 2QZ6A 2G2UA 3E2KA 4DE2A 5DF9A 3NCKA 5EVID 1MXOA 3GMWA 1XA1A 2EX8A 3OCLA 3MZFA 1PIOA 2Y55A 1ZG4A 2HDUA 3S4XA 1DJBA 4S2NA 5FAQA 2Y4AA 3ZG7B 1C3BA 4KZAA 5J8XA 1ZC2A 5CEBA 4EWFA 1Z6FA 1PYYA 3BFGA 2XK1A 4FH2A 4XUZA 5AQAA 4DRTA 3BFFA 5A91A 4OP5A 1E4DA 3UDIA 1SDEA 4JF4A 3VOYA 1DY6A 3UPNA 4OQGA 2VGKA 5EVIB 1KVLA 5TGFA 1NYYA 5CGWA 3BECA 1MBLA 3M2KA 1LI0A 4PM7A 3G34A 4KENB 5GLDA 2Z2MB 2ZM8A 3DTMA 5GLCA 1YLZA 4KZ3A 4LV3A 3ZG5A 1BZAA 4ZBEA 4E3NA 3WS2A 3G30A 4QY6A 1K56A 1EI5A 1S6RA 5EVLA 1DJAA 1FR1A 1HD8A 1PWDA 1ZG6A 3BEBA 3Q07A 4OPYA 5D3OA 5FI2A 1BTLA 4MBHA 4FCFA 2JCHA 3HLWA 4CJNA 4BLMA 1ERMA 2X71A 3Q82A 2WUQA 4HBUA 4IVIA 5CTMA 4WM9A 4U3TA
chains in the Genus database with same CATH superfamily
4RQ9A 5IS1A 2JKTM 4ZJ3A 3MJQA 4HEFA 3ZDJA 1ALQA 2ZOIA 2LB5A 3NY4A 4B9OA 2HP9A 3M6HA 1PWCA 3HJKA 3LIBA 3Q7ZA 2B95A 1GSWA 3S7OA 3PAGA 4HESA 4OH0A 2UWXA 1N9NA 1LSVA 2XQZA 5BOHA 4JGQA 4RYEA 3Q7VA 2BLSA 3A3EA 4Z9QA 3P98A 1M40A 4JXSA 3V67A 2WGWA 3CWFA 4UA9A 3MXQA 3GDIA 5DJTA 2XA7M 2OV5A 4LCMA 3LY3A 1SHVA 1DP6A 1STZA 1LLBA 2A49A 4E3LA 4K08A 3NOUC 1S66L 3C4PA 2RL3A 2Z6CA 3NDEA 4FSFA 4C3QA 1TS7A 3LEZA 5IU1A 3UY6A 3FG8A 1W5DA 5HD3A 3SS4A 2WKIA 1FCOA 2H0TA 5KZHA 3E4PA 3KYEA 1VETB 1CK3A 1Y28A 3DTIA 4IUKA 4WL9A 3BW6A 4UEYA 5F1GA 2VK3A 1VEUB 3A0SA 5F68A 4ZTKA 4NXEA 1W63Q 4Y0OA 5EFWA 4Y0UA 4EEUA 5TR7A 2Z2LB 5EUAA 3LEQA 2HV1A 3CI6A 4HOIA 4DN0A 2PR5A 2CC1A 2XR0A 3F1PA 3MXRA 3KSGA 3BFCA 1ES2A 2V20A 1E3UA 3RFBA 4R4SA 4DDYA 3IBRA 5HX9A 5AVEA 1JWVA 1H5XA 2PBDP 4YINA 1HTZA 4K0XA 1PWGA 4GD6A 4FOFA 5F5YA 1FSYA 1H0MA 3P09A 4MLLA 3PYPA 3EGXC 3HLBA 3PR6A 4XT2A 3IXHA 3MFXA 2WKQA 2KX6A 1KGGA 1FQGA 1GA0A 1NLZA 1TD5A 3LGOA 4BJPA 3G6OA 1T18A 2ACGA 2LB9A 1MWRA 2OOLA 4NETA 5TJJA 4C6YA 3UPPA 3VP0A 4DDSA 1F9IA 1AWIA 3A3IA 4GKUA 4GDBA 2OSUA 4DKIA 1YM1A 3PXPA 4S2NC 3IQAA 1K4FA 2Y2NA 4HNBA 3TOIA 3UB9A 4S2PA 4YOFA 1FSWA 3VFHA 3HLCA 1OTIA 4P87A 3MBZA 5EOEA 4S2IA 3OC2A 2A24A 4GHIB 1V9YA 2JHEA 1W79A 3MKEA 1BLHA 4IBXA 1K6RA 4BBTA 2VEAA 4PAUA 3WS1A 4MBKA 4WELA 2GX5A 3S7PA 2EXBA 1S4SA 2JKRI 4B93A 1K6SA 4Q8IA 3QP1A 3QNBA 3HLFA 3A0RA 5TFQA 3PBRA 2QWSA 1OT6A 3UE0A 3T4TA 1SDNA 2XDMA 3WS5A 3UO9A 3KSFA 3VMAA 3N8SA 4RX3A 4LRZE 1LSWA 1Y54A 2AVXA 4EV4A 2GZAA 4YNRA 1KE0A 4GJ4A 3D9YA 1IELA 4QHCA 3BFEA 2PT7A 4E6XA 2ZQAA 2L4RA 2V2FF 2Y2IA 4O7DA 3HCYA 2K2NA 4ETXA 3C5AA 1HLUP 2P9VA 2W3FA 1U60A 2Y2GA 1BT5A 2ZMAA 1T1CA 5L09A 1NY0A 1UWPX 3PHYA 1W7FA 3OOVA 2XLNA 1G5UA 1OTDA 1G68A 4OONA 1ERQA 4L9GA 4ZDXA 3TW8A 3RH8B 2NUTC 3NHQA 2W3HA 3LI9A 3BLSA 1K57A 5FQQA 2Y59A 3MQOA 4GOGA 4ZAMA 3KYQA 2ZOHA 5F83A 4N1XA 2INWA 2QKPA 4BMWA 4OQ0A 1XJ3A 1ES3A 1N9BA 4S2MA 1LSXA 4D60A 3W2ZA 4JXWA 3ZNTA 4X56A 2PDRA 3BWLA 4N9LA 3L7HA 2M1CA 4UQIS 5FQMA 5DTSA 5GL9A 2Q9NA 1FCMA 3IH8A 1UWNX 2VGLM 3IT9A 2J9OA 4PM9A 5GHYA 3SH9A 4CQHA 1IYOA 4UA7A 1JNUA 1RGZA 1KGFA 5HPIA 4NK3A 1L3LA 3CHWP 1GSVA 3E0YA 4C75A 1PI4A 4GS9A 4R6LA 3ITBA 1FILA 4IVKA 1SKOA 3NBLA 3T4QA 1LHYA 2PU4A 4ARZB 5FATA 5A92A 3G31A 1OMEA 2PR6A 2GJ3A 4MMNA 2XF3A 2EFUA 2J9PA 1ACFA 1Q2QA 3PBQA 3MXSA 1N9OA 4JGRA 3Q1FA 1K55A 2QZ6A 2G2UA 5EVID 1ZG4A 2HDUA 2GNXA 3ZG7B 5DFXA 4MN7A 4CLCD 3ZYTA 3VE4A 2WKRA 4FTXA 4HY8A 4DRTA 3BFFA 1E4DA 2J3WA 5TBMB 3UPNA 3QP6A 1KVLA 3M2KA 3UMEA 4PM7A 2ZM8A 4GCZA 4EU0A 4NXBA 4QY6A 3BQAA 1EI5A 1S6RA 2ZL1B 1FR1A 1PWDA 1BTLA 4Y2FA 3QP8A 2M7VA 2FZ0A 1ERMA 4HBUA 3CUEA 1XJ6A 1D7EA 3OPPA 4H8RA 4F3LB 3IWOA 2Y2MA 5CXWA 3DTKA 3K3CA 2YKFA 2FFYA 4R3BA 1K25A 4EUVA 3W8KA 3CG5A 4GDNA 2J8YA 1J9MA 3B3XA 4U0TA 3UNWA 3WS4A 3ZGAB 4JXGA 5FASA 2B18A 1UGUA 4H6JA 2OWHA 4OOLA 4EUZA 1W8YA 2P04A 4EXOA 2PBYA 2W3EA 4O0PA 4EERA 3BQ8A 4Q0JA 1YT4A 5E2EA 1L0GA 3H82B 1TEMA 3MF0A 3N8LA 5HL1A 1DP8A 4IEDA 5EOOA 4R3AA 3DWZA 1WE4A 3IF6A 1S0WA 5E2HA 1OTAA 2HDQA 2M7UA 1Q2PA 3IX3A 2WZZA 3UB5P 3UE3A 4KQDA 5CHMA 4CLCC 5J7EA 4Y0TA 2XFTA 3T50A 4D2OA 2L1MA 1MWUA 5E2GA 2X01A 3U4LP 4OLDA 1I2WA 1TVFA 1YKDA 1ZKJA 3IWIA 3ZHHA 2O0YA 2O99A 3S22A 3SS5A 4GZBA 5CGXA 2XGNA 3MQ0A 3FV7A 2J3TD 1BULA 5HSQA 2V1BA 4EQ1A 3EWKA 3KYZA 2OAQ1 3D72A 2MJ6A 2D01A 5L8MA 2XROA 1KOUA 1K54C 3AGDA 2R78A 1CQAA 5CERA 1M6KA 2W27A 1YPRA 1TS8A 3OPLA 5FQ9A 2GDNA 4EESA 2JKTI 1XA7A 1JTGA 2C6WB 4R3JA 4KZBA 2E8IA 1N4OA 3OPRA 2HZ5A 2V0WA 1KDWA 2ZQ7A 1OPXA 3GR2A 4OQHA 5EVIA 4KZ8A 4MDZA 2BASA 3VP2A 2G2WA 4E04A 3CPTB 2X02A 4AFIA 3MZEA 3F1OA 2R9XA 3LIDA 5FAPA 3Q7VB 3ISGA 3LICA 3A3DA 3HREA 2WGWB 4N9KA 1I5QA 1JVJA 4X6TA 5JYPA 4IBRA 4PM6A 2L0WA 1K38A 2V8FA 4OPZA 2KOIA 3IXDA 3C38A 1YLPA 4YFMA 3V5MA 3UDFA 5E43A 3WRZA 1F98A 3G35A 2DMWA 4JBFA 4M4XA 3VSKA 2HJ9C 3CZDA 4KUOA 5EECA 3VP3A 5KSHA 1XFNA 2UV0E 1VQQA 4QJGA 3QNCA 1O7EA 2J3TC 1KE3A 3RXXA 3RXWA 1XX2A 3O86A 2HDRA 3EOIA 2VA0A 1OT9A 5CHJA 1LL9A 2NUPC 3O5YA 1BLSA 2ZMFA 3BM6A 1WA9A 4E3IA 1YLTA 4UAAA 1O07A 2EX2A 4JF6A 3PTEA 1NRFA 4JF5A 2JE5A 4OLGA 4L9FA 1VETA 4DXCA 4JGOA 2IWDA 3WWXA 1WYBA 4PKYA 1FIKA 1VEUA 1PZPA 4KZ6A 2WKPA 4O01A 4P6ZM 4WMCD 5DFYA 2HP6A 3IHBA 4XT2B 3FC7A 1D1JA 3ZVWA 3UB8A 1XXMA 1S4RA 1GSXA 4X68A 2P7JA 4HBTA 4R23A 5FQKA 1NJ4A 1NZOA 2Y2QA 1G28A 4QD4A 3BYDA 2VGLS 1GA9A 3TJZC 1LL5A 3F1NB 2P74A 5HWVA 4PKYG 3HLDA 2ZJ9A 2HDSA 5G4YA 2JKFA 3V3RA 1NWZA 4QY5A 3V50A 2W3DA 3W4PA 3GV9A 2O9BA 1EROA 5IHVA 1PZOA 4G3VA 4OQIA 1T19A 3IWQA 4ETZA 4Z1WA 2YKHA 3MKFA 5CGSA 3SZTA 1IEMA 3C2WA 5F82A 2ZM2A 4ID4A 4I3AA 4QB8A 2J80A 2W1RA 2WAEA 4LV1A 3HLGA 3FWLA 3N4IA 1S67L 1LL8A 3ULFA 4OPRA 2WKHA 3QHYA 5FDSA 3M6BA 4BL2A 1CEFA 5KIZA 2ZLYA 4MNRA 3V3SA 3KO6A 3C7UA 4X1LA 3LFVA 4WZ5C 5HWWA 1RP5A 2V1AA 4E3JA 4GN2A 4NEED 4LV0A 4GHIA 2Q0OA 3H9WA 2PRFA 2FH5A 3WS0A 3W4OA 5EVEA 1IKGA 1ZTUA 4OKPA 4DJ3A 3K2NA 3T4LA 1L0EA 3CLOA 3CMZA 2EFXA 5DF7A 3EGDC 3E2KA 5DF9A 3OCLA 5G4ZA 4LRXC 3S4XA 1DJBA 4S2NA 3DAVA 5LBRA 3VOLA 4Y3IA 3BJNA 4KZAA 4IUHA 2KLIA 5J8XA 4EWFA 3ICYA 1PYYA 2VV8A 2XK1A 3LIEA 5AQAA 4OP5A 1NYYA 1MBLA 2B02A 4ZRRA 5GLDA 2Z2MB 5GLCA 1YLZA 3NECA 3WS2A 3BEBA 5FI2A 1ZG6A 5D3OA 1F5MA 4MBHA 4G3WA 4FCFA 2JCHA 2G7UA 4BLMA 3Q82A 5HDCA 1BYWA 4HJ3A 4BENA 5FA7A 2ZQ9A 2VZWA 5HAIA 3BY8A 4WF0A 4B88A 1IYQA 1PW1A 3E4OA 1TS0A 4GLQA 3LYXA 4Y15A 5FQIA 3MR0A 3NIAA 4WEKA 3FPWA 1OTBA 1OTEA 4P85A 3EEAA 1IFQA 1XGJA 4ZJ1A 1MKIA 4JXVA 1CEGA 2JC7A 4QPRA 3N8RA 4KZ9A 3CAXA 4Y17A 3OPHA 4X53A 2B5RA 3G32A 1Z09A 1MKMA 3NJAA 3O88A 2E8JA 5MC7A 4S2KA 4LCLA 4LPZA 2WZXA 4X25A 3GECA 1DJCA 4S2LA 1ZHHB 3KSHA 2ZQDA 2P08A 4I38A 1SKOB 5HAQA 2RCXA 4KQOA 1NZUA 5M19A 1FCNA 2XD5A 3CJMA 1P97A 4LENA 4LV2A 1PI5A 1GHIA 3R7WB 2R9WA 1PRQA 4N92A 5CX7A 1BSGA 1EW0A 3A0VA 1H8ZA 4WEJA 2VKSA 2EX9A 1P9WA 5FI6A 3B42A 4Y5FA 4DF6A 3LR0A 4KZ7A 4FD8A 3T4SA 4P0MA 4E6WA 4NKPA 1P9RA 4RX2A 4DE1A 2VX8A 1F2KA 5EPHA 4KG2A 1XJ4A 3RTYA 4R1GA 4NXGA 2I72A 4JPMA 4BWIA 1X0OA 1XP4A 3IX8A 2ZQ8A 4CLCE 5CHUA 2ZC4B 4R0QA 4MN6A 2EWWA 2XSSA 5J4EA 4JGPA 3IS2A 4ESPA 3TSGA 2H5SA 3KX0X 1CF0A 1V9ZA 4R70A 1MWTA 3IX4A 3T4KA 3GRJA 3H7WB 3FPVA 2XA7S 4UHUA 3R4KA 1EWZA 1GHMA 1OJGA 3BLMA 1CI8A 3G2ZA 3ITAA 5AQ9A 3ZVTA 3PBOA 4ZJ2A 3NC8A 4RVAA 2Z6DA 1S1YA 2ZL1A 2EWVA 4I5SA 3HUNA 2OLVA 3O87A 1FR6A 4HHDA 4HP9A 1D06A 3PBNA 2ZM0A 2EX6A 1K4EA 4PMAA 3W4QA 1JTDA 3P7NA 4I39A 2Y2KA 3T1XA 1CJFA 5I94A 4BBVA 5FEGA 2W1TB 3OBFA 4HP4A 5HPFA 4HI4A 5DJUA 1XPBA 1KVMA 4BBUA 3HJIA 2H28A 2XH9A 3C8CA 3AGEA 3IBJA 4KZ5A 1PW8A 3FYZA 5JYOA 4OP8A 2EXAA 4LGWA 5AQBA 4B4XA 2PD7A 3OCNA 3VP4A 1E3UD 3H82A 2Y91A 4I3IA 4OOYA 3DW0A 4BQMA 1IYPA 2QHKA 2VV7A 4DE3A 2DCFA 1I2SA 2WAFA 1DP9A 1YQSA 4HH3A 4OVDA 5FAOA 3JYIA 3IXGA 2WADA 2DRWA 3E98A 4ME4A 4EQIA 4BD1A 2OLUA 3GQZA 4K0WA 1RGYA 3IF5A 5AQ7A 2J7VA 1YSPA 2PYPA 1LI9A 3GSGA 3LIAA 3LIFA 1IOUA 3UDXA 2JN7A 1G6OA 3HVFA 1DRMA 5L07A 3F1OB 4IJGA 5A93A 3HBRA 3SH8A 1MWSA 4CLCA 3LR3A 5CECA 3SS3A 1VM1A 5HAPA 3QP5A 4OPQA 4R38A 4EBNA 5HDDA 4EEPA 2VJWA 4EETB 4FH4A 4GD8A 3LO7A 4WN5A 2D02A 3JPUA 4GNUA 2VV6A 1YLWA 4Y7PA 4E3MA 3CPTA 3I7JA 4BL3A 4EW7A 4MEZA 1K54A 3GVBA 4XUXA 3AGFA 3IHAA 3FZCA 4HQAA 4QU3A 3NI9A 1ES4A 1VB6A 3CITA 4F94A 1ESIA 4S2JA 2Y79A 4P6BA 2VLGA 5DKKA 1AXBA 1H8YA 1L0FA 2ZQCA 2OAP1 3WRTA 3UPOA 2Y2PA 3NOPC 4X55A 4OOMA 3G2YA 2W0NA 5HFOA 3F1PB 2BG1A 4MBFA 1G6AA 4PHTA 4EBPA 4Q0HA 1KE4A 1J3WA 1MXOA 1XA1A 2EX8A 3MZFA 3LR5A 1PIOA 2Y55A 3VE3A 3QP4A 4LLOB 5DKLA 1C3BA 1ZC2A 5CEBA 5HZHA 3BFGA 4XUZA 4FH2A 4LRYC 3K3DA 4WUJA 3VOYA 1DY6A 4OQGA 3BECA 3EEHA 4KENB 2XRNA 1VHMA 1BZAA 3B47A 5EVLA 1DJAA 3Q07A 1HD8A 3T1RA 1SZVA 5C5KA 4CJNA 2X71A 4IVIA 5CTMA 5HARA 4YWZA 5EE8A 1T1BA 1XGIA 3LCEA 5FEFA 2JKGA 2Y2HA 5HL6A 1NXYA 3UE1A 4WLAA 2DNSA 1GHPA 1NLYA 2HPBA 4PPRA 2PAVP 5GHZA 3NULA 2A24B 3F1NA 3GTCA 1K0KA 3NDGA 3UMDA 4KQQA 3B33A 3DTEA 2I9VA 2WKEA 4GW9A 3MFDA 1A0KA 4RA7A 3S1YA 2V1ZA 2XEPA 4NG2A 4S2OA 1LT0A 4II7A 4I3JA 2Y2JA 3TRCA 3G4PA 1L0DA 4O8GA 1YLJA 2WK0A 3MZDA 3OLOA 3VOZA 3T4OA 4KUKA 1K57C 2XD1A 4X69A 1YLYA 3ZG9B 3ZG0A 3A3FA 2P9VB 2ZC6B 4DMZA 1TF1A 3UB7A 4X1MA 2JKRM 5CTNA 2PU2A 2A2LA 3BY9A 1QMEA 4XXRA 2HGVA 2V9AA 1P0ZA 4UA6A 4WBGA 1FOFA 2ZC3B 3KSIA 1YAXA 1ES5A 3T1SA 4BD0A 2XFSA 1CI9A 1BLCA 4QWOA 4KG5A 2H10A 2EA9A 2IWBA 1XFQA 1WYCA 1MPLA 1Y4OA 4IHQA 3FKVA 2QJ5A 2HF6A 4LFUA 2IWCA 4HIAA 2Y2OA 4PM8A 1ONHA 3L9KA 2K31A 1JWZA 3C30A 3BRMA 3C4OA 2V8CA 5FI7A 4WZ5A 3ZFZA 4MN5A 4WZ4A 3VV4A 1JWPA 5A8BA 4KQRA 3TG9A 1TDGA 3RJUA 4WMCA 3D3OA 3JVUA 3LY4A 3M2JA 1K55C 5HW3A 1MZUA 1L2SA 4EBLA 3MQQA 3Q81A 3ZG8B 3ZCZA 5K5BA 1MY8A 3S7NA 3SOIA 1BLPA 1IYSA 2HJEA 3T1QB 5GLAA 1W8QA 4NXFA 4GS9B 4M3KA 3VSLA 3P01A 3LI8A 2VGJA 5GHXA 5L10A 5GLBA 1ESUA 2QMIA 5U47A 2QPNA 2C5WB 1MC0A 5KSCA 3C7VA 3PAEA 4E3OA 1T1AA 5M1AA 3E4QA 1PFLA 3A3JA 3DBAA 3IXBA 3T4JA 4B4ZA 3CUEC 1HZOA 3HUOA 3NOTC 4DE0A 3DWKA 2BTFP 3BFDA 3HUMA 3PBTA 5CEDA 4KG6A 3S7QA 1K56D 3VFFA 3JVVA 5F6AA 4L9EA 1H8MA 4KZ4A 3D4FA 3R7WA 5DTTA 2CMNA 1YSQA 4ARZA 2KDKA 5E2FA 5HDSA 5EM0A 3MSHA 5DTKA 5DVAA 3IS2B 2ZC5B 4R4RA 1KDSA 1XKZA 4DJ2A 3UN7A 1GCEA 1YMSA 3O3VA 4Y13A 5G18A 3LUQA 3N6IA 5FDHA 1NYMA 4U0XA 3E2LA 2PYRA 3SW1A 2ZC7A 3IF6C 1SKFA 2OWJA 3MMHA 3VP1A 5IT5A 2QJ7A 3EQUA 2V0UA 1W63M 5TBMA 4CPKA 3OZHA 2WGIA 4DXBA 2PD8A 3LR4A 5AJGA 4K91A 2WGVA 2W3GA 4WYYA 2Q9MA 1N9LA 5L2FA 2H0YA 4H6JB 2K7SA 3EQVA 1E25A 5F1FA 1ONGA 2O9CA 3H7WA 4Q0IA 1TDLA 4F3LA 1KGEA 4N1HA 2O9AA 3N7WA 3UB6A 3IH9A 5CRFA 2PHYA 1RCJA 1ODVA 2FFFB 4PM5A 3IF6B 3V39A 2HP5A 2ZD8A 3HLEA 5FQJA 5M18A 2Y8HA 3SH7A 4HJ6A 4G3KA 2WYXA 5AVFA 1HVBA 4HH2A 1QMFA 3FKWA 1SCWA 3UE6A 2W1TA 3ZNYA 1PNEA 4P6ZS 2Y2LA 4UQIM 5EVIC 1BUEA 4JLFA 1YMXA 3PBSA 2IA2A 3MS6A 3QP2A 1OJ5A 5FL3A 2A3UA 3ZQ5A 4E3KA 5F69A 4GB7A 5A90A 4JKTA 5KMWA 2JBFA 4A5RA 5DF8A 5FSRA 3HL9A 4L0LA 5EV0A 1IKIA 2ZBBA 4DE2A 1NRJA 5EM1A 3NCKA 3GMWA 2QYBA 1H3QA 2ZMVA 5FAQA 2Y4AA 1TS6A 3TE8A 5HWTA 3T12B 5J3WA 1Z6FA 1S1ZA 5A91A 3UDIA 1SDEA 4JF4A 4MCWA 2VGKA 5EVIB 5I5LA 5TGFA 5CGWA 3U2AA 1LI0A 3G34A 4HJ4A 3DTMA 4KZ3A 4LV3A 3ZG5A 4ZBEA 4E3NA 1XJ2A 3G30A 1K56A 4CLCB 4OPYA 4FUWA 3HLWA 5HD5A 2WUQA 4WM9A 4U3TA
chains in the Genus database with same CATH topology
3OPPA 4BENA 5FA7A 2ZQ9A 5EE8A 1XGIA 5HAIA 3LCEA 4H8RA 4ZJ3A 4HEFA 3IWOA 4B88A 2Y2HA 3ZDJA 1IYQA 2Y2MA 1ALQA 1PW1A 5CXWA 1NXYA 3UE1A 5FQIA 3NIAA 2DNSA 1GHPA 3NY4A 4WEKA 2HP9A 4P85A 2FFYA 4R3BA 2HPBA 4PPRA 1K25A 1XGJA 3M6HA 3W8KA 1PWCA 4ZJ1A 5GHZA 3CG5A 4GDNA 1MKIA 4JXVA 1CEGA 2JC7A 3Q7ZA 3PAGA 3N8RA 2J8YA 4HESA 1J9MA 3B3XA 4KZ9A 4OH0A 4U0TA 3UNWA 3GTCA 3OPHA 4X53A 3WS4A 3ZGAB 2B5RA 2UWXA 3G32A 4JXGA 5FASA 2XQZA 5BOHA 3NDGA 4KQQA 4RYEA 3Q7VA 3O88A 2WKEA 2BLSA 3MFDA 3A3EA 4OOLA 4Z9QA 4EUZA 1W8YA 3P98A 1M40A 4S2KA 4RA7A 3S1YA 2PBYA 4JXSA 4LCLA 2WGWA 2V1ZA 2XEPA 4UA9A 2WZXA 4S2OA 1DJCA 4S2LA 2Y2JA 2ZQDA 1YT4A 2OV5A 5E2EA 5HAQA 1L0GA 4LCMA 1TEMA 3LY3A 2RCXA 4KQOA 1NZUA 3G4PA 1SHVA 1L0DA 2A49A 1FCNA 1LLBA 2XD5A 4E3LA 5M19A 3CJMA 3N8LA 5HL1A 1YLJA 2WK0A 4IEDA 5EOOA 3MZDA 3C4PA 3VOZA 4LENA 2RL3A 4LV2A 1PI5A 3NDEA 4FSFA 4C3QA 3DWZA 1WE4A 1GHIA 1K57C 3IF6A 1S0WA 2R9WA 5E2HA 3LEZA 2HDQA 2XD1A 4N92A 4X69A 3UY6A 1Q2PA 1BSGA 1YLYA 1W5DA 3SS4A 2WZZA 2WKIA 1H8ZA 1FCOA 3UE3A 2H0TA 3ZG9B 3ZG0A 5KZHA 4WEJA 5CHMA 2EX9A 1CK3A 2XFTA 4Y0TA 4D2OA 1MWUA 5FI6A 5E2GA 2X01A 3A3FA 4DF6A 2P9VB 4OLDA 4KZ7A 2ZC6B 5F1GA 1I2WA 1TVFA 1ZKJA 4FD8A 4P0MA 4E6WA 4ZTKA 5CTNA 4Y0OA 3IWIA 4RX2A 3ZHHA 2PU2A 4Y0UA 4DE1A 5TR7A 3S22A 3SS5A 5EPHA 4GZBA 5CGXA 2Z2LB 5EUAA 4KG2A 2XGNA 4R1GA 2I72A 3FV7A 1BULA 1QMEA 4XXRA 4JPMA 1XP4A 2XR0A 2CC1A 3MXRA 2ZQ8A 4UA6A 1FOFA 4WBGA 2ZC3B 5CHUA 2ZC4B 4R0QA 3BFCA 1ES2A 1K54C 3AGDA 2V20A 1ES5A 4BD0A 1E3UA 5CERA 2XFSA 1CI9A 4R4SA 1M6KA 4DDYA 1BLCA 3TSGA 2H5SA 5HX9A 4KG5A 1JWVA 3OPLA 5FQ9A 1H5XA 2GDNA 2H10A 2IWBA 1XA7A 1JTGA 1MWTA 4YINA 1HTZA 2C6WB 4K0XA 1PWGA 1WYCA 4GD6A 1MPLA 4R3JA 1FSYA 4KZBA 2E8IA 3P09A 3FKVA 4MLLA 1N4OA 3HLBA 3OPRA 2IWCA 2Y2OA 4PM8A 3GRJA 3IXHA 1ONHA 1KDWA 2ZQ7A 1JWZA 4UHUA 3BRMA 3C4OA 3GR2A 5FI7A 4WZ5A 1EWZA 1KGGA 1FQGA 1GHMA 4OQHA 5EVIA 3ZFZA 3BLMA 1GA0A 4KZ8A 4BJPA 1CI8A 3G2ZA 3ITAA 4WZ4A 5AQ9A 1JWPA 1MWRA 3ZVTA 3PBOA 4KQRA 4NETA 3TG9A 4ZJ2A 1TDGA 3VP2A 3NC8A 3RJUA 2G2WA 4RVAA 2X02A 4WMCA 4C6YA 3MZEA 3UPPA 2R9XA 3VP0A 5FAPA 4DDSA 3LY4A 3M2JA 3Q7VB 3ISGA 1K55C 5HW3A 1L2SA 3A3IA 3A3DA 3HUNA 3HREA 4GKUA 4EBLA 2OLVA 2WGWB 4N9KA 1I5QA 3O87A 1FR6A 2OSUA 3Q81A 4GDBA 1JVJA 4X6TA 4DKIA 1YM1A 3PBNA 3ZG8B 3ZCZA 5JYPA 4IBRA 2ZM0A 1MY8A 4S2NC 3IQAA 4PM6A 1K4FA 2Y2NA 2EX6A 3SOIA 1BLPA 1IYSA 1K38A 1K4EA 4PMAA 4OPZA 3IXDA 3W4QA 1JTDA 5GLAA 1W8QA 3TOIA 1YLPA 4M3KA 2Y2KA 4S2PA 4YFMA 3VSLA 3V5MA 2VGJA 5GHXA 5I94A 3UDFA 1FSWA 1ESUA 2QMIA 5E43A 5GLBA 3WRZA 3VFHA 3HLCA 3G35A 5U47A 2QPNA 4P87A 3MBZA 5EOEA 4S2IA 2C5WB 3OC2A 1XPBA 4JBFA 3VSKA 5KSCA 1KVMA 3CZDA 3C7VA 1W79A 3PAEA 4E3OA 2XH9A 3MKEA 3AGEA 4KZ5A 1BLHA 5EECA 5M1AA 3VP3A 1PW8A 1K6RA 4IBXA 5KSHA 3FYZA 3WS1A 1VQQA 4MBKA 4WELA 4QJGA 2EXBA 3A3JA 3IXBA 3QNCA 5JYOA 1O7EA 4B4ZA 1K6SA 4Q8IA 4OP8A 1HZOA 2EXAA 3QNBA 5AQBA 4B4XA 3HLFA 1KE3A 3RXXA 3RXWA 3HUOA 1XX2A 3O86A 2HDRA 5TFQA 4DE0A 3PBRA 3OCNA 3VP4A 3DWKA 3UE0A 1E3UD 2Y91A 4OOYA 1SDNA 3BFDA 3HUMA 2XDMA 3PBTA 3WS5A 5CHJA 3UO9A 4KG6A 1LL9A 3DW0A 4BQMA 3VMAA 5CEDA 3N8SA 4RX3A 1Y54A 1BLSA 1K56D 3VFFA 4EV4A 1KE0A 1IYPA 4KZ4A 3D4FA 3BM6A 4E3IA 1IELA 5DTTA 4QHCA 3BFEA 1YLTA 4DE3A 2DCFA 1O07A 4UAAA 1I2SA 5E2FA 2EX2A 2WAFA 4JF6A 3PTEA 1YQSA 4OVDA 1NRFA 4JF5A 4E6XA 5DTKA 5FAOA 5DVAA 2ZQAA 3JYIA 2JE5A 4OLGA 2ZC5B 2V2FF 2Y2IA 4R4RA 4O7DA 3IXGA 4DXCA 1KDSA 1XKZA 2WADA 2DRWA 3UN7A 1GCEA 1YMSA 2IWDA 3C5AA 3WWXA 2P9VA 1WYBA 4EQIA 4BD1A 1U60A 3O3VA 1PZPA 2Y2GA 4KZ6A 1BT5A 2ZMAA 5G18A 2OLUA 3GQZA 4WMCD 4K0WA 1RGYA 1NY0A 3N6IA 2HP6A 3IHBA 3IF5A 1W7FA 5AQ7A 2J7VA 2XLNA 3ZVWA 5FDHA 1NYMA 1G68A 4OONA 1XXMA 1LI9A 1ERQA 4ZDXA 4U0XA 4X68A 3E2LA 3GSGA 2ZC7A 4HBTA 4R23A 3IF6C 3UDXA 5FQKA 1NJ4A 1SKFA 3VP1A 3HVFA 1NZOA 2Y2QA 3EQUA 4CPKA 3BLSA 1K57A 2WGIA 3OZHA 4QD4A 5FQQA 2Y59A 4DXBA 3BYDA 1GA9A 4GOGA 4ZAMA 4K91A 5A93A 2WGVA 1LL5A 4WYYA 2P74A 3HBRA 3HLDA 2Q9MA 4N1XA 5F83A 2ZJ9A 2HDSA 3SH8A 1MWSA 4OQ0A 1ES3A 1N9BA 5L2FA 5CECA 4S2MA 3V3RA 4QY5A 2H0YA 3V50A 4JXWA 3ZNTA 3SS3A 4X56A 3EQVA 4N9LA 1VM1A 3W4PA 3GV9A 5HAPA 4OPQA 1E25A 1EROA 5F1FA 4EBNA 5IHVA 1PZOA 1ONGA 4OQIA 4FH4A 3IWQA 1TDLA 4GD8A 1KGEA 3LO7A 4N1HA 3MKFA 5CGSA 1IEMA 5F82A 3N7WA 4GNUA 5FQMA 3IH9A 2ZM2A 4ID4A 5DTSA 5GL9A 2Q9NA 4QB8A 5CRFA 2WAEA 1YLWA 1RCJA 1FCMA 3IH8A 4LV1A 4Y7PA 4E3MA 2FFFB 4PM5A 3IT9A 3HLGA 2J9OA 3IF6B 3V39A 4PM9A 2HP5A 5GHYA 2ZD8A 3I7JA 4BL3A 3SH9A 3FWLA 1IYOA 3N4IA 4MEZA 3HLEA 4UA7A 1K54A 1RGZA 1KGFA 3GVBA 4XUXA 3AGFA 3IHAA 4NK3A 5FQJA 4OPRA 5M18A 2WKHA 3QHYA 3FZCA 3SH7A 3M6BA 4QU3A 4BL2A 3NI9A 1CEFA 2WYXA 4C75A 1ES4A 1PI4A 2ZLYA 1HVBA 3ITBA 1QMFA 4MNRA 3FKWA 4IVKA 4F94A 1ESIA 4S2JA 4P6BA 1SCWA 3V3SA 3C7UA 3ZNYA 5HARA 3NBLA 1AXBA 1H8YA 2Y2LA 4WZ5C 1RP5A 1L0FA 5EVIC 1LHYA 1BUEA 2ZQCA 4JLFA 3WRTA 1YMXA 4E3JA 3PBSA 2PU4A 4GN2A 2Y2PA 3UPOA 4LV0A 5FATA 5A92A 2A3UA 3G31A 4E3KA 1OMEA 3WS0A 3W4OA 4X55A 1IKGA 4GB7A 4OOMA 3G2YA 4JKTA 4OKPA 5A90A 5KMWA 5HFOA 2JBFA 2XF3A 2EFUA 2BG1A 4A5RA 2J9PA 1L0EA 1Q2QA 5DF8A 4MBFA 3PBQA 1G6AA 3CMZA 3MXSA 5FSRA 2EFXA 3HL9A 4L0LA 4EBPA 1IKIA 1KE4A 5DF7A 3Q1FA 1K55A 2QZ6A 2G2UA 3E2KA 4DE2A 5DF9A 3NCKA 5EVID 1MXOA 3GMWA 1XA1A 2EX8A 3OCLA 3MZFA 1PIOA 2Y55A 1ZG4A 2HDUA 3S4XA 1DJBA 4S2NA 5FAQA 2Y4AA 3ZG7B 1C3BA 4KZAA 5J8XA 1ZC2A 5CEBA 4EWFA 1Z6FA 1PYYA 3BFGA 2XK1A 4FH2A 4XUZA 5AQAA 4DRTA 3BFFA 5A91A 4OP5A 1E4DA 3UDIA 1SDEA 4JF4A 3VOYA 1DY6A 3UPNA 4OQGA 2VGKA 5EVIB 1KVLA 5TGFA 1NYYA 5CGWA 3BECA 1MBLA 3M2KA 1LI0A 4PM7A 3G34A 4KENB 5GLDA 2Z2MB 2ZM8A 3DTMA 5GLCA 1YLZA 4KZ3A 4LV3A 3ZG5A 1BZAA 4ZBEA 4E3NA 3WS2A 3G30A 4QY6A 1K56A 1EI5A 1S6RA 5EVLA 1DJAA 1FR1A 1HD8A 1PWDA 1ZG6A 3BEBA 3Q07A 4OPYA 5D3OA 5FI2A 1BTLA 4MBHA 4FCFA 2JCHA 3HLWA 4CJNA 4BLMA 1ERMA 2X71A 3Q82A 2WUQA 4HBUA 4IVIA 5CTMA 4WM9A 4U3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPP A;  4BEN A;  5FA7 A;  2ZQ9 A;  5EE8 A;  1XGI A;  5HAI A;  3LCE A;  4H8R A;  4ZJ3 A;  4HEF A;  3IWO A;  4B88 A;  2Y2H A;  3ZDJ A;  1IYQ A;  2Y2M A;  1ALQ A;  1PW1 A;  5CXW A;  1NXY A;  3UE1 A;  5FQI A;  3NIA A;  2DNS A;  1GHP A;  3NY4 A;  4WEK A;  2HP9 A;  4P85 A;  2FFY A;  4R3B A;  2HPB A;  4PPR A;  1K25 A;  1XGJ A;  3M6H A;  3W8K A;  1PWC A;  4ZJ1 A;  5GHZ A;  3CG5 A;  4GDN A;  1MKI A;  4JXV A;  1CEG A;  2JC7 A;  3Q7Z A;  3PAG A;  3N8R A;  2J8Y A;  4HES A;  1J9M A;  3B3X A;  4KZ9 A;  4OH0 A;  4U0T A;  3UNW A;  3GTC A;  3OPH A;  4X53 A;  3WS4 A;  3ZGA B;  2B5R A;  2UWX A;  3G32 A;  4JXG A;  5FAS A;  2XQZ A;  5BOH A;  3NDG A;  4KQQ A;  4RYE A;  3Q7V A;  3O88 A;  2WKE A;  2BLS A;  3MFD A;  3A3E A;  4OOL A;  4Z9Q A;  4EUZ A;  1W8Y A;  3P98 A;  1M40 A;  4S2K A;  4RA7 A;  3S1Y A;  2PBY A;  4JXS A;  4LCL A;  2WGW A;  2V1Z A;  2XEP A;  4UA9 A;  2WZX A;  4S2O A;  1DJC A;  4S2L A;  2Y2J A;  2ZQD A;  1YT4 A;  2OV5 A;  5E2E A;  5HAQ A;  1L0G A;  4LCM A;  1TEM A;  3LY3 A;  2RCX A;  4KQO A;  1NZU A;  3G4P A;  1SHV A;  1L0D A;  2A49 A;  1FCN A;  1LLB A;  2XD5 A;  4E3L A;  5M19 A;  3CJM A;  3N8L A;  5HL1 A;  1YLJ A;  2WK0 A;  4IED A;  5EOO A;  3MZD A;  3C4P A;  3VOZ A;  4LEN A;  2RL3 A;  4LV2 A;  1PI5 A;  3NDE A;  4FSF A;  4C3Q A;  3DWZ A;  1WE4 A;  1GHI A;  1K57 C;  3IF6 A;  1S0W A;  2R9W A;  5E2H A;  3LEZ A;  2HDQ A;  2XD1 A;  4N92 A;  4X69 A;  3UY6 A;  1Q2P A;  1BSG A;  1YLY A;  1W5D A;  3SS4 A;  2WZZ A;  2WKI A;  1H8Z A;  1FCO A;  3UE3 A;  2H0T A;  3ZG9 B;  3ZG0 A;  5KZH A;  4WEJ A;  5CHM A;  2EX9 A;  1CK3 A;  2XFT A;  4Y0T A;  4D2O A;  1MWU A;  5FI6 A;  5E2G A;  2X01 A;  3A3F A;  4DF6 A;  2P9V B;  4OLD A;  4KZ7 A;  2ZC6 B;  5F1G A;  1I2W A;  1TVF A;  1ZKJ A;  4FD8 A;  4P0M A;  4E6W A;  4ZTK A;  5CTN A;  4Y0O A;  3IWI A;  4RX2 A;  3ZHH A;  2PU2 A;  4Y0U A;  4DE1 A;  5TR7 A;  3S22 A;  3SS5 A;  5EPH A;  4GZB A;  5CGX A;  2Z2L B;  5EUA A;  4KG2 A;  2XGN A;  4R1G A;  2I72 A;  3FV7 A;  1BUL A;  1QME A;  4XXR A;  4JPM A;  1XP4 A;  2XR0 A;  2CC1 A;  3MXR A;  2ZQ8 A;  4UA6 A;  1FOF A;  4WBG A;  2ZC3 B;  5CHU A;  2ZC4 B;  4R0Q A;  3BFC A;  1ES2 A;  1K54 C;  3AGD A;  2V20 A;  1ES5 A;  4BD0 A;  1E3U A;  5CER A;  2XFS A;  1CI9 A;  4R4S A;  1M6K A;  4DDY A;  1BLC A;  3TSG A;  2H5S A;  5HX9 A;  4KG5 A;  1JWV A;  3OPL A;  5FQ9 A;  1H5X A;  2GDN A;  2H10 A;  2IWB A;  1XA7 A;  1JTG A;  1MWT A;  4YIN A;  1HTZ A;  2C6W B;  4K0X A;  1PWG A;  1WYC A;  4GD6 A;  1MPL A;  4R3J A;  1FSY A;  4KZB A;  2E8I A;  3P09 A;  3FKV A;  4MLL A;  1N4O A;  3HLB A;  3OPR A;  2IWC A;  2Y2O A;  4PM8 A;  3GRJ A;  3IXH A;  1ONH A;  1KDW A;  2ZQ7 A;  1JWZ A;  4UHU A;  3BRM A;  3C4O A;  3GR2 A;  5FI7 A;  4WZ5 A;  1EWZ A;  1KGG A;  1FQG A;  1GHM A;  4OQH A;  5EVI A;  3ZFZ A;  3BLM A;  1GA0 A;  4KZ8 A;  4BJP A;  1CI8 A;  3G2Z A;  3ITA A;  4WZ4 A;  5AQ9 A;  1JWP A;  1MWR A;  3ZVT A;  3PBO A;  4KQR A;  4NET A;  3TG9 A;  4ZJ2 A;  1TDG A;  3VP2 A;  3NC8 A;  3RJU A;  2G2W A;  4RVA A;  2X02 A;  4WMC A;  4C6Y A;  3MZE A;  3UPP A;  2R9X A;  3VP0 A;  5FAP A;  4DDS A;  3LY4 A;  3M2J A;  3Q7V B;  3ISG A;  1K55 C;  5HW3 A;  1L2S A;  3A3I A;  3A3D A;  3HUN A;  3HRE A;  4GKU A;  4EBL A;  2OLV A;  2WGW B;  4N9K A;  1I5Q A;  3O87 A;  1FR6 A;  2OSU A;  3Q81 A;  4GDB A;  1JVJ A;  4X6T A;  4DKI A;  1YM1 A;  3PBN A;  3ZG8 B;  3ZCZ A;  5JYP A;  4IBR A;  2ZM0 A;  1MY8 A;  4S2N C;  3IQA A;  4PM6 A;  1K4F A;  2Y2N A;  2EX6 A;  3SOI A;  1BLP A;  1IYS A;  1K38 A;  1K4E A;  4PMA A;  4OPZ A;  3IXD A;  3W4Q A;  1JTD A;  5GLA A;  1W8Q A;  3TOI A;  1YLP A;  4M3K A;  2Y2K A;  4S2P A;  4YFM A;  3VSL A;  3V5M A;  2VGJ A;  5GHX A;  5I94 A;  3UDF A;  1FSW A;  1ESU A;  2QMI A;  5E43 A;  5GLB A;  3WRZ A;  3VFH A;  3HLC A;  3G35 A;  5U47 A;  2QPN A;  4P87 A;  3MBZ A;  5EOE A;  4S2I A;  2C5W B;  3OC2 A;  1XPB A;  4JBF A;  3VSK A;  5KSC A;  1KVM A;  3CZD A;  3C7V A;  1W79 A;  3PAE A;  4E3O A;  2XH9 A;  3MKE A;  3AGE A;  4KZ5 A;  1BLH A;  5EEC A;  5M1A A;  3VP3 A;  1PW8 A;  1K6R A;  4IBX A;  5KSH A;  3FYZ A;  3WS1 A;  1VQQ A;  4MBK A;  4WEL A;  4QJG A;  2EXB A;  3A3J A;  3IXB A;  3QNC A;  5JYO A;  1O7E A;  4B4Z A;  1K6S A;  4Q8I A;  4OP8 A;  1HZO A;  2EXA A;  3QNB A;  5AQB A;  4B4X A;  3HLF A;  1KE3 A;  3RXX A;  3RXW A;  3HUO A;  1XX2 A;  3O86 A;  2HDR A;  5TFQ A;  4DE0 A;  3PBR A;  3OCN A;  3VP4 A;  3DWK A;  3UE0 A;  1E3U D;  2Y91 A;  4OOY A;  1SDN A;  3BFD A;  3HUM A;  2XDM A;  3PBT A;  3WS5 A;  5CHJ A;  3UO9 A;  4KG6 A;  1LL9 A;  3DW0 A;  4BQM A;  3VMA A;  5CED A;  3N8S A;  4RX3 A;  1Y54 A;  1BLS A;  1K56 D;  3VFF A;  4EV4 A;  1KE0 A;  1IYP A;  4KZ4 A;  3D4F A;  3BM6 A;  4E3I A;  1IEL A;  5DTT A;  4QHC A;  3BFE A;  1YLT A;  4DE3 A;  2DCF A;  1O07 A;  4UAA A;  1I2S A;  5E2F A;  2EX2 A;  2WAF A;  4JF6 A;  3PTE A;  1YQS A;  4OVD A;  1NRF A;  4JF5 A;  4E6X A;  5DTK A;  5FAO A;  5DVA A;  2ZQA A;  3JYI A;  2JE5 A;  4OLG A;  2ZC5 B;  2V2F F;  2Y2I A;  4R4R A;  4O7D A;  3IXG A;  4DXC A;  1KDS A;  1XKZ A;  2WAD A;  2DRW A;  3UN7 A;  1GCE A;  1YMS A;  2IWD A;  3C5A A;  3WWX A;  2P9V A;  1WYB A;  4EQI A;  4BD1 A;  1U60 A;  3O3V A;  1PZP A;  2Y2G A;  4KZ6 A;  1BT5 A;  2ZMA A;  5G18 A;  2OLU A;  3GQZ A;  4WMC D;  4K0W A;  1RGY A;  1NY0 A;  3N6I A;  2HP6 A;  3IHB A;  3IF5 A;  1W7F A;  5AQ7 A;  2J7V A;  2XLN A;  3ZVW A;  5FDH A;  1NYM A;  1G68 A;  4OON A;  1XXM A;  1LI9 A;  1ERQ A;  4ZDX A;  4U0X A;  4X68 A;  3E2L A;  3GSG A;  2ZC7 A;  4HBT A;  4R23 A;  3IF6 C;  3UDX A;  5FQK A;  1NJ4 A;  1SKF A;  3VP1 A;  3HVF A;  1NZO A;  2Y2Q A;  3EQU A;  4CPK A;  3BLS A;  1K57 A;  2WGI A;  3OZH A;  4QD4 A;  5FQQ A;  2Y59 A;  4DXB A;  3BYD A;  1GA9 A;  4GOG A;  4ZAM A;  4K91 A;  5A93 A;  2WGV A;  1LL5 A;  4WYY A;  2P74 A;  3HBR A;  3HLD A;  2Q9M A;  4N1X A;  5F83 A;  2ZJ9 A;  2HDS A;  3SH8 A;  1MWS A;  4OQ0 A;  1ES3 A;  1N9B A;  5L2F A;  5CEC A;  4S2M A;  3V3R A;  4QY5 A;  2H0Y A;  3V50 A;  4JXW A;  3ZNT A;  3SS3 A;  4X56 A;  3EQV A;  4N9L A;  1VM1 A;  3W4P A;  3GV9 A;  5HAP A;  4OPQ A;  1E25 A;  1ERO A;  5F1F A;  4EBN A;  5IHV A;  1PZO A;  1ONG A;  4OQI A;  4FH4 A;  3IWQ A;  1TDL A;  4GD8 A;  1KGE A;  3LO7 A;  4N1H A;  3MKF A;  5CGS A;  1IEM A;  5F82 A;  3N7W A;  4GNU A;  5FQM A;  3IH9 A;  2ZM2 A;  4ID4 A;  5DTS A;  5GL9 A;  2Q9N A;  4QB8 A;  5CRF A;  2WAE A;  1YLW A;  1RCJ A;  1FCM A;  3IH8 A;  4LV1 A;  4Y7P A;  4E3M A;  2FFF B;  4PM5 A;  3IT9 A;  3HLG A;  2J9O A;  3IF6 B;  3V39 A;  4PM9 A;  2HP5 A;  5GHY A;  2ZD8 A;  3I7J A;  4BL3 A;  3SH9 A;  3FWL A;  1IYO A;  3N4I A;  4MEZ A;  3HLE A;  4UA7 A;  1K54 A;  1RGZ A;  1KGF A;  3GVB A;  4XUX A;  3AGF A;  3IHA A;  4NK3 A;  5FQJ A;  4OPR A;  5M18 A;  2WKH A;  3QHY A;  3FZC A;  3SH7 A;  3M6B A;  4QU3 A;  4BL2 A;  3NI9 A;  1CEF A;  2WYX A;  4C75 A;  1ES4 A;  1PI4 A;  2ZLY A;  1HVB A;  3ITB A;  1QMF A;  4MNR A;  3FKW A;  4IVK A;  4F94 A;  1ESI A;  4S2J A;  4P6B A;  1SCW A;  3V3S A;  3C7U A;  3ZNY A;  5HAR A;  3NBL A;  1AXB A;  1H8Y A;  2Y2L A;  4WZ5 C;  1RP5 A;  1L0F A;  5EVI C;  1LHY A;  1BUE A;  2ZQC A;  4JLF A;  3WRT A;  1YMX A;  4E3J A;  3PBS A;  2PU4 A;  4GN2 A;  2Y2P A;  3UPO A;  4LV0 A;  5FAT A;  5A92 A;  2A3U A;  3G31 A;  4E3K A;  1OME A;  3WS0 A;  3W4O A;  4X55 A;  1IKG A;  4GB7 A;  4OOM A;  3G2Y A;  4JKT A;  4OKP A;  5A90 A;  5KMW A;  5HFO A;  2JBF A;  2XF3 A;  2EFU A;  2BG1 A;  4A5R A;  2J9P A;  1L0E A;  1Q2Q A;  5DF8 A;  4MBF A;  3PBQ A;  1G6A A;  3CMZ A;  3MXS A;  5FSR A;  2EFX A;  3HL9 A;  4L0L A;  4EBP A;  1IKI A;  1KE4 A;  5DF7 A;  3Q1F A;  1K55 A;  2QZ6 A;  2G2U A;  3E2K A;  4DE2 A;  5DF9 A;  3NCK A;  5EVI D;  1MXO A;  3GMW A;  1XA1 A;  2EX8 A;  3OCL A;  3MZF A;  1PIO A;  2Y55 A;  1ZG4 A;  2HDU A;  3S4X A;  1DJB A;  4S2N A;  5FAQ A;  2Y4A A;  3ZG7 B;  1C3B A;  4KZA A;  5J8X A;  1ZC2 A;  5CEB A;  4EWF A;  1Z6F A;  1PYY A;  3BFG A;  2XK1 A;  4FH2 A;  4XUZ A;  5AQA A;  4DRT A;  3BFF A;  5A91 A;  4OP5 A;  1E4D A;  3UDI A;  1SDE A;  4JF4 A;  3VOY A;  1DY6 A;  3UPN A;  4OQG A;  2VGK A;  5EVI B;  1KVL A;  5TGF A;  1NYY A;  5CGW A;  3BEC A;  1MBL A;  3M2K A;  1LI0 A;  4PM7 A;  3G34 A;  4KEN B;  5GLD A;  2Z2M B;  2ZM8 A;  3DTM A;  5GLC A;  1YLZ A;  4KZ3 A;  4LV3 A;  3ZG5 A;  1BZA A;  4ZBE A;  4E3N A;  3WS2 A;  3G30 A;  4QY6 A;  1K56 A;  1EI5 A;  1S6R A;  5EVL A;  1DJA A;  1FR1 A;  1HD8 A;  1PWD A;  1ZG6 A;  3BEB A;  3Q07 A;  4OPY A;  5D3O A;  5FI2 A;  1BTL A;  4MBH A;  4FCF A;  2JCH A;  3HLW A;  4CJN A;  4BLM A;  1ERM A;  2X71 A;  3Q82 A;  2WUQ A;  4HBU A;  4IVI A;  5CTM A;  4WM9 A;  4U3T A; 
#chains in the Genus database with same CATH topology
 4RQ9 A;  5IS1 A;  2JKT M;  4ZJ3 A;  3MJQ A;  4HEF A;  3ZDJ A;  1ALQ A;  2ZOI A;  2LB5 A;  3NY4 A;  4B9O A;  2HP9 A;  3M6H A;  1PWC A;  3HJK A;  3LIB A;  3Q7Z A;  2B95 A;  1GSW A;  3S7O A;  3PAG A;  4HES A;  4OH0 A;  2UWX A;  1N9N A;  1LSV A;  2XQZ A;  5BOH A;  4JGQ A;  4RYE A;  3Q7V A;  2BLS A;  3A3E A;  4Z9Q A;  3P98 A;  1M40 A;  4JXS A;  3V67 A;  2WGW A;  3CWF A;  4UA9 A;  3MXQ A;  3GDI A;  5DJT A;  2XA7 M;  2OV5 A;  4LCM A;  3LY3 A;  1SHV A;  1DP6 A;  1STZ A;  1LLB A;  2A49 A;  4E3L A;  4K08 A;  3NOU C;  1S66 L;  3C4P A;  2RL3 A;  2Z6C A;  3NDE A;  4FSF A;  4C3Q A;  1TS7 A;  3LEZ A;  5IU1 A;  3UY6 A;  3FG8 A;  1W5D A;  5HD3 A;  3SS4 A;  2WKI A;  1FCO A;  2H0T A;  5KZH A;  3E4P A;  3KYE A;  1VET B;  1CK3 A;  1Y28 A;  3DTI A;  4IUK A;  4WL9 A;  3BW6 A;  4UEY A;  5F1G A;  2VK3 A;  1VEU B;  3A0S A;  5F68 A;  4ZTK A;  4NXE A;  1W63 Q;  4Y0O A;  5EFW A;  4Y0U A;  4EEU A;  5TR7 A;  2Z2L B;  5EUA A;  3LEQ A;  2HV1 A;  3CI6 A;  4HOI A;  4DN0 A;  2PR5 A;  2CC1 A;  2XR0 A;  3F1P A;  3MXR A;  3KSG A;  3BFC A;  1ES2 A;  2V20 A;  1E3U A;  3RFB A;  4R4S A;  4DDY A;  3IBR A;  5HX9 A;  5AVE A;  1JWV A;  1H5X A;  2PBD P;  4YIN A;  1HTZ A;  4K0X A;  1PWG A;  4GD6 A;  4FOF A;  5F5Y A;  1FSY A;  1H0M A;  3P09 A;  4MLL A;  3PYP A;  3EGX C;  3HLB A;  3PR6 A;  4XT2 A;  3IXH A;  3MFX A;  2WKQ A;  2KX6 A;  1KGG A;  1FQG A;  1GA0 A;  1NLZ A;  1TD5 A;  3LGO A;  4BJP A;  3G6O A;  1T18 A;  2ACG A;  2LB9 A;  1MWR A;  2OOL A;  4NET A;  5TJJ A;  4C6Y A;  3UPP A;  3VP0 A;  4DDS A;  1F9I A;  1AWI A;  3A3I A;  4GKU A;  4GDB A;  2OSU A;  4DKI A;  1YM1 A;  3PXP A;  4S2N C;  3IQA A;  1K4F A;  2Y2N A;  4HNB A;  3TOI A;  3UB9 A;  4S2P A;  4YOF A;  1FSW A;  3VFH A;  3HLC A;  1OTI A;  4P87 A;  3MBZ A;  5EOE A;  4S2I A;  3OC2 A;  2A24 A;  4GHI B;  1V9Y A;  2JHE A;  1W79 A;  3MKE A;  1BLH A;  4IBX A;  1K6R A;  4BBT A;  2VEA A;  4PAU A;  3WS1 A;  4MBK A;  4WEL A;  2GX5 A;  3S7P A;  2EXB A;  1S4S A;  2JKR I;  4B93 A;  1K6S A;  4Q8I A;  3QP1 A;  3QNB A;  3HLF A;  3A0R A;  5TFQ A;  3PBR A;  2QWS A;  1OT6 A;  3UE0 A;  3T4T A;  1SDN A;  2XDM A;  3WS5 A;  3UO9 A;  3KSF A;  3VMA A;  3N8S A;  4RX3 A;  4LRZ E;  1LSW A;  1Y54 A;  2AVX A;  4EV4 A;  2GZA A;  4YNR A;  1KE0 A;  4GJ4 A;  3D9Y A;  1IEL A;  4QHC A;  3BFE A;  2PT7 A;  4E6X A;  2ZQA A;  2L4R A;  2V2F F;  2Y2I A;  4O7D A;  3HCY A;  2K2N A;  4ETX A;  3C5A A;  1HLU P;  2P9V A;  2W3F A;  1U60 A;  2Y2G A;  1BT5 A;  2ZMA A;  1T1C A;  5L09 A;  1NY0 A;  1UWP X;  3PHY A;  1W7F A;  3OOV A;  2XLN A;  1G5U A;  1OTD A;  1G68 A;  4OON A;  1ERQ A;  4L9G A;  4ZDX A;  3TW8 A;  3RH8 B;  2NUT C;  3NHQ A;  2W3H A;  3LI9 A;  3BLS A;  1K57 A;  5FQQ A;  2Y59 A;  3MQO A;  4GOG A;  4ZAM A;  3KYQ A;  2ZOH A;  5F83 A;  4N1X A;  2INW A;  2QKP A;  4BMW A;  4OQ0 A;  1XJ3 A;  1ES3 A;  1N9B A;  4S2M A;  1LSX A;  4D60 A;  3W2Z A;  4JXW A;  3ZNT A;  4X56 A;  2PDR A;  3BWL A;  4N9L A;  3L7H A;  2M1C A;  4UQI S;  5FQM A;  5DTS A;  5GL9 A;  2Q9N A;  1FCM A;  3IH8 A;  1UWN X;  2VGL M;  3IT9 A;  2J9O A;  4PM9 A;  5GHY A;  3SH9 A;  4CQH A;  1IYO A;  4UA7 A;  1JNU A;  1RGZ A;  1KGF A;  5HPI A;  4NK3 A;  1L3L A;  3CHW P;  1GSV A;  3E0Y A;  4C75 A;  1PI4 A;  4GS9 A;  4R6L A;  3ITB A;  1FIL A;  4IVK A;  1SKO A;  3NBL A;  3T4Q A;  1LHY A;  2PU4 A;  4ARZ B;  5FAT A;  5A92 A;  3G31 A;  1OME A;  2PR6 A;  2GJ3 A;  4MMN A;  2XF3 A;  2EFU A;  2J9P A;  1ACF A;  1Q2Q A;  3PBQ A;  3MXS A;  1N9O A;  4JGR A;  3Q1F A;  1K55 A;  2QZ6 A;  2G2U A;  5EVI D;  1ZG4 A;  2HDU A;  2GNX A;  3ZG7 B;  5DFX A;  4MN7 A;  4CLC D;  3ZYT A;  3VE4 A;  2WKR A;  4FTX A;  4HY8 A;  4DRT A;  3BFF A;  1E4D A;  2J3W A;  5TBM B;  3UPN A;  3QP6 A;  1KVL A;  3M2K A;  3UME A;  4PM7 A;  2ZM8 A;  4GCZ A;  4EU0 A;  4NXB A;  4QY6 A;  3BQA A;  1EI5 A;  1S6R A;  2ZL1 B;  1FR1 A;  1PWD A;  1BTL A;  4Y2F A;  3QP8 A;  2M7V A;  2FZ0 A;  1ERM A;  4HBU A;  3CUE A;  1XJ6 A;  1D7E A;  3OPP A;  4H8R A;  4F3L B;  3IWO A;  2Y2M A;  5CXW A;  3DTK A;  3K3C A;  2YKF A;  2FFY A;  4R3B A;  1K25 A;  4EUV A;  3W8K A;  3CG5 A;  4GDN A;  2J8Y A;  1J9M A;  3B3X A;  4U0T A;  3UNW A;  3WS4 A;  3ZGA B;  4JXG A;  5FAS A;  2B18 A;  1UGU A;  4H6J A;  2OWH A;  4OOL A;  4EUZ A;  1W8Y A;  2P04 A;  4EXO A;  2PBY A;  2W3E A;  4O0P A;  4EER A;  3BQ8 A;  4Q0J A;  1YT4 A;  5E2E A;  1L0G A;  3H82 B;  1TEM A;  3MF0 A;  3N8L A;  5HL1 A;  1DP8 A;  4IED A;  5EOO A;  4R3A A;  3DWZ A;  1WE4 A;  3IF6 A;  1S0W A;  5E2H A;  1OTA A;  2HDQ A;  2M7U A;  1Q2P A;  3IX3 A;  2WZZ A;  3UB5 P;  3UE3 A;  4KQD A;  5CHM A;  4CLC C;  5J7E A;  4Y0T A;  2XFT A;  3T50 A;  4D2O A;  2L1M A;  1MWU A;  5E2G A;  2X01 A;  3U4L P;  4OLD A;  1I2W A;  1TVF A;  1YKD A;  1ZKJ A;  3IWI A;  3ZHH A;  2O0Y A;  2O99 A;  3S22 A;  3SS5 A;  4GZB A;  5CGX A;  2XGN A;  3MQ0 A;  3FV7 A;  2J3T D;  1BUL A;  5HSQ A;  2V1B A;  4EQ1 A;  3EWK A;  3KYZ A;  2OAQ 1;  3D72 A;  2MJ6 A;  2D01 A;  5L8M A;  2XRO A;  1KOU A;  1K54 C;  3AGD A;  2R78 A;  1CQA A;  5CER A;  1M6K A;  2W27 A;  1YPR A;  1TS8 A;  3OPL A;  5FQ9 A;  2GDN A;  4EES A;  2JKT I;  1XA7 A;  1JTG A;  2C6W B;  4R3J A;  4KZB A;  2E8I A;  1N4O A;  3OPR A;  2HZ5 A;  2V0W A;  1KDW A;  2ZQ7 A;  1OPX A;  3GR2 A;  4OQH A;  5EVI A;  4KZ8 A;  4MDZ A;  2BAS A;  3VP2 A;  2G2W A;  4E04 A;  3CPT B;  2X02 A;  4AFI A;  3MZE A;  3F1O A;  2R9X A;  3LID A;  5FAP A;  3Q7V B;  3ISG A;  3LIC A;  3A3D A;  3HRE A;  2WGW B;  4N9K A;  1I5Q A;  1JVJ A;  4X6T A;  5JYP A;  4IBR A;  4PM6 A;  2L0W A;  1K38 A;  2V8F A;  4OPZ A;  2KOI A;  3IXD A;  3C38 A;  1YLP A;  4YFM A;  3V5M A;  3UDF A;  5E43 A;  3WRZ A;  1F98 A;  3G35 A;  2DMW A;  4JBF A;  4M4X A;  3VSK A;  2HJ9 C;  3CZD A;  4KUO A;  5EEC A;  3VP3 A;  5KSH A;  1XFN A;  2UV0 E;  1VQQ A;  4QJG A;  3QNC A;  1O7E A;  2J3T C;  1KE3 A;  3RXX A;  3RXW A;  1XX2 A;  3O86 A;  2HDR A;  3EOI A;  2VA0 A;  1OT9 A;  5CHJ A;  1LL9 A;  2NUP C;  3O5Y A;  1BLS A;  2ZMF A;  3BM6 A;  1WA9 A;  4E3I A;  1YLT A;  4UAA A;  1O07 A;  2EX2 A;  4JF6 A;  3PTE A;  1NRF A;  4JF5 A;  2JE5 A;  4OLG A;  4L9F A;  1VET A;  4DXC A;  4JGO A;  2IWD A;  3WWX A;  1WYB A;  4PKY A;  1FIK A;  1VEU A;  1PZP A;  4KZ6 A;  2WKP A;  4O01 A;  4P6Z M;  4WMC D;  5DFY A;  2HP6 A;  3IHB A;  4XT2 B;  3FC7 A;  1D1J A;  3ZVW A;  3UB8 A;  1XXM A;  1S4R A;  1GSX A;  4X68 A;  2P7J A;  4HBT A;  4R23 A;  5FQK A;  1NJ4 A;  1NZO A;  2Y2Q A;  1G28 A;  4QD4 A;  3BYD A;  2VGL S;  1GA9 A;  3TJZ C;  1LL5 A;  3F1N B;  2P74 A;  5HWV A;  4PKY G;  3HLD A;  2ZJ9 A;  2HDS A;  5G4Y A;  2JKF A;  3V3R A;  1NWZ A;  4QY5 A;  3V50 A;  2W3D A;  3W4P A;  3GV9 A;  2O9B A;  1ERO A;  5IHV A;  1PZO A;  4G3V A;  4OQI A;  1T19 A;  3IWQ A;  4ETZ A;  4Z1W A;  2YKH A;  3MKF A;  5CGS A;  3SZT A;  1IEM A;  3C2W A;  5F82 A;  2ZM2 A;  4ID4 A;  4I3A A;  4QB8 A;  2J80 A;  2W1R A;  2WAE A;  4LV1 A;  3HLG A;  3FWL A;  3N4I A;  1S67 L;  1LL8 A;  3ULF A;  4OPR A;  2WKH A;  3QHY A;  5FDS A;  3M6B A;  4BL2 A;  1CEF A;  5KIZ A;  2ZLY A;  4MNR A;  3V3S A;  3KO6 A;  3C7U A;  4X1L A;  3LFV A;  4WZ5 C;  5HWW A;  1RP5 A;  2V1A A;  4E3J A;  4GN2 A;  4NEE D;  4LV0 A;  4GHI A;  2Q0O A;  3H9W A;  2PRF A;  2FH5 A;  3WS0 A;  3W4O A;  5EVE A;  1IKG A;  1ZTU A;  4OKP A;  4DJ3 A;  3K2N A;  3T4L A;  1L0E A;  3CLO A;  3CMZ A;  2EFX A;  5DF7 A;  3EGD C;  3E2K A;  5DF9 A;  3OCL A;  5G4Z A;  4LRX C;  3S4X A;  1DJB A;  4S2N A;  3DAV A;  5LBR A;  3VOL A;  4Y3I A;  3BJN A;  4KZA A;  4IUH A;  2KLI A;  5J8X A;  4EWF A;  3ICY A;  1PYY A;  2VV8 A;  2XK1 A;  3LIE A;  5AQA A;  4OP5 A;  1NYY A;  1MBL A;  2B02 A;  4ZRR A;  5GLD A;  2Z2M B;  5GLC A;  1YLZ A;  3NEC A;  3WS2 A;  3BEB A;  5FI2 A;  1ZG6 A;  5D3O A;  1F5M A;  4MBH A;  4G3W A;  4FCF A;  2JCH A;  2G7U A;  4BLM A;  3Q82 A;  5HDC A;  1BYW A;  4HJ3 A;  4BEN A;  5FA7 A;  2ZQ9 A;  2VZW A;  5HAI A;  3BY8 A;  4WF0 A;  4B88 A;  1IYQ A;  1PW1 A;  3E4O A;  1TS0 A;  4GLQ A;  3LYX A;  4Y15 A;  5FQI A;  3MR0 A;  3NIA A;  4WEK A;  3FPW A;  1OTB A;  1OTE A;  4P85 A;  3EEA A;  1IFQ A;  1XGJ A;  4ZJ1 A;  1MKI A;  4JXV A;  1CEG A;  2JC7 A;  4QPR A;  3N8R A;  4KZ9 A;  3CAX A;  4Y17 A;  3OPH A;  4X53 A;  2B5R A;  3G32 A;  1Z09 A;  1MKM A;  3NJA A;  3O88 A;  2E8J A;  5MC7 A;  4S2K A;  4LCL A;  4LPZ A;  2WZX A;  4X25 A;  3GEC A;  1DJC A;  4S2L A;  1ZHH B;  3KSH A;  2ZQD A;  2P08 A;  4I38 A;  1SKO B;  5HAQ A;  2RCX A;  4KQO A;  1NZU A;  5M19 A;  1FCN A;  2XD5 A;  3CJM A;  1P97 A;  4LEN A;  4LV2 A;  1PI5 A;  1GHI A;  3R7W B;  2R9W A;  1PRQ A;  4N92 A;  5CX7 A;  1BSG A;  1EW0 A;  3A0V A;  1H8Z A;  4WEJ A;  2VKS A;  2EX9 A;  1P9W A;  5FI6 A;  3B42 A;  4Y5F A;  4DF6 A;  3LR0 A;  4KZ7 A;  4FD8 A;  3T4S A;  4P0M A;  4E6W A;  4NKP A;  1P9R A;  4RX2 A;  4DE1 A;  2VX8 A;  1F2K A;  5EPH A;  4KG2 A;  1XJ4 A;  3RTY A;  4R1G A;  4NXG A;  2I72 A;  4JPM A;  4BWI A;  1X0O A;  1XP4 A;  3IX8 A;  2ZQ8 A;  4CLC E;  5CHU A;  2ZC4 B;  4R0Q A;  4MN6 A;  2EWW A;  2XSS A;  5J4E A;  4JGP A;  3IS2 A;  4ESP A;  3TSG A;  2H5S A;  3KX0 X;  1CF0 A;  1V9Z A;  4R70 A;  1MWT A;  3IX4 A;  3T4K A;  3GRJ A;  3H7W B;  3FPV A;  2XA7 S;  4UHU A;  3R4K A;  1EWZ A;  1GHM A;  1OJG A;  3BLM A;  1CI8 A;  3G2Z A;  3ITA A;  5AQ9 A;  3ZVT A;  3PBO A;  4ZJ2 A;  3NC8 A;  4RVA A;  2Z6D A;  1S1Y A;  2ZL1 A;  2EWV A;  4I5S A;  3HUN A;  2OLV A;  3O87 A;  1FR6 A;  4HHD A;  4HP9 A;  1D06 A;  3PBN A;  2ZM0 A;  2EX6 A;  1K4E A;  4PMA A;  3W4Q A;  1JTD A;  3P7N A;  4I39 A;  2Y2K A;  3T1X A;  1CJF A;  5I94 A;  4BBV A;  5FEG A;  2W1T B;  3OBF A;  4HP4 A;  5HPF A;  4HI4 A;  5DJU A;  1XPB A;  1KVM A;  4BBU A;  3HJI A;  2H28 A;  2XH9 A;  3C8C A;  3AGE A;  3IBJ A;  4KZ5 A;  1PW8 A;  3FYZ A;  5JYO A;  4OP8 A;  2EXA A;  4LGW A;  5AQB A;  4B4X A;  2PD7 A;  3OCN A;  3VP4 A;  1E3U D;  3H82 A;  2Y91 A;  4I3I A;  4OOY A;  3DW0 A;  4BQM A;  1IYP A;  2QHK A;  2VV7 A;  4DE3 A;  2DCF A;  1I2S A;  2WAF A;  1DP9 A;  1YQS A;  4HH3 A;  4OVD A;  5FAO A;  3JYI A;  3IXG A;  2WAD A;  2DRW A;  3E98 A;  4ME4 A;  4EQI A;  4BD1 A;  2OLU A;  3GQZ A;  4K0W A;  1RGY A;  3IF5 A;  5AQ7 A;  2J7V A;  1YSP A;  2PYP A;  1LI9 A;  3GSG A;  3LIA A;  3LIF A;  1IOU A;  3UDX A;  2JN7 A;  1G6O A;  3HVF A;  1DRM A;  5L07 A;  3F1O B;  4IJG A;  5A93 A;  3HBR A;  3SH8 A;  1MWS A;  4CLC A;  3LR3 A;  5CEC A;  3SS3 A;  1VM1 A;  5HAP A;  3QP5 A;  4OPQ A;  4R38 A;  4EBN A;  5HDD A;  4EEP A;  2VJW A;  4EET B;  4FH4 A;  4GD8 A;  3LO7 A;  4WN5 A;  2D02 A;  3JPU A;  4GNU A;  2VV6 A;  1YLW A;  4Y7P A;  4E3M A;  3CPT A;  3I7J A;  4BL3 A;  4EW7 A;  4MEZ A;  1K54 A;  3GVB A;  4XUX A;  3AGF A;  3IHA A;  3FZC A;  4HQA A;  4QU3 A;  3NI9 A;  1ES4 A;  1VB6 A;  3CIT A;  4F94 A;  1ESI A;  4S2J A;  2Y79 A;  4P6B A;  2VLG A;  5DKK A;  1AXB A;  1H8Y A;  1L0F A;  2ZQC A;  2OAP 1;  3WRT A;  3UPO A;  2Y2P A;  3NOP C;  4X55 A;  4OOM A;  3G2Y A;  2W0N A;  5HFO A;  3F1P B;  2BG1 A;  4MBF A;  1G6A A;  4PHT A;  4EBP A;  4Q0H A;  1KE4 A;  1J3W A;  1MXO A;  1XA1 A;  2EX8 A;  3MZF A;  3LR5 A;  1PIO A;  2Y55 A;  3VE3 A;  3QP4 A;  4LLO B;  5DKL A;  1C3B A;  1ZC2 A;  5CEB A;  5HZH A;  3BFG A;  4XUZ A;  4FH2 A;  4LRY C;  3K3D A;  4WUJ A;  3VOY A;  1DY6 A;  4OQG A;  3BEC A;  3EEH A;  4KEN B;  2XRN A;  1VHM A;  1BZA A;  3B47 A;  5EVL A;  1DJA A;  3Q07 A;  1HD8 A;  3T1R A;  1SZV A;  5C5K A;  4CJN A;  2X71 A;  4IVI A;  5CTM A;  5HAR A;  4YWZ A;  5EE8 A;  1T1B A;  1XGI A;  3LCE A;  5FEF A;  2JKG A;  2Y2H A;  5HL6 A;  1NXY A;  3UE1 A;  4WLA A;  2DNS A;  1GHP A;  1NLY A;  2HPB A;  4PPR A;  2PAV P;  5GHZ A;  3NUL A;  2A24 B;  3F1N A;  3GTC A;  1K0K A;  3NDG A;  3UMD A;  4KQQ A;  3B33 A;  3DTE A;  2I9V A;  2WKE A;  4GW9 A;  3MFD A;  1A0K A;  4RA7 A;  3S1Y A;  2V1Z A;  2XEP A;  4NG2 A;  4S2O A;  1LT0 A;  4II7 A;  4I3J A;  2Y2J A;  3TRC A;  3G4P A;  1L0D A;  4O8G A;  1YLJ A;  2WK0 A;  3MZD A;  3OLO A;  3VOZ A;  3T4O A;  4KUK A;  1K57 C;  2XD1 A;  4X69 A;  1YLY A;  3ZG9 B;  3ZG0 A;  3A3F A;  2P9V B;  2ZC6 B;  4DMZ A;  1TF1 A;  3UB7 A;  4X1M A;  2JKR M;  5CTN A;  2PU2 A;  2A2L A;  3BY9 A;  1QME A;  4XXR A;  2HGV A;  2V9A A;  1P0Z A;  4UA6 A;  4WBG A;  1FOF A;  2ZC3 B;  3KSI A;  1YAX A;  1ES5 A;  3T1S A;  4BD0 A;  2XFS A;  1CI9 A;  1BLC A;  4QWO A;  4KG5 A;  2H10 A;  2EA9 A;  2IWB A;  1XFQ A;  1WYC A;  1MPL A;  1Y4O A;  4IHQ A;  3FKV A;  2QJ5 A;  2HF6 A;  4LFU A;  2IWC A;  4HIA A;  2Y2O A;  4PM8 A;  1ONH A;  3L9K A;  2K31 A;  1JWZ A;  3C30 A;  3BRM A;  3C4O A;  2V8C A;  5FI7 A;  4WZ5 A;  3ZFZ A;  4MN5 A;  4WZ4 A;  3VV4 A;  1JWP A;  5A8B A;  4KQR A;  3TG9 A;  1TDG A;  3RJU A;  4WMC A;  3D3O A;  3JVU A;  3LY4 A;  3M2J A;  1K55 C;  5HW3 A;  1MZU A;  1L2S A;  4EBL A;  3MQQ A;  3Q81 A;  3ZG8 B;  3ZCZ A;  5K5B A;  1MY8 A;  3S7N A;  3SOI A;  1BLP A;  1IYS A;  2HJE A;  3T1Q B;  5GLA A;  1W8Q A;  4NXF A;  4GS9 B;  4M3K A;  3VSL A;  3P01 A;  3LI8 A;  2VGJ A;  5GHX A;  5L10 A;  5GLB A;  1ESU A;  2QMI A;  5U47 A;  2QPN A;  2C5W B;  1MC0 A;  5KSC A;  3C7V A;  3PAE A;  4E3O A;  1T1A A;  5M1A A;  3E4Q A;  1PFL A;  3A3J A;  3DBA A;  3IXB A;  3T4J A;  4B4Z A;  3CUE C;  1HZO A;  3HUO A;  3NOT C;  4DE0 A;  3DWK A;  2BTF P;  3BFD A;  3HUM A;  3PBT A;  5CED A;  4KG6 A;  3S7Q A;  1K56 D;  3VFF A;  3JVV A;  5F6A A;  4L9E A;  1H8M A;  4KZ4 A;  3D4F A;  3R7W A;  5DTT A;  2CMN A;  1YSQ A;  4ARZ A;  2KDK A;  5E2F A;  5HDS A;  5EM0 A;  3MSH A;  5DTK A;  5DVA A;  3IS2 B;  2ZC5 B;  4R4R A;  1KDS A;  1XKZ A;  4DJ2 A;  3UN7 A;  1GCE A;  1YMS A;  3O3V A;  4Y13 A;  5G18 A;  3LUQ A;  3N6I A;  5FDH A;  1NYM A;  4U0X A;  3E2L A;  2PYR A;  3SW1 A;  2ZC7 A;  3IF6 C;  1SKF A;  2OWJ A;  3MMH A;  3VP1 A;  5IT5 A;  2QJ7 A;  3EQU A;  2V0U A;  1W63 M;  5TBM A;  4CPK A;  3OZH A;  2WGI A;  4DXB A;  2PD8 A;  3LR4 A;  5AJG A;  4K91 A;  2WGV A;  2W3G A;  4WYY A;  2Q9M A;  1N9L A;  5L2F A;  2H0Y A;  4H6J B;  2K7S A;  3EQV A;  1E25 A;  5F1F A;  1ONG A;  2O9C A;  3H7W A;  4Q0I A;  1TDL A;  4F3L A;  1KGE A;  4N1H A;  2O9A A;  3N7W A;  3UB6 A;  3IH9 A;  5CRF A;  2PHY A;  1RCJ A;  1ODV A;  2FFF B;  4PM5 A;  3IF6 B;  3V39 A;  2HP5 A;  2ZD8 A;  3HLE A;  5FQJ A;  5M18 A;  2Y8H A;  3SH7 A;  4HJ6 A;  4G3K A;  2WYX A;  5AVF A;  1HVB A;  4HH2 A;  1QMF A;  3FKW A;  1SCW A;  3UE6 A;  2W1T A;  3ZNY A;  1PNE A;  4P6Z S;  2Y2L A;  4UQI M;  5EVI C;  1BUE A;  4JLF A;  1YMX A;  3PBS A;  2IA2 A;  3MS6 A;  3QP2 A;  1OJ5 A;  5FL3 A;  2A3U A;  3ZQ5 A;  4E3K A;  5F69 A;  4GB7 A;  5A90 A;  4JKT A;  5KMW A;  2JBF A;  4A5R A;  5DF8 A;  5FSR A;  3HL9 A;  4L0L A;  5EV0 A;  1IKI A;  2ZBB A;  4DE2 A;  1NRJ A;  5EM1 A;  3NCK A;  3GMW A;  2QYB A;  1H3Q A;  2ZMV A;  5FAQ A;  2Y4A A;  1TS6 A;  3TE8 A;  5HWT A;  3T12 B;  5J3W A;  1Z6F A;  1S1Z A;  5A91 A;  3UDI A;  1SDE A;  4JF4 A;  4MCW A;  2VGK A;  5EVI B;  5I5L A;  5TGF A;  5CGW A;  3U2A A;  1LI0 A;  3G34 A;  4HJ4 A;  3DTM A;  4KZ3 A;  4LV3 A;  3ZG5 A;  4ZBE A;  4E3N A;  1XJ2 A;  3G30 A;  1K56 A;  4CLC B;  4OPY A;  4FUW A;  3HLW A;  5HD5 A;  2WUQ A;  4WM9 A;  4U3T A; 
#chains in the Genus database with same CATH homology
 3OPP A;  4BEN A;  5FA7 A;  2ZQ9 A;  5EE8 A;  1XGI A;  5HAI A;  3LCE A;  4H8R A;  4ZJ3 A;  4HEF A;  3IWO A;  4B88 A;  2Y2H A;  3ZDJ A;  1IYQ A;  2Y2M A;  1ALQ A;  1PW1 A;  5CXW A;  1NXY A;  3UE1 A;  5FQI A;  3NIA A;  2DNS A;  1GHP A;  3NY4 A;  4WEK A;  2HP9 A;  4P85 A;  2FFY A;  4R3B A;  2HPB A;  4PPR A;  1K25 A;  1XGJ A;  3M6H A;  3W8K A;  1PWC A;  4ZJ1 A;  5GHZ A;  3CG5 A;  4GDN A;  1MKI A;  4JXV A;  1CEG A;  2JC7 A;  3Q7Z A;  3PAG A;  3N8R A;  2J8Y A;  4HES A;  1J9M A;  3B3X A;  4KZ9 A;  4OH0 A;  4U0T A;  3UNW A;  3GTC A;  3OPH A;  4X53 A;  3WS4 A;  3ZGA B;  2B5R A;  2UWX A;  3G32 A;  4JXG A;  5FAS A;  2XQZ A;  5BOH A;  3NDG A;  4KQQ A;  4RYE A;  3Q7V A;  3O88 A;  2WKE A;  2BLS A;  3MFD A;  3A3E A;  4OOL A;  4Z9Q A;  4EUZ A;  1W8Y A;  3P98 A;  1M40 A;  4S2K A;  4RA7 A;  3S1Y A;  2PBY A;  4JXS A;  4LCL A;  2WGW A;  2V1Z A;  2XEP A;  4UA9 A;  2WZX A;  4S2O A;  1DJC A;  4S2L A;  2Y2J A;  2ZQD A;  1YT4 A;  2OV5 A;  5E2E A;  5HAQ A;  1L0G A;  4LCM A;  1TEM A;  3LY3 A;  2RCX A;  4KQO A;  1NZU A;  3G4P A;  1SHV A;  1L0D A;  2A49 A;  1FCN A;  1LLB A;  2XD5 A;  4E3L A;  5M19 A;  3CJM A;  3N8L A;  5HL1 A;  1YLJ A;  2WK0 A;  4IED A;  5EOO A;  3MZD A;  3C4P A;  3VOZ A;  4LEN A;  2RL3 A;  4LV2 A;  1PI5 A;  3NDE A;  4FSF A;  4C3Q A;  3DWZ A;  1WE4 A;  1GHI A;  1K57 C;  3IF6 A;  1S0W A;  2R9W A;  5E2H A;  3LEZ A;  2HDQ A;  2XD1 A;  4N92 A;  4X69 A;  3UY6 A;  1Q2P A;  1BSG A;  1YLY A;  1W5D A;  3SS4 A;  2WZZ A;  2WKI A;  1H8Z A;  1FCO A;  3UE3 A;  2H0T A;  3ZG9 B;  3ZG0 A;  5KZH A;  4WEJ A;  5CHM A;  2EX9 A;  1CK3 A;  2XFT A;  4Y0T A;  4D2O A;  1MWU A;  5FI6 A;  5E2G A;  2X01 A;  3A3F A;  4DF6 A;  2P9V B;  4OLD A;  4KZ7 A;  2ZC6 B;  5F1G A;  1I2W A;  1TVF A;  1ZKJ A;  4FD8 A;  4P0M A;  4E6W A;  4ZTK A;  5CTN A;  4Y0O A;  3IWI A;  4RX2 A;  3ZHH A;  2PU2 A;  4Y0U A;  4DE1 A;  5TR7 A;  3S22 A;  3SS5 A;  5EPH A;  4GZB A;  5CGX A;  2Z2L B;  5EUA A;  4KG2 A;  2XGN A;  4R1G A;  2I72 A;  3FV7 A;  1BUL A;  1QME A;  4XXR A;  4JPM A;  1XP4 A;  2XR0 A;  2CC1 A;  3MXR A;  2ZQ8 A;  4UA6 A;  1FOF A;  4WBG A;  2ZC3 B;  5CHU A;  2ZC4 B;  4R0Q A;  3BFC A;  1ES2 A;  1K54 C;  3AGD A;  2V20 A;  1ES5 A;  4BD0 A;  1E3U A;  5CER A;  2XFS A;  1CI9 A;  4R4S A;  1M6K A;  4DDY A;  1BLC A;  3TSG A;  2H5S A;  5HX9 A;  4KG5 A;  1JWV A;  3OPL A;  5FQ9 A;  1H5X A;  2GDN A;  2H10 A;  2IWB A;  1XA7 A;  1JTG A;  1MWT A;  4YIN A;  1HTZ A;  2C6W B;  4K0X A;  1PWG A;  1WYC A;  4GD6 A;  1MPL A;  4R3J A;  1FSY A;  4KZB A;  2E8I A;  3P09 A;  3FKV A;  4MLL A;  1N4O A;  3HLB A;  3OPR A;  2IWC A;  2Y2O A;  4PM8 A;  3GRJ A;  3IXH A;  1ONH A;  1KDW A;  2ZQ7 A;  1JWZ A;  4UHU A;  3BRM A;  3C4O A;  3GR2 A;  5FI7 A;  4WZ5 A;  1EWZ A;  1KGG A;  1FQG A;  1GHM A;  4OQH A;  5EVI A;  3ZFZ A;  3BLM A;  1GA0 A;  4KZ8 A;  4BJP A;  1CI8 A;  3G2Z A;  3ITA A;  4WZ4 A;  5AQ9 A;  1JWP A;  1MWR A;  3ZVT A;  3PBO A;  4KQR A;  4NET A;  3TG9 A;  4ZJ2 A;  1TDG A;  3VP2 A;  3NC8 A;  3RJU A;  2G2W A;  4RVA A;  2X02 A;  4WMC A;  4C6Y A;  3MZE A;  3UPP A;  2R9X A;  3VP0 A;  5FAP A;  4DDS A;  3LY4 A;  3M2J A;  3Q7V B;  3ISG A;  1K55 C;  5HW3 A;  1L2S A;  3A3I A;  3A3D A;  3HUN A;  3HRE A;  4GKU A;  4EBL A;  2OLV A;  2WGW B;  4N9K A;  1I5Q A;  3O87 A;  1FR6 A;  2OSU A;  3Q81 A;  4GDB A;  1JVJ A;  4X6T A;  4DKI A;  1YM1 A;  3PBN A;  3ZG8 B;  3ZCZ A;  5JYP A;  4IBR A;  2ZM0 A;  1MY8 A;  4S2N C;  3IQA A;  4PM6 A;  1K4F A;  2Y2N A;  2EX6 A;  3SOI A;  1BLP A;  1IYS A;  1K38 A;  1K4E A;  4PMA A;  4OPZ A;  3IXD A;  3W4Q A;  1JTD A;  5GLA A;  1W8Q A;  3TOI A;  1YLP A;  4M3K A;  2Y2K A;  4S2P A;  4YFM A;  3VSL A;  3V5M A;  2VGJ A;  5GHX A;  5I94 A;  3UDF A;  1FSW A;  1ESU A;  2QMI A;  5E43 A;  5GLB A;  3WRZ A;  3VFH A;  3HLC A;  3G35 A;  5U47 A;  2QPN A;  4P87 A;  3MBZ A;  5EOE A;  4S2I A;  2C5W B;  3OC2 A;  1XPB A;  4JBF A;  3VSK A;  5KSC A;  1KVM A;  3CZD A;  3C7V A;  1W79 A;  3PAE A;  4E3O A;  2XH9 A;  3MKE A;  3AGE A;  4KZ5 A;  1BLH A;  5EEC A;  5M1A A;  3VP3 A;  1PW8 A;  1K6R A;  4IBX A;  5KSH A;  3FYZ A;  3WS1 A;  1VQQ A;  4MBK A;  4WEL A;  4QJG A;  2EXB A;  3A3J A;  3IXB A;  3QNC A;  5JYO A;  1O7E A;  4B4Z A;  1K6S A;  4Q8I A;  4OP8 A;  1HZO A;  2EXA A;  3QNB A;  5AQB A;  4B4X A;  3HLF A;  1KE3 A;  3RXX A;  3RXW A;  3HUO A;  1XX2 A;  3O86 A;  2HDR A;  5TFQ A;  4DE0 A;  3PBR A;  3OCN A;  3VP4 A;  3DWK A;  3UE0 A;  1E3U D;  2Y91 A;  4OOY A;  1SDN A;  3BFD A;  3HUM A;  2XDM A;  3PBT A;  3WS5 A;  5CHJ A;  3UO9 A;  4KG6 A;  1LL9 A;  3DW0 A;  4BQM A;  3VMA A;  5CED A;  3N8S A;  4RX3 A;  1Y54 A;  1BLS A;  1K56 D;  3VFF A;  4EV4 A;  1KE0 A;  1IYP A;  4KZ4 A;  3D4F A;  3BM6 A;  4E3I A;  1IEL A;  5DTT A;  4QHC A;  3BFE A;  1YLT A;  4DE3 A;  2DCF A;  1O07 A;  4UAA A;  1I2S A;  5E2F A;  2EX2 A;  2WAF A;  4JF6 A;  3PTE A;  1YQS A;  4OVD A;  1NRF A;  4JF5 A;  4E6X A;  5DTK A;  5FAO A;  5DVA A;  2ZQA A;  3JYI A;  2JE5 A;  4OLG A;  2ZC5 B;  2V2F F;  2Y2I A;  4R4R A;  4O7D A;  3IXG A;  4DXC A;  1KDS A;  1XKZ A;  2WAD A;  2DRW A;  3UN7 A;  1GCE A;  1YMS A;  2IWD A;  3C5A A;  3WWX A;  2P9V A;  1WYB A;  4EQI A;  4BD1 A;  1U60 A;  3O3V A;  1PZP A;  2Y2G A;  4KZ6 A;  1BT5 A;  2ZMA A;  5G18 A;  2OLU A;  3GQZ A;  4WMC D;  4K0W A;  1RGY A;  1NY0 A;  3N6I A;  2HP6 A;  3IHB A;  3IF5 A;  1W7F A;  5AQ7 A;  2J7V A;  2XLN A;  3ZVW A;  5FDH A;  1NYM A;  1G68 A;  4OON A;  1XXM A;  1LI9 A;  1ERQ A;  4ZDX A;  4U0X A;  4X68 A;  3E2L A;  3GSG A;  2ZC7 A;  4HBT A;  4R23 A;  3IF6 C;  3UDX A;  5FQK A;  1NJ4 A;  1SKF A;  3VP1 A;  3HVF A;  1NZO A;  2Y2Q A;  3EQU A;  4CPK A;  3BLS A;  1K57 A;  2WGI A;  3OZH A;  4QD4 A;  5FQQ A;  2Y59 A;  4DXB A;  3BYD A;  1GA9 A;  4GOG A;  4ZAM A;  4K91 A;  5A93 A;  2WGV A;  1LL5 A;  4WYY A;  2P74 A;  3HBR A;  3HLD A;  2Q9M A;  4N1X A;  5F83 A;  2ZJ9 A;  2HDS A;  3SH8 A;  1MWS A;  4OQ0 A;  1ES3 A;  1N9B A;  5L2F A;  5CEC A;  4S2M A;  3V3R A;  4QY5 A;  2H0Y A;  3V50 A;  4JXW A;  3ZNT A;  3SS3 A;  4X56 A;  3EQV A;  4N9L A;  1VM1 A;  3W4P A;  3GV9 A;  5HAP A;  4OPQ A;  1E25 A;  1ERO A;  5F1F A;  4EBN A;  5IHV A;  1PZO A;  1ONG A;  4OQI A;  4FH4 A;  3IWQ A;  1TDL A;  4GD8 A;  1KGE A;  3LO7 A;  4N1H A;  3MKF A;  5CGS A;  1IEM A;  5F82 A;  3N7W A;  4GNU A;  5FQM A;  3IH9 A;  2ZM2 A;  4ID4 A;  5DTS A;  5GL9 A;  2Q9N A;  4QB8 A;  5CRF A;  2WAE A;  1YLW A;  1RCJ A;  1FCM A;  3IH8 A;  4LV1 A;  4Y7P A;  4E3M A;  2FFF B;  4PM5 A;  3IT9 A;  3HLG A;  2J9O A;  3IF6 B;  3V39 A;  4PM9 A;  2HP5 A;  5GHY A;  2ZD8 A;  3I7J A;  4BL3 A;  3SH9 A;  3FWL A;  1IYO A;  3N4I A;  4MEZ A;  3HLE A;  4UA7 A;  1K54 A;  1RGZ A;  1KGF A;  3GVB A;  4XUX A;  3AGF A;  3IHA A;  4NK3 A;  5FQJ A;  4OPR A;  5M18 A;  2WKH A;  3QHY A;  3FZC A;  3SH7 A;  3M6B A;  4QU3 A;  4BL2 A;  3NI9 A;  1CEF A;  2WYX A;  4C75 A;  1ES4 A;  1PI4 A;  2ZLY A;  1HVB A;  3ITB A;  1QMF A;  4MNR A;  3FKW A;  4IVK A;  4F94 A;  1ESI A;  4S2J A;  4P6B A;  1SCW A;  3V3S A;  3C7U A;  3ZNY A;  5HAR A;  3NBL A;  1AXB A;  1H8Y A;  2Y2L A;  4WZ5 C;  1RP5 A;  1L0F A;  5EVI C;  1LHY A;  1BUE A;  2ZQC A;  4JLF A;  3WRT A;  1YMX A;  4E3J A;  3PBS A;  2PU4 A;  4GN2 A;  2Y2P A;  3UPO A;  4LV0 A;  5FAT A;  5A92 A;  2A3U A;  3G31 A;  4E3K A;  1OME A;  3WS0 A;  3W4O A;  4X55 A;  1IKG A;  4GB7 A;  4OOM A;  3G2Y A;  4JKT A;  4OKP A;  5A90 A;  5KMW A;  5HFO A;  2JBF A;  2XF3 A;  2EFU A;  2BG1 A;  4A5R A;  2J9P A;  1L0E A;  1Q2Q A;  5DF8 A;  4MBF A;  3PBQ A;  1G6A A;  3CMZ A;  3MXS A;  5FSR A;  2EFX A;  3HL9 A;  4L0L A;  4EBP A;  1IKI A;  1KE4 A;  5DF7 A;  3Q1F A;  1K55 A;  2QZ6 A;  2G2U A;  3E2K A;  4DE2 A;  5DF9 A;  3NCK A;  5EVI D;  1MXO A;  3GMW A;  1XA1 A;  2EX8 A;  3OCL A;  3MZF A;  1PIO A;  2Y55 A;  1ZG4 A;  2HDU A;  3S4X A;  1DJB A;  4S2N A;  5FAQ A;  2Y4A A;  3ZG7 B;  1C3B A;  4KZA A;  5J8X A;  1ZC2 A;  5CEB A;  4EWF A;  1Z6F A;  1PYY A;  3BFG A;  2XK1 A;  4FH2 A;  4XUZ A;  5AQA A;  4DRT A;  3BFF A;  5A91 A;  4OP5 A;  1E4D A;  3UDI A;  1SDE A;  4JF4 A;  3VOY A;  1DY6 A;  3UPN A;  4OQG A;  2VGK A;  5EVI B;  1KVL A;  5TGF A;  1NYY A;  5CGW A;  3BEC A;  1MBL A;  3M2K A;  1LI0 A;  4PM7 A;  3G34 A;  4KEN B;  5GLD A;  2Z2M B;  2ZM8 A;  3DTM A;  5GLC A;  1YLZ A;  4KZ3 A;  4LV3 A;  3ZG5 A;  1BZA A;  4ZBE A;  4E3N A;  3WS2 A;  3G30 A;  4QY6 A;  1K56 A;  1EI5 A;  1S6R A;  5EVL A;  1DJA A;  1FR1 A;  1HD8 A;  1PWD A;  1ZG6 A;  3BEB A;  3Q07 A;  4OPY A;  5D3O A;  5FI2 A;  1BTL A;  4MBH A;  4FCF A;  2JCH A;  3HLW A;  4CJN A;  4BLM A;  1ERM A;  2X71 A;  3Q82 A;  2WUQ A;  4HBU A;  4IVI A;  5CTM A;  4WM9 A;  4U3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...