5EW0A

Crystal structure of the metallo-beta-lactamase sfh-i in complex with the bisthiazolidine inhibitor l-cs319
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
228
Chain Sequence
NLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia fonticola
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 84
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ew0A00
3IE0A 4UWSB 1X8IA 2I7TA 4Z5YA 4UWRB 3L6NA 4EFZA 3T3OA 1X8HA 4DILA 4TZBA 3X2XA 4PVOA 5K4NA 4NQ2A 2Q0JA 4HL1A 3BV6A 2Q0IA 3SPUA 4HL2A 2YNVA 4H0DA 3IEKA 2DKFA 3H3EA 1ZNBA 4BP0A 4XWWA 3X2ZA 5FQBA 3MD7A 4UAMA 1DXKA 2XR1A 5EHTA 5EVKA 2YNTA 4EYLA 5A87A 4RL2A 2A7MA 4NQ5A 1ZKPA 5HISA 5A0TA 5LCHA 5DPXA 5AXRA 2WRSA 1QH5A 2GMNA 4ZNBA 4HKYA 4D1WA 4UWPB 2R2DA 5FQCA 3IELA 2AIOA 3ZR9A 2QDTA 5AXOA 1A8TA 3SBLA 5K4KA 4EY2A 4C1GA 4WD6A 5HH4A 4U4LA 2BFZA 2FU9A 2UYXA 3IOFA 5EV6A 3IDZA 1SMLA 5LE1A 3A4YA 5EW0A 1WUPA 1KR3A 4EYBA 4GCWA 5ACPA 1XM8A 2Y8AA 4NQ6A 3RPCA 5B1UA 2FHXA 5ACTA 5KIKA 4B87A 5ACWA 3S0ZA 2BG2A 4LE6A 2M5CA 1L9YA 4JO0A 3DH8A 5HIQA 4ZO3A 1KO2A 3LVZA 2P97A 3KNSA 3WXCA 5KILA 1VMEA 3AF6A 2NZEA 2BFLA 2Y87A 1XTOA 4YSBA 5EVBA 2BC2A 4F6HA 4KEQA 5HIOA 4RAMA 2BMIA 3FCZA 3X2YA 1VGNA 4D1TA 4DIKA 2AZ4A 2YZ3A 4Z5ZA 4FSBA 1ZTCA 2NZFA 5ACUA 1M2XA 3IOGA 3DHBA 5LS3A 3TP9A 2ZO4A 5LM6A 3X30A 3P2UA 2NXAA 4J5FA 4TYFA 4XWTA 4UBQA 5EV8A 3FAIA 2P1EA 2YNTB 2WHGA 4C09A 5K4MA 3I15A 3PY5A 4J5HA 3BC2A 5FQAA 3RKKA 1MQOA 2Y8BA 4FR7A 1P9EA 3SRXA 1YCFA 2BG7A 2I7XA 4GYUA 3IEMA 5HH6A 2BFKA 4C1FA 3KL7A 4GYQA 1HLKA 3DHCA 4XUKA 5LLDA 5A5ZA 4NQ4A 4Z7RA 2WYMA 4AD9A 3ADRA 3R2UA 1WW1A 2BG8B 5AYAA 5A0VA 2BTNA 5LCAA 5ACRA 2QDSA 3SW3A 2FHXB 3ESHA 5EH9A 4KEPA 4ZEJA 2ZWRA 5LCFA 2BGAA 3AJ3A 1BVTA 2FU7A 2WYLA 3PG4A 2NYPA 3Q6VA 4C1DA 4FEKA 2GFJA 2GFKA 5LSCA 4D1VA 4Z60A 2FK6A 2OHJA 1DDKA 4AWZA 4RM5A 2BG8A 2BIBA 2BG6A 5B15A 1K07A 2WYMC 4TZFA 3ZQ4A 4D1UA 3ZNBA 2DOOA 5HIPA 4V0HA 1Y44A 2M5DA 3IE2A 1YCGA 5ACVA 2YNWA 4C1EA 3IE1A 2YNUA 4EXYA 1YCHA 5K0WA 3AF5A 3QH8A 4TYTA 4Z6XA 5IQKA 4C1HA 5HH5A 3BK2A 3I11A 4ZO2A 2XF4A 1JT1A 1VJNA 3T3NA 3BK1A 5AHRA 3ZWFA 2FM6A 1BMCA 3SFPA 2GKLA 4TZ9A 5EWAA 5B3RA 4EXSA 5ACSA 3SD9A 2I7VA 1WRAA 3JXPA 2FU6A 3RKJA 4D02A 2YCBA 4RL0A 4CHLA 5EVDA 4YSLA 5AEBA 1KO3A 2FU8A 2P4ZA 1WUOA 3VPEA 2ZZIA 2OHIA 2QJSA 4RBSA 3G1PA 4C1CA 2VW8A 2OHHA 3VQZA 3I13A 1JJTA 2YNVB 4AWYB 4O98A 2QEDA 2BR6A 4AX0B 3T9MA 1QH3A 2P18A 2HB9A 4RAWA 1DD6A 3DHAA 1E5DA 5ACQA 1A7TA 2H6AA 4AX1B 4EYFA 5AHOA 4F6ZA 2BFZB 3I0VA 4UA4A 4BZ3A 1JJEA 5LMCA 5ACXA 4UWOB 2GCUA 3I14A 3F9OA 2ZNBA 1X8GA 2Q42A 4YSKA 1BC2A 2Q9UA 3KNRA 2E7YA 3PY6A 2CBNA 4PVTA 4TZEA 4Z67A 2QINA 4P62A
chains in the Genus database with same CATH superfamily
3IE0A 4UWSB 1X8IA 2I7TA 4Z5YA 4UWRB 3L6NA 4EFZA 3T3OA 1X8HA 4DILA 4TZBA 3X2XA 4PVOA 5K4NA 4NQ2A 2Q0JA 4HL1A 3BV6A 2Q0IA 3SPUA 4HL2A 2YHEA 2YNVA 4H0DA 3IEKA 2DKFA 3H3EA 2CFZA 1ZNBA 4BP0A 4XWWA 3X2ZA 5FQBA 3MD7A 4UAMA 1DXKA 2XR1A 5EHTA 5A23A 5EVKA 2YNTA 4EYLA 5A87A 4RL2A 5AIJA 2A7MA 4NQ5A 1ZKPA 5HISA 5A0TA 5LCHA 5DPXA 5AXRA 2WRSA 1QH5A 2GMNA 4ZNBA 4HKYA 4D1WA 4UWPB 2R2DA 5FQCA 3IELA 2AIOA 3ZR9A 2QDTA 5AXOA 1A8TA 3SBLA 5K4KA 4EY2A 4C1GA 4WD6A 4NURA 5HH4A 4U4LA 2BFZA 2FU9A 2UYXA 3IOFA 5EV6A 3IDZA 1SMLA 5LE1A 2CG2A 3A4YA 5EW0A 1WUPA 1KR3A 4EYBA 4GCWA 5ACPA 1XM8A 2Y8AA 4NQ6A 3RPCA 5B1UA 2FHXA 5ACTA 5KIKA 4B87A 5ACWA 3S0ZA 2BG2A 4LE6A 2M5CA 1L9YA 4JO0A 3DH8A 5HIQA 4ZO3A 1KO2A 3LVZA 2P97A 3KNSA 5AJLA 3WXCA 5KILA 1VMEA 3AF6A 2NZEA 2BFLA 2Y87A 1XTOA 4YSBA 5EVBA 2BC2A 4F6HA 4KEQA 5HIOA 4RAMA 2BMIA 4AV7A 3FCZA 3X2YA 1VGNA 4D1TA 4DIKA 2AZ4A 2YZ3A 4Z5ZA 4FSBA 1ZTCA 2NZFA 5ACUA 1M2XA 3IOGA 3DHBA 5LS3A 3TP9A 2ZO4A 5LM6A 3X30A 3P2UA 2NXAA 4J5FA 4TYFA 4XWTA 4UBQA 5EV8A 3FAIA 2P1EA 2YNTB 2WHGA 4C09A 5K4MA 3I15A 3PY5A 4J5HA 3BC2A 5FQAA 3RKKA 1MQOA 2Y8BA 4FR7A 1P9EA 3SRXA 1YCFA 2BG7A 2I7XA 4GYUA 3IEMA 5HH6A 2BFKA 4C1FA 3KL7A 4GYQA 1HLKA 3DHCA 4XUKA 4AXHA 5LLDA 5A5ZA 4NQ4A 4Z7RA 2WYMA 4AD9A 3ADRA 3R2UA 1WW1A 2BG8B 5AYAA 5A0VA 2CFUA 2BTNA 5LCAA 5ACRA 2QDSA 3SW3A 2FHXB 3ESHA 5EH9A 4KEPA 4ZEJA 2ZWRA 5LCFA 2BGAA 3AJ3A 1BVTA 2FU7A 2WYLA 3PG4A 2NYPA 3Q6VA 4C1DA 4FEKA 2GFJA 2GFKA 5LSCA 4D1VA 4Z60A 2FK6A 2OHJA 1DDKA 4AWZA 4RM5A 2BG8A 2BIBA 2BG6A 5B15A 4PDXA 1K07A 2WYMC 4TZFA 3ZQ4A 4D1UA 3ZNBA 2DOOA 5HIPA 4V0HA 1Y44A 2M5DA 3IE2A 1YCGA 5ACVA 2YNWA 4C1EA 3IE1A 2YNUA 4EXYA 1YCHA 5K0WA 3AF5A 3QH8A 4TYTA 4Z6XA 5IQKA 4C1HA 5HH5A 3BK2A 3I11A 4ZO2A 2CG3A 2XF4A 1JT1A 1VJNA 3T3NA 3BK1A 5AHRA 3ZWFA 2FM6A 1BMCA 3SFPA 2GKLA 4TZ9A 5EWAA 5B3RA 4EXSA 5ACSA 3SD9A 2I7VA 1WRAA 3JXPA 2FU6A 3RKJA 4D02A 2YCBA 4RL0A 4CHLA 5EVDA 4YSLA 5AEBA 1KO3A 2FU8A 2P4ZA 1WUOA 3VPEA 2ZZIA 2OHIA 2QJSA 4RBSA 3G1PA 4C1CA 2VW8A 2OHHA 3VQZA 3I13A 1JJTA 2YNVB 4AWYB 4O98A 2QEDA 2BR6A 4AX0B 3T9MA 1QH3A 2P18A 2HB9A 4RAWA 1DD6A 3DHAA 1E5DA 5ACQA 1A7TA 2H6AA 4AX1B 4EYFA 5AHOA 4F6ZA 2BFZB 3I0VA 4UA4A 4BZ3A 1JJEA 5LMCA 5ACXA 4UWOB 2GCUA 3I14A 3F9OA 2ZNBA 1X8GA 2Q42A 4YSKA 1BC2A 2Q9UA 3KNRA 2E7YA 3PY6A 2CBNA 4PVTA 4TZEA 4Z67A 2QINA 4P62A
chains in the Genus database with same CATH topology
3IE0A 4UWSB 1X8IA 2I7TA 4Z5YA 4UWRB 3L6NA 4EFZA 3T3OA 1X8HA 4DILA 4TZBA 3X2XA 4PVOA 5K4NA 4NQ2A 2Q0JA 4HL1A 3BV6A 2Q0IA 3SPUA 4HL2A 2YNVA 4H0DA 3IEKA 2DKFA 3H3EA 1ZNBA 4BP0A 4XWWA 3X2ZA 5FQBA 3MD7A 4UAMA 1DXKA 2XR1A 5EHTA 5EVKA 2YNTA 4EYLA 5A87A 4RL2A 2A7MA 4NQ5A 1ZKPA 5HISA 5A0TA 5LCHA 5DPXA 5AXRA 2WRSA 1QH5A 2GMNA 4ZNBA 4HKYA 4D1WA 4UWPB 2R2DA 5FQCA 3IELA 2AIOA 3ZR9A 2QDTA 5AXOA 1A8TA 3SBLA 5K4KA 4EY2A 4C1GA 4WD6A 5HH4A 4U4LA 2BFZA 2FU9A 2UYXA 3IOFA 5EV6A 3IDZA 1SMLA 5LE1A 3A4YA 5EW0A 1WUPA 1KR3A 4EYBA 4GCWA 5ACPA 1XM8A 2Y8AA 4NQ6A 3RPCA 5B1UA 2FHXA 5ACTA 5KIKA 4B87A 5ACWA 3S0ZA 2BG2A 4LE6A 2M5CA 1L9YA 4JO0A 3DH8A 5HIQA 4ZO3A 1KO2A 3LVZA 2P97A 3KNSA 3WXCA 5KILA 1VMEA 3AF6A 2NZEA 2BFLA 2Y87A 1XTOA 4YSBA 5EVBA 2BC2A 4F6HA 4KEQA 5HIOA 4RAMA 2BMIA 3FCZA 3X2YA 1VGNA 4D1TA 4DIKA 2AZ4A 2YZ3A 4Z5ZA 4FSBA 1ZTCA 2NZFA 5ACUA 1M2XA 3IOGA 3DHBA 5LS3A 3TP9A 2ZO4A 5LM6A 3X30A 3P2UA 2NXAA 4J5FA 4TYFA 4XWTA 4UBQA 5EV8A 3FAIA 2P1EA 2YNTB 2WHGA 4C09A 5K4MA 3I15A 3PY5A 4J5HA 3BC2A 5FQAA 3RKKA 1MQOA 2Y8BA 4FR7A 1P9EA 3SRXA 1YCFA 2BG7A 2I7XA 4GYUA 3IEMA 5HH6A 2BFKA 4C1FA 3KL7A 4GYQA 1HLKA 3DHCA 4XUKA 5LLDA 5A5ZA 4NQ4A 4Z7RA 2WYMA 4AD9A 3ADRA 3R2UA 1WW1A 2BG8B 5AYAA 5A0VA 2BTNA 5LCAA 5ACRA 2QDSA 3SW3A 2FHXB 3ESHA 5EH9A 4KEPA 4ZEJA 2ZWRA 5LCFA 2BGAA 3AJ3A 1BVTA 2FU7A 2WYLA 3PG4A 2NYPA 3Q6VA 4C1DA 4FEKA 2GFJA 2GFKA 5LSCA 4D1VA 4Z60A 2FK6A 2OHJA 1DDKA 4AWZA 4RM5A 2BG8A 2BIBA 2BG6A 5B15A 1K07A 2WYMC 4TZFA 3ZQ4A 4D1UA 3ZNBA 2DOOA 5HIPA 4V0HA 1Y44A 2M5DA 3IE2A 1YCGA 5ACVA 2YNWA 4C1EA 3IE1A 2YNUA 4EXYA 1YCHA 5K0WA 3AF5A 3QH8A 4TYTA 4Z6XA 5IQKA 4C1HA 5HH5A 3BK2A 3I11A 4ZO2A 2XF4A 1JT1A 1VJNA 3T3NA 3BK1A 5AHRA 3ZWFA 2FM6A 1BMCA 3SFPA 2GKLA 4TZ9A 5EWAA 5B3RA 4EXSA 5ACSA 3SD9A 2I7VA 1WRAA 3JXPA 2FU6A 3RKJA 4D02A 2YCBA 4RL0A 4CHLA 5EVDA 4YSLA 5AEBA 1KO3A 2FU8A 2P4ZA 1WUOA 3VPEA 2ZZIA 2OHIA 2QJSA 4RBSA 3G1PA 4C1CA 2VW8A 2OHHA 3VQZA 3I13A 1JJTA 2YNVB 4AWYB 4O98A 2QEDA 2BR6A 4AX0B 3T9MA 1QH3A 2P18A 2HB9A 4RAWA 1DD6A 3DHAA 1E5DA 5ACQA 1A7TA 2H6AA 4AX1B 4EYFA 5AHOA 4F6ZA 2BFZB 3I0VA 4UA4A 4BZ3A 1JJEA 5LMCA 5ACXA 4UWOB 2GCUA 3I14A 3F9OA 2ZNBA 1X8GA 2Q42A 4YSKA 1BC2A 2Q9UA 3KNRA 2E7YA 3PY6A 2CBNA 4PVTA 4TZEA 4Z67A 2QINA 4P62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IE0 A;  4UWS B;  1X8I A;  2I7T A;  4Z5Y A;  4UWR B;  3L6N A;  4EFZ A;  3T3O A;  1X8H A;  4DIL A;  4TZB A;  3X2X A;  4PVO A;  5K4N A;  4NQ2 A;  2Q0J A;  4HL1 A;  3BV6 A;  2Q0I A;  3SPU A;  4HL2 A;  2YNV A;  4H0D A;  3IEK A;  2DKF A;  3H3E A;  1ZNB A;  4BP0 A;  4XWW A;  3X2Z A;  5FQB A;  3MD7 A;  4UAM A;  1DXK A;  2XR1 A;  5EHT A;  5EVK A;  2YNT A;  4EYL A;  5A87 A;  4RL2 A;  2A7M A;  4NQ5 A;  1ZKP A;  5HIS A;  5A0T A;  5LCH A;  5DPX A;  5AXR A;  2WRS A;  1QH5 A;  2GMN A;  4ZNB A;  4HKY A;  4D1W A;  4UWP B;  2R2D A;  5FQC A;  3IEL A;  2AIO A;  3ZR9 A;  2QDT A;  5AXO A;  1A8T A;  3SBL A;  5K4K A;  4EY2 A;  4C1G A;  4WD6 A;  5HH4 A;  4U4L A;  2BFZ A;  2FU9 A;  2UYX A;  3IOF A;  5EV6 A;  3IDZ A;  1SML A;  5LE1 A;  3A4Y A;  5EW0 A;  1WUP A;  1KR3 A;  4EYB A;  4GCW A;  5ACP A;  1XM8 A;  2Y8A A;  4NQ6 A;  3RPC A;  5B1U A;  2FHX A;  5ACT A;  5KIK A;  4B87 A;  5ACW A;  3S0Z A;  2BG2 A;  4LE6 A;  2M5C A;  1L9Y A;  4JO0 A;  3DH8 A;  5HIQ A;  4ZO3 A;  1KO2 A;  3LVZ A;  2P97 A;  3KNS A;  3WXC A;  5KIL A;  1VME A;  3AF6 A;  2NZE A;  2BFL A;  2Y87 A;  1XTO A;  4YSB A;  5EVB A;  2BC2 A;  4F6H A;  4KEQ A;  5HIO A;  4RAM A;  2BMI A;  3FCZ A;  3X2Y A;  1VGN A;  4D1T A;  4DIK A;  2AZ4 A;  2YZ3 A;  4Z5Z A;  4FSB A;  1ZTC A;  2NZF A;  5ACU A;  1M2X A;  3IOG A;  3DHB A;  5LS3 A;  3TP9 A;  2ZO4 A;  5LM6 A;  3X30 A;  3P2U A;  2NXA A;  4J5F A;  4TYF A;  4XWT A;  4UBQ A;  5EV8 A;  3FAI A;  2P1E A;  2YNT B;  2WHG A;  4C09 A;  5K4M A;  3I15 A;  3PY5 A;  4J5H A;  3BC2 A;  5FQA A;  3RKK A;  1MQO A;  2Y8B A;  4FR7 A;  1P9E A;  3SRX A;  1YCF A;  2BG7 A;  2I7X A;  4GYU A;  3IEM A;  5HH6 A;  2BFK A;  4C1F A;  3KL7 A;  4GYQ A;  1HLK A;  3DHC A;  4XUK A;  5LLD A;  5A5Z A;  4NQ4 A;  4Z7R A;  2WYM A;  4AD9 A;  3ADR A;  3R2U A;  1WW1 A;  2BG8 B;  5AYA A;  5A0V A;  2BTN A;  5LCA A;  5ACR A;  2QDS A;  3SW3 A;  2FHX B;  3ESH A;  5EH9 A;  4KEP A;  4ZEJ A;  2ZWR A;  5LCF A;  2BGA A;  3AJ3 A;  1BVT A;  2FU7 A;  2WYL A;  3PG4 A;  2NYP A;  3Q6V A;  4C1D A;  4FEK A;  2GFJ A;  2GFK A;  5LSC A;  4D1V A;  4Z60 A;  2FK6 A;  2OHJ A;  1DDK A;  4AWZ A;  4RM5 A;  2BG8 A;  2BIB A;  2BG6 A;  5B15 A;  1K07 A;  2WYM C;  4TZF A;  3ZQ4 A;  4D1U A;  3ZNB A;  2DOO A;  5HIP A;  4V0H A;  1Y44 A;  2M5D A;  3IE2 A;  1YCG A;  5ACV A;  2YNW A;  4C1E A;  3IE1 A;  2YNU A;  4EXY A;  1YCH A;  5K0W A;  3AF5 A;  3QH8 A;  4TYT A;  4Z6X A;  5IQK A;  4C1H A;  5HH5 A;  3BK2 A;  3I11 A;  4ZO2 A;  2XF4 A;  1JT1 A;  1VJN A;  3T3N A;  3BK1 A;  5AHR A;  3ZWF A;  2FM6 A;  1BMC A;  3SFP A;  2GKL A;  4TZ9 A;  5EWA A;  5B3R A;  4EXS A;  5ACS A;  3SD9 A;  2I7V A;  1WRA A;  3JXP A;  2FU6 A;  3RKJ A;  4D02 A;  2YCB A;  4RL0 A;  4CHL A;  5EVD A;  4YSL A;  5AEB A;  1KO3 A;  2FU8 A;  2P4Z A;  1WUO A;  3VPE A;  2ZZI A;  2OHI A;  2QJS A;  4RBS A;  3G1P A;  4C1C A;  2VW8 A;  2OHH A;  3VQZ A;  3I13 A;  1JJT A;  2YNV B;  4AWY B;  4O98 A;  2QED A;  2BR6 A;  4AX0 B;  3T9M A;  1QH3 A;  2P18 A;  2HB9 A;  4RAW A;  1DD6 A;  3DHA A;  1E5D A;  5ACQ A;  1A7T A;  2H6A A;  4AX1 B;  4EYF A;  5AHO A;  4F6Z A;  2BFZ B;  3I0V A;  4UA4 A;  4BZ3 A;  1JJE A;  5LMC A;  5ACX A;  4UWO B;  2GCU A;  3I14 A;  3F9O A;  2ZNB A;  1X8G A;  2Q42 A;  4YSK A;  1BC2 A;  2Q9U A;  3KNR A;  2E7Y A;  3PY6 A;  2CBN A;  4PVT A;  4TZE A;  4Z67 A;  2QIN A;  4P62 A; 
#chains in the Genus database with same CATH topology
 3IE0 A;  4UWS B;  1X8I A;  2I7T A;  4Z5Y A;  4UWR B;  3L6N A;  4EFZ A;  3T3O A;  1X8H A;  4DIL A;  4TZB A;  3X2X A;  4PVO A;  5K4N A;  4NQ2 A;  2Q0J A;  4HL1 A;  3BV6 A;  2Q0I A;  3SPU A;  4HL2 A;  2YHE A;  2YNV A;  4H0D A;  3IEK A;  2DKF A;  3H3E A;  2CFZ A;  1ZNB A;  4BP0 A;  4XWW A;  3X2Z A;  5FQB A;  3MD7 A;  4UAM A;  1DXK A;  2XR1 A;  5EHT A;  5A23 A;  5EVK A;  2YNT A;  4EYL A;  5A87 A;  4RL2 A;  5AIJ A;  2A7M A;  4NQ5 A;  1ZKP A;  5HIS A;  5A0T A;  5LCH A;  5DPX A;  5AXR A;  2WRS A;  1QH5 A;  2GMN A;  4ZNB A;  4HKY A;  4D1W A;  4UWP B;  2R2D A;  5FQC A;  3IEL A;  2AIO A;  3ZR9 A;  2QDT A;  5AXO A;  1A8T A;  3SBL A;  5K4K A;  4EY2 A;  4C1G A;  4WD6 A;  4NUR A;  5HH4 A;  4U4L A;  2BFZ A;  2FU9 A;  2UYX A;  3IOF A;  5EV6 A;  3IDZ A;  1SML A;  5LE1 A;  2CG2 A;  3A4Y A;  5EW0 A;  1WUP A;  1KR3 A;  4EYB A;  4GCW A;  5ACP A;  1XM8 A;  2Y8A A;  4NQ6 A;  3RPC A;  5B1U A;  2FHX A;  5ACT A;  5KIK A;  4B87 A;  5ACW A;  3S0Z A;  2BG2 A;  4LE6 A;  2M5C A;  1L9Y A;  4JO0 A;  3DH8 A;  5HIQ A;  4ZO3 A;  1KO2 A;  3LVZ A;  2P97 A;  3KNS A;  5AJL A;  3WXC A;  5KIL A;  1VME A;  3AF6 A;  2NZE A;  2BFL A;  2Y87 A;  1XTO A;  4YSB A;  5EVB A;  2BC2 A;  4F6H A;  4KEQ A;  5HIO A;  4RAM A;  2BMI A;  4AV7 A;  3FCZ A;  3X2Y A;  1VGN A;  4D1T A;  4DIK A;  2AZ4 A;  2YZ3 A;  4Z5Z A;  4FSB A;  1ZTC A;  2NZF A;  5ACU A;  1M2X A;  3IOG A;  3DHB A;  5LS3 A;  3TP9 A;  2ZO4 A;  5LM6 A;  3X30 A;  3P2U A;  2NXA A;  4J5F A;  4TYF A;  4XWT A;  4UBQ A;  5EV8 A;  3FAI A;  2P1E A;  2YNT B;  2WHG A;  4C09 A;  5K4M A;  3I15 A;  3PY5 A;  4J5H A;  3BC2 A;  5FQA A;  3RKK A;  1MQO A;  2Y8B A;  4FR7 A;  1P9E A;  3SRX A;  1YCF A;  2BG7 A;  2I7X A;  4GYU A;  3IEM A;  5HH6 A;  2BFK A;  4C1F A;  3KL7 A;  4GYQ A;  1HLK A;  3DHC A;  4XUK A;  4AXH A;  5LLD A;  5A5Z A;  4NQ4 A;  4Z7R A;  2WYM A;  4AD9 A;  3ADR A;  3R2U A;  1WW1 A;  2BG8 B;  5AYA A;  5A0V A;  2CFU A;  2BTN A;  5LCA A;  5ACR A;  2QDS A;  3SW3 A;  2FHX B;  3ESH A;  5EH9 A;  4KEP A;  4ZEJ A;  2ZWR A;  5LCF A;  2BGA A;  3AJ3 A;  1BVT A;  2FU7 A;  2WYL A;  3PG4 A;  2NYP A;  3Q6V A;  4C1D A;  4FEK A;  2GFJ A;  2GFK A;  5LSC A;  4D1V A;  4Z60 A;  2FK6 A;  2OHJ A;  1DDK A;  4AWZ A;  4RM5 A;  2BG8 A;  2BIB A;  2BG6 A;  5B15 A;  4PDX A;  1K07 A;  2WYM C;  4TZF A;  3ZQ4 A;  4D1U A;  3ZNB A;  2DOO A;  5HIP A;  4V0H A;  1Y44 A;  2M5D A;  3IE2 A;  1YCG A;  5ACV A;  2YNW A;  4C1E A;  3IE1 A;  2YNU A;  4EXY A;  1YCH A;  5K0W A;  3AF5 A;  3QH8 A;  4TYT A;  4Z6X A;  5IQK A;  4C1H A;  5HH5 A;  3BK2 A;  3I11 A;  4ZO2 A;  2CG3 A;  2XF4 A;  1JT1 A;  1VJN A;  3T3N A;  3BK1 A;  5AHR A;  3ZWF A;  2FM6 A;  1BMC A;  3SFP A;  2GKL A;  4TZ9 A;  5EWA A;  5B3R A;  4EXS A;  5ACS A;  3SD9 A;  2I7V A;  1WRA A;  3JXP A;  2FU6 A;  3RKJ A;  4D02 A;  2YCB A;  4RL0 A;  4CHL A;  5EVD A;  4YSL A;  5AEB A;  1KO3 A;  2FU8 A;  2P4Z A;  1WUO A;  3VPE A;  2ZZI A;  2OHI A;  2QJS A;  4RBS A;  3G1P A;  4C1C A;  2VW8 A;  2OHH A;  3VQZ A;  3I13 A;  1JJT A;  2YNV B;  4AWY B;  4O98 A;  2QED A;  2BR6 A;  4AX0 B;  3T9M A;  1QH3 A;  2P18 A;  2HB9 A;  4RAW A;  1DD6 A;  3DHA A;  1E5D A;  5ACQ A;  1A7T A;  2H6A A;  4AX1 B;  4EYF A;  5AHO A;  4F6Z A;  2BFZ B;  3I0V A;  4UA4 A;  4BZ3 A;  1JJE A;  5LMC A;  5ACX A;  4UWO B;  2GCU A;  3I14 A;  3F9O A;  2ZNB A;  1X8G A;  2Q42 A;  4YSK A;  1BC2 A;  2Q9U A;  3KNR A;  2E7Y A;  3PY6 A;  2CBN A;  4PVT A;  4TZE A;  4Z67 A;  2QIN A;  4P62 A; 
#chains in the Genus database with same CATH homology
 3IE0 A;  4UWS B;  1X8I A;  2I7T A;  4Z5Y A;  4UWR B;  3L6N A;  4EFZ A;  3T3O A;  1X8H A;  4DIL A;  4TZB A;  3X2X A;  4PVO A;  5K4N A;  4NQ2 A;  2Q0J A;  4HL1 A;  3BV6 A;  2Q0I A;  3SPU A;  4HL2 A;  2YNV A;  4H0D A;  3IEK A;  2DKF A;  3H3E A;  1ZNB A;  4BP0 A;  4XWW A;  3X2Z A;  5FQB A;  3MD7 A;  4UAM A;  1DXK A;  2XR1 A;  5EHT A;  5EVK A;  2YNT A;  4EYL A;  5A87 A;  4RL2 A;  2A7M A;  4NQ5 A;  1ZKP A;  5HIS A;  5A0T A;  5LCH A;  5DPX A;  5AXR A;  2WRS A;  1QH5 A;  2GMN A;  4ZNB A;  4HKY A;  4D1W A;  4UWP B;  2R2D A;  5FQC A;  3IEL A;  2AIO A;  3ZR9 A;  2QDT A;  5AXO A;  1A8T A;  3SBL A;  5K4K A;  4EY2 A;  4C1G A;  4WD6 A;  5HH4 A;  4U4L A;  2BFZ A;  2FU9 A;  2UYX A;  3IOF A;  5EV6 A;  3IDZ A;  1SML A;  5LE1 A;  3A4Y A;  5EW0 A;  1WUP A;  1KR3 A;  4EYB A;  4GCW A;  5ACP A;  1XM8 A;  2Y8A A;  4NQ6 A;  3RPC A;  5B1U A;  2FHX A;  5ACT A;  5KIK A;  4B87 A;  5ACW A;  3S0Z A;  2BG2 A;  4LE6 A;  2M5C A;  1L9Y A;  4JO0 A;  3DH8 A;  5HIQ A;  4ZO3 A;  1KO2 A;  3LVZ A;  2P97 A;  3KNS A;  3WXC A;  5KIL A;  1VME A;  3AF6 A;  2NZE A;  2BFL A;  2Y87 A;  1XTO A;  4YSB A;  5EVB A;  2BC2 A;  4F6H A;  4KEQ A;  5HIO A;  4RAM A;  2BMI A;  3FCZ A;  3X2Y A;  1VGN A;  4D1T A;  4DIK A;  2AZ4 A;  2YZ3 A;  4Z5Z A;  4FSB A;  1ZTC A;  2NZF A;  5ACU A;  1M2X A;  3IOG A;  3DHB A;  5LS3 A;  3TP9 A;  2ZO4 A;  5LM6 A;  3X30 A;  3P2U A;  2NXA A;  4J5F A;  4TYF A;  4XWT A;  4UBQ A;  5EV8 A;  3FAI A;  2P1E A;  2YNT B;  2WHG A;  4C09 A;  5K4M A;  3I15 A;  3PY5 A;  4J5H A;  3BC2 A;  5FQA A;  3RKK A;  1MQO A;  2Y8B A;  4FR7 A;  1P9E A;  3SRX A;  1YCF A;  2BG7 A;  2I7X A;  4GYU A;  3IEM A;  5HH6 A;  2BFK A;  4C1F A;  3KL7 A;  4GYQ A;  1HLK A;  3DHC A;  4XUK A;  5LLD A;  5A5Z A;  4NQ4 A;  4Z7R A;  2WYM A;  4AD9 A;  3ADR A;  3R2U A;  1WW1 A;  2BG8 B;  5AYA A;  5A0V A;  2BTN A;  5LCA A;  5ACR A;  2QDS A;  3SW3 A;  2FHX B;  3ESH A;  5EH9 A;  4KEP A;  4ZEJ A;  2ZWR A;  5LCF A;  2BGA A;  3AJ3 A;  1BVT A;  2FU7 A;  2WYL A;  3PG4 A;  2NYP A;  3Q6V A;  4C1D A;  4FEK A;  2GFJ A;  2GFK A;  5LSC A;  4D1V A;  4Z60 A;  2FK6 A;  2OHJ A;  1DDK A;  4AWZ A;  4RM5 A;  2BG8 A;  2BIB A;  2BG6 A;  5B15 A;  1K07 A;  2WYM C;  4TZF A;  3ZQ4 A;  4D1U A;  3ZNB A;  2DOO A;  5HIP A;  4V0H A;  1Y44 A;  2M5D A;  3IE2 A;  1YCG A;  5ACV A;  2YNW A;  4C1E A;  3IE1 A;  2YNU A;  4EXY A;  1YCH A;  5K0W A;  3AF5 A;  3QH8 A;  4TYT A;  4Z6X A;  5IQK A;  4C1H A;  5HH5 A;  3BK2 A;  3I11 A;  4ZO2 A;  2XF4 A;  1JT1 A;  1VJN A;  3T3N A;  3BK1 A;  5AHR A;  3ZWF A;  2FM6 A;  1BMC A;  3SFP A;  2GKL A;  4TZ9 A;  5EWA A;  5B3R A;  4EXS A;  5ACS A;  3SD9 A;  2I7V A;  1WRA A;  3JXP A;  2FU6 A;  3RKJ A;  4D02 A;  2YCB A;  4RL0 A;  4CHL A;  5EVD A;  4YSL A;  5AEB A;  1KO3 A;  2FU8 A;  2P4Z A;  1WUO A;  3VPE A;  2ZZI A;  2OHI A;  2QJS A;  4RBS A;  3G1P A;  4C1C A;  2VW8 A;  2OHH A;  3VQZ A;  3I13 A;  1JJT A;  2YNV B;  4AWY B;  4O98 A;  2QED A;  2BR6 A;  4AX0 B;  3T9M A;  1QH3 A;  2P18 A;  2HB9 A;  4RAW A;  1DD6 A;  3DHA A;  1E5D A;  5ACQ A;  1A7T A;  2H6A A;  4AX1 B;  4EYF A;  5AHO A;  4F6Z A;  2BFZ B;  3I0V A;  4UA4 A;  4BZ3 A;  1JJE A;  5LMC A;  5ACX A;  4UWO B;  2GCU A;  3I14 A;  3F9O A;  2ZNB A;  1X8G A;  2Q42 A;  4YSK A;  1BC2 A;  2Q9U A;  3KNR A;  2E7Y A;  3PY6 A;  2CBN A;  4PVT A;  4TZE A;  4Z67 A;  2QIN A;  4P62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...