5EW0A

Crystal structure of the metallo-beta-lactamase sfh-i in complex with the bisthiazolidine inhibitor l-cs319
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
228
Chain Sequence
NLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia fonticola
molecule tags Hydrolase
total genus 84
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ew0A00
3ADRA 4LE6A 2DKFA 2OHJA 3IE0A 4C1FA 2FHXB 3BK1A 5LSCA 3IEMA 3KL7A 2BFZA 1M2XA 5ACTA 2P18A 3QH8A 2NZFA 4F6HA 2GMNA 1VJNA 3X30A 2NZEA 4RBSA 1A7TA 2OHHA 3R2UA 3T3OA 4H0DA 3BC2A 4UA4A 3X2YA 5EVKA 3SBLA 3SFPA 1DXKA 2CBNA 1E5DA 1ZNBA 3SRXA 4DILA 3ZQ4A 5HISA 5A0VA 1XTOA 4ZNBA 4NQ6A 3RPCA 1X8HA 3DHCA 4C1HA 4TZEA 4D02A 3AF5A 5K0WA 3ESHA 2A7MA 1BC2A 5A87A 5A0TA 2BG8B 3A4YA 2I7VA 4Z7RA 4BP0A 5LLDA 4FEKA 4Z67A 2QDSA 2FU9A 3WXCA 4ZEJA 5EVBA 2FU7A 5ACVA 2I7TA 2BIBA 4UBQA 4UWRB 4UAMA 1QH3A 1YCFA 2WRSA 3PY6A 4AWZA 2YNUA 3DHAA 5AHOA 2Y8AA 4RAWA 4D1WA 4Z6XA 4AX1B 2YNTA 2YCBA 5LCFA 2Q42A 4J5FA 2Q0JA 4C1CA 5EH9A 2GFJA 3H3EA 2ZNBA 4U4LA 2XF4A 4O98A 2XR1A 3SW3A 4EYBA 1MQOA 3IE1A 4RM5A 1P9EA 5B3RA 4P62A 4TYTA 3T3NA 2VW8A 4NQ5A 5AHRA 5HIQA 2QJSA 2NXAA 3I0VA 2P4ZA 3VQZA 3I11A 5LCAA 4RAMA 3PY5A 5B15A 3AJ3A 1VMEA 1X8IA 1WRAA 1BVTA 1YCHA 2BTNA 4XWWA 4D1TA 4FSBA 4TZBA 2YNWA 3S0ZA 1KO3A 4Z5ZA 2M5DA 2BFZB 3ZNBA 2FM6A 2YNVA 4HL2A 5ACPA 1A8TA 3IELA 3IOGA 4C1DA 2UYXA 4KEQA 4PVTA 2AZ4A 5ACXA 3G1PA 2BFLA 5HH5A 3L6NA 4EYFA 1JJTA 1HLKA 5K4MA 5IQKA 5LM6A 3P2UA 4V0HA 3LVZA 5AYAA 2BG8A 3IEKA 2YZ3A 2BC2A 2I7XA 1BMCA 5KIKA 1X8GA 2FK6A 5AEBA 5AXRA 5K4NA 1KR3A 3T9MA 5HH4A 4EFZA 5EV6A 3IOFA 3KNRA 2GCUA 4TZ9A 4EYLA 5KILA 2BG2A 2FU6A 1KO2A 2WYMA 5HH6A 4AX0B 4BZ3A 4RL0A 2QDTA 2WYMC 4TZFA 2R2DA 5EW0A 1XM8A 5FQBA 3JXPA 2YNTB 3X2ZA 2WYLA 3AF6A 2BGAA 4UWOB 5A5ZA 1QH5A 5FQAA 4AWYB 2BMIA 3ZWFA 4EY2A 2M5CA 2E7YA 2P1EA 2BG6A 5K4KA 3SPUA 5EV8A 4F6ZA 4CHLA 5LS3A 2ZZIA 4JO0A 1ZTCA 1WUOA 4KEPA 4ZO2A 4NQ4A 2P97A 1VGNA 3TP9A 4DIKA 4ZO3A 3FAIA 4PVOA 4GCWA 3BV6A 2FHXA 4UWPB 2NYPA 4WD6A 4YSBA 5LCHA 4YSKA 4RL2A 2H6AA 3X2XA 2WHGA 2ZO4A 4YSLA 2AIOA 2BFKA 5FQCA 2YNVB 4NQ2A 5B1UA 4C1EA 3FCZA 3I14A 3F9OA 5DPXA 3SD9A 3MD7A 1JT1A 1L9YA 2HB9A 2QINA 2OHIA 3IDZA 4Z5YA 4EXYA 2ZWRA 2Y87A 2BR6A 4XWTA 4C1GA 4C09A 5LMCA 4GYUA 2Q0IA 3DHBA 4Z60A 1ZKPA 3I13A 5EHTA 4D1UA 3IE2A 5AXOA 2QEDA 2FU8A 1JJEA 3Q6VA 4AD9A 5ACSA 4GYQA 3DH8A 2DOOA 4B87A 3RKKA 1WW1A 5ACRA 4J5HA 3PG4A 4EXSA 1WUPA 4D1VA 5EWAA 1DDKA 3KNSA 1SMLA 4XUKA 1DD6A 2Y8BA 5ACWA 4TYFA 4HKYA 4UWSB 2BG7A 2Q9UA 3ZR9A 3VPEA 3BK2A 5LE1A 2GFKA 5EVDA 3I15A 1K07A 1Y44A 4FR7A 2GKLA 3RKJA 5ACQA 4HL1A 5HIOA 5HIPA 1YCGA 5ACUA
chains in the Genus database with same CATH superfamily
3ADRA 4LE6A 2DKFA 2OHJA 3IE0A 4C1FA 2FHXB 3BK1A 5LSCA 3IEMA 3KL7A 2BFZA 1M2XA 5ACTA 2P18A 3QH8A 2NZFA 4F6HA 2GMNA 1VJNA 3X30A 2NZEA 4RBSA 1A7TA 2OHHA 3R2UA 3T3OA 4H0DA 3BC2A 4UA4A 3X2YA 5EVKA 2CG3A 3SBLA 3SFPA 1DXKA 2CBNA 1E5DA 1ZNBA 3SRXA 4DILA 3ZQ4A 5HISA 5A0VA 1XTOA 4ZNBA 4NQ6A 3RPCA 1X8HA 3DHCA 4C1HA 4TZEA 4D02A 3AF5A 5K0WA 3ESHA 2A7MA 1BC2A 5A87A 5A0TA 2BG8B 3A4YA 2I7VA 4Z7RA 4BP0A 5LLDA 4FEKA 4Z67A 2QDSA 2FU9A 3WXCA 4ZEJA 5EVBA 2FU7A 5ACVA 2I7TA 2BIBA 4UBQA 4UWRB 4UAMA 1QH3A 1YCFA 2WRSA 3PY6A 4AWZA 2YNUA 3DHAA 5AHOA 2Y8AA 4RAWA 4NURA 4D1WA 2CFZA 4Z6XA 4AX1B 2YNTA 2YCBA 5LCFA 2Q42A 4J5FA 2Q0JA 4C1CA 5EH9A 2GFJA 3H3EA 2ZNBA 4U4LA 2XF4A 4O98A 2XR1A 3SW3A 4EYBA 1MQOA 3IE1A 4RM5A 1P9EA 5B3RA 4P62A 4TYTA 3T3NA 5AIJA 2VW8A 4NQ5A 5AHRA 5HIQA 2QJSA 2NXAA 3I0VA 2P4ZA 3VQZA 3I11A 5LCAA 4RAMA 3PY5A 5B15A 3AJ3A 1VMEA 1X8IA 1WRAA 1BVTA 1YCHA 2BTNA 4XWWA 4D1TA 4FSBA 4TZBA 2YNWA 3S0ZA 1KO3A 4Z5ZA 2M5DA 2BFZB 3ZNBA 2FM6A 2YNVA 4HL2A 5ACPA 1A8TA 3IELA 3IOGA 4C1DA 2UYXA 4KEQA 4PVTA 2AZ4A 5ACXA 3G1PA 2BFLA 5HH5A 3L6NA 4EYFA 1JJTA 1HLKA 5K4MA 5IQKA 5LM6A 3P2UA 4V0HA 3LVZA 5AYAA 2BG8A 3IEKA 2YZ3A 2BC2A 2I7XA 1BMCA 5KIKA 1X8GA 2FK6A 5AEBA 5AXRA 5K4NA 1KR3A 4AXHA 3T9MA 5HH4A 4EFZA 5EV6A 3IOFA 3KNRA 2GCUA 4TZ9A 4EYLA 5KILA 2BG2A 2FU6A 1KO2A 2WYMA 5HH6A 2YHEA 4AX0B 4BZ3A 4RL0A 2QDTA 2WYMC 4TZFA 2R2DA 5EW0A 1XM8A 5FQBA 3JXPA 2YNTB 3X2ZA 2WYLA 3AF6A 2BGAA 4UWOB 5A5ZA 1QH5A 5FQAA 4AWYB 2BMIA 3ZWFA 4EY2A 2M5CA 2E7YA 2P1EA 2BG6A 5K4KA 3SPUA 5EV8A 4F6ZA 4PDXA 4CHLA 5LS3A 2ZZIA 4JO0A 1ZTCA 1WUOA 4KEPA 4ZO2A 4NQ4A 2P97A 1VGNA 3TP9A 4DIKA 4ZO3A 3FAIA 4PVOA 4GCWA 3BV6A 2FHXA 4UWPB 2NYPA 4WD6A 4YSBA 5LCHA 4YSKA 4RL2A 2H6AA 3X2XA 2WHGA 2ZO4A 4YSLA 2AIOA 2BFKA 5FQCA 2YNVB 2CFUA 4NQ2A 5B1UA 4C1EA 3FCZA 3I14A 3F9OA 5DPXA 3SD9A 3MD7A 1JT1A 1L9YA 2HB9A 2QINA 2OHIA 3IDZA 4Z5YA 4EXYA 2ZWRA 2Y87A 2BR6A 4XWTA 4C1GA 4C09A 5LMCA 4GYUA 2CG2A 2Q0IA 3DHBA 4Z60A 1ZKPA 3I13A 5EHTA 4D1UA 3IE2A 5AXOA 2QEDA 2FU8A 1JJEA 3Q6VA 4AD9A 5ACSA 4GYQA 3DH8A 4AV7A 2DOOA 4B87A 3RKKA 1WW1A 5ACRA 4J5HA 3PG4A 5A23A 4EXSA 1WUPA 4D1VA 5EWAA 1DDKA 3KNSA 1SMLA 4XUKA 1DD6A 2Y8BA 5ACWA 4TYFA 4HKYA 4UWSB 2BG7A 2Q9UA 3ZR9A 3VPEA 3BK2A 5LE1A 2GFKA 5EVDA 3I15A 1K07A 5AJLA 1Y44A 4FR7A 2GKLA 3RKJA 5ACQA 4HL1A 5HIOA 5HIPA 1YCGA 5ACUA
chains in the Genus database with same CATH topology
3ADRA 4LE6A 2DKFA 2OHJA 3IE0A 4C1FA 2FHXB 3BK1A 5LSCA 3IEMA 3KL7A 2BFZA 1M2XA 5ACTA 2P18A 3QH8A 2NZFA 4F6HA 2GMNA 1VJNA 3X30A 2NZEA 4RBSA 1A7TA 2OHHA 3R2UA 3T3OA 4H0DA 3BC2A 4UA4A 3X2YA 5EVKA 3SBLA 3SFPA 1DXKA 2CBNA 1E5DA 1ZNBA 3SRXA 4DILA 3ZQ4A 5HISA 5A0VA 1XTOA 4ZNBA 4NQ6A 3RPCA 1X8HA 3DHCA 4C1HA 4TZEA 4D02A 3AF5A 5K0WA 3ESHA 2A7MA 1BC2A 5A87A 5A0TA 2BG8B 3A4YA 2I7VA 4Z7RA 4BP0A 5LLDA 4FEKA 4Z67A 2QDSA 2FU9A 3WXCA 4ZEJA 5EVBA 2FU7A 5ACVA 2I7TA 2BIBA 4UBQA 4UWRB 4UAMA 1QH3A 1YCFA 2WRSA 3PY6A 4AWZA 2YNUA 3DHAA 5AHOA 2Y8AA 4RAWA 4D1WA 4Z6XA 4AX1B 2YNTA 2YCBA 5LCFA 2Q42A 4J5FA 2Q0JA 4C1CA 5EH9A 2GFJA 3H3EA 2ZNBA 4U4LA 2XF4A 4O98A 2XR1A 3SW3A 4EYBA 1MQOA 3IE1A 4RM5A 1P9EA 5B3RA 4P62A 4TYTA 3T3NA 2VW8A 4NQ5A 5AHRA 5HIQA 2QJSA 2NXAA 3I0VA 2P4ZA 3VQZA 3I11A 5LCAA 4RAMA 3PY5A 5B15A 3AJ3A 1VMEA 1X8IA 1WRAA 1BVTA 1YCHA 2BTNA 4XWWA 4D1TA 4FSBA 4TZBA 2YNWA 3S0ZA 1KO3A 4Z5ZA 2M5DA 2BFZB 3ZNBA 2FM6A 2YNVA 4HL2A 5ACPA 1A8TA 3IELA 3IOGA 4C1DA 2UYXA 4KEQA 4PVTA 2AZ4A 5ACXA 3G1PA 2BFLA 5HH5A 3L6NA 4EYFA 1JJTA 1HLKA 5K4MA 5IQKA 5LM6A 3P2UA 4V0HA 3LVZA 5AYAA 2BG8A 3IEKA 2YZ3A 2BC2A 2I7XA 1BMCA 5KIKA 1X8GA 2FK6A 5AEBA 5AXRA 5K4NA 1KR3A 3T9MA 5HH4A 4EFZA 5EV6A 3IOFA 3KNRA 2GCUA 4TZ9A 4EYLA 5KILA 2BG2A 2FU6A 1KO2A 2WYMA 5HH6A 4AX0B 4BZ3A 4RL0A 2QDTA 2WYMC 4TZFA 2R2DA 5EW0A 1XM8A 5FQBA 3JXPA 2YNTB 3X2ZA 2WYLA 3AF6A 2BGAA 4UWOB 5A5ZA 1QH5A 5FQAA 4AWYB 2BMIA 3ZWFA 4EY2A 2M5CA 2E7YA 2P1EA 2BG6A 5K4KA 3SPUA 5EV8A 4F6ZA 4CHLA 5LS3A 2ZZIA 4JO0A 1ZTCA 1WUOA 4KEPA 4ZO2A 4NQ4A 2P97A 1VGNA 3TP9A 4DIKA 4ZO3A 3FAIA 4PVOA 4GCWA 3BV6A 2FHXA 4UWPB 2NYPA 4WD6A 4YSBA 5LCHA 4YSKA 4RL2A 2H6AA 3X2XA 2WHGA 2ZO4A 4YSLA 2AIOA 2BFKA 5FQCA 2YNVB 4NQ2A 5B1UA 4C1EA 3FCZA 3I14A 3F9OA 5DPXA 3SD9A 3MD7A 1JT1A 1L9YA 2HB9A 2QINA 2OHIA 3IDZA 4Z5YA 4EXYA 2ZWRA 2Y87A 2BR6A 4XWTA 4C1GA 4C09A 5LMCA 4GYUA 2Q0IA 3DHBA 4Z60A 1ZKPA 3I13A 5EHTA 4D1UA 3IE2A 5AXOA 2QEDA 2FU8A 1JJEA 3Q6VA 4AD9A 5ACSA 4GYQA 3DH8A 2DOOA 4B87A 3RKKA 1WW1A 5ACRA 4J5HA 3PG4A 4EXSA 1WUPA 4D1VA 5EWAA 1DDKA 3KNSA 1SMLA 4XUKA 1DD6A 2Y8BA 5ACWA 4TYFA 4HKYA 4UWSB 2BG7A 2Q9UA 3ZR9A 3VPEA 3BK2A 5LE1A 2GFKA 5EVDA 3I15A 1K07A 1Y44A 4FR7A 2GKLA 3RKJA 5ACQA 4HL1A 5HIOA 5HIPA 1YCGA 5ACUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADR A;  4LE6 A;  2DKF A;  2OHJ A;  3IE0 A;  4C1F A;  2FHX B;  3BK1 A;  5LSC A;  3IEM A;  3KL7 A;  2BFZ A;  1M2X A;  5ACT A;  2P18 A;  3QH8 A;  2NZF A;  4F6H A;  2GMN A;  1VJN A;  3X30 A;  2NZE A;  4RBS A;  1A7T A;  2OHH A;  3R2U A;  3T3O A;  4H0D A;  3BC2 A;  4UA4 A;  3X2Y A;  5EVK A;  3SBL A;  3SFP A;  1DXK A;  2CBN A;  1E5D A;  1ZNB A;  3SRX A;  4DIL A;  3ZQ4 A;  5HIS A;  5A0V A;  1XTO A;  4ZNB A;  4NQ6 A;  3RPC A;  1X8H A;  3DHC A;  4C1H A;  4TZE A;  4D02 A;  3AF5 A;  5K0W A;  3ESH A;  2A7M A;  1BC2 A;  5A87 A;  5A0T A;  2BG8 B;  3A4Y A;  2I7V A;  4Z7R A;  4BP0 A;  5LLD A;  4FEK A;  4Z67 A;  2QDS A;  2FU9 A;  3WXC A;  4ZEJ A;  5EVB A;  2FU7 A;  5ACV A;  2I7T A;  2BIB A;  4UBQ A;  4UWR B;  4UAM A;  1QH3 A;  1YCF A;  2WRS A;  3PY6 A;  4AWZ A;  2YNU A;  3DHA A;  5AHO A;  2Y8A A;  4RAW A;  4D1W A;  4Z6X A;  4AX1 B;  2YNT A;  2YCB A;  5LCF A;  2Q42 A;  4J5F A;  2Q0J A;  4C1C A;  5EH9 A;  2GFJ A;  3H3E A;  2ZNB A;  4U4L A;  2XF4 A;  4O98 A;  2XR1 A;  3SW3 A;  4EYB A;  1MQO A;  3IE1 A;  4RM5 A;  1P9E A;  5B3R A;  4P62 A;  4TYT A;  3T3N A;  2VW8 A;  4NQ5 A;  5AHR A;  5HIQ A;  2QJS A;  2NXA A;  3I0V A;  2P4Z A;  3VQZ A;  3I11 A;  5LCA A;  4RAM A;  3PY5 A;  5B15 A;  3AJ3 A;  1VME A;  1X8I A;  1WRA A;  1BVT A;  1YCH A;  2BTN A;  4XWW A;  4D1T A;  4FSB A;  4TZB A;  2YNW A;  3S0Z A;  1KO3 A;  4Z5Z A;  2M5D A;  2BFZ B;  3ZNB A;  2FM6 A;  2YNV A;  4HL2 A;  5ACP A;  1A8T A;  3IEL A;  3IOG A;  4C1D A;  2UYX A;  4KEQ A;  4PVT A;  2AZ4 A;  5ACX A;  3G1P A;  2BFL A;  5HH5 A;  3L6N A;  4EYF A;  1JJT A;  1HLK A;  5K4M A;  5IQK A;  5LM6 A;  3P2U A;  4V0H A;  3LVZ A;  5AYA A;  2BG8 A;  3IEK A;  2YZ3 A;  2BC2 A;  2I7X A;  1BMC A;  5KIK A;  1X8G A;  2FK6 A;  5AEB A;  5AXR A;  5K4N A;  1KR3 A;  3T9M A;  5HH4 A;  4EFZ A;  5EV6 A;  3IOF A;  3KNR A;  2GCU A;  4TZ9 A;  4EYL A;  5KIL A;  2BG2 A;  2FU6 A;  1KO2 A;  2WYM A;  5HH6 A;  4AX0 B;  4BZ3 A;  4RL0 A;  2QDT A;  2WYM C;  4TZF A;  2R2D A;  5EW0 A;  1XM8 A;  5FQB A;  3JXP A;  2YNT B;  3X2Z A;  2WYL A;  3AF6 A;  2BGA A;  4UWO B;  5A5Z A;  1QH5 A;  5FQA A;  4AWY B;  2BMI A;  3ZWF A;  4EY2 A;  2M5C A;  2E7Y A;  2P1E A;  2BG6 A;  5K4K A;  3SPU A;  5EV8 A;  4F6Z A;  4CHL A;  5LS3 A;  2ZZI A;  4JO0 A;  1ZTC A;  1WUO A;  4KEP A;  4ZO2 A;  4NQ4 A;  2P97 A;  1VGN A;  3TP9 A;  4DIK A;  4ZO3 A;  3FAI A;  4PVO A;  4GCW A;  3BV6 A;  2FHX A;  4UWP B;  2NYP A;  4WD6 A;  4YSB A;  5LCH A;  4YSK A;  4RL2 A;  2H6A A;  3X2X A;  2WHG A;  2ZO4 A;  4YSL A;  2AIO A;  2BFK A;  5FQC A;  2YNV B;  4NQ2 A;  5B1U A;  4C1E A;  3FCZ A;  3I14 A;  3F9O A;  5DPX A;  3SD9 A;  3MD7 A;  1JT1 A;  1L9Y A;  2HB9 A;  2QIN A;  2OHI A;  3IDZ A;  4Z5Y A;  4EXY A;  2ZWR A;  2Y87 A;  2BR6 A;  4XWT A;  4C1G A;  4C09 A;  5LMC A;  4GYU A;  2Q0I A;  3DHB A;  4Z60 A;  1ZKP A;  3I13 A;  5EHT A;  4D1U A;  3IE2 A;  5AXO A;  2QED A;  2FU8 A;  1JJE A;  3Q6V A;  4AD9 A;  5ACS A;  4GYQ A;  3DH8 A;  2DOO A;  4B87 A;  3RKK A;  1WW1 A;  5ACR A;  4J5H A;  3PG4 A;  4EXS A;  1WUP A;  4D1V A;  5EWA A;  1DDK A;  3KNS A;  1SML A;  4XUK A;  1DD6 A;  2Y8B A;  5ACW A;  4TYF A;  4HKY A;  4UWS B;  2BG7 A;  2Q9U A;  3ZR9 A;  3VPE A;  3BK2 A;  5LE1 A;  2GFK A;  5EVD A;  3I15 A;  1K07 A;  1Y44 A;  4FR7 A;  2GKL A;  3RKJ A;  5ACQ A;  4HL1 A;  5HIO A;  5HIP A;  1YCG A;  5ACU A; 
#chains in the Genus database with same CATH topology
 3ADR A;  4LE6 A;  2DKF A;  2OHJ A;  3IE0 A;  4C1F A;  2FHX B;  3BK1 A;  5LSC A;  3IEM A;  3KL7 A;  2BFZ A;  1M2X A;  5ACT A;  2P18 A;  3QH8 A;  2NZF A;  4F6H A;  2GMN A;  1VJN A;  3X30 A;  2NZE A;  4RBS A;  1A7T A;  2OHH A;  3R2U A;  3T3O A;  4H0D A;  3BC2 A;  4UA4 A;  3X2Y A;  5EVK A;  2CG3 A;  3SBL A;  3SFP A;  1DXK A;  2CBN A;  1E5D A;  1ZNB A;  3SRX A;  4DIL A;  3ZQ4 A;  5HIS A;  5A0V A;  1XTO A;  4ZNB A;  4NQ6 A;  3RPC A;  1X8H A;  3DHC A;  4C1H A;  4TZE A;  4D02 A;  3AF5 A;  5K0W A;  3ESH A;  2A7M A;  1BC2 A;  5A87 A;  5A0T A;  2BG8 B;  3A4Y A;  2I7V A;  4Z7R A;  4BP0 A;  5LLD A;  4FEK A;  4Z67 A;  2QDS A;  2FU9 A;  3WXC A;  4ZEJ A;  5EVB A;  2FU7 A;  5ACV A;  2I7T A;  2BIB A;  4UBQ A;  4UWR B;  4UAM A;  1QH3 A;  1YCF A;  2WRS A;  3PY6 A;  4AWZ A;  2YNU A;  3DHA A;  5AHO A;  2Y8A A;  4RAW A;  4NUR A;  4D1W A;  2CFZ A;  4Z6X A;  4AX1 B;  2YNT A;  2YCB A;  5LCF A;  2Q42 A;  4J5F A;  2Q0J A;  4C1C A;  5EH9 A;  2GFJ A;  3H3E A;  2ZNB A;  4U4L A;  2XF4 A;  4O98 A;  2XR1 A;  3SW3 A;  4EYB A;  1MQO A;  3IE1 A;  4RM5 A;  1P9E A;  5B3R A;  4P62 A;  4TYT A;  3T3N A;  5AIJ A;  2VW8 A;  4NQ5 A;  5AHR A;  5HIQ A;  2QJS A;  2NXA A;  3I0V A;  2P4Z A;  3VQZ A;  3I11 A;  5LCA A;  4RAM A;  3PY5 A;  5B15 A;  3AJ3 A;  1VME A;  1X8I A;  1WRA A;  1BVT A;  1YCH A;  2BTN A;  4XWW A;  4D1T A;  4FSB A;  4TZB A;  2YNW A;  3S0Z A;  1KO3 A;  4Z5Z A;  2M5D A;  2BFZ B;  3ZNB A;  2FM6 A;  2YNV A;  4HL2 A;  5ACP A;  1A8T A;  3IEL A;  3IOG A;  4C1D A;  2UYX A;  4KEQ A;  4PVT A;  2AZ4 A;  5ACX A;  3G1P A;  2BFL A;  5HH5 A;  3L6N A;  4EYF A;  1JJT A;  1HLK A;  5K4M A;  5IQK A;  5LM6 A;  3P2U A;  4V0H A;  3LVZ A;  5AYA A;  2BG8 A;  3IEK A;  2YZ3 A;  2BC2 A;  2I7X A;  1BMC A;  5KIK A;  1X8G A;  2FK6 A;  5AEB A;  5AXR A;  5K4N A;  1KR3 A;  4AXH A;  3T9M A;  5HH4 A;  4EFZ A;  5EV6 A;  3IOF A;  3KNR A;  2GCU A;  4TZ9 A;  4EYL A;  5KIL A;  2BG2 A;  2FU6 A;  1KO2 A;  2WYM A;  5HH6 A;  2YHE A;  4AX0 B;  4BZ3 A;  4RL0 A;  2QDT A;  2WYM C;  4TZF A;  2R2D A;  5EW0 A;  1XM8 A;  5FQB A;  3JXP A;  2YNT B;  3X2Z A;  2WYL A;  3AF6 A;  2BGA A;  4UWO B;  5A5Z A;  1QH5 A;  5FQA A;  4AWY B;  2BMI A;  3ZWF A;  4EY2 A;  2M5C A;  2E7Y A;  2P1E A;  2BG6 A;  5K4K A;  3SPU A;  5EV8 A;  4F6Z A;  4PDX A;  4CHL A;  5LS3 A;  2ZZI A;  4JO0 A;  1ZTC A;  1WUO A;  4KEP A;  4ZO2 A;  4NQ4 A;  2P97 A;  1VGN A;  3TP9 A;  4DIK A;  4ZO3 A;  3FAI A;  4PVO A;  4GCW A;  3BV6 A;  2FHX A;  4UWP B;  2NYP A;  4WD6 A;  4YSB A;  5LCH A;  4YSK A;  4RL2 A;  2H6A A;  3X2X A;  2WHG A;  2ZO4 A;  4YSL A;  2AIO A;  2BFK A;  5FQC A;  2YNV B;  2CFU A;  4NQ2 A;  5B1U A;  4C1E A;  3FCZ A;  3I14 A;  3F9O A;  5DPX A;  3SD9 A;  3MD7 A;  1JT1 A;  1L9Y A;  2HB9 A;  2QIN A;  2OHI A;  3IDZ A;  4Z5Y A;  4EXY A;  2ZWR A;  2Y87 A;  2BR6 A;  4XWT A;  4C1G A;  4C09 A;  5LMC A;  4GYU A;  2CG2 A;  2Q0I A;  3DHB A;  4Z60 A;  1ZKP A;  3I13 A;  5EHT A;  4D1U A;  3IE2 A;  5AXO A;  2QED A;  2FU8 A;  1JJE A;  3Q6V A;  4AD9 A;  5ACS A;  4GYQ A;  3DH8 A;  4AV7 A;  2DOO A;  4B87 A;  3RKK A;  1WW1 A;  5ACR A;  4J5H A;  3PG4 A;  5A23 A;  4EXS A;  1WUP A;  4D1V A;  5EWA A;  1DDK A;  3KNS A;  1SML A;  4XUK A;  1DD6 A;  2Y8B A;  5ACW A;  4TYF A;  4HKY A;  4UWS B;  2BG7 A;  2Q9U A;  3ZR9 A;  3VPE A;  3BK2 A;  5LE1 A;  2GFK A;  5EVD A;  3I15 A;  1K07 A;  5AJL A;  1Y44 A;  4FR7 A;  2GKL A;  3RKJ A;  5ACQ A;  4HL1 A;  5HIO A;  5HIP A;  1YCG A;  5ACU A; 
#chains in the Genus database with same CATH homology
 3ADR A;  4LE6 A;  2DKF A;  2OHJ A;  3IE0 A;  4C1F A;  2FHX B;  3BK1 A;  5LSC A;  3IEM A;  3KL7 A;  2BFZ A;  1M2X A;  5ACT A;  2P18 A;  3QH8 A;  2NZF A;  4F6H A;  2GMN A;  1VJN A;  3X30 A;  2NZE A;  4RBS A;  1A7T A;  2OHH A;  3R2U A;  3T3O A;  4H0D A;  3BC2 A;  4UA4 A;  3X2Y A;  5EVK A;  3SBL A;  3SFP A;  1DXK A;  2CBN A;  1E5D A;  1ZNB A;  3SRX A;  4DIL A;  3ZQ4 A;  5HIS A;  5A0V A;  1XTO A;  4ZNB A;  4NQ6 A;  3RPC A;  1X8H A;  3DHC A;  4C1H A;  4TZE A;  4D02 A;  3AF5 A;  5K0W A;  3ESH A;  2A7M A;  1BC2 A;  5A87 A;  5A0T A;  2BG8 B;  3A4Y A;  2I7V A;  4Z7R A;  4BP0 A;  5LLD A;  4FEK A;  4Z67 A;  2QDS A;  2FU9 A;  3WXC A;  4ZEJ A;  5EVB A;  2FU7 A;  5ACV A;  2I7T A;  2BIB A;  4UBQ A;  4UWR B;  4UAM A;  1QH3 A;  1YCF A;  2WRS A;  3PY6 A;  4AWZ A;  2YNU A;  3DHA A;  5AHO A;  2Y8A A;  4RAW A;  4D1W A;  4Z6X A;  4AX1 B;  2YNT A;  2YCB A;  5LCF A;  2Q42 A;  4J5F A;  2Q0J A;  4C1C A;  5EH9 A;  2GFJ A;  3H3E A;  2ZNB A;  4U4L A;  2XF4 A;  4O98 A;  2XR1 A;  3SW3 A;  4EYB A;  1MQO A;  3IE1 A;  4RM5 A;  1P9E A;  5B3R A;  4P62 A;  4TYT A;  3T3N A;  2VW8 A;  4NQ5 A;  5AHR A;  5HIQ A;  2QJS A;  2NXA A;  3I0V A;  2P4Z A;  3VQZ A;  3I11 A;  5LCA A;  4RAM A;  3PY5 A;  5B15 A;  3AJ3 A;  1VME A;  1X8I A;  1WRA A;  1BVT A;  1YCH A;  2BTN A;  4XWW A;  4D1T A;  4FSB A;  4TZB A;  2YNW A;  3S0Z A;  1KO3 A;  4Z5Z A;  2M5D A;  2BFZ B;  3ZNB A;  2FM6 A;  2YNV A;  4HL2 A;  5ACP A;  1A8T A;  3IEL A;  3IOG A;  4C1D A;  2UYX A;  4KEQ A;  4PVT A;  2AZ4 A;  5ACX A;  3G1P A;  2BFL A;  5HH5 A;  3L6N A;  4EYF A;  1JJT A;  1HLK A;  5K4M A;  5IQK A;  5LM6 A;  3P2U A;  4V0H A;  3LVZ A;  5AYA A;  2BG8 A;  3IEK A;  2YZ3 A;  2BC2 A;  2I7X A;  1BMC A;  5KIK A;  1X8G A;  2FK6 A;  5AEB A;  5AXR A;  5K4N A;  1KR3 A;  3T9M A;  5HH4 A;  4EFZ A;  5EV6 A;  3IOF A;  3KNR A;  2GCU A;  4TZ9 A;  4EYL A;  5KIL A;  2BG2 A;  2FU6 A;  1KO2 A;  2WYM A;  5HH6 A;  4AX0 B;  4BZ3 A;  4RL0 A;  2QDT A;  2WYM C;  4TZF A;  2R2D A;  5EW0 A;  1XM8 A;  5FQB A;  3JXP A;  2YNT B;  3X2Z A;  2WYL A;  3AF6 A;  2BGA A;  4UWO B;  5A5Z A;  1QH5 A;  5FQA A;  4AWY B;  2BMI A;  3ZWF A;  4EY2 A;  2M5C A;  2E7Y A;  2P1E A;  2BG6 A;  5K4K A;  3SPU A;  5EV8 A;  4F6Z A;  4CHL A;  5LS3 A;  2ZZI A;  4JO0 A;  1ZTC A;  1WUO A;  4KEP A;  4ZO2 A;  4NQ4 A;  2P97 A;  1VGN A;  3TP9 A;  4DIK A;  4ZO3 A;  3FAI A;  4PVO A;  4GCW A;  3BV6 A;  2FHX A;  4UWP B;  2NYP A;  4WD6 A;  4YSB A;  5LCH A;  4YSK A;  4RL2 A;  2H6A A;  3X2X A;  2WHG A;  2ZO4 A;  4YSL A;  2AIO A;  2BFK A;  5FQC A;  2YNV B;  4NQ2 A;  5B1U A;  4C1E A;  3FCZ A;  3I14 A;  3F9O A;  5DPX A;  3SD9 A;  3MD7 A;  1JT1 A;  1L9Y A;  2HB9 A;  2QIN A;  2OHI A;  3IDZ A;  4Z5Y A;  4EXY A;  2ZWR A;  2Y87 A;  2BR6 A;  4XWT A;  4C1G A;  4C09 A;  5LMC A;  4GYU A;  2Q0I A;  3DHB A;  4Z60 A;  1ZKP A;  3I13 A;  5EHT A;  4D1U A;  3IE2 A;  5AXO A;  2QED A;  2FU8 A;  1JJE A;  3Q6V A;  4AD9 A;  5ACS A;  4GYQ A;  3DH8 A;  2DOO A;  4B87 A;  3RKK A;  1WW1 A;  5ACR A;  4J5H A;  3PG4 A;  4EXS A;  1WUP A;  4D1V A;  5EWA A;  1DDK A;  3KNS A;  1SML A;  4XUK A;  1DD6 A;  2Y8B A;  5ACW A;  4TYF A;  4HKY A;  4UWS B;  2BG7 A;  2Q9U A;  3ZR9 A;  3VPE A;  3BK2 A;  5LE1 A;  2GFK A;  5EVD A;  3I15 A;  1K07 A;  1Y44 A;  4FR7 A;  2GKL A;  3RKJ A;  5ACQ A;  4HL1 A;  5HIO A;  5HIP A;  1YCG A;  5ACU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...