5EWIH

Crystal structure of the human fab vrc38.01, an hiv-1 v1v2-directed neutralizing antibody isolated from donor n90
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
225
structure length
221
Chain Sequence
EVQLVESGGKLVQPGGSLRLSCEASGESVGDNDMHWVRQVAGKGLEWVSSIGSSGDTYYIDAVKGRFTVSRDKGRNSVYLQMKTLTVGDTGVYFCVRGPESGWFYHYYWGLGVWGRGTTVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Virus-like Particles Identify an HIV V1V2 Apex-Binding Neutralizing Antibody that Lacks a Protruding Loop.
pubmed doi rcsb
molecule tags Immune system
molecule keywords VRC38.01 Heavy Chain
total genus 47
structure length 221
sequence length 225
ec nomenclature
pdb deposition date 2015-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ewiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ewiH02
1I1YA 5IROA 5FYJE 2ICWI 5HDBF 4PB9L 1ZTXH 4RGMB 1CR9L 4MD0B 4H88H 4HK0B 5EA0H 3ZE1E 4PJ7E 3B5HA 4CVXB 2XXCB 2BNQE 3P4NA 3KYMA 5SWQA 5FYKU 3T77A 1E28A 1A4JB 4PV8A 1B3JA 3DHMA 1MQ8A 3F8UB 4ZS7L 1JI2A 5J56B 1XR8A 4EBQH 3OKOA 2Z35A 3G5XA 5JA9A 3V6FA 4IRSC 5EG6C 1V7MH 1NCWL 3L5WA 5C0JB 2APWA 3BH8A 5I8CB 4TSAH 1WQVT 4PTUA 4XVJH 3CD4A 4IOIB 1A9EA 4TOYL 3SCMB 2UWEE 4C59B 2ZUWA 4KPHL 2VXTH 3N1FC 5D1XB 3QQ3B 4I3RH 2PW1A 4XVTL 3KJ6H 1KSRA 3SHSA 1PG7W 4Y4FC 2YRLA 1MCHA 5EORL 4NQCE 4RISL 3HC4L 5IM7B 3AREA 4ODTL 3GUTA 1R0AL 2ESVE 1MVFA 3DRTA 4PR5B 4HWEL 4LCWD 4UU9B 3QUMA 4OQTH 1WFTA 4A6YL 3H3PL 4PRIE 4OI7A 1ACYL 3ULUE 3CSBA 2GEEA 2NX5D 2UZIH 1F2XK 4C58B 1HIML 5BS0E 1F4XH 3I6KA 3H0TB 2PCPA 4PS4H 2XWTA 2YWZA 1YMHA 3FMGL 5FGRA 5DD0H 4MAYD 4MJID 2BVOB 1PQZA 2HFEA 3EOAB 4APQC 4AY0A 1XGPA 5JZ7C 5ICXA 3BGFB 3WL9B 1TQCB 1FL3B 3X3GL 1XR9A 5I17B 5EU4A 1YEEH 1E27B 4LHUD 4CADA 2AEPL 4O4YL 1PZ5B 2EH7L 3CDGB 4PJ8C 5EO0B 1FIEA 1RI8A 1AR1D 2BVQA 2PO6D 1H0DB 3A6CH 4PBVC 4JVPA 1XCQB 1UB5A 4NJAH 3HAEH 3NAAL 3L5HA 4OD2A 5IJVB 4ODVL 4DKFL 3MLZL 2EDLA 3BUYB 1A9BA 3WJJA 3IU3B 3NABL 4JPWL 2VAJA 3ZT6A 4O00A 2DI7A 3SE8L 5D7KD 4PJGB 2AXJA 4ZFZB 4MD0A 1IC5H 1C8PA 1BZ9B 4Z7QE 2DWDA 4U0RB 5TGBB 5DJCB 3VJ6A 5GGTA 1XZ0B 4KHXH 5CEYA 3V5DA 2NNAB 1I7UA 1RMFH 1KC5H 3QUXA 1U8JB 1TQCC 2VAAB 4DGIH 3AMKA 1MHPH 2RAMA 1IM9A 5E2JA 2NPLX 4JAMB 5TDNA 2NXYD 4KPHH 1E4XI 3O6KL 3X12A 5A2FA 2AXHA 1I9JL 5GS2H 3ZT5A 4OGXL 4OB5L 5JW4N 4E42B 2DLIA 1XF5B 1BFSA 1K4CB 1D5IH 4RGNC 3O11A 3C6SA 4DN3H 5JUEH 1U8KB 1PZUB 3TPKA 1PY9A 4OZHE 4WHTA 3JZ7A 1JN6A 3GSOB 1NC4D 3UTSA 1W0VA 2MCPH 2J7LA 5CUSL 1EHLH 3LKOB 3QUZC 5E5MB 3BKJL 1QNZH 4L3CB 3VXPA 3QQ9D 4ELMA 3PGFL 3RPIB 1CLYH 3T8XB 2VITA 1VPOL 4M6NL 4FG6D 4ONFL 1MCJA 5DK3A 3RVXD 4ODWA 1P4IL 4NHUB 2AJXH 2F19L 1DEEA 2X4RA 4K3GA 5CP3H 1FLTX 2BSRA 4LARL 5L9DH 3LHPH 4M1DH 4J8RB 3D85D 3LN9A 1V5JA 3HZYB 5TF1L 2DQUH 2CKBH 4UTAL 1AE6H 2ZCHH 3KYOB 4NYLB 2IBBA 3VRLF 3A0OA 4J3TA 4HS8H 1CDIA 1S9VB 4DGVH 4DVRH 4KTYA 5L2JA 2ZCHL 1TZIA 3T2QA 5IW6A 4FQHB 4O2EA 3ARWA 2EKSB 2FRGP 1HYRC 3D25A 1U2CA 2MSPA 3RNKA 1KTDA 3MRMB 3STLB 1P7HL 4K2UH 5E24E 2G5RA 2NZIA 2X1PA 2YKLL 4LHUG 1T80A 4V2CB 4ODWB 1F4WL 4JVWA 1ZAGA 3X11A 2E9IA 2QHLA 1W0VB 2FYYB 3CH1A 1DTUA 3LKRA 2AABL 5EUOF 3VA2C 3IETB 1HWHB 4PJFA 2X05A 3RIFF 4X6CA 5AG9A 3HZKB 4HX1A 2IPKB 1UWEL 5FM8A 4Y19D 4JFHD 3VXQB 5C70A 1F8TH 4FQXB 5INCB 3QJFA 3QNXB 5DUBB 4Y5YC 3S35X 2GSIA 4X5XB 4MNQE 3QO0A 2IC2A 1IAMA 3LQAC 1S8DB 3JWDC 3HNSH 3V4PL 2JJVA 2P44B 4BFBD 4GG6A 1LEGB 2R0WH 1FFPA 4AYFA 3RIFK 3L3IB 1M7XA 2OLDA 2EDJA 4NQCD 1H3PH 5CBAB 5A3ID 3BZFA 1VDGA 2Y07L 3BIAX 1H9VA 4PG2C 4PRHD 3SE4A 1TZHA 3RFZC 4Y2DA 5EO1A 7CGTA 4YNYA 1RURL 4ZD3L 4WU5B 2F74B 2CXGA 1NCUA 2NX5E 4IHOA 2R1YA 1FNSL 3OKYA 5AYUH 4L5FH 3QZWA 5DRWA 9CGTA 4NT6A 2JCCB 3ZYJA 1OARL 3PIQB 1XGUA 3GSWA 5LBSH 3SGKA 1KPRA 4YXHH 1WSST 5ICYA 3RY4A 4W6WB 4LHUB 3PL6B 3RWFB 2YA0A 4GRLA 5BJTA 4NIKB 5C71A 4G8GB 2X5PA 4K94H 3WE6B 1HHJA 4UT6L 5C0FB 2HKHH 1O5DT 1S7TB 4ODUA 1I8MA 4X7SL 3ZYOA 4YC2B 3DJ9A 3CVHH 3DO3A 4ISVA 1LE9B 1F4YH 4PRPE 4U49A 5SX4H 2WUBH 3TCLB 4NM8L 4D94A 3PWUB 4MLSA 1E4KA 1QNZL 1U2HA 4FMFA 3MREB 2QQNH 4G8FB 1X3DA 3GMMB 2D7NA 4L9DA 3QFJA 4MD4B 3C09B 2C1PB 5AUMB 5AWNH 3CFCH 1RZKH 3W0WA 1KJMA 4JO4H 3PL6A 1PLGH 5CBEA 4FQPA 4YR6B 4Q9RH 4XAWL 2IPUG 4N0CC 4LVNB 4FOMA 1MH5B 2BOCA 2Q3AA 3PGCB 4P2QE 5I8EA 4CMMB 4LSTL 4GRWH 1HIMH 5C0FA 2FSEA 1ED3B 1ES0B 1T0NA 4DVRL 3HCVB 3BEVA 1MJJA 3REWB 3U7YH 1OP9A 1TXKA 3JSSA 5BRZD 3GMOB 5ELIA 4L4VE 1KEMH 5IHLB 3VFNB 1EHNA 4K3JL 4G8GA 1NGPL 5SX5K 1A21A 3O2DH 1I9IH 2BNQD 2YUWA 3MUZ1 5E08H 1J1XH 1XGUB 5ILTH 4OLWH 5F7MC 2IQAB 4G8GD 3VWJC 4FTVB 4R4BA 3RU8H 2IBZY 2QR0A 3RWHB 1DSFH 1MHCA 2CIKB 2W0KA 3O9WB 3VXUB 3SDDD 2W38A 3MNVA 3WSQH 1A3RH 2J8HA 4JDZA 3BGMB 1LO2H 1IGMH 3T0DA 2IJ0C 2BMKA 2Z31B 2JELL 1T0NB 4GKSB 1G7HB 5EBWB 3WD5H 1FSKC 4U1HB 1B90A 5I19H 3VXUD 5JORB 5F7EH 5CBEB 3HI5L 1ZSDB 1Z9OA 4C4KO 3MRPA 1N5AA 3CFIC 5C0ND 4FXLA 1RUAL 4PJFB 2UYLB 1T7WA 1TNMA 3FO0L 3GSVB 3QZWB 5KSBA 4G43A 5JHDA 4Z7NE 1MFAH 3ARGA 4R0LA 1NANI 3OB0H 5IF0B 5EU6B 4OT1L 4OUOA 4FQXA 4JO3L 4JDTH 3WN5B 5KVGH 3VXQA 2VDKL 3LKQA 1AGEA 2UZXB 4Q2ZB 2ORBL 4WVRA 1J5OL 3ARGC 4R0LC 2W1NA 4Q58C 2ADFH 2ATKA 1GC1L 4QOKA 1SM3H 3ZKXC 1FFPB 4RMVA 1AFVH 1AQKL 3KS0J 5KOVC 1Z5LA 1L9MA 4HBQA 1Q9OA 3LOWA 1J86A 2DQIH 3STBA 4HXAH 1YN7A 1UEMA 2Q76B 3OXRA 4ELME 1OLLA 1IMHC 5KG9A 4HWEH 3NABH 3MR9A 5JW5A 2CUIA 2FO4B 4Q0XL 5IROC 2PYEE 3NAAH 3V8CA 2CGRH 4WTZG 3FQNB 1QBBA 4NNYB 4V1DD 1X5HA 1D9KC 2ITCA 2XKUA 4CAGA 3LQMA 3PHSA 4KJYB 5EUOA 4WW2F 3SDDA 2HVKB 3GJFB 3WMSA 1S7XA 4P48A 4R96B 5I0ZA 1CDCA 3T0VA 4FQCL 5FGCB 3NGBC 3C5JB 4X6DA 1FNFA 4Y88A 4P9ML 2UYLA 2ZUUA 1U3HA 3IFOA 4UQ2B 1ZHKA 1DL7L 2KKQA 4NP4L 1JPSL 4MQ7B 4TUJB 2IEPA 5BRZA 2JF1A 4HHAA 3P3YA 3PWNA 3PQYB 1CFQB 1FL5B 1SEQL 4FXKB 3WN5A 3W5NA 1I3UA 4LSRH 1KIUA 1A6WL 5IB3B 4PBXA 3VXRE 4JFEA 4OV5B 4JRXE 4PD4K 2LU3A 3TWCH 1BD2D 5I73C 2MNUA 4XPGH 4M7LT 1FG2B 3DUSA 4XPBH 2RCSL 5IBTH 2HT3C 1MIEH 3SO3B 1I8LC 1U6AL 2VXVL 4S1SL 5ID1A 1VACA 1ZT4B 3MRBA 5GGUB 4RNRB 2GITA 5IVXB 5TE6H 4JZNA 3N50A 5JORA 5I1CL 5EZJB 5DC9B 3BRGC 1CLZH 3BQUC 2E7MA 2VLJE 1R5WB 4KU1A 4PJ8A 1JI1A 2MPAL 1ORSA 1SBSL 2XKNA 4HIIA 1RHHB 4UAOC 1QRNA 3MV01 1KFAL 5GGRY 1AQDB 1JWSA 2VAAA 3T1WA 4ETYA 1RJLA 4RGNE 4F2MB 3MYJB 2AK1H 5EO9A 2IQ9H 1W72H 3H7BA 3X3FL 4XCCH 1D5BB 4YXHL 1MHHA 3D6GA 2VLJA 4LRNH 3VXMD 4ZFFB 4NGHL 4EDXA 1NEZB 2KDGA 2CIIB 3KPRB 4PJIF 3EJYD 1XF4A 2DQUL 5DJ8B 3UJIL 1B0RB 1H3UA 1HCFX 1KJVA 2GK0B 4WEMB 1A6TB 3EFDH 3VE0B 2DB8A 2BDNH 1A7BA 2CSPA 4H26B 4XPHL 2VDNH 2GSIB 2E7CA 1QLRB 2XV6B 2V2WA 4NKDA 4PRIA 1AGDB 5CGTA 4LPYA 3WV0A 2KPNA 3RHWF 4Y2DD 2BVPA 3VGDA 2ZUYA 3P4MB 1QHPA 3CFKA 2YKLH 4NZRL 3KLAB 1D7FA 3V5KB 1JHTA 5E5UB 2HTLD 1EA9C 4YZFF 4EOWH 5KSBF 3K80A 1N3NB 1INEH 3CX5J 1LQSR 3RX5A 5FB8B 1NEZA 2I5YH 1DFBH 1GGIL 4EN3A 2EIZA 1FC1A 4HH9A 2PNDA 4UIKL 4KGLA 2DN7A 1CFNA 2D7OA 1NFKA 2WP3O 1AGBA 4YGVA 3BDBA 2FLRT 2LVCA 5J11B 1EEZB 1VA9A 1T1YB 4HWBH 1RZ8B 1XF3B 4I5BB 4F8TA 1T0MB 5ACMA 1RJLB 3V2AR 3WJLA 3V0WL 5HI4D 4CN4A 5C07B 3ZHDA 3HNVH 3TVMA 1X9QA 2MPAH 4NC0B 3BKYL 4NQUA 2GQHA 2DQTL 4FQLH 1HN1A 4WUUD 1WUNT 3RU8L 5T1MB 3DBXB 4DGYH 2B5IB 1I7RA 1MNUH 1KC5L 3ZHKA 1F3DJ 1JF1A 1JWMA 4GMSH 1A4JA 5A43C 4PRHE 2MOVA 1JYWA 4ONHB 5FM5O 4Q9QH 3DVGA 3PWPE 4M7LL 4PGBB 3L3DB 5FKAA 4OCWL 1KXVC 3CFDA 5D1XD 5GRVK 3TN0B 2OXHA 1S9WA 3HS0B 1O7SA 2R0KH 5L0QC 4PV8B 3PP4L 5IKCB 2NY7H 4IOFC 5AEAA 2VISB 2CKNA 2V2XB 2DQHL 3KJ4C 3UBXG 5FUCC 1ZHKB 5CEZL 3VRJA 3NPSB 1S8DA 3VXME 3TT1L 5FK9A 4OFIA 4JRYB 5HGGS 4PJHF 3F65A 2OTWB 2QQLH 3AU1B 5CIPH 1GGTA 3MRNA 3S36X 4JFEB 1VFBB 4BJLA 3QUKB 1T66C 3TVMB 1F4YL 3CZFA 5CJQL 1N7MH 2OL3H 4YHYB 1QRNE 4MXWH 3TVMD 4M5ZH 1RJCA 3SDXE 5CEXA 2GSGA 1VFAB 3E1F1 2ERJC 5DRXB 1YEHL 3INUL 3GUTB 2X4UA 3VH8A 2FL5B 4HXAL 2H41A 4P3DB 1AO7B 1XMWA 3L3DA 2XICA 5F71A 1A4KB 1FAIL 3IJHB 3CK0L 4H1LH 5C0RH 2ZCLL 2WAHA 1SJHA 5D7LA 1OARH 4KI5C 5HYJD 4XPFL 3HFML 1UH2A 4TULL 4YXLL 4P9HH 5JXAL 5A1AA 5D93B 4YUEL 4Z5RB 3FAXA 1IT9L 1U41A 5IBUB 1P1ZB 1XGTA 3RWDB 4FQLL 1J0HA 5EBMB 5I1DA 3EAKA 25C8H 4ZSOB 1S7SB 4MJ2A 4OCLC 3O6FA 2FO4A 4V2BA 4X8XA 4MDJA 1MRCL 2FHBA 3PNWA 1I3GH 2HRPL 1TPXB 5JTWA 4LSSH 4U1SA 2VE6B 3MUY1 4GBXD 2YN3A 3D0LA 2R2EA 3L7EB 4PG2A 3UEZA 1F3RB 3U4EA 3VD3A 3D18B 1NCTA 3KPQA 3ARBB 4WRLA 5E4EB 1CDJA 1UFUA 4ZOAA 1G7JA 2DD8H 4KAQH 2XWBB 5GS1C 4D8PA 3PWPD 3MLWH 1RK1B 2PUQT 3ME0A 3CFCL 5ITBL 1GGCL 1MJ8H 2YPKB 3IU3A 4KZDH 5GGVY 2E7LC 2I26N 4XRCB 3QBTB 3R06B 1E4KC 1WCBB 1X7QA 3MLTA 1FDLL 3MRDB 1S5HA 3MRQB 4Y4KA 4KRPB 5JW5B 3D69B 4X80H 5HHMB 1LD9A 2W07A 1D5XB 2YXMA 3CDFA 1NMBH 1CICB 2CQVA 4ZFOB 4RMTA 3UC0L 3K8MA 1FL6A 4PJ8D 1PDKA 43C9A 1MQKL 8FABB 2R0ZL 5K93A 5FGSA 5CINL 3QCUH 4XC3L 1ZA3B 2H3NB 4PTTB 3K8KA 2XYCA 3T08A 1T2QL 4IOIA 4YBQD 3TA3C 3IS1X 2NY3C 2P47B 1G7IB 2H8PB 5MEND 1NUFA 3IS0X 3HUJB 4MAYC 1KB9K 3BESR 4PJIA 3ILQD 3WUWB 1AE6L 4PRPD 3ULVL 4HC1H 5TE4H 2OJZH 2J8UF 5JHDE 3HRZB 5IB1B 2LFGA 1HSBB 3QUYD 2YPVH 3ZL4L 2BSSA 3VGAC 1M6OB 1JZ6A 4WI2A 1MAML 1KNOB 4XP4L 1SBSH 2HT4C 3V0WH 3SJVE 5C7XH 1IAIM 5DMKB 2FX8L 3RDTD 3FQWB 4BZYA 4YBHA 5I1IL 3BD4A 1BAFL 2VDNL 5JPNB 3DWTA 3H0TA 5J89A 3FT4A 2B1HH 4O02L 4HUVA 1ADQA 3C8KA 5FO7B 4NFBA 4R8WL 4U6YB 3VWJB 1CT8B 4UB0L 4JM2B 4OFVA 1QA9B 1WK0A 2K1MA 4QY8A 4L8BA 3B9KD 3SDCC 1XR9B 4WY7H 3JWOC 3CX5K 1R3IH 2C1PA 3G6JF 4WEBH 3P0VL 3BT2H 1HQ4B 3Q1SH 3RGVB 2FJHA 2FZ3B 1FFRA 2SEBA 4Z7QF 1D5MA 2PKDA 2NYYD 1FO0L 4FFZL 1RZIA 5IFJB 1MFBL 2XXMB 4UQ3B 3KPLB 4PV9A 2OCFD 4XC1H 1S3KL 5MENB 2DLEA 5F3BA 3W5MA 1P7KB 4OZGA 4HWBA 1SY6H 1ZGLP 3DVNA 4RMSA 2NY3B 3IDXH 5HHOE 3UZEA 4DN4H 3RBGA 3SO5A 4NO0A 5D93C 4EI5D 5CSGA 2BOCB 3PGCA 1YYLH 4TULH 4YXLH 5KVDL 1NCDL 3WHE1 4B0MM 1B4JH 4UILH 1T1ZB 4ZUWB 4HS8L 4DGVL 3H9SD 1CICD 4M03A 4DOHB 3T0EC 1GZQB 1AIFA 3V95A 1CICC 1BX2B 4FNLH 1WBZB 3NTCH 4KRPD 4OBSA 4Z5RA 4BM7A 1VFOA 5IEHA 1J1PH 2DJ4A 4HWUA 1O7VA 4KROD 1YEHH 2V9RA 1U95A 1IKNA 1QFPA 2EDWA 2WIIB 1GHFH 3QDGB 3OKDA 4ZG1A 5CP7A 2D7MA 1DL7H 5E2TH 4LEOB 4U1HA 3HG1A 1KJ3L 4G6AD 5HI5C 2NTSP 4O58H 3FOLA 4X0KB 1YNKL 3HMXH 1Q38A 2EE6A 1CQYA 3HZVA 4F15C 2NYYC 4OFYA 5FHBH 3T0WA 2GJZB 5EN2B 3QWOB 4M00A 3UZVB 4YHMH 1INDL 5E8DL 1CDBA 2IG2H 2ERJB 1N0XH 3MTRA 4JFDE 4X6CF 3IJYB 5L88H 1QR1A 3RWIB 2K7QA 5DLMH 5EU6E 3WXWH 4GSDH 4LLWB 5BCAA 4NO3A 4CJ0A 1MUJB 4JN2B 2CLRB 4PJEA 2KQNA 5C09E 2DQJL 5I30H 2YSSB 5CGMA 5C0DB 3RUGA 4DVBB 2VYRE 4F7EA 3KJ4B 1CYGA 3BGMA 5EUKB 2WIIA 4UBDD 4HPOH 4RSVA 3TYGH 3PL6D 5JXAH 2YR3A 3WFDL 3M45A 3UDWC 3U82B 4XPFH 4CMHB 4JY6B 1YECL 4YHPA 1WBXB 5K9KB 3CU7A 5TDPA 5DJ0A 3MNWB 4R4FH 5L6YH 3FQUB 4R6UA 1AXIB 3LN4B 4JFZL 3S88L 1HHKA 1EO8L 1QSEE 4D0DB 4MB4A 3E6FA 3V6ZB 1A3LL 4P3CL 3QP3A 2R4RH 4H0IA 4JKPL 2HLFC 4PLJD 1TZGH 3BQUA 2I07A 3FCTA 1DQQA 4JKMA 1EGJA 4H5SB 1SJVA 1B2WL 4FXGA 3S36H 3BN9D 4GLRI 4X8JB 1QPPA 1RULL 3RWHA 5LGHH 4WTWA 1S78C 4HH9B 4OLEA 1CD1B 2DM7A 4YDLB 2DWEA 3MCLH 3O4OC 4JKLA 4YFLI 3OAYH 4JO3H 5KSUB 2NZ9C 2GAZB 3WFDH 1G9EA 2MJWA 3MRFA 1EHXA 3KXFD 3MGTB 4O9HH 3PABB 4BH8A 2O5ZH 1MHCB 4QHLA 1RUAH 4Y19B 4GRWE 1N4XL 1EMTL 4HK3J 5EWIL 4P49A 4PRHA 1KCSH 2B0SL 3BP6A 4LCUB 3B6SA 1N2RB 2GJ6E 1S7UA 3ETBF 4G7YL 4NQCA 2CLZB 1T4KB 3OSKA 4HGWB 5T5NG 2DI9A 2JELH 4U0RC 4Z6AT 5C9KA 5CIPA 5MP6H 3FT3B 3CIQA 4ZYKB 1U92A 3FB7A 4EVNB 2UWEA 3CU1A 2JLLA 1ZSDA 4JG1L 1RY7B 4GXUM 4NT6B 4OI9A 2C1OB 2ZSVB 3C60C 1EUUA 4IDJL 3BOVA 2GUOB 4OLVL 2A83B 3HA0A 3DLQR 4BH8B 4NCDA 3QDAA 4Y19A 5F1SA 5EIIA 1G7IA 3QG6A 5JNYA 5I1HL 1NGWA 4RDQF 3B3IA 3WE6A 2CO6B 2W92A 2CMRL 3QA3A 1UH3A 2J8UA 2DL9A 3FN3A 4XP6H 3E6HA 4XI5D 3QSKB 5I9QC 3ET9F 2R29L 5C0CB 1T7ZA 2DMBA 3WXWL 3OKNB 4H25B 4M7JH 4G5ZH 1Z6JT 3CUPA 3B2UC 5EIQA 3GSNH 4LSPL 3TZVB 1N2RA 3ILPA 1IGIH 3FO9A 3RY5A 3HKFA 5D2NC 2FGWH 4QRTA 3KDMB 5SWZA 4Q9QL 3MRJB 4PJXB 4TSCH 5DUML 3S5LG 2XKNB 5I0DA 4HUVB 3IDNB 4X4MA 2O5YH 4L4VB 3S8WA 4Y7MA 4PJGA 4ZFZA 4KVCH 4J3OC 1MUJA 3E2HC 4JN2A 1UM5L 4WWKC 1SJHB 3RI5K 2AXGA 3U4AA 3WXVH 4XBGB 4J3UA 4XP5L 1B88A 1PYWA 1U8NA 3GMNA 4DWHA 1I8KB 3NCCB 3O2WH 4X6BB 4CMHC 1JYVA 5IB3A 1RZJC 2XA8H 4YHLH 2ZSVA 5GIRB 5L8LB 4PJ5A 4LKCA 5D2LB 5C0DA 4AT6A 4WEBL 5T3XE 3RBSA 1HNFA 2IQ9L 2XA8L 1G0XA 3IRPX 2OR9H 3MMEA 1TENA 2ZNWA 3S37X 2X1OA 3CPLB 4HAFA 1FLRH 1TIUA 3ARED 4PY7B 2BHZA 1GAFL 3IDYB 3WIFA 3DX7A 4FQQB 3FQUA 5L8KB 2GY5A 5KS9F 1BF8A 4HK0A 5DHVB 5E6IC 5I1EL 2P8MA 1A14L 4DW2H 5C0BD 4HIXL 4M6MH 2OTUA 5C7XL 2A2QT 1OD9A 1MIEL 4WO4D 1N5AB 4UT7L 2O61B 2FR4A 2I07B 3FCTB 4RGOH 4HC1A 4OTXL 1IC7H 4L4TA 5IB2A 2YD2A 1MFAL 1A6WH 2X2YA 3HG1B 2FWOA 4M7JL 2K9UA 2H26B 4NBXB 5B39G 3WNLA 1ZOXA 3P0YH 3QQ4B 4NWTH 4RFOL 4BK4A 1BM3L 1EFXA 1C08A 3F58H 4Y16D 5MEPA 1JPGA 1QO3A 2GJJA 1FSKB 4TQEL 5JIPA 1FYTE 4P9MH 1W72L 4ZQKB 3VXSE 2XACC 1IFHL 4Y2DC 1S9YA 4ZFOL 5D7IF 3ZTJG 3EYSL 3FQRB 5F9AC 1TJHH 4JQIH 2ICWB 2BNRD 2ESVB 2J2ZA 3G6AB 3BAEH 3GSOA 4Y4KC 2AK4A 2R2CA 5TH2B 3DX7B 1ZLUH 5KTEH 2B20A 4PJEF 3P9MA 2NTFB 3EO0B 4YO0A 1W0WA 3D3VA 5KANG 4PJ7A 3CSYA 4M62H 1HINL 5JPMB 1JIBA 5ISZD 5EBLA 3ZHLA 1YEDA 4L29A 5E08L 2GJ6B 3IDMA 1MWAA 1UJ3C 5L8JB 1JWUB 2NXYB 3DETD 3D9AH 4MA8H 2QADD 4QF1A 5K59E 1A1NA 3BSZL 2WWKO 1OQXA 2WNGA 4ZXBC 5DXWA 5TDNB 1AQKH 1G1CA 1TETL 4S0SD 2ZSWA 5EIIB 1LEIB 3MRCA 5DLML 5I16A 2XQYG 3GMRB 4XWGL 1YJDL 5H35A 5HHVH 1VPOH 4M6NH 4QY8B 3TZVD 5EBWA 5SWSD 1CZ8H 1IZJA 5ALBH 4GKNB 4WGVB 1NLBL 2F5AH 2ZOKB 4OLUL 4I48B 5FM4A 3RVUC 3FN0H 5HVGB 1D5MB 4R7NA 3VFPA 3TNNA 2AEPH 1I3RB 2E6JA 1JRHI 4BSWA 1FNGB 1MY5A 3K4DA 3CUPB 2FIKB 1P53A 1AD0B 3EYFB 1ZANH 1J0IA 3MA9L 5TE7L 2NR6C 4Z7OE 5JIHA 3MRRA 3VJ6B 4KVNL 3HI1A 5MERB 3RVVD 4JQXA 1PFCA 4HWZB 5JMOC 3QDME 1UM4L 1LD9B 2XN9D 1VENA 3HMXA 2XZZA 5FXCH 4JFDD 5GGSY 4NRXA 1AI1H 1AKJD 1CLOL 2AJUL 4YQXH 3T65B 4N8PA 4XWOC 4N68A 4Y4KD 1T21B 1B4JL 1DANU 3Q6GL 4QXUL 4MQTB 1QSFE 3G08A 3U4BH 1QSZA 4K94C 5EORH 1DP0A 4HMCA 4E42A 1YMHB 3ZSTA 3ZYZA 3EOAA 3ZDZE 4TSBL 4N0CD 1Q8MA 3LV3B 5HHQB 5GISL 1HDMB 3PWJB 2CDGA 2ZOKA 1BEYH 3TT1H 3K46A 2Y07H 5E8OA 5IB1A 2FJGB 3UTPD 3VGHA 1OGAE 2F74A 3EW3B 4MB5A 1WIUA 3CC5B 5DJ6B 4ALAH 1WITA 1YPZA 2Q87A 3L3JB 4TTDC 5BQ7A 4KJWC 5GQBA 3W0WE 4U6HB 1INQA 3U6RB 4XZUA 3D87B 3NCJL 1MWAL 4X6CB 5CJBA 4M48L 3MGTA 3KYNA 1KT2B 3W2DH 2WLZA 1K6QH 2W9LA 3NBNA 1RZJH 4Y4KB 5BJTB 3ROLB 4JANB 3QJHA 4KJWD 4F9LC 5GJSL 1JNLH 1AGFB 3U9UB 2P5EB 3LEXA 3RP1A 5E2UL 4UIMA 3GSUB 5I8OH 3KJ6L 4ZNEE 2AABH 2FLBT 4I0PD 2AGJH 5J6GB 3NH7H 4AM0B 4CKVX 5FO8B 3UO1L 2VZVA 4XCFH 1NMAH 1XGTB 1J1XL 2ZUXA 3V79C 1AKJA 3MLUL 4JHAH 3KWWB 3LH2H 3DIFB 1CBVL 2V7HA 5F7YC 2XWBA 3TA3B 1Q9KB 5D71H 3U1SL 4PJ5D 1PG7X 3U83A 4LHQB 1S7RA 3HAEA 1JZ3A 3O3BA 2FBJL 5EBLB 4OCSH 3SDDC 4ORGA 3MV9B 4ZXBB 4PJ7B 1S5HB 3SPVB 4F2MA 1C16B 2MHAA 5L9DL 4HEPG 2AJXL 4LKCB 3EYVA 3P73A 4K7PH 1QFUL 1W8NA 2QSCL 4F7CA 2RR3A 4OM0H 5F70A 5C0AA 4I9WD 1N64L 2AP2A 4GAYB 3NA9L 4WJ5B 5CUSH 4HFWA 1RUKL 5IG7B 2X4NA 2Q8BH 4PYGA 1SJEA 3QUZD 3J7HA 4Y89A 4HZLB 3RX8A 4UB0H 1A8JH 3WNMA 4L4VD 4WWKB 2YRPA 2VOTA 4GG6F 5LCVH 4L9LC 4R97B 4YHLL 3UTZA 2O61A 2OTWA 4ZXBD 2O5XL 1ZKAA 3H2WA 4MCYA 5I1IH 1NMCB 2Y36L 2BRRH 2NY5C 2DDQH 4LCYB 4TNVK 4R7DA 3PF2A 3GB7A 1K4CA 3FTGB 3QISA 4NQSA 4GO6B 1TDQA 2P24A 3FT4B 5KZCB 2CDEB 2C4XA 2EIZB 1R5VA 3IDGA 4NKMA 1GOFA 3DSFH 2YMXH 5E00A 1C12B 1YN6B 3AVEA 2UUDK 1WJ3A 4IS6A 1K4DA 3QDMB 2F15A 1JNHA 4OLYH 2PXYA 1FO0H 2PTTB 5DEZA 5E5MA 4NRXB 5I9QB 4NBYB 2GIYA 4Z9KB 2GI7A 3OKEB 1DVFC 4S0TD 4ENED 1F00I 1UM4H 5FGBC 4Y16C 1C5DA 1EEYB 3BXNA 4NM4L 4AEIH 3QNYB 1CDYA 5DFVC 1J0JA 5GGQH 3GMMA 2EZ0C 1UC6A 3OAUL 5FGBA 3KXFA 1F90L 4I13B 2Q6WB 3FOMA 5IFJA 5JA8B 4MX7B 3HE6A 4JFPB 3WDHA 1KJ2A 4X4XA 1YPZB 2RCSH 2BX5A 1QYGH 4JDVB 2XTJE 2HLFD 1CDGA 1R3LB 4LFHD 1IZKA 5IF0A 3TN0C 2P7TA 5FA3A 4N9GB 4Q9BA 3VRJB 3HPLA 4ELKA 3OR7A 1FAKT 2R0KL 1DQLL 1MCCA 5IHBA 4BSJA 3BXNB 1A5FL 3RL2B 4HKJA 3Q5YA 2RQ8A 3ARVA 3K2UH 4HT1H 4P2QD 1MJ7L 2IGFL 3KPPB 4LLQA 1HE7A 3MJ9A 4MNHA 3DTXA 4WCYH 2F53A 4MJ6B 1GC1C 5DD1L 2OK0H 4LSUH 1M1SA 2VSDA 3UYRL 1WT5C 4K8RL 4ETQA 3PABA 4DGIL 1MCOH 5KJRH 1YEFH 3WIHH 3OZ9H 5JW3H 2DDQL 2F58L 1BIIB 4I3RL 3Q6GH 5I8OL 1JFQL 2BY3A 3BP4A 2Z35B 3BFOA 1DBAH 1FAIH 2NXZB 3UTTD 5F72S 2YXFA 3BEWA 5D70L 1IAOA 2X42A 3OMZA 2HWZL 5JW4Q 2NY1B 3CVHA 4FXGB 5HDQH 3O9WD 3MLZH 1T1WB 1CWVA 3LDBC 5DEGB 3ZKMD 1G9NH 1J05B 5E7FA 4F3FB 3TNNB 5D1QA 4WU5A 3HI5H 3L7FB 4LOUD 2C26A 3SGDI 3PHOA 3MROB 1N64H 3LV3A 4CMMA 1P9MA 5JPNA 3VCLA 3VI3F 1NGYA 1QEWA 5GGVH 5F88B 1B0GB 4HHAB 1VSCA 3ISWA 1BQHG 1N26A 2B4CH 2BOBA 4M6OH 2M8XA 4PGDA 5LGJB 1J10A 2GK0A 3L1OH 4QRPE 3RZCD 1C5DB 1X5YA 1VFMA 1WIPA 3QO0B 4QT5A 4U7MA 3S37L 5IESL 5LGHL 5E2WH 1HXMA 7FABL 1AGDA 3M17B 5T3XD 3L5XH 1I9EA 5DHXB 5K9OB 3UP1A 4I4WB 2ESVA 3CK0H 1W0YT 2IH3A 5MEOA 4CJ1A 1HCVA 5EC1B 4K3EL 5E6IA 1HHHA 3BMVA 5IVXE 1OCWH 4RAVB 4KI5E 1VESA 2DTSA 5IP4A 4IM8A 5C9JB 4LLDA 3CDYA 5J6GA 3P30L 4NJ9L 3H9SA 4YBLC 1LO2L 4NUGH 5GRJL 2YWYA 5L88L 1KCVH 1UXWB 1I8KA 4NO5B 3M07A 2ENSA 5F7LB 4DGYL 4BELD 3KLHD 1JVKA 4KROB 5AYQA 5IMOB 1DLFH 3ARZA 1AIFB 3HPJB 4N8VB 4YFLF 1D5ZB 2VLRD 1E4XL 1OOAA 4YDVA 4V1DE 1JNLL 2HG5B 3DXAB 4PJBA 1A6ZA 4XVUC 2NQCA 5JW4M 1KF9B 1EUTA 3FFCD 5I30L 3QH3A 1JYNA 2NZ9D 3BPLB 2PR4H 3U0TB 1SY6A 5CZXC 1QKZL 1I3VA 1FQ9C 3VRIA 2NY7L 1GIGL 2NY4C 4RWYL 4PJDF 4HBCH 4HZAA 1ZGLA 1MELA 2CD0A 4M8QB 2HJFA 5HYSG 3CCHA 4PGCB 1OAUH 5FYJD 2VL5B 4TUOA 4LLYB 3O8XB 4UOJA 5DK0B 5ITFB 4A6YH 4AG4L 1INDH 3MV9E 1RFDH 3GJFA 5F97E 4G8EA 1CN4A 4N8CH 2E7BA 4KK5D 2J3SA 4OZIB 3A67L 5LJYH 4F57L 1XCTB 5IFHL 5ANMB 3LSOB 3JV5A 3T65A 4JRXB 3IKKA 4PJEB 5MEPB 5IBUG 1HHGB 4Z7VE 2WINB 3D39A 4GUPB 2DAVA 1CTNA 4YHIB 3SDXF 1EJ6A 3LS4H 3SKOB 4HWBL 1E4WL 3JWNC 3W9EB 3L9RB 5DO2C 3T2OA 3P73B 1XH3A 1A47A 1MREL 1KLUB 5E9DD 2ARJB 4KDVA 5IUSA 5JQ6L 5CEXB 1MCEA 4L8CA 2H32A 1IJ9A 1LEKB 1Q1JH 4F58L 4PRIB 1P4LA 3S96B 4HPYH 4I2XE 2NY4D 5BXFA 4L3EE 3T0EB 1EMTH 5F1NB 4CU7A 1Q9OB 4L8DB 4XNUH 3P40A 5ICZB 4KKAC 3TT3L 1L9NA 3QHFL 5IVXF 5ADOH 4MA3A 1NFDB 2OMBA 3TPUB 4GRLB 5DD3L 4NO2B 1PQZB 4W70A 3QHFH 4WHYG 5IJKC 4YDKL 3W9DB 15C8L 4XPGL 3FKUS 1A1OA 1FFQA 4ZNCD 3Q1SL 3MV7D 1XGYL 3D48R 1NBYA 4KKCC 1NGYB 4LSPH 5DMGD 3UJJL 3QRFM 3S5LA 3ULVH 5EO0A 3RZWA 4U1MA 3SDYL 4Z78B 3N1MC 2BSED 1LWRA 4BK5A 5HYJE 2OBGA 1TVHA 3EO0A 4YO0B 4DKDC 3MBXL 4NSKA 4NKDB 5F7UA 4KRPC 4JHAL 1OP5H 1KPRB 2VLJB 3P11L 4LSQH 3IFNL 4TUJA 3IFLH 4WFGD 3QO1A 3SDAB 3LPFA 2G9HB 1NCBH 3GMQA 1N5YH 2FIKA 1YEKL 4KDWA 3WLWC 3A67H 1A7RL 4QHKI 1MFEL 3S5LB 5E2UH 4HWZA 2GW5A 1Z0NA 5DJCA 2ZSWB 4F9LA 4XMLL 4LU5H 5ISZE 4KKCD 2IAMB 4JFOB 2OTPA 4KAQL 4F7TA 4HS6A 1PSKH 3WHXA 4QRQA 5D96C 5F3HA 4HJGB 1DQJA 1X4ZA 4LVNC 1G7QB 5EWIH 1NFDA 1RZFL 5F89A 1HHGA 4KK5C 3GMLB 3MLRH 4NZRH 1A9EB 2DQDH 2WWKT 4JFFA 4PD4J 1MLBA 3SKOA 4GW5A 1I1YB 3B9KC 1GRWA 4OCMC 1AO7D 2Z9TA 4JPKH 5ADOL 3MUJA 3KPOB 2EDHA 3PGFH 4P99A 4PJAE 5FF6B 2WUCL 2J5LB 1U9KA 3ZE2E 2IPKA 2PTUA 1YEDB 3P9WB 3PQYD 4L8CB 3F5WB 2VB5A 4YHKL 3TBYB 3OAZK 4KH2A 5HHNA 5HY9B 1IGCH 2VC2L 4NQXA 4OV5A 2D0GA 3IU4H 1A3QA 3MV8B 2VR5A 4QXUH 5E2TL 5SWSA 3IGAA 3N1QC 4JG1H 4D9QE 1UCBL 1LE9A 4ZTOH 4MDIA 1DUYA 4XBEH 3SKJL 1MWAB 4JRYD 3F7YB 3MLXL 1ZLWH 4X5WB 3LQAL 1AD9B 4XBEL 3GBMH 4N5EC 5E2VH 2W0PA 1JYXA 2W91A 5KN5B 4X7EC 2VQUA 4PJDA 4OM1L 2PXYB 4YNYB 4J3VA 3NPSC 5ALCL 3GSNA 1YYLL 3TN0D 3TYGL 1FG9C 5D72L 1PYWB 3WNKA 2Z8WC 4K8RH 3OR6B 1LP9F 3O11B 1UZ6E 1YEEL 4XPAL 5IW6B 1G7QA 1DQDH 2YD6A 2Q1EA 3B2VL 4JGJA 3LQZB 2VDRH 1JPFA 3FOLB 2DQHH 4HLZG 4Z7WA 2D7PA 3CPLA 4U0QB 2BVEA 4U1JA 4WUUB 1NLDH 4JO2L 3UPCA 3CLEH 1DVFA 4E41E 3Q0HA 5ERWB 4DKFH 3UTPE 2HA1A 1S7WA 2ZUQB 1T3FA 3OQ3B 1WWAX 4KDTA 4PJDB 5DVLA 4XVUD 3SPVA 3WS6C 5IQ7H 4QOKB 5DZOA 5TDOA 1P6FA 3H3PH 2AEIT 5BV7L 5GJTL 4AENB 2VITB 4U1KB 4MA8L 3V6OE 1TJIH 3GKWL 4G7VL 1IM9D 4MXVF 4NO3B 1DLHA 1JZ8A 1ZLVH 1R6VA 2Z91B 4KMTL 4I3SH 4RFEA 3MJGX 2DQTH 2YSSA 1Y18B 3U36A 4D0CB 4XNMB 5EBGA 3WKMH 4JO1L 3V0VB 5I1KH 4AH2B 5D7LD 5IKCA 5MHSD 4HUMB 5I74B 2D9CA 4HGMA 4H0GA 3MOBL 4HS3A 4P5KA 3BKMH 1RZ8A 3GSRB 4HC1L 5TE4L 4QRPD 5GHWH 4K3EH 4IOSD 5I8KL 3QIBC 3TBSA 4OQTL 4Z7WB 2DKMA 1EIBA 5DRZA 4XXDA 4BQ9A 1R0AH 3I3EA 4UT9H 1GGIH 1C5CH 5BVJA 3KYKL 2AXGB 3EOTH 2O5ZL 3MV8A 1FPTH 1I7RB 3V7AE 2GFBB 1X5XA 1YEJH 1NBZB 4LHUA 3T8XA 1UWGL 4BUHA 3QWRA 4P2YA 1UB5B 3DNKA 4CN1A 1BX2A 4CDHA 4U6YA 3GRWL 5HHXH 2HT3D 1VGEH 4KJPC 1KGCD 1WGOA 1HHJB 5DSCB 3R4DA 5FHAL 2QQNL 3QR2A 1EJOH 3RTQD 5IMMB 4OLXH 1A6AB 4L8BB 4LOUC 4KUCF 2G5BB 2VN7A 1NJ9A 3G9AB 4D9QD 4D9RD 2C3WA 4TQEH 4N90E 3QWRD 3ULUD 4JREB 2XIDA 1YQVL 5E1AB 4XNMA 4D3CH 1JGDA 5J6HB 3BKCL 1ZLSH 2QQKL 1W72B 5I1LB 2HVJB 1R5IA 3D5OF 3AGVA 4BKLA 5D2NA 3NN8A 5D5ME 1DLHB 4R90L 4LRNL 3ZLQC 4JZJC 2QQKH 4MJIE 3JV6B 3X14A 2DQGH 4JEGB 1MCPH 5B21A 4UAOB 5HHNB 5HY9A 3EJZD 1ODAA 3F5WA 3LVEA 4OLYL 1TTFA 4WI8A 1WZ1H 2YD9A 4Y16B 5L2KE 3LKSB 4PRPB 4RAUA 1DVFB 2WZPD 2CRIA 3HC3H 4N1HB 4JFFD 3KHOA 3SO3C 4XMPL 1IAIH 4XHJD 2YC1B 5J6HA 2D7TL 3UPRB 1P69B 4RBPH 1QOKA 1KB5H 4P2OC 3VU2A 3BJ91 4KHXL 4NGHH 4U1GB 1YC8A 4J4PA 1KENL 2BJMH 4WI9A 4K7FB 4GSDL 1KTDB 3UXFA 3ZE0F 3TIDB 1G6VK 1II4E 4YWGH 1NBQA 2VLMD 3RL1A 3L3OB 1HHKB 2JIXD 4JHBA 4HDIA 4OFKA 3FOMB 3ZYIA 1D6EA 1Z0MA 1NMAL 4J23A 1QRNB 3BRFA 3HZVB 2QTEA 1NSNH 4NNPH 3MNZA 1ZWIA 1TZHB 4P4KC 5T1LA 1W2KT 2Q7NA 5JLZA 3SGJA 3OG4B 3VXMB 3ZDXF 3GIZH 1D9KB 3SQOL 4NKIL 3VFRA 5I74C 3KVQA 1UB6B 5SV4A 1ZLWK 3IVKA 5DRNA 3D18A 3VFGL 5DURB 2EH8H 4BSVB 2PYFA 1M7IA 3K0WA 1F4WH 5T3ZH 1GGUA 43CAB 1F45A 4OUUB 5I8CA 1OAKL 4GG8A 2N1KA 3LSOA 4YWGL 1JP5A 4OIIL 3KYAA 4M9PA 1KLFA 5E00B 2B7DT 3B8SA 1A7OL 1CXFA 4WUKL 3LN5B 4WFFD 1E4WH 3JUZA 3EOYG 4OGXH 5DEFA 5EU6D 3MQIA 1HK6A 4OCYH 1WBXA 4C56D 2VDQL 3HR6A 3MJ7B 3RVVC 5IQ9B 1QRND 4PRAB 2I25N 2NR6D 3L3GA 3TYFB 1GYAA 1KB9J 1XIWD 3QUMB 2KZWA 2JIXB 4NHCH 3B8YA 1P4BH 2GCYA 4P9HC 3IFPA 3QIUB 1AY1L 5FYJL 1H3TA 3DVIA 4P23A 5HDOA 5IK3A 3OL2A 5DS8A 1HQ4A 1RFDL 2A6KB 4HIEA 4OLZL 3V6FB 6FABH 1J05A 4R4NC 3FQTB 5LWYH 4XVJL 5BW7C 3L6FA 5GGVL 3P0VH 3IJSB 5BVPL 3QXTA 2MQCA 2DQEH 4R7DB 2LV4A 2NW2B 3C2AL 1U36A 3HAEB 5KSBB 2DRUA 3CLFL 3QAZB 5H94A 3RHWK 4J1UB 2V6HA 3H9ZA 3OJDB 4M7ZC 4CU6A 4V1DB 3KR3L 5HGAA 5ESQB 1DBMH 3F7RA 4G3YL 5AZ2L 1S9XB 5EA0L 1DN0A 5B38A 3W0WD 2QQLL 3QDJD 1GZQA 5FO7A 5HD8D 4YDIH 1FE8L 3GDBA 6FABL 5IHZB 3P4MA 4GAYA 4WJ5A 1C7TA 2JK5B 3AROA 3PE9A 1WWWX 2OQJB 1ZMYA 3FB6B 2W59A 2W9EL 4G9DA 1XIWA 1OM3L 5HYSB 4BFGA 1E6OH 5DEFB 2P8MB 4IDLA 3ESVF 2NLJA 4F37F 2FJHB 2FZ3A 1J8HD 4F3FA 3U0PA 3ROLA 5K9QI 4TNVF 1HH6B 5HGHB 3F7VA 3KPLA 3PQYE 1BFOA 1MFNA 5I19L 3VH8G 4JM4H 1WBYB 4GS7C 4OFDA 4GAGL 3SOBH 2G75B 4PJDE 3GO1H 4XCCL 3QDJB 4LDEB 5BZWB 4LARH 5DEGA 5GIRA 1WWCA 4XNXH 4M1CC 3JBG7 4X6BA 5IOPB 4XWOD 2W9EH 1OM3H 2F58H 2EIDA 3STZB 3G5YB 5D2LF 4K3DL 1AGCB 1AY1H 2YD1A 5FYJH 5BMFH 3HNVL 3WHXB 2ILLA 2BCKA 1RZKC 3QG7H 4KI1A 1J8HA 5K9JL 2R4SL 1T83C 2Q7YB 1KYOJ 5ID0B 3G5ZA 3K81A 1HHIB 4W68A 4Z77B 4Z8FL 2PO6B 4XAKD 3S6CA 3OAUH 5E6ID 35C8H 1YYML 4HUUA 5GGQL 1TTGA 5B38B 2IFFH 1HSBA 3IXTA 4WUKH 4KY1H 3QDJA 5C86A 2NCMA 1DFBL 1MOEA 3ARBC 3AREC 1A2YA 2DQEL 1BECA 3CXDH 5DRNB 4NNXB 3ZZ1A 3VXNA 2VWEC 5DA0B 5DMKA 1SEQH 1U8LB 4OBRA 3S34L 5F7DB 3MNWA 4LU5L 2Z4QA 4QTIL 1F58L 2ZOLB 4HFUH 5DK2B 2NW2A 2FEDD 25C8L 1ZA3A 3O0RH 5D4QA 3B9DA 1ORQA 1XGQA 1EFXB 4OD1H 3W81A 2BVOA 3HAEG 1KIRA 3H9YA 3PV6B 5IW1A 1D5BA 4X7SH 2B4CC 4YEFA 2QADB 2A1WH 1EO5A 1UJ3B 5FO9B 5IGXH 1UG9A 1J8HB 1RK1A 1YY9D 3KPPA 1KJ2L 1S9XA 4DZ8B 4E5XB 3I9GH 1U8OA 4GRWF 5DUPH 5T5NF 3RPKA 2LTQC 4G42A 5HPOA 4CVZA 4X9FA 2DWEB 1YEIL 3I2CH 1A4KA 3E3QE 5IEKA 4ODVH 3IRZA 2BVUA 2VXSL 3P0YL 1XCQA 5EOQH 4C56A 3LS4L 4XBPB 4XH2B 2OL3L 5MEQB 4LGSB 5GGUA 1E6JH 2EEAA 3C5SB 5CILH 4XMKL 5GRXG 3QCVL 4I3GA 3D85A 2HJFB 4O2FA 2D03H 4YHYC 1OT2A 4GXVH 5AD0A 5DZNA 1UM5H 3JWDL 1WF5A 3LKNB 1RK0A 4RDQG 4RX4A 1U91B 3FHQA 3RWJA 5JXEC 2F53D 1X4YA 1WFOA 4YBLB 3P4NB 5C92A 5SWQB 3ARFA 4PBWD 2VLLB 4YPGB 4P57A 5GS0L 2ORBH 3DGCR 1YA5A 1XGPB 5IBTL 3BRDA 3AMLA 4P4KD 2YD5A 3BPLC 3KPQB 1S9YB 4ODSL 4AEFA 4DUVA 1BP3B 2EC9T 5EOCL 1FO0B 2D31A 3ZTNH 4JFYB 4MCZA 2ICEB 4PG9B 5CJOL 5J0BA 3VFOA 4QRPA 3T2NL 4R96A 5E4IA 5F88A 1J7VR 3SBWC 2NXYC 4JJ5A 1KCRL 4P5MB 3C6LB 3UMTA 3QH3B 1MHEB 4Z7NF 3CXHK 5EDXA 3V9FA 2NY4B 2VXUL 3ORJA 4GG8B 2I9LA 1JZ7A 1KEGL 1ZGLB 3WIFB 3MSPA 4CU8A 4X5WA 4WW2C 4WHCA 3FFCE 2NY6C 2E8YA 1IL1A 3ARRA 4XNXL 5KS9A 4FHBD 2YPLA 1OPGH 4YEEA 1FPTL 2J1KA 3BWAB 3F58L 4KK8D 5C9JA 4YPGA 2XQBL 2KZ1B 4BZ1H 3W11D 1OQOA 4BQ8A 1S78D 1WVZA 5ENWB 1KCLA 3RWDA 4GW4A 2VDML 2CKBL 1TVBA 2W0FB 3CXDL 1LP9E 4P59H 4JFYA 5IWLC 1M7IB 1B4RA 1IQWL 1QVOB 4HFWB 2X4PA 1MQKH 3LHPL 2R23B 4LCCA 4LVOC 3CLEL 5C6TL 1Q94A 3MLYH 1CR9H 1P84K 2C5DC 5D2NB 1FYHB 32C2A 1K5NB 3HE6C 4QWWD 5C08E 3FB8A 1D6VL 4OZFB 4U3CA 1QFWH 3BIKA 2D31B 1CDUA 1JHTB 1QLFB 2R2BA 5FDYA 1RUQL 1YDPA 1T4KA 4E41B 4HCRL 4U2YA 2GSGB 2MMXA 2P5WB 3TBTB 2R15A 1YEJL 1XF1A 2IAMA 4JFOA 1BJ1J 4ZPTA 3TBWB 3D85B 4L4JA 1A2YB 1RZJL 5FKAB 4UBDC 1RZGB 4PJXA 1QUNA 2FDBP 4DKEL 1ZEAL 1FZMB 3SKNA 3VFUB 3ARDB 1XF3A 1I9RL 1I1AD 1NLDL 4JO2H 3C2AH 2AI0H 4CL7A 4FP8L 4QNPF 4KQ4H 1YMMB 1QQDA 4Y4FD 5HHQA 2ADGA 2BNQB 2X70A 1GPOL 2BY2A 3BDYH 4RRPA 3GZKA 1I4FA 1AFVL 3A6CL 5JOFA 3BGFC 4NC1E 1K8IA 5B39B 4LPUA 1YEFL 3G6JA 4NRYA 4E5XA 2IPUK 1DJSA 3BQUB 4ORGB 5F7NC 3TP4A 1F42A 1NGPH 3VWKB 4N0UE 2RIKA 3WS3B 1TJIL 3UJTH 3GGWB 1QBML 3D2UA 4YDIL 2XTJC 2IANA 1KPUB 3MV8E 1FCCA 4HIJA 3CMGA 1BGXL 1UB6A 1KT2A 2DYPB 2FB4L 2HN7B 5BVJB 4OI8A 3WNOA 1U91A 1IQWH 4XCNB 2IFFL 1ACZA 4M8VA 4Q9RL 4JR9H 4OGZA 4MXWL 3T0AA 3VGFA 1PW3A 3PG2A 3HR5B 3CJJA 4AM0A 4QHUB 5F9DC 3G6JB 4JM2A 1OAYL 5AWNL 3TLRA 2HP4A 2YUXA 1G7MB 1OW0C 4UMGA 1U93B 3IB4A 3SGJC 3BN9C 5DSCA 1JMXA 4ZFGH 2BP3A 1R5IB 2HKFH 1CU4H 2A6JA 5K9JH 1DBAL 1QD0A 1Z3GH 4YE4L 4OLVH 3N0PB 3NFSH 1HXYA 4PLJC 3VXRB 5KS9E 1D6VH 4LLMB 1JMZA 3MRCB 3I84A 3NIGF 5B4MC 3O4LE 4G9FE 2AXFB 1WZLA 4TSAL 3P30H 5FEBA 5JOPD 1OAXL 2BFVH 1V7ML 2ED7A 3BDXA 1QRKA 5TDOB 2VLRB 1IAII 2V2WB 3NTCL 5D1ZA 4RGMC 5HYEA 5A2JH 3HN3A 5KVEH 2R39A 4UIKH 3IKCA 1WV7T 2F53E 4ZAKB 2C3XA 4M93B 4HIEB 1I7TA 4JQVC 4QRUB 4GMSL 3CSYB 5C08D 2WWMC 4ZDHA 3ABZA 3EO9H 1CE1L 1MFEH 4PRBA 2EE3A 3BPNC 3THMH 5C0AD 4QRRE 2FIRT 5BRZB 5LAXA 1GXEA 1AO7E 4W4NA 3FB5A 1UKSA 3FO2A 3IAQA 2JB6A 1AR1C 2RFXB 2OM5A 4PGJA 4U1SB 3TH4T 1A6VL 2LABA 1DN0B 3EHBD 4LCWE 5DUBA 3QEGL 4DEPB 3GIZL 5D2LE 1J1OL 4NN5B 1Y6NR 4G6FD 3S4SG 1LO4L 2ADJB 5A16B 3MO1B 3QUYC 2J6EA 1BHGA 1HILA 2M1KA 2EDRA 1LO0H 1AXTH 1Q1JL 3FJTA 4F58H 1G6RH 5I1AB 2HFFB 1NCCL 1MI5D 4JRYE 2GFBA 4OAWA 1A7NH 4P23C 3TPUA 4XMLH 4ODSH 5HI5D 5ACZB 1WAAE 3FB5B 4BSWB 1QR1B 2R69H 1T89A 1Q9KA 1ZEAH 1KELH 3VGEA 2JCCF 2ZZUT 2H6PB 3ALPA 3CXHJ 5E8PA 3OZ9L 2YMXL 5CMAA 5AYUL 1T03H 4P46A 1QBLL 4I0PA 3PWNB 1M71B 5GPRA 2ATPB 2VZUA 3VFNA 5DR5L 1C16A 3QHZH 4KVCL 3ZO0A 4D0BB 1RUQH 4K07A 2R2HB 5I1GH 2HMIC 3UJIH 2FBJH 2H2SC 4J3WA 4JFHE 3VI3E 5HHOA 1BQLH 4WI7A 4AMKH 5KW9L 3VDBA 4Z7VB 5D1ZD 3AXLB 1HXMB 3ULVC 5KVEL 4LQ1A 1IGIL 3GJFK 4E41D 8CGTA 4G9FD 1CFVL 4GOSA 4F37K 3I50H 4L8SC 5DVMA 4C4KT 2A6IA 5ISZA 5DQDL 3PJSB 1G7HA 3OX8B 3R1GH 4OF6A 4X0KA 3KLAA 4FA8A 1MCRA 1Y0LB 3RWEB 4LNRA 3VFWB 2HFGL 1P7KA 4OZGB 2DKSA 1DDHA 3QEHB 1KCUL 5HJ3B 3NFSL 3NCFB 4U7KA 5TF0A 2UWEB 1V3KA 4NO5A 1RV6X 1EAPB 4DAGL 1T83A 5CLWA 1KJ3H 2MWCA 3O0RL 4OGYL 1FIGL 1T1XB 4JM2D 1JK8A 1M7DA 1R24A 3GMLA 4IDJH 3ZKND 3Q2CA 4M7KH 5JOPE 5DJDA 5FA4A 2CIIA 3KPRA 4NZDA 2ATPA 4WDIB 5L7XH 4GLRH 5GS0C 1CK0L 4P2CG 4MHHI 2ZUSA 5BV7B 2A6JB 3WFZA 3SQBA 4FNLL 4N0YH 4QRTB 3P4LA 3VD7A 3DURA 2ICWJ 3SDAD 4ZUSA 4ETQB 2VO5A 1PX3A 1RZ7H 4G8IB 5C0BA 3TIDA 1U58A 3VXUA 4Z95H 2DBLH 1F6AB 1MPAL 4N1CA 1TCMA 2EYTB 3OPZL 1BZQK 1JTTA 1Q0XL 1LK3H 4BYHA 4FQIL 4Y4HB 3ARBA 3TA3D 2V2TA 1I8LA 1N59B 5CIPB 3KPSE 4K23H 3ZKMC 3HPLB 2QHRL 1EGJH 2H1PL 5D1QB 4LEXL 2GUOA 4CDGC 2R0WL 4GXVL 4ZNEA 2PYFB 1FL3A 4JN1H 3CVIL 1K8IB 3FO0H 1G7PB 4OCNC 4NRZB 4WDIA 3DUHA 5H2BA 5TFSL 5GGTH 2AV7B 2A77L 3U30B 1A7QL 4BZ2L 4ZTPL 5CZXD 1HSAA 3MLPA 4HKZA 5KSUA 4MAYB 4MJIB 4H1LB 1B9ZA 1I3GL 2HRPH 2YRZA 3BYTA 2AV1B 4APQA 1NAMA 3KPSB 1YPZE 3SKNB 2APTA 3OGCB 5E1AA 3WJJC 4B53A 1OGAA 1Q9LB 3DRQA 3VGAB 4CBPA 5JMRA 3QFJD 1JPST 1UJTA 2AK4D 2V7NA 2V17H 1R3KB 2BNRA 2DQDL 2Z0BA 4NHCL 4YAQA 4ZYKA 3KR3H 4G8EB 1S9KC 5DD1H 1YJDC 3O2DL 4JB9L 2UZIL 2Y23A 3HUJF 4ZO8A 1UXWA 5F7DA 5AZEH 2VLME 3UROR 4H5SA 3D39B 4K8RD 2B0SH 3JWOH 2AI0L 3TFKD 2GJZA 3ECBA 5EN2A 1DR9A 2WINA 2WANA 1PZ5A 4UNUA 1OAZL 4S2SA 4DJMA 3HE7D 5E4EC 4KI5D 1K2DB 1OTSC 3QDMA 2EZ0D 4JG0L 1RZKL 4FQ1L 1GOGA 2Z8SA 4WO4A 3RGHA 5BO1H 4KFZC 2HTLC 4NQVB 4XP9L 2GTWA 1EO7A 3SDXA 1LO3H 3P9LA 4NN7B 4YK4C 1JN6B 1DBKH 2MFNA 4DAGH 1ZT1A 3PDOB 2FL5A 4N5UA 4YPJA 3DVGB 3O8XA 4M8QA 4K3DH 2BOBB 4JPKL 1BBJA 4PGCA 3TVMC 3MRPB 2Q8AH 3NCJH 4GBXC 4HW6A 3R06A 4ZS7H 5TFSH 1OAZH 3TESA 2JE8A 2EYSA 3K8LA 4X99A 2K3TA 4K94L 4LASL 3EJYC 3VXOA 4WV1A 3CVIH 3BWUC 4EKXA 3OHXB 4NO0B 2CK2A 1BGXH 4ZPTB 1OAKH 4JAMA 2J88H 5LWYL 2GAZA 5L0QB 3SY0A 3ARFD 3KYOA 4BSVA 1DQTA 3ECBB 2YHGA 4TSBH 3F7YA 4H20L 4LFHG 2ICEA 2OZ4H 2VE6A 4KUZL 1ZHBA 3W9EA 4X9HA 4O58L 3QEQA 5IB5A 1ND0B 2VISA 4O5LH 1Q0XH 4OFPA 5I15L 1CIUA 3L3KA 1TZIB 5KTEL 1YNLL 5C09B 1Q9WB 1KEGH 3A6OA 2J8UE 2A6DB 3H7LA 3VFOB 2MHAB 1H3XA 4KTDH 4W6YB 4WV1B 2P8LB 4IRJD 4L3EB 4HH8A 3T0EE 1UZ6F 2EKJA 1KBGL 3C6LA 1IEBB 4FQJL 3UYPA 4DUXA 4G6MH 4Y19E 2A77H 1IKFL 3FQWA 3SCMD 5F96L 1HKLH 1NCCH 1N7ML 1QSVA 3W0WB 1J8KA 3U46B 1LO0L 1A9BB 1BJ8A 3ARFB 3IU4L 4ODHH 5IMLA 1BVLB 5EOCH 1KIQA 5EULV 3VFTB 1QHOA 1DE4A 5ENWA 1DQJB 5MEOB 3AB0C 5HVHB 3C08L 5DQ9A 4OCXH 4M1GH 3HS0A 1IM3B 4QHUA 3MBED 3QEQD 2IWGA 3WNNA 1KLGB 3LMJL 3MRGB 2AJZB 4F9PA 5D9SB 1A14H 4DW2L 1H15A 1KG0B 4PLKD 1M05B 3PV6A 3PXHA 1MF2H 3EFDL 1UWGH 5DJ2A 4LP5A 1JZ4A 3VGGA 5CKGA 2R56L 4LLMA 4YGVB 2NY6D 5IMOA 3ZMRA 1WTGT 3KYKH 1HXYB 2NY2B 1NC4A 4MD5B 3DX6A 5CSBA 1G0DA 3AFLA 4ELMF 3OGOE 3I02A 4LCIH 3N1GC 35C8L 2DMCA 5C07A 3L3JA 1CGUA 4YX2H 1ZHLB 4MXVE 1M4KA 5T1DL 1MY7A 3F6LA 2R0ZH 1JNNH 3OKLB 1FZMA 3CVHB 3PWVA 2YD8A 3C87A 2XA3A 1LO3L 3NZHH 4MMZC 2W0LA 2X1QA 2UY7A 3DUUA 2WBJD 1CGSL 4JQIL 4XAKE 1X5LA 1CI5A 3K4AA 1KELL 1BFOB 5DQ9B 4F7PB 4Z18A 2OJZL 4KMQA 2SEBB 2GJ6D 1JHKH 4CADB 3PHQA 1NDMA 3CFBB 2EDXA 1AJ7L 3BT2L 1NGZA 4TSCL 1BVLA 2LVEA 3ARXA 5FECA 2AJYL 4C83A 3PWUA 3SGKC 3STZA 1WC7B 8FABA 3BQUD 3KPOA 5JXED 3VDAA 2DLFL 4XP1L 2AJVH 2CDGB 3HLAA 1S5IH 5E99L 4GKNA 4MGXA 3MOBH 2O26U 1L0XA 4N0FA 1YDPB 2VABB 3RUGE 2BZDA 2H8PA 4GW1B 1K4DB 2FECI 1SMAA 5DD3H 5BS0B 2DQCH 2ZUVA 2PO6A 5IB4B 3VWKC 1TITA 1KN4L 5IMKB 5ICYB 2IBZX 3ARSA 4HULB 5KSVA 1NDMB 3CFBA 4IMKC 2BDNL 1U8PB 2COQA 4K71B 5L2KA 2C4FT 3WBDA 2D03L 4P5TA 5EU3B 4U1KA 3DMMC 1NCAH 1UXSB 5IBLC 1RVFH 3HFMH 4JFDA 3T0BA 4EI5B 2VIRA 5MI0C 4EUPH 5KOMC 1H8SA 4I0PB 1F3JA 2QQQA 3PWVB 3SGEH 5HDQL 2GT9B 2HJKB 2Z8RA 4R26L 4RAHA 3QIWD 3NACL 3ZDXE 3Q5TA 1BFVH 1AP2A 1X44A 3MRHB 3LRHA 3NN8B 1UYWH 1HNGA 5CLTA 5I1DB 3BKCH 3AS1A 2R2BB 1PG7H 4RBPK 4TYUA 1YQVH 5GS3A 5C0EB 4NFCA 5E1HB 1ONQA 2CDFB 4NDMA 5M94B 1OTUD 1T5XA 1JGEA 4EQ2A 3ARBD 2DOCA 1LK2A 5E9DB 2GY7B 4NOFA 3WUWG 4EUPG 4MWFA 3ULSA 3OJVC 3L1OL 4KKLC 1OSPL 2RGSA 1MJ8L 1ZVHA 5EU7E 2V5YA 2P24B 2ADIA 1T89C 3GBML 4UI2A 3H9HA 1CL7H 4HIHA 3IDIB 1KPVB 2HRLA 3LKRB 3S36L 5C08A 5HBBA 3U9UA 4S1DD 1DQMH 1JTPA 1NGQL 2P45B 2RFXA 2C7UA 2YA2A 4KVNH 4Z7UE 4GKOA 5ICZA 2HYMA 3OKDB 3WFEH 2Q8AL 2QEJA 1E4JA 1SVZA 2VLLA 4I18A 3H42L 1F11B 3ROOB 1CICA 1RAMA 3AY4A 3HB3C 5IEHB 1PKOA 5TQ0L 4BQCA 1OAXH 1G84A 3LN5A 1OSPH 4I0CC 5DJXA 2EEDA 4XPAH 5KSAB 3ULUL 4F33B 3TO2B 1D6EB 3VRIB 3C5ZB 4OLZH 3U7AA 1A3RL 3WO4C 3P77A 1NUDA 3AY4C 2BNUB 2VQ1B 4JG0H 4N0FB 3X11B 1FORH 2JIXA 5DC0A 3OXSA 4R2GB 1MPAH 2VXUH 4P3DA 4OAWB 4FP8H 1IC4H 4M43H 1VKXA 1YMME 2VDQH 3FTGA 4WFED 4PRBB 3TC9A 1U42A 3RA7H 2OMNA 5HHMD 1M6OA 1SJXA 2W9DH 5HD8C 3GHBL 3OF6A 5A2KH 2BNRE 4A6YB 5HHOD 4Z76B 5CMAB 1U3HC 3MUHL 2JJTA 4R4BB 4GQ9H 4HKBB 3H3KA 2AW2A 2JB5L 1JRHH 3BKYH 1Z5LB 1ZA6B 4IRSA 3QI9C 4XHJC 5E6ZA 2Z31C 1IGJA 1QSFA 4HUWB 5J12C 5C0NC 2VKXA 4GBXB 1HZHH 4BKLB 2ZNXA 4XBPA 1YJDH 2HFFA 5HHPA 3UAJC 3JTTA 3RGVA 4R4ND 5JLZB 3JWDH 3IDNA 2VDOH 4E0RA 1MCPL 5J57B 1R3IL 5ACLA 3BZDA 4PLKC 4Y4FA 2R1YB 1E6JL 5HYIA 2Y25A 1YNTA 4NRYB 4PRPA 1HKLL 3Q5OA 1FGNL 2AJYH 4G43B 3RGVC 5JHDB 4NOBA 3LD8C 4OUUA 4HIIB 4C56E 4S1RH 2FO1A 5FOJA 5EZOL 3F6IA 1NC2A 1A22B 2YC1A 4G6JL 2VDLL 4TVSa 5IBLD 1JF1B 5HYJB 3JVGA 4OF0A 3VFMA 1EJOL 4HKJB 2CUMA 4PJCA 5DHVH 3DV6A 4PY8J 4E9LA 1IGCL 2VC2H 5EIVA 2XZCH 4ODUB 3KWWA 1H5BB 4JPIB 1B0RA 3O6LL 1RJZB 2P5EE 2EEBA 3AS2A 2P8PA 1JNNL 4I4WA 2XZCL 4NCC2 3IF1B 2NMSA 1A0QL 5F1OB 3DTXB 4XB8A 3D3VD 1TLKA 4OCYL 1FLRL 4FTVA 1DCLA 1S7TA 4U1IB 3U7YL 1UCTA 3LPGA 4UIMB 3S34H 1JZ2A 3BHBA 3FT3A 4MS8D 4UTAH 5C0BB 2BHYA 3G9VA 5I1JL 3LS5H 1L0YA 3LH2L 1U8HA 5CINH 5DVKA 4Z7UF 5GGRA 1LHZA 4GAJL 4RWYH 3OXSB 2IG2L 5JXEA 1M05A 5A3IC 4BZ1L 1NMBL 2V9QA 3C60D 2EH8L 5FHBL 3GSRA 2CKBA 3MRRB 2D0FA 1CLCA 1CL7I 2AK4E 3WKNA 1E4XH 3KPMB 4KK6C 3MCG1 1S7WB 4Q7DA 2NW3B 2ZOLA 1AGBB 1WTLA 4DCQA 1DLFL 5D7IA 2HTKC 5EPMB 3V4UH 4XMKH 3OKKA 4JE4B 5IB5B 4FXKA 5I2IA 2A9ML 5IVOA 3F62A 5JQ6H 2PW1B 3WJLC 1ZLVK 3L3IA 3S9DB 3FFDA 1NKRA 1IQDB 4HBCL 4Z0XA 2VZTA 1VEOA 4N0RA 3GMPB 2FH6A 5C07D 6CGTA 2X44D 1G9NC 3O2WL 2W9DL 3MRKA 4LGRB 1EH9A 1OCWL 4PJ7F 1NJ9B 4JVUA 2CMRH 2A6DA 1T2JA 2BFVL 1U8QA 1OTSD 3DRTB 4PPTA 4XX1G 3TIEA 4L4TB 5IB2B 4NCC1 3T4AB 1IAIL 4MB3A 4GRMB 5DWUL 1X5FA 2JCCA 2GK2A 1JF6A 1JV5B 4G9FB 1FV1B 3NCBB 4MAUL 4KK9D 4UUJA 4KV5F 2X4QB 1FC2D 4I3SL 1CLYL 2D3VA 5HVFB 4M1GL 5L2JB 3OJDA 1C08B 1CQKA 3FFDB 5I18L 1X6LA 3U7WL 2C3VA 3IXAB 1AXSB 3MODH 4JRYA 2G60L 2HVKA 4ZDHB 5EPMA 1FGNH 3WLBB 3RVXC 1UT9A 3TBYA 4NP4H 1EVUA 5FDWB 1AHWB 5E56A 4XI5C 4POZD 3L3GB 4AH2A 5D2LA 1MLCB 2B1HL 1XH3B 1BBJB 3IDJA 1YN7B 1OGAB 3DRQB 2V5SA 1C7SA 4C56B 2FX8H 5DQJB 3FRUA 3X13A 5HPMB 2ZCKL 5MI0B 4QHMA 4LEXH 4MDIB 1XF2B 5B22A 4R3SA 3UBXA 1S9VA 1BD2A 3WIHL 3L3OA 4ODBD 3OX8A 5IFHH 2EO1A 1P7QB 2YK1L 2PTVA 2ZUTA 3RY6C 5LQBH 2CLRA 4YXKL 2ITDA 3B4NA 5D7SH 2AQ3A 1DBJL 2BVPB 5DHYB 3GKZA 3NFNB 4IJ3C 1F3DH 1FZKA 2A73A 4RRPG 1V8HA 4AIOA 4P3WA 3VG0H 1GCFA 1KV3A 3QT2A 5E2VL 4NZUH 2WBJB 4KQ4L 1JPTH 3N9GH 3TV3H 3X12B 5D7LE 5MHSE 2F5BL 3GMNB 1H3GA 1FV1A 4JB9H 1F5WA 5D70H 4DOHE 4D0BA 5GSRA 1X5ZA 3QO1B 2BXYA 1DQML 4C55A 1QPXA 2YPLD 3IDIA 4HIHB 1FZOA 4PJHB 4DQOH 1K8DB 2NY5H 2HVJA 2VUYA 5JOEA 4EUPA 4WHTB 4GKSA 3LRSB 2IPTH 1EHLL 1HH9B 3P11H 3I75B 4IBLT 4EIZC 1Q0YL 4PJ5E 3CSPA 1KN4H 2D4FA 1NFDF 2D7QA 2OSLB 4FQ1H 5DF0A 3TH2T 3RPIA 4P4KB 1QLRA 1G9MH 5DT1H 3RAJL 4PJ8B 4BFEA 5KSVB 5F9JB 5KAQF 4BUGA 4JFXB 3PP4H 4J12A 4LSTH 4S11A 3VW3H 2GITB 2YD7A 3HE7A 4OCRH 4EI5C 3FO1A 3GO1L 4CNIB 5IVXA 4P57B 1C5BL 4HUNB 3MUGA 5F9WC 1J0ZA 4WHDA 1I9JH 3CH8A 2P5ED 2QHRH 1SYSB 2NY2C 4LP4A 1H0DA 2WLYA 4WHYH 4EI5A 1YECH 4P2OB 1KLGA 4PJ9C 5EC2A 5D6CA 3CC5A 5EO9B 1FNSH 5CJ5A 1CFQA 4Z77A 2JTDA 5JHDD 5E03A 3O2DA 3PDDA 2F8VA 5C6PB 1RURH 3V52H 1NBVL 1I9IL 4PYHA 3DMMA 3GHEH 2VXTL 3JV4B 5DA4A 2H32H 1F4HA 4ODHL 4CVXA 2EDQA 1AI1L 2AJUH 3HMWL 4HK3N 2DL2A 2J8OA 1QEWB 1RD6A 3IDUA 2VR4A 4ZUSB 3G04B 4HG4K 1CS6A 4GMTL 4YLQT 5SV3A 5H37H 4L8DA 3VWKA 2AQ1A 1RPQA 2BERA 1CIDA 2G5BA 4KTDL 4D0CA 4DTGH 1N59A 4NO2A 4X4YB 4Y4HA 1XGQB 3FO1B 4MA3B 4YJZL 5D2NE 1BFTA 2OI9C 4F7TB 5I6XC 3GNML 5B3NA 2AKRA 4HCRH 5JZ7D 2BNQA 3MGOB 2Y1VA 2MKLC 4NRZA 2X89A 5FUOH 3ARDD 3GI8L 1FHGA 3CMOH 3QUYA 4OD3L 5AAMA 1VERA 5EU5B 3GMOA 4PJIB 4ERSL 2HFGH 1ZHNB 3BPOC 1ZGLM 1F13A 2FGWL 5C6TH 3RJDA 3V4VH 2DLGA 4I48A 3THML 5T5FH 5EO1B 4X6DF 3L95B 2A38A 3BIKB 4PJCB 4GFTB 4IIQB 1YZZA 5FYJU 1RJYB 1FVCB 4HIJB 1NFIA 4L9LB 4LLVA 4R97C 1CG9B 1NGXB 1R5VB 4NKMB 4EZMA 1OAQL 3MRBB 4YHPB 1MAKA 1QFHA 4ODTH 3LCYA 3NA9H 4Y5XA 1TNNA 2W60B 1T20B 3NA4A 1JHKL 4JPVL 5KSAD 4P46C 3JV4A 3IAGC 4IJ3B 4ELMB 3GRWA 1WBZA 3PP3K 4RFEB 1YC7A 4D0DA 5HTSA 5DHYA 1IGFL 1N5YL 4QOKD 1H15B 1KG0A 5FYKL 3ZT7A 1MSPA 1A1OB 5GZND 1IGFH 1XR8B 3K4ZA 4HG4J 3ZE2F 5DJAB 4O2EB 3HG1E 4GW4B 5C6WH 3BKJH 1ETZA 4FQXD 4UNVA 1CU4L 2XTLA 2ARJA 3FO2B 4LEOA 4NYLA 1ZA6A 4IRSB 2CR6A 5GZNC 1NSNL 4NNPL 2UY6A 5ITBH 4HWNA 3T2NH 1KCKA 43C9B 4XGZA 4QO1A 3V6OA 4KI5F 4GW5B 4KJYA 5EZIH 4KKAD 3VXSB 1RUKH 1D5IL 1U3JA 1UKTA 2Z8VC 3TBTA 1MIML 1UZ8A 3FT2B 4E41A 2BSTA 1CG9A 1NGXA 1U8OB 3O6FD 1VFUA 1MJJB 4Y2OA 3T1FA 4GT7A 5CZVL 2B4CL 5KVGL 4OZGE 5I1HH 1NBVH 4OF5A 2I24N 5LAXB 2XKSA 3K74B 3QJHB 1CF8H 3ZE1F 3VH8B 1AD9A 4X6DE 5BO1L 5FECB 1UA6H 3IDJB 3MV7B 1HOCA 5D1QD 1A7QH 2Z4QB 1PGRB 4BZ2H 3HI6H 3SY0B 1U3YA 1RK0B 1L0QA 4I77H 5DDHA 4K3HA 4OSUH 3QFJE 4Z7VF 5GHWL 5KVFH 2NY3D 5GRUL 1UADC 2ADJA 2BK8A 1SBBA 3QCUL 5TF1H 5J9PB 4JHZA 3UTSB 4WENB 3VA6A 3IF1A 2OXGA 5J3HC 3JVGC 2DLHA 3LIZL 1CGTA 2GTZB 3VG0L 2H2PD 3GMQB 3IXAA 5C0AE 5C1MB 5MENA 3AC0A 1LO4H 2LAAA 3F7QA 1FVDB 4ZS6D 4IOFD 3RWIA 1NFIB 4L9LA 4LLVB 3QEGH 4YE4H 4Y8AA 3CFEB 5ILTL 4UQ3A 1IE5A 1K85A 1I1AC 4QRUA 3LKOA 3U6RA 4X7CC 2VDKH 5BQ7B 4QOKE 3RWGB 1RZ7L 1F3JB 2DQJH 5LGKA 3IT8D 5DD6B 4TNWK 3WHE0 4G3YH 2EE9A 4X83A 4AEHH 4QRRB 1MVUB 5E5RB 5FUZL 3ZKQD 1U93A 5HGBB 1MCNA 5IW1B 4AEHL 3GM8A 1BQHA 5D96B 5F7EL 4MA7L 5KSBE 1RUPL 2CO7B 2H3NA 4PTTA 2ICCA 1N6VA 4TUKH 5B38G 3QXDA 4HKXA 5HI4C 3HE6D 4U31A 5T1KD 1ROWA 4JFZH 3MREA 4B41A 4PRNA 5JIIA 2FSEB 5MENE 2BRQA 4RFNB 3UTSD 2QKIA 3WKML 4CGTA 1F90H 1MHHB 1BQSA 3P2TA 3LAFA 1DDHB 2XY1A 1U8QB 3QEHA 2AEWA 3D3VE 3TNMB 3U30C 4XH2A 2EDNA 4Q6IC 4LVHC 3ARUA 1CLOH 3K2MC 1K9TA 2E7HA 4Y5YB 1MCDA 3IFNH 1TJHL 5DVNA 3VE0A 4XCNA 1NBZA 1AGCA 5TQ0H 1FFNB 3GBNH 5FYLD 4GAFB 1B0GA 1WAAF 5GRUH 3MJ8A 5D5MB 4EN3D 4GS7B 4PJFE 2IANB 3UPRA 5HYJA 1EEQA 4QRSB 2J4WH 1KENH 2VRAA 3UTQB 2EDFA 4G8GE 1DVFD 1A5FH 2QSVA 5D7SL 5E8NB 4AIZA 3VI4F 4WFGE 1URLA 2ED9A 1IL1B 4LPVA 3DSFL 4OIIH 4XCEA 2QKIB 5F7WC 3HTLX 3LY6A 4WGWB 5IMMA 2G60H 4KRLB 5DC4B 4WEUD 3UTOA 5FDWA 4LVEA 5E8DH 3C60A 2A6KA 3O8XC 3OKNA 4H25A 3HC3L 1KIPB 4Q74A 4KK6D 4E0RB 1TFHA 2P46B 2HAZA 3QI9B 1YMMA 4N1EA 3QEUB 2BVTA 4K9EC 1P84J 2B2XH 3LEYH 2ICES 4XWGH 3FMGH 1ITBB 2O5XH 2Y5EA 3QXWA 5GS2D 5ACZA 1NUGA 1W8OA 4R3SB 3QDGE 2DBLL 1XF2A 3WDJA 4P59L 3O3EA 4XRCA 4AENA 4ZOCA 5ANMA 4MCYB 1G6RL 4JFQB 4DTGL 4PB0H 4X6EB 4NPYA 4MS8C 2VXSH 5D7JD 3L3HA 1RHHA 4YDVB 4EJ1C 3IDGB 4AL8H 1FBIH 2FJFB 4KTEL 1RIUH 1PKQB 2WIMA 3QYCA 4IS6B 4ONHA 4PJBF 4U1LA 1QSFB 4XP5H 1U8MA 4W4OA 3BZEB 1J12A 4QTHB 3TO4B 4EDXB 4J8RA 5CP7B 3MR9B 3M17A 4YHKH 4Z7VA 2DIAA 1OLZA 4FQQA 5CAYB 4TUOB 3TBSB 2NX5A 1AO7A 1EEYA 1CE1H 2HJKA 2YA1A 5E6IB 3MLSH 2OQJA 3MV8D 1BPVA 4RQQA 1ZWIB 5LXGL 2YZ1A 4JFED 3T3PF 2E27L 3C5ZA 1R3KA 3MV9A 3OAZH 5I75B 5CP3A 5IK3B 5F7KC 5FOBA 2VXQH 2WQ8A 2ZJSL 4ZAKC 5EZIL 1PLGL 1QSFD 2L4OA 2E8ZA 3RY6A 3C9NA 1ZLSL 4MWFB 3H8NA 4QLRA 5EUOB 4N8VA 5E8EB 5H94B 1OF2A 5I2IB 1PJ9A 1ADQL 3DI3B 2AJ3A 1FNHA 3CVHL 3E0GA 3EO1B 4V1DA 5HGAB 1DUZB 3E2HB 1MHEA 2BXZA 4A6YA 3MJ6A 3GKWH 4X6CE 3VD4A 2A9NH 3HR5A 3KS0H 1OP3K 3R1GL 3FQRA 5HHME 3W2DL 1GGBL 4NZTL 4JY6A 1T6VN 5T1DH 5GS1A 3MBXH 5SX4I 4JDZB 1CXKA 5F6IB 2JB6B 2A0LC 3GSVA 3MV11 1GOHA 3TH3T 1JPSH 1NL0L 4Z0BL 2H9GB 1JWMB 5T1MA 2J4WL 4FFWD 1LGVA 3EFFA 2VTFA 2DMKA 1BIIA 2VLJD 3VXMA 3EKCA 2APFA 1I7ZB 1FZJA 3UJJH 3GBNL 1IC4L 4M43L 1G6RA 1MCLA 3CFDB 1YNLH 4PJ9A 2VDOL 1AH1A 2FEEL 3QHZL 4DN4L 4X7TB 4XCFL 3K1DA 3QIWB 4PJAB 2VNCA 1ZLUK 2CR3A 2E9JA 2AJSH 1J5OH 2OI9B 4RZCA 3R0MA 4M93C 5KBNC 3PHOB 2YUVA 4QRSA 2ADGB 2X70B 5F8RC 1RIHH 3UTQA 2VMFA 2ZCKH 1Z9SA 4H1LA 3MRLB 4RAUB 3DOSA 5FK9B 2FGZA 3DPBA 4LSRL 3INUH 3DUSB 1NGWB 2DQIL 4MSWB 1I3RA 4JY5L 5EOQL 4XP6L 2VSCA 4PRHB 3VFSA 2D9QB 5GGTL 3UTSE 4M4PA 2FX7H 5JIKA 3CNKA 1MREH 3CFKB 2X40A 1XIWB 4AT6B 2NY1C 1OB1A 4PRDA 1IC1A 3IVKB 4UDTA 1GL4B 4P5KB 2MQ3A 1OP3H 4DFHA 3RGVD 1NAKL 3S35H 4LL9A 5INDB 4K7PL 3VWJA 3WXVL 3W9DA 1T20A 3RKPA 3MUGB 3V5KA 2VJXA 4PJAF 4OT1H 3WIIL 5K9QG 5F1IB 4NC1C 1XFPA 4X6FA 3EFFB 2QSQA 3G08B 3TZVC 4PS4L 4HD9A 2EYRA 4LIQL 4QXGH 3MOQA 3X17A 4M61A 4U1MB 4JRXA 2OZ4A 2F54A 4GAGH 4G7YH 4LAQH 1KIRB 2ZG1A 1HQRA 4GRWB 1MAJA 3FONB 5IOPA 4JR9L 5ESQA 4M7LH 1Y6MR 4UDTB 1LP9A 3O4LD 1EEZA 5I71B 1CDHA 1DBJH 1M7DB 4OCRL 5TQ2L 3RVWC 5IM7A 5C0CA 5A40E 5EOCJ 7FABH 4OSUL 1G7LB 2Y06L 1BJMA 5F8QC 3DMMD 5F9WB 3TJEH 1SJEB 1VKXB 1IRAY 1FG2A 4NN6C 3AS3A 5CJXC 5EUOE 3GSQB 5C0GB 3GM0A 1ADQH 3T0EA 1CVSC 4M61B 2NY6B 3OHXA 3X3GH 3T1FB 5IIEB 1YQ2A 2DQCL 4HUXA 3PWLB 1IM3A 3IYLW 5JOFB 3S3SA 1KCVL 3DXAD 3LPWA 4HJJL 5C07E 2I9TB 5GSRB 2GJ6A 1EBAA 3R8QA 4RA3A 1VCAA 3QEQE 3U36B 1NGZB 1ZS8A 2A74A 1QTYT 1B6UA 1HOCB 3SOBL 3S98A 3RJQB 5C0IA 1PSKL 4EOWL 3MODL 3BX7C 4Y1AD 5KVFL 1F6FB 5JR1L 3C8HA 3MCKB 4N0UA 5I18H 2JCCE 4HLZH 1G0YR 3DVFA 4YDKH 3PXJA 4K23L 4IIQA 3PWPB 4X9IA 1I1CA 1HKFA 3MPCA 3SKUD 3G6JE 1IGYA 4O9HL 1HINH 3QIBB 2WBJC 2QLVB 3RZCA 3IKCB 1P4BL 3BI9X 1KN2H 3IDXL 3ALWA 5T33H 1PG7L 4K3JH 4HPYL 3IJHA 3OXRB 3V8OA 5MEQA 1IC5L 3U46A 2OTUB 2X89D 4JCMA 4RIRA 1IILE 2D0HA 4H8WC 3EOBB 3LB6C 4IRZH 1MJUL 4G6KL 4NNYA 2OSLA 4M4RA 1I9RH 3MFGB 4ZPVB 4QTHA 4PJXF 4EI6A 1Z2KA 1FNAA 3QIWA 2JJTC 4PJXE 4ZTOL 4XAWH 4RWHA 2AS5M 5DMIH 2A9MH 4JY5H 1MCWW 3H9HB 5FCUL 1BVKB 1REIA 3QULB 5E94A 3S4SB 2PYEB 2G2RA 4YHZL 3V4UL 5D7JC 5A16A 3VXOB 4D3CL 1F8TL 2BMKB 2Z31A 4O4YH 1AJ7H 4M5YL 3S7GA 3EJZC 4PJ5B 3AXLA 1TMCB 2BHUA 1ZTXL 3VI4E 3DV4A 4NKIH 1YUHA 3NZ8B 5D5MF 3UYOD 1T1YA 3VRLE 2CK0H 5E8OB 1FO0A 1X5IA 5C0EA 2AVGA 2QADC 4FQIH 2NY1D 1H3PL 1I7TB 2R8SL 3TJHD 5DWUH 4MLIA 2DJUA 2EDEA 3U0WH 2NTFA 2Z92B 3MLRL 5JDSB 4NNXA 3RUGB 4F7EB 1TETH 5F7HA 5CS7A 1GAFH 2VXQL 3GGWA 3I50L 1BD2E 4LIQE 2EIEA 3MRJA 3S4SA 5CWSA 1JPFB 3VXRD 4I2XB 2Y7QA 1CFTB 1K3IA 3BISA 1NDGB 2AQ2A 1QKZH 3TO4D 4FG6C