5EXQA

Human cytochrome c y48h
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSHTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c
publication title To be announced
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 30
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5exqA00
1QYZA 1AOFA 1PPJD 4O1QA 5KLVD 5C9MA 1OAEA 2GB8B 1H32A 4WQ9A 1C6RA 5CIDB 2GC4D 2N18B 2HV4A 1BE3D 2C1UA 2GIWA 3A9FA 4XXLA 1U74B 1IO3A 4FANA 4L3GA 1C7MA 2N3YA 1CYCA 1H32B 3WU2V 1DVHA 1DW1A 1CYIA 3O1YA 4FA1A 4YE1A 4FB1A 1COTA 2C1DA 5GTHV 1M70A 1JDLA 3L72D 4QAOA 1C2NA 1QL3A 4UB6V 1ETPA 4WQCA 1E2RA 3MK7B 4EIDA 1NIRA 1CXCA 1FHBA 1PP9D 1QKSA 4WQBA 2BPBB 3NBSA 2C1DB 1CTZA 4MU8A 1YICA 1F1FA 1EB7A 2B10B 3RN1A 5KLIB 1H31A 1CSVA 2ZZS1 2BH5X 1A2SA 4AX3A 1MG2D 1IQCA 3HQ8A 1CIHA 2D0SA 1L9BC 1R0QA 2QJKB 2BH4X 2ZBOA 2ZXYA 4PJ0V 1DIIC 5CICB 1FI3A 2C1VA 1AOQA 3ZOYA 3SVWA 1KB0A 1IRVA 1DW2A 4UB8V 1I8PA 1K3GA 451CA 1CRYA 1J3SA 1H33A 1CORA 4EICA 3ZOWA 3H1ID 1I8OA 1M6ZA 1C2RA 1KB9D 1N90A 2ORLA 3PXSA 1LFMA 2AI5A 1NTKD 2N3BA 3TYIA 4WQ8A 3ZIYA 1SQQD 1CRGA 3HQ7A 4L1QA 2OZ1A 1MG3D 4N0KA 1L9JC 1NU1D 3L71D 3OCDB 1C6SA 1H33B 1F1CA 1RAQA 3WFCC 1IZL0 1RZ6A 5C0ZA 3RMZA 1NNOA 2L4DA 1RZ5A 4AANA 2CA3B 1YEBA 1N15A 2BCNB 2LIRA 3JBTB 1CEDA 2OZ1B 4K3IA 1IRWA 1YTCA 5AURA 1HROA 4WQDA 1B7VA 1AKKA 1CSXA 3L75D 5DFSA 3H1LD 1CC5A 1KIBA 1NTZD 1LMSA 2CXBA 1KYOD 1CO6A 4PD4D 2B0ZB 1K3HA 1GDVA 2CA4B 1KV9A 155CA 1FCDC 5CIBB 1W5CT 2CE1A 1GIWA 4LJIA 4V2KA 1A56A 3DMIA 1YEAA 1KYOW 4KMGA 1CYJA 2DGEA 2B12B 1HJ3A 1P84D 4P4QB 1DW0A 3CX5D 4IL6V 2PACA 1A8CA 1CIGA 1HZVA 1I6DA 3WUIA 1HH7A 2XTSB 3HQ6A 3PH2B 3CX5W 1BCCD 3HQ9A 2N9IA 5CIGB 1KX7A 1CRJA 3NWVA 1RAPA 1FJ0A 2C2CA 1CHHA 4Y5RA 1KX2A 3WC8A 1CRCA 5CYTR 1HJ5A 1ZZHA 3SWSA 1YNRA 1SQVD 3DR0A 1I5TA 1CSWA 1CHIA 1NTMD 5KAIV 3OCDA 3M97X 2YCCA 1GU2A 3OA8B 4WQAA 1YIQA 4DY9A 3O0RC 3ZCFA 2PCCB 3PXTA 5CIEB 3KZIV 4EIEA 2FWLA 4J20A 1WEJF 5KKZB 5EXQA 4AAOA 1QL4A 3BCCD 5H2FV 4L3HA 5KAFV 1CIFA 5E79V 3CYTI 1BL9A 2BGVX 3L4OA 1LC2A 2I8FA 4FA5A 4H0KA 5TISV 1WVEC 2PCBB 3VYMA 3SLEA 2EXVA 1HZUA 1EZVD 4FAVA 1GJQA 1MZ4A 2ZONG 2FYUD 3WFDC 3C2CA 3RN0A 2YK3A 3ZOXA 1L0ND 1ZRTD 2V07A 5IY51 3DP5A 2ZOOA 1HCMA 2A06D 2D0WA 4Q5PA 1LC1A 1CRHA 3L4MA 3H1HD 2YIUB 4WQEA 3MK7C 3L74D 1E8EA 1H1OA 1NMLA 1U75B 1YCCA 3CXHD 1I6EA 4WQ7A 1FOCA 1DIQC 1W2LA 3ZBMA 3ORVA 1N9CA 2B4ZA 1H9XA 1QN2A 1AYGA 1SQXD 2DVHA 2N9JA 2V08A 5CIHB 4XYDB 4NFGB 4GYDA 3CXHW 4FA9A 1DT1A 4AAMA 2VHDA 2CE0A 1SQPD 1SQBD 3CU4A 2FRCA 2GC7D 1LS9A 1I54A 5DF5A 1CCHA 2BCCD 1CHJA 3SJLA 3A0HV 4GEDB 2MHMA 1L0LD 1FI9A 1VYDA 1H9YA 3TGUD 1FI7A 4O1WA 3CP5A 1CRIA 3ZOOA 1C52A 2AIUA 3WFEC 5GTIV 2MTAC 3O20A 5B6QA 1C6OA 2YQBA 2C9XB 3OA8A 2B11B 3PXWA 1HRCA 3NBTA 1CXAA 2QJYB 4U3FD 4PWAA 3SXTA 1DW3A 1CNOA 1S6VB 1S5LV 4EIFA 1CIEA 3L73D 1CTYA 3L70D 4RSZA 1NMIA 3CWBD 1GKSA 4FA4A 2JTIB 4PW9B 2LITA 1CSUA 351CA 3RLMA 5DJQC 5CIFB 3H1JD 5B66V 1C75A 1I55A 3VRDA 3VNWA 1BGYD 1H31B 1OCDA 4H0JA 3X39A 3H1KD 2FYNB 1N50A 1YFCA 2C8SA 2JQRA 3A0BV 3O5CA 5B5EV 2N18C 1M60A 3WFBC 2QJPB 1HJ4A 4D6TD 2AXTV 1CTJA 2BLFB 4AALA 4JCGA 2IBZD 1CCRA 1DVVA 5DJQB 1E29A 1GQ1A
chains in the Genus database with same CATH superfamily
1QYZA 1AOFA 1PPJD 4O1QA 5KLVD 5C9MA 1OAEA 2GB8B 1H32A 4WQ9A 1C6RA 5CIDB 2GC4D 2N18B 2HV4A 1BE3D 2C1UA 2GIWA 3A9FA 4XXLA 1U74B 1IO3A 4FANA 4L3GA 1C7MA 2N3YA 1CYCA 1H32B 3WU2V 1DVHA 1DW1A 1CYIA 3O1YA 4FA1A 4YE1A 4FB1A 1COTA 2C1DA 5GTHV 1M70A 1JDLA 3L72D 4QAOA 1C2NA 1QL3A 4UB6V 1ETPA 4WQCA 1E2RA 3MK7B 4EIDA 1NIRA 1CXCA 1FHBA 1PP9D 1QKSA 4WQBA 2BPBB 3NBSA 2C1DB 1CTZA 4MU8A 1YICA 1F1FA 1EB7A 2B10B 3RN1A 5KLIB 1H31A 1CSVA 2ZZS1 2BH5X 1A2SA 4AX3A 1MG2D 1IQCA 3HQ8A 1CIHA 2D0SA 1L9BC 1R0QA 2QJKB 2BH4X 2ZBOA 2ZXYA 4PJ0V 1DIIC 5CICB 1FI3A 2C1VA 1AOQA 3ZOYA 3SVWA 1KB0A 1IRVA 1DW2A 4UB8V 1I8PA 1K3GA 451CA 1CRYA 1J3SA 1H33A 1CORA 4EICA 3ZOWA 3H1ID 1I8OA 1M6ZA 1C2RA 1KB9D 1N90A 2ORLA 3PXSA 1LFMA 2AI5A 1NTKD 2N3BA 3TYIA 4WQ8A 3ZIYA 1SQQD 1CRGA 3HQ7A 4L1QA 2OZ1A 1MG3D 4N0KA 1L9JC 1NU1D 3L71D 3OCDB 1C6SA 1H33B 1F1CA 1RAQA 3WFCC 1IZL0 1RZ6A 5C0ZA 3RMZA 1NNOA 2L4DA 1RZ5A 4AANA 2CA3B 1YEBA 1N15A 2BCNB 2LIRA 3JBTB 1CEDA 2OZ1B 4K3IA 1IRWA 1YTCA 5AURA 1HROA 4WQDA 1B7VA 1AKKA 1CSXA 3L75D 5DFSA 3H1LD 1CC5A 1KIBA 1NTZD 1LMSA 2CXBA 1KYOD 1CO6A 4PD4D 2B0ZB 1K3HA 1GDVA 2CA4B 1KV9A 155CA 1FCDC 5CIBB 1W5CT 2CE1A 1GIWA 4LJIA 4V2KA 1A56A 3DMIA 1YEAA 1KYOW 4KMGA 1CYJA 2DGEA 2B12B 1HJ3A 1P84D 4P4QB 1DW0A 3CX5D 4IL6V 2PACA 1A8CA 1CIGA 1HZVA 1I6DA 3WUIA 1HH7A 2XTSB 3HQ6A 3PH2B 3CX5W 1BCCD 3HQ9A 2N9IA 5CIGB 1KX7A 1CRJA 3NWVA 1RAPA 1FJ0A 2C2CA 1CHHA 4Y5RA 1KX2A 3WC8A 1CRCA 5CYTR 1HJ5A 1ZZHA 3SWSA 1YNRA 1SQVD 3DR0A 1I5TA 1CSWA 1CHIA 1NTMD 5KAIV 3OCDA 3M97X 2YCCA 1GU2A 3OA8B 4WQAA 1YIQA 4DY9A 3O0RC 3ZCFA 2PCCB 3PXTA 5CIEB 3KZIV 4EIEA 2FWLA 4J20A 1WEJF 5KKZB 5EXQA 4AAOA 1QL4A 3BCCD 5H2FV 4L3HA 5KAFV 1CIFA 5E79V 3CYTI 1BL9A 2BGVX 3L4OA 1LC2A 2I8FA 4FA5A 4H0KA 5TISV 1WVEC 2PCBB 3VYMA 3SLEA 2EXVA 1HZUA 1EZVD 4FAVA 1GJQA 1MZ4A 2ZONG 2FYUD 3WFDC 3C2CA 3RN0A 2YK3A 3ZOXA 1L0ND 1ZRTD 2V07A 5IY51 3DP5A 2ZOOA 1HCMA 2A06D 2D0WA 4Q5PA 1LC1A 1CRHA 3L4MA 3H1HD 2YIUB 4WQEA 3MK7C 3L74D 1E8EA 1H1OA 1NMLA 1U75B 1YCCA 3CXHD 1I6EA 4WQ7A 1FOCA 1DIQC 1W2LA 3ZBMA 3ORVA 1N9CA 2B4ZA 1H9XA 1QN2A 1AYGA 1SQXD 2DVHA 2N9JA 2V08A 5CIHB 4XYDB 4NFGB 4GYDA 3CXHW 4FA9A 1DT1A 4AAMA 2VHDA 2CE0A 1SQPD 3D0WA 1SQBD 3CU4A 2FRCA 2GC7D 1LS9A 1I54A 5DF5A 1CCHA 2BCCD 1CHJA 3SJLA 3A0HV 4GEDB 2MHMA 1L0LD 1FI9A 1VYDA 1H9YA 3TGUD 1FI7A 4O1WA 3CP5A 1CRIA 3ZOOA 1C52A 2AIUA 3WFEC 5GTIV 2MTAC 3O20A 5B6QA 1C6OA 2YQBA 2C9XB 3OA8A 2B11B 3PXWA 1HRCA 3NBTA 1CXAA 2QJYB 4U3FD 4PWAA 3SXTA 1DW3A 1CNOA 1S6VB 1S5LV 4EIFA 1CIEA 3L73D 1CTYA 3L70D 4RSZA 1NMIA 3CWBD 1GKSA 4FA4A 2JTIB 4PW9B 2LITA 1CSUA 351CA 3RLMA 5DJQC 5CIFB 3H1JD 5B66V 1C75A 1I55A 3VRDA 3VNWA 1BGYD 1H31B 1OCDA 4H0JA 3X39A 3H1KD 2FYNB 1N50A 1YFCA 2C8SA 2JQRA 3A0BV 3O5CA 5B5EV 2N18C 1M60A 3WFBC 2QJPB 1HJ4A 4D6TD 2AXTV 1CTJA 2BLFB 4AALA 4JCGA 2IBZD 1CCRA 1DVVA 5DJQB 1E29A 1GQ1A
chains in the Genus database with same CATH topology
1QYZA 1AOFA 1PPJD 4O1QA 5KLVD 5C9MA 1OAEA 2GB8B 1H32A 4WQ9A 1C6RA 5CIDB 2GC4D 2N18B 2HV4A 1BE3D 2C1UA 2GIWA 3A9FA 4XXLA 1U74B 1IO3A 4FANA 4L3GA 1C7MA 2N3YA 1CYCA 1H32B 3WU2V 1DVHA 1DW1A 1CYIA 3O1YA 4FA1A 4YE1A 4FB1A 1COTA 2C1DA 5GTHV 1M70A 1JDLA 3L72D 4QAOA 1C2NA 1QL3A 4UB6V 1ETPA 4WQCA 1E2RA 3MK7B 4EIDA 1NIRA 1CXCA 1FHBA 1PP9D 1QKSA 4WQBA 2BPBB 3NBSA 2C1DB 1CTZA 4MU8A 1YICA 1F1FA 1EB7A 2B10B 3RN1A 5KLIB 1H31A 1CSVA 2ZZS1 2BH5X 1A2SA 4AX3A 1MG2D 1IQCA 3HQ8A 1CIHA 2D0SA 1L9BC 1R0QA 2QJKB 2BH4X 2ZBOA 2ZXYA 4PJ0V 1DIIC 5CICB 1FI3A 2C1VA 1AOQA 3ZOYA 3SVWA 1KB0A 1IRVA 1DW2A 4UB8V 1I8PA 1K3GA 451CA 1CRYA 1J3SA 1H33A 1CORA 4EICA 3ZOWA 3H1ID 1I8OA 1M6ZA 1C2RA 1KB9D 1N90A 2ORLA 3PXSA 1LFMA 2AI5A 1NTKD 2N3BA 3TYIA 4WQ8A 3ZIYA 1SQQD 1CRGA 3HQ7A 4L1QA 2OZ1A 1MG3D 4N0KA 1L9JC 1NU1D 3L71D 3OCDB 1C6SA 1H33B 1F1CA 1RAQA 3WFCC 1IZL0 1RZ6A 5C0ZA 3RMZA 1NNOA 2L4DA 1RZ5A 4AANA 2CA3B 1YEBA 1N15A 2BCNB 2LIRA 3JBTB 1CEDA 2OZ1B 4K3IA 1IRWA 1YTCA 5AURA 1HROA 4WQDA 1B7VA 1AKKA 1CSXA 3L75D 5DFSA 3H1LD 1CC5A 1KIBA 1NTZD 1LMSA 2CXBA 1KYOD 1CO6A 4PD4D 2B0ZB 1K3HA 1GDVA 2CA4B 1KV9A 155CA 1FCDC 5CIBB 1W5CT 2CE1A 1GIWA 4LJIA 4V2KA 1A56A 3DMIA 1YEAA 1KYOW 4KMGA 1CYJA 2DGEA 2B12B 1HJ3A 1P84D 4P4QB 1DW0A 3CX5D 4IL6V 2PACA 1A8CA 1CIGA 1HZVA 1I6DA 3WUIA 1HH7A 2XTSB 3HQ6A 3PH2B 3CX5W 1BCCD 3HQ9A 2N9IA 5CIGB 1KX7A 1CRJA 3NWVA 1RAPA 1FJ0A 2C2CA 1CHHA 4Y5RA 1KX2A 3WC8A 1CRCA 5CYTR 1HJ5A 1ZZHA 3SWSA 1YNRA 1SQVD 3DR0A 1I5TA 1CSWA 1CHIA 1NTMD 5KAIV 3OCDA 3M97X 2YCCA 1GU2A 3OA8B 4WQAA 1YIQA 4DY9A 3O0RC 3ZCFA 2PCCB 3PXTA 5CIEB 3KZIV 4EIEA 2FWLA 4J20A 1WEJF 5KKZB 5EXQA 4AAOA 1QL4A 3BCCD 5H2FV 4L3HA 5KAFV 1CIFA 5E79V 3CYTI 1BL9A 2BGVX 3L4OA 1LC2A 2I8FA 4FA5A 4H0KA 5TISV 1WVEC 2PCBB 3VYMA 3SLEA 2EXVA 1HZUA 1EZVD 4FAVA 1GJQA 1MZ4A 2ZONG 2FYUD 3WFDC 3C2CA 3RN0A 2YK3A 3ZOXA 1L0ND 1ZRTD 2V07A 5IY51 3DP5A 2ZOOA 1HCMA 2A06D 2D0WA 4Q5PA 1LC1A 1CRHA 3L4MA 3H1HD 2YIUB 4WQEA 3MK7C 3L74D 1E8EA 1H1OA 1NMLA 1U75B 1YCCA 3CXHD 1I6EA 4WQ7A 1FOCA 1DIQC 1W2LA 3ZBMA 3ORVA 1N9CA 2B4ZA 1H9XA 1QN2A 1AYGA 1SQXD 2DVHA 2N9JA 2V08A 5CIHB 4XYDB 4NFGB 4GYDA 3CXHW 4FA9A 1DT1A 4AAMA 2VHDA 2CE0A 1SQPD 1SQBD 3CU4A 2FRCA 2GC7D 1LS9A 1I54A 5DF5A 1CCHA 2BCCD 1CHJA 3SJLA 3A0HV 4GEDB 2MHMA 1L0LD 1FI9A 1VYDA 1H9YA 3TGUD 1FI7A 4O1WA 3CP5A 1CRIA 3ZOOA 1C52A 2AIUA 3WFEC 5GTIV 2MTAC 3O20A 5B6QA 1C6OA 2YQBA 2C9XB 3OA8A 2B11B 3PXWA 1HRCA 3NBTA 1CXAA 2QJYB 4U3FD 4PWAA 3SXTA 1DW3A 1CNOA 1S6VB 1S5LV 4EIFA 1CIEA 3L73D 1CTYA 3L70D 4RSZA 1NMIA 3CWBD 1GKSA 4FA4A 2JTIB 4PW9B 2LITA 1CSUA 351CA 3RLMA 5DJQC 5CIFB 3H1JD 5B66V 1C75A 1I55A 3VRDA 3VNWA 1BGYD 1H31B 1OCDA 4H0JA 3X39A 3H1KD 2FYNB 1N50A 1YFCA 2C8SA 2JQRA 3A0BV 3O5CA 5B5EV 2N18C 1M60A 3WFBC 2QJPB 1HJ4A 4D6TD 2AXTV 1CTJA 2BLFB 4AALA 4JCGA 2IBZD 1CCRA 1DVVA 5DJQB 1E29A 1GQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYZ A;  1AOF A;  1PPJ D;  4O1Q A;  5KLV D;  5C9M A;  1OAE A;  2GB8 B;  1H32 A;  4WQ9 A;  1C6R A;  5CID B;  2GC4 D;  2N18 B;  2HV4 A;  1BE3 D;  2C1U A;  2GIW A;  3A9F A;  4XXL A;  1U74 B;  1IO3 A;  4FAN A;  4L3G A;  1C7M A;  2N3Y A;  1CYC A;  1H32 B;  3WU2 V;  1DVH A;  1DW1 A;  1CYI A;  3O1Y A;  4FA1 A;  4YE1 A;  4FB1 A;  1COT A;  2C1D A;  5GTH V;  1M70 A;  1JDL A;  3L72 D;  4QAO A;  1C2N A;  1QL3 A;  4UB6 V;  1ETP A;  4WQC A;  1E2R A;  3MK7 B;  4EID A;  1NIR A;  1CXC A;  1FHB A;  1PP9 D;  1QKS A;  4WQB A;  2BPB B;  3NBS A;  2C1D B;  1CTZ A;  4MU8 A;  1YIC A;  1F1F A;  1EB7 A;  2B10 B;  3RN1 A;  5KLI B;  1H31 A;  1CSV A;  2ZZS 1;  2BH5 X;  1A2S A;  4AX3 A;  1MG2 D;  1IQC A;  3HQ8 A;  1CIH A;  2D0S A;  1L9B C;  1R0Q A;  2QJK B;  2BH4 X;  2ZBO A;  2ZXY A;  4PJ0 V;  1DII C;  5CIC B;  1FI3 A;  2C1V A;  1AOQ A;  3ZOY A;  3SVW A;  1KB0 A;  1IRV A;  1DW2 A;  4UB8 V;  1I8P A;  1K3G A;  451C A;  1CRY A;  1J3S A;  1H33 A;  1COR A;  4EIC A;  3ZOW A;  3H1I D;  1I8O A;  1M6Z A;  1C2R A;  1KB9 D;  1N90 A;  2ORL A;  3PXS A;  1LFM A;  2AI5 A;  1NTK D;  2N3B A;  3TYI A;  4WQ8 A;  3ZIY A;  1SQQ D;  1CRG A;  3HQ7 A;  4L1Q A;  2OZ1 A;  1MG3 D;  4N0K A;  1L9J C;  1NU1 D;  3L71 D;  3OCD B;  1C6S A;  1H33 B;  1F1C A;  1RAQ A;  3WFC C;  1IZL 0;  1RZ6 A;  5C0Z A;  3RMZ A;  1NNO A;  2L4D A;  1RZ5 A;  4AAN A;  2CA3 B;  1YEB A;  1N15 A;  2BCN B;  2LIR A;  3JBT B;  1CED A;  2OZ1 B;  4K3I A;  1IRW A;  1YTC A;  5AUR A;  1HRO A;  4WQD A;  1B7V A;  1AKK A;  1CSX A;  3L75 D;  5DFS A;  3H1L D;  1CC5 A;  1KIB A;  1NTZ D;  1LMS A;  2CXB A;  1KYO D;  1CO6 A;  4PD4 D;  2B0Z B;  1K3H A;  1GDV A;  2CA4 B;  1KV9 A;  155C A;  1FCD C;  5CIB B;  1W5C T;  2CE1 A;  1GIW A;  4LJI A;  4V2K A;  1A56 A;  3DMI A;  1YEA A;  1KYO W;  4KMG A;  1CYJ A;  2DGE A;  2B12 B;  1HJ3 A;  1P84 D;  4P4Q B;  1DW0 A;  3CX5 D;  4IL6 V;  2PAC A;  1A8C A;  1CIG A;  1HZV A;  1I6D A;  3WUI A;  1HH7 A;  2XTS B;  3HQ6 A;  3PH2 B;  3CX5 W;  1BCC D;  3HQ9 A;  2N9I A;  5CIG B;  1KX7 A;  1CRJ A;  3NWV A;  1RAP A;  1FJ0 A;  2C2C A;  1CHH A;  4Y5R A;  1KX2 A;  3WC8 A;  1CRC A;  5CYT R;  1HJ5 A;  1ZZH A;  3SWS A;  1YNR A;  1SQV D;  3DR0 A;  1I5T A;  1CSW A;  1CHI A;  1NTM D;  5KAI V;  3OCD A;  3M97 X;  2YCC A;  1GU2 A;  3OA8 B;  4WQA A;  1YIQ A;  4DY9 A;  3O0R C;  3ZCF A;  2PCC B;  3PXT A;  5CIE B;  3KZI V;  4EIE A;  2FWL A;  4J20 A;  1WEJ F;  5KKZ B;  5EXQ A;  4AAO A;  1QL4 A;  3BCC D;  5H2F V;  4L3H A;  5KAF V;  1CIF A;  5E79 V;  3CYT I;  1BL9 A;  2BGV X;  3L4O A;  1LC2 A;  2I8F A;  4FA5 A;  4H0K A;  5TIS V;  1WVE C;  2PCB B;  3VYM A;  3SLE A;  2EXV A;  1HZU A;  1EZV D;  4FAV A;  1GJQ A;  1MZ4 A;  2ZON G;  2FYU D;  3WFD C;  3C2C A;  3RN0 A;  2YK3 A;  3ZOX A;  1L0N D;  1ZRT D;  2V07 A;  5IY5 1;  3DP5 A;  2ZOO A;  1HCM A;  2A06 D;  2D0W A;  4Q5P A;  1LC1 A;  1CRH A;  3L4M A;  3H1H D;  2YIU B;  4WQE A;  3MK7 C;  3L74 D;  1E8E A;  1H1O A;  1NML A;  1U75 B;  1YCC A;  3CXH D;  1I6E A;  4WQ7 A;  1FOC A;  1DIQ C;  1W2L A;  3ZBM A;  3ORV A;  1N9C A;  2B4Z A;  1H9X A;  1QN2 A;  1AYG A;  1SQX D;  2DVH A;  2N9J A;  2V08 A;  5CIH B;  4XYD B;  4NFG B;  4GYD A;  3CXH W;  4FA9 A;  1DT1 A;  4AAM A;  2VHD A;  2CE0 A;  1SQP D;  1SQB D;  3CU4 A;  2FRC A;  2GC7 D;  1LS9 A;  1I54 A;  5DF5 A;  1CCH A;  2BCC D;  1CHJ A;  3SJL A;  3A0H V;  4GED B;  2MHM A;  1L0L D;  1FI9 A;  1VYD A;  1H9Y A;  3TGU D;  1FI7 A;  4O1W A;  3CP5 A;  1CRI A;  3ZOO A;  1C52 A;  2AIU A;  3WFE C;  5GTI V;  2MTA C;  3O20 A;  5B6Q A;  1C6O A;  2YQB A;  2C9X B;  3OA8 A;  2B11 B;  3PXW A;  1HRC A;  3NBT A;  1CXA A;  2QJY B;  4U3F D;  4PWA A;  3SXT A;  1DW3 A;  1CNO A;  1S6V B;  1S5L V;  4EIF A;  1CIE A;  3L73 D;  1CTY A;  3L70 D;  4RSZ A;  1NMI A;  3CWB D;  1GKS A;  4FA4 A;  2JTI B;  4PW9 B;  2LIT A;  1CSU A;  351C A;  3RLM A;  5DJQ C;  5CIF B;  3H1J D;  5B66 V;  1C75 A;  1I55 A;  3VRD A;  3VNW A;  1BGY D;  1H31 B;  1OCD A;  4H0J A;  3X39 A;  3H1K D;  2FYN B;  1N50 A;  1YFC A;  2C8S A;  2JQR A;  3A0B V;  3O5C A;  5B5E V;  2N18 C;  1M60 A;  3WFB C;  2QJP B;  1HJ4 A;  4D6T D;  2AXT V;  1CTJ A;  2BLF B;  4AAL A;  4JCG A;  2IBZ D;  1CCR A;  1DVV A;  5DJQ B;  1E29 A;  1GQ1 A; 
#chains in the Genus database with same CATH topology
 1QYZ A;  1AOF A;  1PPJ D;  4O1Q A;  5KLV D;  5C9M A;  1OAE A;  2GB8 B;  1H32 A;  4WQ9 A;  1C6R A;  5CID B;  2GC4 D;  2N18 B;  2HV4 A;  1BE3 D;  2C1U A;  2GIW A;  3A9F A;  4XXL A;  1U74 B;  1IO3 A;  4FAN A;  4L3G A;  1C7M A;  2N3Y A;  1CYC A;  1H32 B;  3WU2 V;  1DVH A;  1DW1 A;  1CYI A;  3O1Y A;  4FA1 A;  4YE1 A;  4FB1 A;  1COT A;  2C1D A;  5GTH V;  1M70 A;  1JDL A;  3L72 D;  4QAO A;  1C2N A;  1QL3 A;  4UB6 V;  1ETP A;  4WQC A;  1E2R A;  3MK7 B;  4EID A;  1NIR A;  1CXC A;  1FHB A;  1PP9 D;  1QKS A;  4WQB A;  2BPB B;  3NBS A;  2C1D B;  1CTZ A;  4MU8 A;  1YIC A;  1F1F A;  1EB7 A;  2B10 B;  3RN1 A;  5KLI B;  1H31 A;  1CSV A;  2ZZS 1;  2BH5 X;  1A2S A;  4AX3 A;  1MG2 D;  1IQC A;  3HQ8 A;  1CIH A;  2D0S A;  1L9B C;  1R0Q A;  2QJK B;  2BH4 X;  2ZBO A;  2ZXY A;  4PJ0 V;  1DII C;  5CIC B;  1FI3 A;  2C1V A;  1AOQ A;  3ZOY A;  3SVW A;  1KB0 A;  1IRV A;  1DW2 A;  4UB8 V;  1I8P A;  1K3G A;  451C A;  1CRY A;  1J3S A;  1H33 A;  1COR A;  4EIC A;  3ZOW A;  3H1I D;  1I8O A;  1M6Z A;  1C2R A;  1KB9 D;  1N90 A;  2ORL A;  3PXS A;  1LFM A;  2AI5 A;  1NTK D;  2N3B A;  3TYI A;  4WQ8 A;  3ZIY A;  1SQQ D;  1CRG A;  3HQ7 A;  4L1Q A;  2OZ1 A;  1MG3 D;  4N0K A;  1L9J C;  1NU1 D;  3L71 D;  3OCD B;  1C6S A;  1H33 B;  1F1C A;  1RAQ A;  3WFC C;  1IZL 0;  1RZ6 A;  5C0Z A;  3RMZ A;  1NNO A;  2L4D A;  1RZ5 A;  4AAN A;  2CA3 B;  1YEB A;  1N15 A;  2BCN B;  2LIR A;  3JBT B;  1CED A;  2OZ1 B;  4K3I A;  1IRW A;  1YTC A;  5AUR A;  1HRO A;  4WQD A;  1B7V A;  1AKK A;  1CSX A;  3L75 D;  5DFS A;  3H1L D;  1CC5 A;  1KIB A;  1NTZ D;  1LMS A;  2CXB A;  1KYO D;  1CO6 A;  4PD4 D;  2B0Z B;  1K3H A;  1GDV A;  2CA4 B;  1KV9 A;  155C A;  1FCD C;  5CIB B;  1W5C T;  2CE1 A;  1GIW A;  4LJI A;  4V2K A;  1A56 A;  3DMI A;  1YEA A;  1KYO W;  4KMG A;  1CYJ A;  2DGE A;  2B12 B;  1HJ3 A;  1P84 D;  4P4Q B;  1DW0 A;  3CX5 D;  4IL6 V;  2PAC A;  1A8C A;  1CIG A;  1HZV A;  1I6D A;  3WUI A;  1HH7 A;  2XTS B;  3HQ6 A;  3PH2 B;  3CX5 W;  1BCC D;  3HQ9 A;  2N9I A;  5CIG B;  1KX7 A;  1CRJ A;  3NWV A;  1RAP A;  1FJ0 A;  2C2C A;  1CHH A;  4Y5R A;  1KX2 A;  3WC8 A;  1CRC A;  5CYT R;  1HJ5 A;  1ZZH A;  3SWS A;  1YNR A;  1SQV D;  3DR0 A;  1I5T A;  1CSW A;  1CHI A;  1NTM D;  5KAI V;  3OCD A;  3M97 X;  2YCC A;  1GU2 A;  3OA8 B;  4WQA A;  1YIQ A;  4DY9 A;  3O0R C;  3ZCF A;  2PCC B;  3PXT A;  5CIE B;  3KZI V;  4EIE A;  2FWL A;  4J20 A;  1WEJ F;  5KKZ B;  5EXQ A;  4AAO A;  1QL4 A;  3BCC D;  5H2F V;  4L3H A;  5KAF V;  1CIF A;  5E79 V;  3CYT I;  1BL9 A;  2BGV X;  3L4O A;  1LC2 A;  2I8F A;  4FA5 A;  4H0K A;  5TIS V;  1WVE C;  2PCB B;  3VYM A;  3SLE A;  2EXV A;  1HZU A;  1EZV D;  4FAV A;  1GJQ A;  1MZ4 A;  2ZON G;  2FYU D;  3WFD C;  3C2C A;  3RN0 A;  2YK3 A;  3ZOX A;  1L0N D;  1ZRT D;  2V07 A;  5IY5 1;  3DP5 A;  2ZOO A;  1HCM A;  2A06 D;  2D0W A;  4Q5P A;  1LC1 A;  1CRH A;  3L4M A;  3H1H D;  2YIU B;  4WQE A;  3MK7 C;  3L74 D;  1E8E A;  1H1O A;  1NML A;  1U75 B;  1YCC A;  3CXH D;  1I6E A;  4WQ7 A;  1FOC A;  1DIQ C;  1W2L A;  3ZBM A;  3ORV A;  1N9C A;  2B4Z A;  1H9X A;  1QN2 A;  1AYG A;  1SQX D;  2DVH A;  2N9J A;  2V08 A;  5CIH B;  4XYD B;  4NFG B;  4GYD A;  3CXH W;  4FA9 A;  1DT1 A;  4AAM A;  2VHD A;  2CE0 A;  1SQP D;  3D0W A;  1SQB D;  3CU4 A;  2FRC A;  2GC7 D;  1LS9 A;  1I54 A;  5DF5 A;  1CCH A;  2BCC D;  1CHJ A;  3SJL A;  3A0H V;  4GED B;  2MHM A;  1L0L D;  1FI9 A;  1VYD A;  1H9Y A;  3TGU D;  1FI7 A;  4O1W A;  3CP5 A;  1CRI A;  3ZOO A;  1C52 A;  2AIU A;  3WFE C;  5GTI V;  2MTA C;  3O20 A;  5B6Q A;  1C6O A;  2YQB A;  2C9X B;  3OA8 A;  2B11 B;  3PXW A;  1HRC A;  3NBT A;  1CXA A;  2QJY B;  4U3F D;  4PWA A;  3SXT A;  1DW3 A;  1CNO A;  1S6V B;  1S5L V;  4EIF A;  1CIE A;  3L73 D;  1CTY A;  3L70 D;  4RSZ A;  1NMI A;  3CWB D;  1GKS A;  4FA4 A;  2JTI B;  4PW9 B;  2LIT A;  1CSU A;  351C A;  3RLM A;  5DJQ C;  5CIF B;  3H1J D;  5B66 V;  1C75 A;  1I55 A;  3VRD A;  3VNW A;  1BGY D;  1H31 B;  1OCD A;  4H0J A;  3X39 A;  3H1K D;  2FYN B;  1N50 A;  1YFC A;  2C8S A;  2JQR A;  3A0B V;  3O5C A;  5B5E V;  2N18 C;  1M60 A;  3WFB C;  2QJP B;  1HJ4 A;  4D6T D;  2AXT V;  1CTJ A;  2BLF B;  4AAL A;  4JCG A;  2IBZ D;  1CCR A;  1DVV A;  5DJQ B;  1E29 A;  1GQ1 A; 
#chains in the Genus database with same CATH homology
 1QYZ A;  1AOF A;  1PPJ D;  4O1Q A;  5KLV D;  5C9M A;  1OAE A;  2GB8 B;  1H32 A;  4WQ9 A;  1C6R A;  5CID B;  2GC4 D;  2N18 B;  2HV4 A;  1BE3 D;  2C1U A;  2GIW A;  3A9F A;  4XXL A;  1U74 B;  1IO3 A;  4FAN A;  4L3G A;  1C7M A;  2N3Y A;  1CYC A;  1H32 B;  3WU2 V;  1DVH A;  1DW1 A;  1CYI A;  3O1Y A;  4FA1 A;  4YE1 A;  4FB1 A;  1COT A;  2C1D A;  5GTH V;  1M70 A;  1JDL A;  3L72 D;  4QAO A;  1C2N A;  1QL3 A;  4UB6 V;  1ETP A;  4WQC A;  1E2R A;  3MK7 B;  4EID A;  1NIR A;  1CXC A;  1FHB A;  1PP9 D;  1QKS A;  4WQB A;  2BPB B;  3NBS A;  2C1D B;  1CTZ A;  4MU8 A;  1YIC A;  1F1F A;  1EB7 A;  2B10 B;  3RN1 A;  5KLI B;  1H31 A;  1CSV A;  2ZZS 1;  2BH5 X;  1A2S A;  4AX3 A;  1MG2 D;  1IQC A;  3HQ8 A;  1CIH A;  2D0S A;  1L9B C;  1R0Q A;  2QJK B;  2BH4 X;  2ZBO A;  2ZXY A;  4PJ0 V;  1DII C;  5CIC B;  1FI3 A;  2C1V A;  1AOQ A;  3ZOY A;  3SVW A;  1KB0 A;  1IRV A;  1DW2 A;  4UB8 V;  1I8P A;  1K3G A;  451C A;  1CRY A;  1J3S A;  1H33 A;  1COR A;  4EIC A;  3ZOW A;  3H1I D;  1I8O A;  1M6Z A;  1C2R A;  1KB9 D;  1N90 A;  2ORL A;  3PXS A;  1LFM A;  2AI5 A;  1NTK D;  2N3B A;  3TYI A;  4WQ8 A;  3ZIY A;  1SQQ D;  1CRG A;  3HQ7 A;  4L1Q A;  2OZ1 A;  1MG3 D;  4N0K A;  1L9J C;  1NU1 D;  3L71 D;  3OCD B;  1C6S A;  1H33 B;  1F1C A;  1RAQ A;  3WFC C;  1IZL 0;  1RZ6 A;  5C0Z A;  3RMZ A;  1NNO A;  2L4D A;  1RZ5 A;  4AAN A;  2CA3 B;  1YEB A;  1N15 A;  2BCN B;  2LIR A;  3JBT B;  1CED A;  2OZ1 B;  4K3I A;  1IRW A;  1YTC A;  5AUR A;  1HRO A;  4WQD A;  1B7V A;  1AKK A;  1CSX A;  3L75 D;  5DFS A;  3H1L D;  1CC5 A;  1KIB A;  1NTZ D;  1LMS A;  2CXB A;  1KYO D;  1CO6 A;  4PD4 D;  2B0Z B;  1K3H A;  1GDV A;  2CA4 B;  1KV9 A;  155C A;  1FCD C;  5CIB B;  1W5C T;  2CE1 A;  1GIW A;  4LJI A;  4V2K A;  1A56 A;  3DMI A;  1YEA A;  1KYO W;  4KMG A;  1CYJ A;  2DGE A;  2B12 B;  1HJ3 A;  1P84 D;  4P4Q B;  1DW0 A;  3CX5 D;  4IL6 V;  2PAC A;  1A8C A;  1CIG A;  1HZV A;  1I6D A;  3WUI A;  1HH7 A;  2XTS B;  3HQ6 A;  3PH2 B;  3CX5 W;  1BCC D;  3HQ9 A;  2N9I A;  5CIG B;  1KX7 A;  1CRJ A;  3NWV A;  1RAP A;  1FJ0 A;  2C2C A;  1CHH A;  4Y5R A;  1KX2 A;  3WC8 A;  1CRC A;  5CYT R;  1HJ5 A;  1ZZH A;  3SWS A;  1YNR A;  1SQV D;  3DR0 A;  1I5T A;  1CSW A;  1CHI A;  1NTM D;  5KAI V;  3OCD A;  3M97 X;  2YCC A;  1GU2 A;  3OA8 B;  4WQA A;  1YIQ A;  4DY9 A;  3O0R C;  3ZCF A;  2PCC B;  3PXT A;  5CIE B;  3KZI V;  4EIE A;  2FWL A;  4J20 A;  1WEJ F;  5KKZ B;  5EXQ A;  4AAO A;  1QL4 A;  3BCC D;  5H2F V;  4L3H A;  5KAF V;  1CIF A;  5E79 V;  3CYT I;  1BL9 A;  2BGV X;  3L4O A;  1LC2 A;  2I8F A;  4FA5 A;  4H0K A;  5TIS V;  1WVE C;  2PCB B;  3VYM A;  3SLE A;  2EXV A;  1HZU A;  1EZV D;  4FAV A;  1GJQ A;  1MZ4 A;  2ZON G;  2FYU D;  3WFD C;  3C2C A;  3RN0 A;  2YK3 A;  3ZOX A;  1L0N D;  1ZRT D;  2V07 A;  5IY5 1;  3DP5 A;  2ZOO A;  1HCM A;  2A06 D;  2D0W A;  4Q5P A;  1LC1 A;  1CRH A;  3L4M A;  3H1H D;  2YIU B;  4WQE A;  3MK7 C;  3L74 D;  1E8E A;  1H1O A;  1NML A;  1U75 B;  1YCC A;  3CXH D;  1I6E A;  4WQ7 A;  1FOC A;  1DIQ C;  1W2L A;  3ZBM A;  3ORV A;  1N9C A;  2B4Z A;  1H9X A;  1QN2 A;  1AYG A;  1SQX D;  2DVH A;  2N9J A;  2V08 A;  5CIH B;  4XYD B;  4NFG B;  4GYD A;  3CXH W;  4FA9 A;  1DT1 A;  4AAM A;  2VHD A;  2CE0 A;  1SQP D;  1SQB D;  3CU4 A;  2FRC A;  2GC7 D;  1LS9 A;  1I54 A;  5DF5 A;  1CCH A;  2BCC D;  1CHJ A;  3SJL A;  3A0H V;  4GED B;  2MHM A;  1L0L D;  1FI9 A;  1VYD A;  1H9Y A;  3TGU D;  1FI7 A;  4O1W A;  3CP5 A;  1CRI A;  3ZOO A;  1C52 A;  2AIU A;  3WFE C;  5GTI V;  2MTA C;  3O20 A;  5B6Q A;  1C6O A;  2YQB A;  2C9X B;  3OA8 A;  2B11 B;  3PXW A;  1HRC A;  3NBT A;  1CXA A;  2QJY B;  4U3F D;  4PWA A;  3SXT A;  1DW3 A;  1CNO A;  1S6V B;  1S5L V;  4EIF A;  1CIE A;  3L73 D;  1CTY A;  3L70 D;  4RSZ A;  1NMI A;  3CWB D;  1GKS A;  4FA4 A;  2JTI B;  4PW9 B;  2LIT A;  1CSU A;  351C A;  3RLM A;  5DJQ C;  5CIF B;  3H1J D;  5B66 V;  1C75 A;  1I55 A;  3VRD A;  3VNW A;  1BGY D;  1H31 B;  1OCD A;  4H0J A;  3X39 A;  3H1K D;  2FYN B;  1N50 A;  1YFC A;  2C8S A;  2JQR A;  3A0B V;  3O5C A;  5B5E V;  2N18 C;  1M60 A;  3WFB C;  2QJP B;  1HJ4 A;  4D6T D;  2AXT V;  1CTJ A;  2BLF B;  4AAL A;  4JCG A;  2IBZ D;  1CCR A;  1DVV A;  5DJQ B;  1E29 A;  1GQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...