5EYLA

Tubulin-binding darpin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
GSDLGKKLLEAARAGQDDEVRILMANGADVNATDASGLTPLHLAATYGHLEIVEVLLKHGADVNAIDIMGSTPLHLAALIGHLEIVEVLLKHGADVNAVDTWGDTPLRLAAIMGHLEIVEVLLKHGADVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED ANKYRIN REPEAT PROTEIN (DARPIN)
publication title Destabilizing an interacting motif strengthens the association of a designed ankyrin repeat protein with tubulin.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
total genus 41
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5eylA00
2L6BA 2JABA 3NOGD 3UI2A 4JB8P 4DX7D 1IHBA 5CEAA 1N0QA 3AJIA 1DC2A 3J5PA 5CEDB 2B0OE 3EU9A 1MX6A 2F8XK 4DX2A 4Z68A 3DEPA 1BI7B 3V30A 1BD8A 3DEOA 4GPMA 4HRNA 3V31A 4DRXE 3F6QA 5KBAA 4ZHBA 1QYMA 4ATZD 1TR4A 4HLLA 3UXGA 4HQDA 4J8YA 5AAOA 2XEHA 5AQBA 4LSZE 3TWUA 3JUEA 2NYJA 1N11A 4F6RD 4RLYA 1MYOA 2XENA 4LG6A 4U8VD 2XEEA 2ZGDA 4HRLA 3TWXA 2Y0BG 2ETCA 3LJNA 5D66A 3V2XA 2XZTG 4G8KA 4C48B 1K1BA 2V5QC 4ZFHA 1IKND 1YMPA 2KXPC 3SO8A 4DX6D 4G8LA 5EIBE 4YDWA 3Q9UC 5KNGA 1MX4A 2VGEA 4O60A 3EHRA 1NFIE 3B7BA 2RFAA 4N5QA 5ENRD 5HKPA 2HE0A 1S70B 2ETBA 4CZ2D 3TWSA 4DX1A 3EHQA 3AAAC 3TWWA 5CECB 4U96D 1OY3D 4OAVB 5JA4D 3TWVA 5AARA 5JMND 5FINA 5ENQD 5ITZF 4HI8A 5KNHD 1YCSB 2DVWA 2F37A 2BKKB 4DX5D 1AP7A 2BKGA 1WG0A 5FIOA 3T8KA 3T9KA 1BLXB 4HBDA 3UTMA 2QYJA 3HG0D 3J5QB 5AQAA 3W9FA 1SW6A 4HB5A 4K5AB 2FO1E 1BU9A 5EYLA 3KEAA 5ENSD 3ZNGA 3TWRA 4BEPA 1A5EA 2MYOA 3B95A 3ZUVB 5KWDA 2Y1LE 3C5RA 4U8YD 1IXVA 4HRMB 3HRAA 3NBNB 2ZGGA 1UOHA 1D9SA 4K5BA 5BXUA 2A5EA 4LNUD 3TWTA 1MJ0A 2J8SD 2DZNA 2ETAA 4TUMA 1N0RA 4HNAD 2DWZA 5AQ7A 4HI9A 4BERA 4CYMD 5CERB 3NOCD 4UUCA 5AN8A 5EILA 5HRYA 5CBNA 3IXEA 2KBXA 5BXOA 5HS0A 4BSZB 4QFVA 4YDYA 5ENTD 3V79K 4B93B 2V4HC 4GMRA 5EYPF 2RFMA 4U95D 4F1PA 1SVXA 3TWQA 4DUIA 1AWCB 4O1OA 5ENPD 4J7WA 4BETA 5EIDA 3Q9NC 1MX2A 1K3ZD 5AQ9A 5CBOA 4K5CA 2DZOA 1BI8B 2P2CP 5EN5D 3ZKJA 4OAUC 2QC9A 4O1PA 2AJAA 1OT8A 1WDYA 3JXIA 2PNNA 3ZU7B 3W9GA 4A63B 2XZDG 1DCQA 1YYHA 1G3NB 4NIKA 3D9HA 4QQIA 5ENOD 3V2OA 2F8YA 3JXJA 1K1AA 4BESA
chains in the Genus database with same CATH superfamily
3EHNA 1U3CA 3QARA 1JCRA 2J4BA 4FJZA 2P9SG 3O48A 3ULQA 5HQ8A 1TR4A 1Z3YA 2V5FA 3OXLA 4I9EA 3L54A 3UX4A 4G23A 3FEXA 2L9BA 4CT4A 2XZTG 3NAWA 5E75A 4U04A 4O60A 4BX8A 3KD7A 2E2EA 5ENRD 3QWVA 2JEKA 3D9MA 3TWSA 4I1MA 4OAVB 3HYMB 2X6KA 5C2YA 2KM4A 2KC7A 2ZU6B 4JW1A 1H6KA 2CHZA 3CQCB 2XS8A 3TWTA 1MJ0A 3E4BA 1SQMA 2CHWA 2WXPA 5G04J 3PUJA 2XEVA 1S64A 2EIKE 3IXEA 4G24A 4GMRA 2X3MA 1Y6IA 1SVXA 4IULA 4GTPA 2KZTA 3Q49B 2R59A 3CHOA 1PY1A 5BV1A 3DXMG 4I1AA 1H6PA 3VLFA 4BTBA 3BU8A 3ZYQA 2WQ7A 4IYPA 2R17C 3FTWA 2HO1A 4U7EB 1BI7B 4DLOA 3T5VA 3V31A 4ANWA 4HOTA 2J09A 3U64A 4J8YA 3SNXA 4PS3A 2BUGA 4A1GA 2ZGDA 3CVLA 3FTXA 4NURA 4JEUA 3CQGB 1MX4A 4FHKA 2AWIA 2L0IA 4N5QA 1TNBA 2ONDA 3EHQA 3SBTB 3R7RA 3C98A 4GTRA 4U96D 3MA5A 4O6FA 3ZW3A 1TYQG 1UW4B 1E96B 4K5AB 4HB5A 1KT0A 4GTMA 1HXIA 2EIME 4BWRA 5KWDA 1H6OA 3X2QE 2A5EA 4HOSA 2XHEA 4CGWA 2WXJA 4HNAD 5CERB 3LVQE 3FUIA 2X6JA 3CV0A 1IHGA 2VYIA 4XZ4A 3ASFA 1OWOA 1QZ2A 2XCBA 1RZ4A 3ONKA 5JJ7A 5KJNA 3U66A 3TJPA 2CFUA 3RIBA 3ML8A 2DYRE 2F8YA 1LF8A 2WXFA 4B8CB 3IV0A 2L6JA 4ACKA 1QYMA 3BQOA 3RAUA 1E8ZA 1NZNA 1OWMA 1H2VC 2ETCA 3I4RB 3FY4A 2QZAA 4GPKA 3Q9UC 2IO3C 2P9LG 1LD7A 5BNWA 2IOSA 3I5PA 2WXOA 3D9IA 1RW2A 1NL4A 3CVPA 3UM3A 3ABLE 4C0EA 4EBAA 3DWLG 3CVWA 2NXPA 5CRVA 3MKQB 3Q15A 4WWNA 4U8HA 4GCOA 3RKVA 2J9QA 2Y1LE 4AY6A 4ANVA 4GAAA 3C3RA 2J8SD 3UUXA 1N9AA 2J07A 3DSVA 3SFZA 4JA9A 3PZ4A 5EIDA 4BSXA 5JJTA 5CHEE 3DSWA 3W9GA 4A63B 3JUIA 3D9HA 4QQIA 1NA0A 1YA0A 4MBGA 2KCVA 3APCA 3L9TA 3MV3B 4FLHA 5B1BE 3DEPA 1FVHA 1HE8A 3L6AA 3DEOA 1U2VG 4ZHBA 5AJLA 4OVVA 1E8WA 2OOEA 3C3QA 4HRLA 2Y0BG 2QY7A 1FVFA 1EYHA 3QNKA 2AXUA 3SO8A 2XS1A 4DX6D 4G25A 4JHJA 5LX8A 3OTNA 1SA5A 3SFYA 1BPOA 3FUJA 4JA7A 5CECB 1OY3D 3G2WA 4HLEA 3JQ1A 1ELWA 1K8KG 4URKA 4F1SA 4B94A 3CK9A 4KZ0A 3ZIMA 3RJVA 4I6GA 1JWFA 3TG5A 1A5EA 4L23A 5BPPA 1OWPA 5FZSA 3AG4E 4BT8A 2J49A 4GMJA 3LY8A 3AG3E 2YQ8A 3AG2E 3RRNB 4LUNU 2WXNA 4U95D 4YDOA 4JZYA 3HXFA 2AVPA 5AYWD 3MKQA 4U0UA 2I2OA 4C9BB 1BI8B 4WNGA 5CCLA 4XE0A 5G05J 4GMLA 4UI9J 1TNUA 1K1AA 1V55E 3JYSA 4PDXA 3HIZA 3UI2A 4U63A 1N0QA 2WXQA 2GROB 4DX2A 1A17A 2VTBB 4DPRA 5AIJA 1TN6A 1D8EA 3LXUX 1Z6TA 5KBAA 3LCAA 3ASHA 3FUFA 3B7RL 4L7TA 3ZEFA 2KCKA 4GTTA 3PH0C 4KBQA 4F6RD 3ZYKA 1HG2A 3C72A 3FEYA 2C2LA 2HR2A 3G2UA 5EIBE 3CLJA 4A1SA 4YDWA 3D9OA 1NFIE 3FDHA 3C3OA 3R9MA 2EQXA 1TNOA 4A55A 3LY9A 1KPSB 4HVBA 3AU4A 3TWVA 2H6IA 5FIOA 1E8XA 4WNFA 2UY1B 3ONLA 2QYUA 2XRYA 2HM8A 4CGVA 3CEQA 4K5BA 5BXUA 4G1TA 3DBSA 3E30A 3L17A 2H6GA 4CYMD 5EILA 1UJJA 3LPZA 2YHCA 4C0MA 1LTXA 5FZQA 2V4HC 2X6IA 4O1OA 4BETA 4J7WA 1HU3A 2VQ2A 2VSYA 3GW4A 4K5CA 3ZKJA 2UWJG 2ZISA 3G2TA 3UIOC 3SD5A 1IQRA 3ULEG 1ZU2A 4AP2A 1Z3XA 1FPPA 4JB8P 4WWOA 4AJWA 4B89A 4XEIG 1MX6A 3ML9A 5A6CA 4JC8A 4M7CA 3F6QA 4L2YA 3RO3A 4EQFA 3ZYMA 2EIJE 5FZRA 4BTAA 4FULA 1KLXA 2DYSE 5FWQA 2V5QC 4AVXA 1YMPA 3ABME 2KXPC 1DVPA 2P9NG 3EIJA 2RG8A 1FT1A 2CHXA 4IN3B 5ANLA 1FT2A 4N2SA 3S7JA 1IYGA 3TWWA 1ZBPA 3TGOA 2R02A 1QQEA 5JA4D 1JWGA 5JMND 2R03A 2Y4UA 1JCSA 4FU3A 4FLBA 1BLXB 4OYSA 5ENSD 3QJZA 4FADA 3ENEA 1E7UA 3WG7E 5D0OD 1EF1C 3HRAA 4UWKA 4I6JA 5KJMA 2DWZA 4XX5A 3SBSA 5AN8A 1JCQA 3UMVA 2A5UA 2VGXB 2IO2C 5EYPF 3CVXA 2WMOA 3ABKE 1O1SA 3P1UA 4GTOA 2UY1A 2DZOA 3HXBA 2V4LA 3BG0B 4AY5A 4I1OB 4L9PA 3FP3A 4N2QA 3FU0A 1IHBA 4D10C 4BFRA 3UT4A 3S7DA 1JPLA 4TXPA 5M72A 3U3WA 3DSUA 4XIFA 4FA6A 3I3NA 1OWNA 2GW1A 3BEEA 4GZ5A 3TXMA 4Q69A 5KJLA 3CVNA 2I9CA 3LS8A 2IEJA 3CVYA 5LCWC 3HVEB 5B3SE 3UQ3A 3L08A 5IY5E 3SFXA 4WAFA 3AS5A 3PZ1A 3TL5A 4NRHB 4HI8A 3CK8A 2BKKB 1W3BA 2QYJA 3NF1A 4UWHA 1BU9A 5CCMA 4WNDA 2OCCE 4GA1A 3ZUVB 1ZB1A 3C5RA 3CVUA 1UOHA 1D9SA 4TUUA 2LXLA 4TUMA 2MHKA 3Q75A 3MZLB 5BXOA 4GZCA 3ZRHA 2I6HA 1S0PA 2XCCA 4JHKA 3VTXA 3PEVB 3QOUA 2Y3AA 1MX2A 4JL0A 1DNPA 1SA4A 4NQ0A 2AJAA 3FFLA 3NZUA 3CKBA 2WMNA 2PQNA 2LXMA 2JABA 5G04C 4UWLA 2PL2A 4MKTA 2VGXA 4HFGA 2GRLA 2OV8A 3NQPA 1XGWA 3CK7A 3UIPC 2C0MA 4MRUA 1TJCA 3UKUG 3WXXA 4ANXA 3L16A 3PUKA 3PS6A 3QK0A 1OWLA 2OVBA 4GTQA 1AP7A 1WG0A 3BG1B 3UTMA 1SZ9A 4AIFA 2FO1E 4AM9A 4L1BA 5CMYA 3ZNGA 4EZKA 2I1JA 4HS2A 4FP7A 2B6CA 4N39A 3LYAA 3FTZA 4CDRA 3LKUA 1KZOA 3MYVA 4GB9A 1P5QA 1GW6A 4MS6A 1MZCA 3UT8A 1JUQA 1E8YA 4CCAA 2A4ZA 3PZ2A 1K3ZD 5AQ9A 4O1PA 3PZ3A 3JQ0A 3MX3A 4GCNA 3NOGD 2EILE 2IONA 3Q5MA 4L2LA 5FQ4A 1O5MA 3FTUA 1H2TC 1HX8A 4HRNA 2XEHA 3GYZA 3TWUA 5FT9A 3FTYA 4K03A 2XEEA 2MRIA 2FULA 1N4SA 2XPYA 3ESLA 2WQHA 4TRQA 1HZ4A 3VLDA 3S2AA 4LRZA 1TNZA 2HE0A 4ATGA 1TN8A 2C0LA 2AW6A 3E32A 5FINA 2MOWA 2XPZA 4JVSA 3T8KA 3T9KA 4KYOB 5LP0A 4LERA 2EINE 3FUDA 4JEHA 3NBNB 2ZGGA 4PS7A 2IU1A 3IEGA 3TG4A 5HI7A 2VSXE 5AQ7A 3KSQA 2AXVA 5CRUA 1WAO1 4YNDA 4IRUA 2R2LA 3SY2A 4BSZB 2WVIA 4QFVA 1MQSA 3CHSA 3G2VA 2RFMA 1O1RA 1V54E 2LAIA 2VGYA 3TWQA 2WXLA 5KCMA 5EN5D 1N52A 3DSTA 5T3RA 1YYHA 4EHMA 5E76A 2L6BA 1OCOE 1FCHA 2IY0C 1QNFA 3ASDA 3ZYLA 1EPUA 4GPMA 2BTDA 4ATZD 3UXGA 2P9PG 3ZHEB 1WM5A 3SQVA 4LSZE 1D8DA 4LNBA 1MYOA 3CVVA 4U8VD 2DBAA 4I2ZA 3TWXA 4C48B 3RU0A 4Q94A 4ZFHA 3CKCA 2E0IA 3EHMA 1ELRA 4XKBA 5BUZA 3D3MA 4ILHB 2IQCA 1NI1A 3APFA 3HXCA 4WNEA 3ASGA 3KEZA 3EIQC 5KNHD 1YCSB 4H7YA 1NA3A 1VDYA 3PRZA 5B1AE 2H6HA 5BT1A 2VSNA 5FTPA 3UKRG 1UN9A 3FU5A 4NACA 3VTYA 2WXHA 4HRMB 2DZNA 3OXFA 4BT9A 1HO8A 5T8IA 3T5XA 1E90A 2FI7A 4B8AA 5ENTD 3RK6A 2WQ6A 4AXHA 2GRPB 2P9UG 4P29A 3Q9NC 3PNTB 4EBAG 3IHYA 4PH4B 4OAUC 5LOZA 3MCXA 1KT1A 3CSTA 4DJAA 3V2OA 3FUNA 3UINC 4ME2A 2FF4A 3CR3A 4YDEA 2LO6A 4U0ZA 2B0OE 3EU9A 4Z68A 3OXGA 3CHMA 4F53A 2CG3A 3SI5A 5J90A 4GTVA 2NYJA 1N11A 3CIAA 3UM1A 5G05C 1H0AA 3V2XA 3PE4A 4G8KA 4B0ZA 4UI9C 3IHVA 4KZCA 3Q79A 2FEZA 2J08A 2IF4A 3L13A 5D2MC 1DCEA 4CZ2D 4DX1A 3AAAC 4OVUA 2WM9A 3ZHEA 4J8FA 1UG3A 3W9FA 4HOUA 1OUVA 4G2VA 3EU5A 4BEPA 4J8SA 3B95A 3DPYA 3SHFA 5DBKA 4LNUD 2FO7A 2VTBA 2R05A 3FULA 4YDYA 3R7QA 4GYOA 2XPIA 2JLBA 4GZ3A 1QBQA 2GRNB 2QC9A 1N95A 3PEUB 2H6FA 3ASNE 4NIKA 2PM7A 3S7FA 5FJYA 1PAQA 3Q73A 5JJ6A 3DRAA 2DIWA 3J5PA 5CEDB 3N71A 3ZVVA 3CHQA 4ILIA 3MGBA 3B13A 4DRXE 2IOLA 5FQ6A 4HLLA 3ZGQA 5LFAA 3QAQA 2X38A 1N4RA 5J08A 4LG6A 4G26A 3FUMA 1WY6A 2RD0A 4DI3A 2VGEA 3S7BA 3B7BA 2ZIRA 5G2NA 2RFAA 4YVQC 2GRMA 4U07A 3FTVA 4ABNA 2P9KG 5EDSA 1S63A 2DVWA 3APDA 2LUHA 2PQRA 4UQXA 4LEUA 5G55A 3KEAA 3FTSA 3EJNA 3U4TA 4PUCA 4RSYA 4U8YD 4GA2A 4UWFA 1Y8MA 1HS6A 3QC1A 3FUKA 4GTSA 2ETAA 1Z5SC 4J0UA 4UQYA 3L82A 4HOQA 3TAXA 3LJ3A 4K0RA 3EDTB 4JHRA 3B7UX 3TXNA 5FQ8A 5DIZA 4N3BA 1H2UA 3CHPA 2XGMA 4ACLA 3MJWA 2XZDG 1DCQA 5H7PA 4DK5A 2NC9A 3AS4A 2BEDA 5KJKA 1OXJA 3ASOE 3AJIA 3PDNA 4KMOA 1OCRE 2YINA 3Q47B 2YNQA 4Y6WA 3QWPA 2KCLA 3HHMA 5AQBA 4J6IA 3ZXSA 2XENA 2IFUA 1MHQA 5D66A 1B89A 1K1BA 3SF4A 4FJYA 4U0SA 1X81A 4YVOA 4UQZA 3NZSA 3HDXA 2GRQB 3EHRA 5HKPA 3E37A 3IKOB 3JCKC 1L5JA 4DLQA 2BKGA 3J5QB 2VSOE 5EYLA 2CG2A 4G11A 2RKKA 2BF0X 2MYOA 2WXKA 2X6FA 4CEMA 3GZ1A 5EX3A 2WXMA 2FBNA 2DCPA 2X6HA 5HRYA 1HG5A 1N4QA 2R5SA 4F7AA 4LNGA 4F1PA 5BW8C 4DUIA 3FUEA 1TNYA 2IJGX 1UN8A 2P2CP 3QWWA 4HXIA 1OT8A 3HVEA 3ZN3A 3JXIA 1U3DA 1HF8A 4APFA 3CHRA 3FH5A 2M63A 2PZIA 3KAEA 4DX7D 5CEAA 3UPVA 4I43A 1N94A 2F8XK 2P58C 3QKYA 2HYZA 1N4PA 1E7VA 1O1TA 2GGFA 4TXQA 5D0QD 4W9RA 5JHAA 4KT6B 3G2SA 4N5CA 1PC2A 4RLYA 2I1KA 4UI9K 3T8MA 4I2WA 1IKND 3AU5A 4GZ6A 3NB2A 2ETBA 3MKRA 5JHBA 5ANRA 2LNIA 4J8EA 5AARA 4CDMA 5ITZF 4Q96A 2J4DA 2F37A 2WXRA 3D9JA 5ENNA 1ELKA 4I9CA 3PZDA 3ZPJA 1LD8A 4GZDA 2XGOA 3IBEA 2XGSA 2VJ8A 4RQIA 5FQ7A 1TJFA 1N0RA 4HI9A 2AXZA 3ESKA 3ISMC 5CBNA 2KBXA 1KZPA 5HS0A 1N54A 4HORA 5CMWA 3ZFWA 2NSZA 4I17A 5ARGA 4E85A 5EX0A 4EZJA 4UWGA 4LCTA 3GZSA 1WDYA 2QFCA 3Q7FA 4E6HA 4A3TA 1G3NB 1OCCE 4N3AA 3P2BA 2V0PA 4BESA 2WPVA 4EPZA 3KSLA 3ULYA 1DC2A 3FH7A 1EDUA 3VLEA 4GYWA 4ILGA 4GA0A 3V30A 1BD8A 4I6EA 2WXGA 4HQDA 3Q4AB 3JUEA 3Q78A 4AOFA 2Y69E 3LJNA 4J8DA 4EECA 4G8LA 1TEZA 4FHJA 3SZ7A 3LEWA 5KNGA 1XNFA 4RG9A 5ARFA 3FWVA 5A7DB 1X5BA 4WUYA 3LVRE 3GZ2A 4TXRA 2OEWA 4XI0A 2XRZA 2XQ0A 3PNLB 3R9AB 3URZA 3UM0A 4KXKB 4V3IA 3B7SA 2PM6A 5BV0A 5AQAA 1SW6A 4JD2G 3Q7AA 4F3VA 3CGHA 3AG1E 3D9KA 1IXVA 3DSSA 2F0YA 4ANUA 4BERA 3HXEA 4R7LA 4UUCA 3V79K 1SZAA 4B93B 4FC8A 3FUHA 4PS8A 3E33A 4XI9A 5C1DA 1UJKA 1AWCB 4KVMA 4WWPA 3MV2B 4A3VA 3AS8A 1NP7A 3K9IA 3ZU7B 3QDNA 2GRRB 4JPSA 2LSVA 3PREA 4MLPA 3DXKG 3E34A 3RRMB 2YHEA 2ZXWE 3D9NA 2Y4TA 5A23A 1HFAA 4KVOA 1H19A 3MEKA 3LY7A 3D9PA 3RSEG 4N3CA 3FU6A 2ILRA 4APOA 1Q2ZA 5AAOA 2OEVA 4GYYA 4BX9A 3FH8A 3D9LA 3EUVA 3UT7A 2Q7FA 2V8SE 2CFZA 5EKQD 2P9IG 3FU3A 2WXIA 4RVBA 1TN7A 1S70B 3KS2A 3I4GA 4CT0A 4Y6CA 4AEZC 3RO2A 5ENQD 2OVFA 5T4YA 1OCZE 4JXTA 4DX5D 3LDZA 3SGHA 2LSUA 4HBDA 3HG0D 3FHEA 3U9WA 2KZTB 4BY6A 3QB2A 2L0TB 3TWRA 4RG6A 2LAHA 4X8QA 3PVLA 4DI4A 4EZLA 3OAWA 4CDNA 3O4ZA 3CVQA 3DPDA 4CRWA 3BUAA 4AV7A 4M3OA 3NOCD 3B7TA 4XKCA 4GU5A 1HH8A 3UM2A 5AENA 3PE3A 5ENPD 3HXDA 5CBOA 2WB2A 4TV3A 5AJDA 2KATA 2PNNA 3DSXA 3RRUA 3L22A 3CSFA 1IQUA 5LCWJ 5ENOD 1INZA 3JXJA 3ZXPA 4H7XA
chains in the Genus database with same CATH topology
2L6BA 2JABA 3NOGD 3UI2A 4JB8P 4DX7D 1IHBA 5CEAA 1N0QA 3AJIA 1DC2A 3J5PA 5CEDB 2B0OE 3EU9A 1MX6A 2F8XK 4DX2A 4Z68A 3DEPA 1BI7B 3V30A 1BD8A 3DEOA 4GPMA 4HRNA 3V31A 4DRXE 3F6QA 5KBAA 4ZHBA 1QYMA 4ATZD 1TR4A 4HLLA 3UXGA 4HQDA 4J8YA 5AAOA 2XEHA 5AQBA 4LSZE 3TWUA 3JUEA 2NYJA 1N11A 4F6RD 4RLYA 1MYOA 2XENA 4LG6A 4U8VD 2XEEA 2ZGDA 4HRLA 3TWXA 2Y0BG 2ETCA 3LJNA 5D66A 3V2XA 2XZTG 4G8KA 4C48B 1K1BA 2V5QC 4ZFHA 1IKND 1YMPA 2KXPC 3SO8A 4DX6D 4G8LA 5EIBE 4YDWA 3Q9UC 5KNGA 1MX4A 2VGEA 4O60A 3EHRA 1NFIE 3B7BA 2RFAA 4N5QA 5ENRD 5HKPA 2HE0A 1S70B 2ETBA 4CZ2D 3TWSA 4DX1A 3EHQA 3AAAC 3TWWA 5CECB 4U96D 1OY3D 4OAVB 5JA4D 3TWVA 5AARA 5JMND 5FINA 5ENQD 5ITZF 4HI8A 5KNHD 1YCSB 2DVWA 2F37A 2BKKB 4DX5D 1AP7A 2BKGA 1WG0A 5FIOA 3T8KA 3T9KA 1BLXB 4HBDA 3UTMA 2QYJA 3HG0D 3J5QB 5AQAA 3W9FA 1SW6A 4HB5A 4K5AB 2FO1E 1BU9A 5EYLA 3KEAA 5ENSD 3ZNGA 3TWRA 4BEPA 1A5EA 2MYOA 3B95A 3ZUVB 5KWDA 2Y1LE 3C5RA 4U8YD 1IXVA 4HRMB 3HRAA 3NBNB 2ZGGA 1UOHA 1D9SA 4K5BA 5BXUA 2A5EA 4LNUD 3TWTA 1MJ0A 2J8SD 2DZNA 2ETAA 4TUMA 1N0RA 4HNAD 2DWZA 5AQ7A 4HI9A 4BERA 4CYMD 5CERB 3NOCD 4UUCA 5AN8A 5EILA 5HRYA 5CBNA 3IXEA 2KBXA 5BXOA 5HS0A 4BSZB 4QFVA 4YDYA 5ENTD 3V79K 4B93B 2V4HC 4GMRA 5EYPF 2RFMA 4U95D 4F1PA 1SVXA 3TWQA 4DUIA 1AWCB 4O1OA 5ENPD 4J7WA 4BETA 5EIDA 3Q9NC 1MX2A 1K3ZD 5AQ9A 5CBOA 4K5CA 2DZOA 1BI8B 2P2CP 5EN5D 3ZKJA 4OAUC 2QC9A 4O1PA 2AJAA 1OT8A 1WDYA 3JXIA 2PNNA 3ZU7B 3W9GA 4A63B 2XZDG 1DCQA 1YYHA 1G3NB 4NIKA 3D9HA 4QQIA 5ENOD 3V2OA 2F8YA 3JXJA 1K1AA 4BESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6B A;  2JAB A;  3NOG D;  3UI2 A;  4JB8 P;  4DX7 D;  1IHB A;  5CEA A;  1N0Q A;  3AJI A;  1DC2 A;  3J5P A;  5CED B;  2B0O E;  3EU9 A;  1MX6 A;  2F8X K;  4DX2 A;  4Z68 A;  3DEP A;  1BI7 B;  3V30 A;  1BD8 A;  3DEO A;  4GPM A;  4HRN A;  3V31 A;  4DRX E;  3F6Q A;  5KBA A;  4ZHB A;  1QYM A;  4ATZ D;  1TR4 A;  4HLL A;  3UXG A;  4HQD A;  4J8Y A;  5AAO A;  2XEH A;  5AQB A;  4LSZ E;  3TWU A;  3JUE A;  2NYJ A;  1N11 A;  4F6R D;  4RLY A;  1MYO A;  2XEN A;  4LG6 A;  4U8V D;  2XEE A;  2ZGD A;  4HRL A;  3TWX A;  2Y0B G;  2ETC A;  3LJN A;  5D66 A;  3V2X A;  2XZT G;  4G8K A;  4C48 B;  1K1B A;  2V5Q C;  4ZFH A;  1IKN D;  1YMP A;  2KXP C;  3SO8 A;  4DX6 D;  4G8L A;  5EIB E;  4YDW A;  3Q9U C;  5KNG A;  1MX4 A;  2VGE A;  4O60 A;  3EHR A;  1NFI E;  3B7B A;  2RFA A;  4N5Q A;  5ENR D;  5HKP A;  2HE0 A;  1S70 B;  2ETB A;  4CZ2 D;  3TWS A;  4DX1 A;  3EHQ A;  3AAA C;  3TWW A;  5CEC B;  4U96 D;  1OY3 D;  4OAV B;  5JA4 D;  3TWV A;  5AAR A;  5JMN D;  5FIN A;  5ENQ D;  5ITZ F;  4HI8 A;  5KNH D;  1YCS B;  2DVW A;  2F37 A;  2BKK B;  4DX5 D;  1AP7 A;  2BKG A;  1WG0 A;  5FIO A;  3T8K A;  3T9K A;  1BLX B;  4HBD A;  3UTM A;  2QYJ A;  3HG0 D;  3J5Q B;  5AQA A;  3W9F A;  1SW6 A;  4HB5 A;  4K5A B;  2FO1 E;  1BU9 A;  5EYL A;  3KEA A;  5ENS D;  3ZNG A;  3TWR A;  4BEP A;  1A5E A;  2MYO A;  3B95 A;  3ZUV B;  5KWD A;  2Y1L E;  3C5R A;  4U8Y D;  1IXV A;  4HRM B;  3HRA A;  3NBN B;  2ZGG A;  1UOH A;  1D9S A;  4K5B A;  5BXU A;  2A5E A;  4LNU D;  3TWT A;  1MJ0 A;  2J8S D;  2DZN A;  2ETA A;  4TUM A;  1N0R A;  4HNA D;  2DWZ A;  5AQ7 A;  4HI9 A;  4BER A;  4CYM D;  5CER B;  3NOC D;  4UUC A;  5AN8 A;  5EIL A;  5HRY A;  5CBN A;  3IXE A;  2KBX A;  5BXO A;  5HS0 A;  4BSZ B;  4QFV A;  4YDY A;  5ENT D;  3V79 K;  4B93 B;  2V4H C;  4GMR A;  5EYP F;  2RFM A;  4U95 D;  4F1P A;  1SVX A;  3TWQ A;  4DUI A;  1AWC B;  4O1O A;  5ENP D;  4J7W A;  4BET A;  5EID A;  3Q9N C;  1MX2 A;  1K3Z D;  5AQ9 A;  5CBO A;  4K5C A;  2DZO A;  1BI8 B;  2P2C P;  5EN5 D;  3ZKJ A;  4OAU C;  2QC9 A;  4O1P A;  2AJA A;  1OT8 A;  1WDY A;  3JXI A;  2PNN A;  3ZU7 B;  3W9G A;  4A63 B;  2XZD G;  1DCQ A;  1YYH A;  1G3N B;  4NIK A;  3D9H A;  4QQI A;  5ENO D;  3V2O A;  2F8Y A;  3JXJ A;  1K1A A;  4BES A; 
#chains in the Genus database with same CATH topology
 3EHN A;  1U3C A;  3QAR A;  1JCR A;  2J4B A;  4FJZ A;  2P9S G;  3O48 A;  3ULQ A;  5HQ8 A;  1TR4 A;  1Z3Y A;  2V5F A;  3OXL A;  4I9E A;  3L54 A;  3UX4 A;  4G23 A;  3FEX A;  2L9B A;  4CT4 A;  2XZT G;  3NAW A;  5E75 A;  4U04 A;  4O60 A;  4BX8 A;  3KD7 A;  2E2E A;  5ENR D;  3QWV A;  2JEK A;  3D9M A;  3TWS A;  4I1M A;  4OAV B;  3HYM B;  2X6K A;  5C2Y A;  2KM4 A;  2KC7 A;  2ZU6 B;  4JW1 A;  1H6K A;  2CHZ A;  3CQC B;  2XS8 A;  3TWT A;  1MJ0 A;  3E4B A;  1SQM A;  2CHW A;  2WXP A;  5G04 J;  3PUJ A;  2XEV A;  1S64 A;  2EIK E;  3IXE A;  4G24 A;  4GMR A;  2X3M A;  1Y6I A;  1SVX A;  4IUL A;  4GTP A;  2KZT A;  3Q49 B;  2R59 A;  3CHO A;  1PY1 A;  5BV1 A;  3DXM G;  4I1A A;  1H6P A;  3VLF A;  4BTB A;  3BU8 A;  3ZYQ A;  2WQ7 A;  4IYP A;  2R17 C;  3FTW A;  2HO1 A;  4U7E B;  1BI7 B;  4DLO A;  3T5V A;  3V31 A;  4ANW A;  4HOT A;  2J09 A;  3U64 A;  4J8Y A;  3SNX A;  4PS3 A;  2BUG A;  4A1G A;  2ZGD A;  3CVL A;  3FTX A;  4NUR A;  4JEU A;  3CQG B;  1MX4 A;  4FHK A;  2AWI A;  2L0I A;  4N5Q A;  1TNB A;  2OND A;  3EHQ A;  3SBT B;  3R7R A;  3C98 A;  4GTR A;  4U96 D;  3MA5 A;  4O6F A;  3ZW3 A;  1TYQ G;  1UW4 B;  1E96 B;  4K5A B;  4HB5 A;  1KT0 A;  4GTM A;  1HXI A;  2EIM E;  4BWR A;  5KWD A;  1H6O A;  3X2Q E;  2A5E A;  4HOS A;  2XHE A;  4CGW A;  2WXJ A;  4HNA D;  5CER B;  3LVQ E;  3FUI A;  2X6J A;  3CV0 A;  1IHG A;  2VYI A;  4XZ4 A;  3ASF A;  1OWO A;  1QZ2 A;  2XCB A;  1RZ4 A;  3ONK A;  5JJ7 A;  5KJN A;  3U66 A;  3TJP A;  2CFU A;  3RIB A;  3ML8 A;  2DYR E;  2F8Y A;  1LF8 A;  2WXF A;  4B8C B;  3IV0 A;  2L6J A;  4ACK A;  1QYM A;  3BQO A;  3RAU A;  1E8Z A;  1NZN A;  1OWM A;  1H2V C;  2ETC A;  3I4R B;  3FY4 A;  2QZA A;  4GPK A;  3Q9U C;  2IO3 C;  2P9L G;  1LD7 A;  5BNW A;  2IOS A;  3I5P A;  2WXO A;  3D9I A;  1RW2 A;  1NL4 A;  3CVP A;  3UM3 A;  3ABL E;  4C0E A;  4EBA A;  3DWL G;  3CVW A;  2NXP A;  5CRV A;  3MKQ B;  3Q15 A;  4WWN A;  4U8H A;  4GCO A;  3RKV A;  2J9Q A;  2Y1L E;  4AY6 A;  4ANV A;  4GAA A;  3C3R A;  2J8S D;  3UUX A;  1N9A A;  2J07 A;  3DSV A;  3SFZ A;  4JA9 A;  3PZ4 A;  5EID A;  4BSX A;  5JJT A;  5CHE E;  3DSW A;  3W9G A;  4A63 B;  3JUI A;  3D9H A;  4QQI A;  1NA0 A;  1YA0 A;  4MBG A;  2KCV A;  3APC A;  3L9T A;  3MV3 B;  4FLH A;  5B1B E;  3DEP A;  1FVH A;  1HE8 A;  3L6A A;  3DEO A;  1U2V G;  4ZHB A;  5AJL A;  4OVV A;  1E8W A;  2OOE A;  3C3Q A;  4HRL A;  2Y0B G;  2QY7 A;  1FVF A;  1EYH A;  3QNK A;  2AXU A;  3SO8 A;  2XS1 A;  4DX6 D;  4G25 A;  4JHJ A;  5LX8 A;  3OTN A;  1SA5 A;  3SFY A;  1BPO A;  3FUJ A;  4JA7 A;  5CEC B;  1OY3 D;  3G2W A;  4HLE A;  3JQ1 A;  1ELW A;  1K8K G;  4URK A;  4F1S A;  4B94 A;  3CK9 A;  4KZ0 A;  3ZIM A;  3RJV A;  4I6G A;  1JWF A;  3TG5 A;  1A5E A;  4L23 A;  5BPP A;  1OWP A;  5FZS A;  3AG4 E;  4BT8 A;  2J49 A;  4GMJ A;  3LY8 A;  3AG3 E;  2YQ8 A;  3AG2 E;  3RRN B;  4LUN U;  2WXN A;  4U95 D;  4YDO A;  4JZY A;  3HXF A;  2AVP A;  5AYW D;  3MKQ A;  4U0U A;  2I2O A;  4C9B B;  1BI8 B;  4WNG A;  5CCL A;  4XE0 A;  5G05 J;  4GML A;  4UI9 J;  1TNU A;  1K1A A;  1V55 E;  3JYS A;  4PDX A;  3HIZ A;  3UI2 A;  4U63 A;  1N0Q A;  2WXQ A;  2GRO B;  4DX2 A;  1A17 A;  2VTB B;  4DPR A;  5AIJ A;  1TN6 A;  1D8E A;  3LXU X;  1Z6T A;  5KBA A;  3LCA A;  3ASH A;  3FUF A;  3B7R L;  4L7T A;  3ZEF A;  2KCK A;  4GTT A;  3PH0 C;  4KBQ A;  4F6R D;  3ZYK A;  1HG2 A;  3C72 A;  3FEY A;  2C2L A;  2HR2 A;  3G2U A;  5EIB E;  3CLJ A;  4A1S A;  4YDW A;  3D9O A;  1NFI E;  3FDH A;  3C3O A;  3R9M A;  2EQX A;  1TNO A;  4A55 A;  3LY9 A;  1KPS B;  4HVB A;  3AU4 A;  3TWV A;  2H6I A;  5FIO A;  1E8X A;  4WNF A;  2UY1 B;  3ONL A;  2QYU A;  2XRY A;  2HM8 A;  4CGV A;  3CEQ A;  4K5B A;  5BXU A;  4G1T A;  3DBS A;  3E30 A;  3L17 A;  2H6G A;  4CYM D;  5EIL A;  1UJJ A;  3LPZ A;  2YHC A;  4C0M A;  1LTX A;  5FZQ A;  2V4H C;  2X6I A;  4O1O A;  4BET A;  4J7W A;  1HU3 A;  2VQ2 A;  2VSY A;  3GW4 A;  4K5C A;  3ZKJ A;  2UWJ G;  2ZIS A;  3G2T A;  3UIO C;  3SD5 A;  1IQR A;  3ULE G;  1ZU2 A;  4AP2 A;  1Z3X A;  1FPP A;  4JB8 P;  4WWO A;  4AJW A;  4B89 A;  4XEI G;  1MX6 A;  3ML9 A;  5A6C A;  4JC8 A;  4M7C A;  3F6Q A;  4L2Y A;  3RO3 A;  4EQF A;  3ZYM A;  2EIJ E;  5FZR A;  4BTA A;  4FUL A;  1KLX A;  2DYS E;  5FWQ A;  2V5Q C;  4AVX A;  1YMP A;  3ABM E;  2KXP C;  1DVP A;  2P9N G;  3EIJ A;  2RG8 A;  1FT1 A;  2CHX A;  4IN3 B;  5ANL A;  1FT2 A;  4N2S A;  3S7J A;  1IYG A;  3TWW A;  1ZBP A;  3TGO A;  2R02 A;  1QQE A;  5JA4 D;  1JWG A;  5JMN D;  2R03 A;  2Y4U A;  1JCS A;  4FU3 A;  4FLB A;  1BLX B;  4OYS A;  5ENS D;  3QJZ A;  4FAD A;  3ENE A;  1E7U A;  3WG7 E;  5D0O D;  1EF1 C;  3HRA A;  4UWK A;  4I6J A;  5KJM A;  2DWZ A;  4XX5 A;  3SBS A;  5AN8 A;  1JCQ A;  3UMV A;  2A5U A;  2VGX B;  2IO2 C;  5EYP F;  3CVX A;  2WMO A;  3ABK E;  1O1S A;  3P1U A;  4GTO A;  2UY1 A;  2DZO A;  3HXB A;  2V4L A;  3BG0 B;  4AY5 A;  4I1O B;  4L9P A;  3FP3 A;  4N2Q A;  3FU0 A;  1IHB A;  4D10 C;  4BFR A;  3UT4 A;  3S7D A;  1JPL A;  4TXP A;  5M72 A;  3U3W A;  3DSU A;  4XIF A;  4FA6 A;  3I3N A;  1OWN A;  2GW1 A;  3BEE A;  4GZ5 A;  3TXM A;  4Q69 A;  5KJL A;  3CVN A;  2I9C A;  3LS8 A;  2IEJ A;  3CVY A;  5LCW C;  3HVE B;  5B3S E;  3UQ3 A;  3L08 A;  5IY5 E;  3SFX A;  4WAF A;  3AS5 A;  3PZ1 A;  3TL5 A;  4NRH B;  4HI8 A;  3CK8 A;  2BKK B;  1W3B A;  2QYJ A;  3NF1 A;  4UWH A;  1BU9 A;  5CCM A;  4WND A;  2OCC E;  4GA1 A;  3ZUV B;  1ZB1 A;  3C5R A;  3CVU A;  1UOH A;  1D9S A;  4TUU A;  2LXL A;  4TUM A;  2MHK A;  3Q75 A;  3MZL B;  5BXO A;  4GZC A;  3ZRH A;  2I6H A;  1S0P A;  2XCC A;  4JHK A;  3VTX A;  3PEV B;  3QOU A;  2Y3A A;  1MX2 A;  4JL0 A;  1DNP A;  1SA4 A;  4NQ0 A;  2AJA A;  3FFL A;  3NZU A;  3CKB A;  2WMN A;  2PQN A;  2LXM A;  2JAB A;  5G04 C;  4UWL A;  2PL2 A;  4MKT A;  2VGX A;  4HFG A;  2GRL A;  2OV8 A;  3NQP A;  1XGW A;  3CK7 A;  3UIP C;  2C0M A;  4MRU A;  1TJC A;  3UKU G;  3WXX A;  4ANX A;  3L16 A;  3PUK A;  3PS6 A;  3QK0 A;  1OWL A;  2OVB A;  4GTQ A;  1AP7 A;  1WG0 A;  3BG1 B;  3UTM A;  1SZ9 A;  4AIF A;  2FO1 E;  4AM9 A;  4L1B A;  5CMY A;  3ZNG A;  4EZK A;  2I1J A;  4HS2 A;  4FP7 A;  2B6C A;  4N39 A;  3LYA A;  3FTZ A;  4CDR A;  3LKU A;  1KZO A;  3MYV A;  4GB9 A;  1P5Q A;  1GW6 A;  4MS6 A;  1MZC A;  3UT8 A;  1JUQ A;  1E8Y A;  4CCA A;  2A4Z A;  3PZ2 A;  1K3Z D;  5AQ9 A;  4O1P A;  3PZ3 A;  3JQ0 A;  3MX3 A;  4GCN A;  3NOG D;  2EIL E;  2ION A;  3Q5M A;  4L2L A;  5FQ4 A;  1O5M A;  3FTU A;  1H2T C;  1HX8 A;  4HRN A;  2XEH A;  3GYZ A;  3TWU A;  5FT9 A;  3FTY A;  4K03 A;  2XEE A;  2MRI A;  2FUL A;  1N4S A;  2XPY A;  3ESL A;  2WQH A;  4TRQ A;  1HZ4 A;  3VLD A;  3S2A A;  4LRZ A;  1TNZ A;  2HE0 A;  4ATG A;  1TN8 A;  2C0L A;  2AW6 A;  3E32 A;  5FIN A;  2MOW A;  2XPZ A;  4JVS A;  3T8K A;  3T9K A;  4KYO B;  5LP0 A;  4LER A;  2EIN E;  3FUD A;  4JEH A;  3NBN B;  2ZGG A;  4PS7 A;  2IU1 A;  3IEG A;  3TG4 A;  5HI7 A;  2VSX E;  5AQ7 A;  3KSQ A;  2AXV A;  5CRU A;  1WAO 1;  4YND A;  4IRU A;  2R2L A;  3SY2 A;  4BSZ B;  2WVI A;  4QFV A;  1MQS A;  3CHS A;  3G2V A;  2RFM A;  1O1R A;  1V54 E;  2LAI A;  2VGY A;  3TWQ A;  2WXL A;  5KCM A;  5EN5 D;  1N52 A;  3DST A;  5T3R A;  1YYH A;  4EHM A;  5E76 A;  2L6B A;  1OCO E;  1FCH A;  2IY0 C;  1QNF A;  3ASD A;  3ZYL A;  1EPU A;  4GPM A;  2BTD A;  4ATZ D;  3UXG A;  2P9P G;  3ZHE B;  1WM5 A;  3SQV A;  4LSZ E;  1D8D A;  4LNB A;  1MYO A;  3CVV A;  4U8V D;  2DBA A;  4I2Z A;  3TWX A;  4C48 B;  3RU0 A;  4Q94 A;  4ZFH A;  3CKC A;  2E0I A;  3EHM A;  1ELR A;  4XKB A;  5BUZ A;  3D3M A;  4ILH B;  2IQC A;  1NI1 A;  3APF A;  3HXC A;  4WNE A;  3ASG A;  3KEZ A;  3EIQ C;  5KNH D;  1YCS B;  4H7Y A;  1NA3 A;  1VDY A;  3PRZ A;  5B1A E;  2H6H A;  5BT1 A;  2VSN A;  5FTP A;  3UKR G;  1UN9 A;  3FU5 A;  4NAC A;  3VTY A;  2WXH A;  4HRM B;  2DZN A;  3OXF A;  4BT9 A;  1HO8 A;  5T8I A;  3T5X A;  1E90 A;  2FI7 A;  4B8A A;  5ENT D;  3RK6 A;  2WQ6 A;  4AXH A;  2GRP B;  2P9U G;  4P29 A;  3Q9N C;  3PNT B;  4EBA G;  3IHY A;  4PH4 B;  4OAU C;  5LOZ A;  3MCX A;  1KT1 A;  3CST A;  4DJA A;  3V2O A;  3FUN A;  3UIN C;  4ME2 A;  2FF4 A;  3CR3 A;  4YDE A;  2LO6 A;  4U0Z A;  2B0O E;  3EU9 A;  4Z68 A;  3OXG A;  3CHM A;  4F53 A;  2CG3 A;  3SI5 A;  5J90 A;  4GTV A;  2NYJ A;  1N11 A;  3CIA A;  3UM1 A;  5G05 C;  1H0A A;  3V2X A;  3PE4 A;  4G8K A;  4B0Z A;  4UI9 C;  3IHV A;  4KZC A;  3Q79 A;  2FEZ A;  2J08 A;  2IF4 A;  3L13 A;  5D2M C;  1DCE A;  4CZ2 D;  4DX1 A;  3AAA C;  4OVU A;  2WM9 A;  3ZHE A;  4J8F A;  1UG3 A;  3W9F A;  4HOU A;  1OUV A;  4G2V A;  3EU5 A;  4BEP A;  4J8S A;  3B95 A;  3DPY A;  3SHF A;  5DBK A;  4LNU D;  2FO7 A;  2VTB A;  2R05 A;  3FUL A;  4YDY A;  3R7Q A;  4GYO A;  2XPI A;  2JLB A;  4GZ3 A;  1QBQ A;  2GRN B;  2QC9 A;  1N95 A;  3PEU B;  2H6F A;  3ASN E;  4NIK A;  2PM7 A;  3S7F A;  5FJY A;  1PAQ A;  3Q73 A;  5JJ6 A;  3DRA A;  2DIW A;  3J5P A;  5CED B;  3N71 A;  3ZVV A;  3CHQ A;  4ILI A;  3MGB A;  3B13 A;  4DRX E;  2IOL A;  5FQ6 A;  4HLL A;  3ZGQ A;  5LFA A;  3QAQ A;  2X38 A;  1N4R A;  5J08 A;  4LG6 A;  4G26 A;  3FUM A;  1WY6 A;  2RD0 A;  4DI3 A;  2VGE A;  3S7B A;  3B7B A;  2ZIR A;  5G2N A;  2RFA A;  4YVQ C;  2GRM A;  4U07 A;  3FTV A;  4ABN A;  2P9K G;  5EDS A;  1S63 A;  2DVW A;  3APD A;  2LUH A;  2PQR A;  4UQX A;  4LEU A;  5G55 A;  3KEA A;  3FTS A;  3EJN A;  3U4T A;  4PUC A;  4RSY A;  4U8Y D;  4GA2 A;  4UWF A;  1Y8M A;  1HS6 A;  3QC1 A;  3FUK A;  4GTS A;  2ETA A;  1Z5S C;  4J0U A;  4UQY A;  3L82 A;  4HOQ A;  3TAX A;  3LJ3 A;  4K0R A;  3EDT B;  4JHR A;  3B7U X;  3TXN A;  5FQ8 A;  5DIZ A;  4N3B A;  1H2U A;  3CHP A;  2XGM A;  4ACL A;  3MJW A;  2XZD G;  1DCQ A;  5H7P A;  4DK5 A;  2NC9 A;  3AS4 A;  2BED A;  5KJK A;  1OXJ A;  3ASO E;  3AJI A;  3PDN A;  4KMO A;  1OCR E;  2YIN A;  3Q47 B;  2YNQ A;  4Y6W A;  3QWP A;  2KCL A;  3HHM A;  5AQB A;  4J6I A;  3ZXS A;  2XEN A;  2IFU A;  1MHQ A;  5D66 A;  1B89 A;  1K1B A;  3SF4 A;  4FJY A;  4U0S A;  1X81 A;  4YVO A;  4UQZ A;  3NZS A;  3HDX A;  2GRQ B;  3EHR A;  5HKP A;  3E37 A;  3IKO B;  3JCK C;  1L5J A;  4DLQ A;  2BKG A;  3J5Q B;  2VSO E;  5EYL A;  2CG2 A;  4G11 A;  2RKK A;  2BF0 X;  2MYO A;  2WXK A;  2X6F A;  4CEM A;  3GZ1 A;  5EX3 A;  2WXM A;  2FBN A;  2DCP A;  2X6H A;  5HRY A;  1HG5 A;  1N4Q A;  2R5S A;  4F7A A;  4LNG A;  4F1P A;  5BW8 C;  4DUI A;  3FUE A;  1TNY A;  2IJG X;  1UN8 A;  2P2C P;  3QWW A;  4HXI A;  1OT8 A;  3HVE A;  3ZN3 A;  3JXI A;  1U3D A;  1HF8 A;  4APF A;  3CHR A;  3FH5 A;  2M63 A;  2PZI A;  3KAE A;  4DX7 D;  5CEA A;  3UPV A;  4I43 A;  1N94 A;  2F8X K;  2P58 C;  3QKY A;  2HYZ A;  1N4P A;  1E7V A;  1O1T A;  2GGF A;  4TXQ A;  5D0Q D;  4W9R A;  5JHA A;  4KT6 B;  3G2S A;  4N5C A;  1PC2 A;  4RLY A;  2I1K A;  4UI9 K;  3T8M A;  4I2W A;  1IKN D;  3AU5 A;  4GZ6 A;  3NB2 A;  2ETB A;  3MKR A;  5JHB A;  5ANR A;  2LNI A;  4J8E A;  5AAR A;  4CDM A;  5ITZ F;  4Q96 A;  2J4D A;  2F37 A;  2WXR A;  3D9J A;  5ENN A;  1ELK A;  4I9C A;  3PZD A;  3ZPJ A;  1LD8 A;  4GZD A;  2XGO A;  3IBE A;  2XGS A;  2VJ8 A;  4RQI A;  5FQ7 A;  1TJF A;  1N0R A;  4HI9 A;  2AXZ A;  3ESK A;  3ISM C;  5CBN A;  2KBX A;  1KZP A;  5HS0 A;  1N54 A;  4HOR A;  5CMW A;  3ZFW A;  2NSZ A;  4I17 A;  5ARG A;  4E85 A;  5EX0 A;  4EZJ A;  4UWG A;  4LCT A;  3GZS A;  1WDY A;  2QFC A;  3Q7F A;  4E6H A;  4A3T A;  1G3N B;  1OCC E;  4N3A A;  3P2B A;  2V0P A;  4BES A;  2WPV A;  4EPZ A;  3KSL A;  3ULY A;  1DC2 A;  3FH7 A;  1EDU A;  3VLE A;  4GYW A;  4ILG A;  4GA0 A;  3V30 A;  1BD8 A;  4I6E A;  2WXG A;  4HQD A;  3Q4A B;  3JUE A;  3Q78 A;  4AOF A;  2Y69 E;  3LJN A;  4J8D A;  4EEC A;  4G8L A;  1TEZ A;  4FHJ A;  3SZ7 A;  3LEW A;  5KNG A;  1XNF A;  4RG9 A;  5ARF A;  3FWV A;  5A7D B;  1X5B A;  4WUY A;  3LVR E;  3GZ2 A;  4TXR A;  2OEW A;  4XI0 A;  2XRZ A;  2XQ0 A;  3PNL B;  3R9A B;  3URZ A;  3UM0 A;  4KXK B;  4V3I A;  3B7S A;  2PM6 A;  5BV0 A;  5AQA A;  1SW6 A;  4JD2 G;  3Q7A A;  4F3V A;  3CGH A;  3AG1 E;  3D9K A;  1IXV A;  3DSS A;  2F0Y A;  4ANU A;  4BER A;  3HXE A;  4R7L A;  4UUC A;  3V79 K;  1SZA A;  4B93 B;  4FC8 A;  3FUH A;  4PS8 A;  3E33 A;  4XI9 A;  5C1D A;  1UJK A;  1AWC B;  4KVM A;  4WWP A;  3MV2 B;  4A3V A;  3AS8 A;  1NP7 A;  3K9I A;  3ZU7 B;  3QDN A;  2GRR B;  4JPS A;  2LSV A;  3PRE A;  4MLP A;  3DXK G;  3E34 A;  3RRM B;  2YHE A;  2ZXW E;  3D9N A;  2Y4T A;  5A23 A;  1HFA A;  4KVO A;  1H19 A;  3MEK A;  3LY7 A;  3D9P A;  3RSE G;  4N3C A;  3FU6 A;  2ILR A;  4APO A;  1Q2Z A;  5AAO A;  2OEV A;  4GYY A;  4BX9 A;  3FH8 A;  3D9L A;  3EUV A;  3UT7 A;  2Q7F A;  2V8S E;  2CFZ A;  5EKQ D;  2P9I G;  3FU3 A;  2WXI A;  4RVB A;  1TN7 A;  1S70 B;  3KS2 A;  3I4G A;  4CT0 A;  4Y6C A;  4AEZ C;  3RO2 A;  5ENQ D;  2OVF A;  5T4Y A;  1OCZ E;  4JXT A;  4DX5 D;  3LDZ A;  3SGH A;  2LSU A;  4HBD A;  3HG0 D;  3FHE A;  3U9W A;  2KZT B;  4BY6 A;  3QB2 A;  2L0T B;  3TWR A;  4RG6 A;  2LAH A;  4X8Q A;  3PVL A;  4DI4 A;  4EZL A;  3OAW A;  4CDN A;  3O4Z A;  3CVQ A;  3DPD A;  4CRW A;  3BUA A;  4AV7 A;  4M3O A;  3NOC D;  3B7T A;  4XKC A;  4GU5 A;  1HH8 A;  3UM2 A;  5AEN A;  3PE3 A;  5ENP D;  3HXD A;  5CBO A;  2WB2 A;  4TV3 A;  5AJD A;  2KAT A;  2PNN A;  3DSX A;  3RRU A;  3L22 A;  3CSF A;  1IQU A;  5LCW J;  5ENO D;  1INZ A;  3JXJ A;  3ZXP A;  4H7X A; 
#chains in the Genus database with same CATH homology
 2L6B A;  2JAB A;  3NOG D;  3UI2 A;  4JB8 P;  4DX7 D;  1IHB A;  5CEA A;  1N0Q A;  3AJI A;  1DC2 A;  3J5P A;  5CED B;  2B0O E;  3EU9 A;  1MX6 A;  2F8X K;  4DX2 A;  4Z68 A;  3DEP A;  1BI7 B;  3V30 A;  1BD8 A;  3DEO A;  4GPM A;  4HRN A;  3V31 A;  4DRX E;  3F6Q A;  5KBA A;  4ZHB A;  1QYM A;  4ATZ D;  1TR4 A;  4HLL A;  3UXG A;  4HQD A;  4J8Y A;  5AAO A;  2XEH A;  5AQB A;  4LSZ E;  3TWU A;  3JUE A;  2NYJ A;  1N11 A;  4F6R D;  4RLY A;  1MYO A;  2XEN A;  4LG6 A;  4U8V D;  2XEE A;  2ZGD A;  4HRL A;  3TWX A;  2Y0B G;  2ETC A;  3LJN A;  5D66 A;  3V2X A;  2XZT G;  4G8K A;  4C48 B;  1K1B A;  2V5Q C;  4ZFH A;  1IKN D;  1YMP A;  2KXP C;  3SO8 A;  4DX6 D;  4G8L A;  5EIB E;  4YDW A;  3Q9U C;  5KNG A;  1MX4 A;  2VGE A;  4O60 A;  3EHR A;  1NFI E;  3B7B A;  2RFA A;  4N5Q A;  5ENR D;  5HKP A;  2HE0 A;  1S70 B;  2ETB A;  4CZ2 D;  3TWS A;  4DX1 A;  3EHQ A;  3AAA C;  3TWW A;  5CEC B;  4U96 D;  1OY3 D;  4OAV B;  5JA4 D;  3TWV A;  5AAR A;  5JMN D;  5FIN A;  5ENQ D;  5ITZ F;  4HI8 A;  5KNH D;  1YCS B;  2DVW A;  2F37 A;  2BKK B;  4DX5 D;  1AP7 A;  2BKG A;  1WG0 A;  5FIO A;  3T8K A;  3T9K A;  1BLX B;  4HBD A;  3UTM A;  2QYJ A;  3HG0 D;  3J5Q B;  5AQA A;  3W9F A;  1SW6 A;  4HB5 A;  4K5A B;  2FO1 E;  1BU9 A;  5EYL A;  3KEA A;  5ENS D;  3ZNG A;  3TWR A;  4BEP A;  1A5E A;  2MYO A;  3B95 A;  3ZUV B;  5KWD A;  2Y1L E;  3C5R A;  4U8Y D;  1IXV A;  4HRM B;  3HRA A;  3NBN B;  2ZGG A;  1UOH A;  1D9S A;  4K5B A;  5BXU A;  2A5E A;  4LNU D;  3TWT A;  1MJ0 A;  2J8S D;  2DZN A;  2ETA A;  4TUM A;  1N0R A;  4HNA D;  2DWZ A;  5AQ7 A;  4HI9 A;  4BER A;  4CYM D;  5CER B;  3NOC D;  4UUC A;  5AN8 A;  5EIL A;  5HRY A;  5CBN A;  3IXE A;  2KBX A;  5BXO A;  5HS0 A;  4BSZ B;  4QFV A;  4YDY A;  5ENT D;  3V79 K;  4B93 B;  2V4H C;  4GMR A;  5EYP F;  2RFM A;  4U95 D;  4F1P A;  1SVX A;  3TWQ A;  4DUI A;  1AWC B;  4O1O A;  5ENP D;  4J7W A;  4BET A;  5EID A;  3Q9N C;  1MX2 A;  1K3Z D;  5AQ9 A;  5CBO A;  4K5C A;  2DZO A;  1BI8 B;  2P2C P;  5EN5 D;  3ZKJ A;  4OAU C;  2QC9 A;  4O1P A;  2AJA A;  1OT8 A;  1WDY A;  3JXI A;  2PNN A;  3ZU7 B;  3W9G A;  4A63 B;  2XZD G;  1DCQ A;  1YYH A;  1G3N B;  4NIK A;  3D9H A;  4QQI A;  5ENO D;  3V2O A;  2F8Y A;  3JXJ A;  1K1A A;  4BES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...