5EYPB

Tubulin-darpin complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
431
structure length
425
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
molecule tags Cell cycle
source organism Synthetic construct
publication title Destabilizing an interacting motif strengthens the association of a designed ankyrin repeat protein with tubulin.
pubmed doi rcsb
total genus 178
structure length 425
sequence length 431
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5eypB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5eypB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5eypB01
3HKCA 4B46A 4X1KB 4FFBA 3N2KB 3ZBPA 4I4TB 3CB2A 4ZI7A 5CB4A 3HKBA 2GVIA 1JFFB 3C8LA 4I50B 3RYFA 3RB8A 3UT5B 4I55B 5JCOA 3RYCA 5GONA 4DRXB 3V3TA 5J2TB 4TUYB 5CA0B 4EB6A 1TUBB 4ZOLA 5LOVB 2RHJA 1RQ2A 3JALB 5EZYA 3RYHB 4LNUA 3N2GA 1Z5WA 5C8YB 5C8YA 3HKEB 3N2GB 5JQGA 5LYJB 5ITZB 2R751 5JH7A 1TUBA 3E22A 4ZOLB 5J2TA 3JASA 5EYPA 4E6EA 3RYCB 5CA1B 4O2BA 4U3JA 3HKDB 2XKBA 1SA0A 3HKDA 2VAMA 4O4JA 3WGNA 3R4VA 5CB4B 3JASB 3JAKA 5EYPB 1W5EA 3RYIB 3M8KA 4I4TA 2VAWA 3E22B 4YJ3B 5IJ9B 5JVDB 5IYZB 5LYJA 5JQGB 5IJ0B 5MN6A 3HKCB 1W5FA 5IJ0A 5EIBD 4F6RA 3WGJA 5LOVA 4YJ3A 5CA0A 4HNAA 4O4HA 1Z5VA 4O4LA 3JAKB 4TUYA 1W581 3VOBA 5GONB 4O4JB 5LP6C 4WBNA 3M89A 3UT5A 4U39A 2VXYA 3RYFB 2XKAA 1SA0B 4I50A 2BTOA 5CA1A 4WBNB 1FFXA 3JARA 3ZIDA 4ZI7B 5MN5A 5JH7B 4F6RB 4FFBB 3HKEA 3VOAA 4LNUB 5IYZA 5JVDA 2RHHA 5IJ9A 4X20A 4YJ2A 4EB6B 3WGKA 3RYIA 4B45A 4DXDA 3VO9A 4EI9A 5EIBC 2Q1YA 4DRXA 1W5AA 4I55A 5J2UB 4IHJB 3JATB 1JFFA 4O2BB 4U3JB 5JCOC 3WGMA 5M7EA 3HKBB 2RHOA 2VAPA 5KX5A 1TVKB 5LXTA 5ITZA 4EI7A 5BMVB 4X1KA 4O2AB 5KMGB 3JALA 5EZYB 3RYHA 4TV9A 4TV9B 1FSZA 4IIJB 4O2AA 1OFUA 5FNVB 1RQ7A 4M8IA 5BMVA 4EI8A 3JAWA 1W5BA 4XCQA 4X1IA 1TVKA 5LXTB 4O4IA 4TV8A 5LA6B 5KX5B 3WGLA 2R6R1 5LP6B 3JARB 1FFXB 4X1YB 4X1YA 4ZHQB 4ZHQA 2Q1XA 5LP6A 3JATA 4IHJA 4O4IB 3N2KA 4TV8B 5LA6A 5J2UA 1W59A 4X1IB 3VO8A 3ZBQA 4KWEA 3JAWB 1RLUA 3VPAA 5FNVA 4HNAB 4O4HB 4IIJA 2BTQA 4O4LB 4YJ2B 4X20B 2RHLA 5MN4A 5KMGA 2BTQB
chains in the Genus database with same CATH superfamily
4PYOA 4G4VA 1AI7A 2WABA 3D4BA 1BQZA 3C39A 1XDSA 1LD3A 5FPSA 3ZU2A 3B7GA 3RFCA 1IIBA 2KS6A 4RY0A 3VU9B 2V45A 1C41A 5AKJA 1L0NH 1U99A 1UP6A 3A9RA 2AE1A 2Z1TA 2H0QA 2FMFA 3ZR4B 2NXNA 4AECA 2ZSHA 1JHYA 1LLQA 4ENPA 5K0JA 1MHPA 1X7DA 4ZMRA 4ZKIA 2IYEA 2AD5A 4GBJA 1AVMA 3RLIA 3CKLA 5IYCO 2QLFA 2ZU6A 4O0MA 3RV3A 5JSZB 1PWEA 3KELA 5E4FA 2J48A 2DJ5A 3DFIA 2FR1A 1MLDA 4RXTA 5AJXA 1FDOA 1ZIYA 3M82A 4ID3A 4Y2VA 1BDIA 5HY0A 3I2JA 4KQWA 3IESA 3IVRA 1W9MA 2PGOA 5KKAA 2FUEA 1TIKA 3ETHA 2O14A 2XUHA 4PQRA 1D0IA 4BNIA 5JQWA 2HJWA 3EGWA 3BMNA 3CX8A 3T8YA 1XJ5A 2WTXA 1AB3A 1FNMA 4XLTA 3TNLA 3FPGA 3KHKA 4B7ZA 1W0JD 3SPIA 1REQB 5C7LO 1GHTA 1GQ2A 1XXHE 3QFCA 4LOHA 1ZP6A 4E3WA 4GYWA 3B6KA 4O2LA 3NOXA 4DWWA 1M2OA 2I7TA 4KAFA 2VBGA 2ZBEA 5KQRA 2B34A 1E2IA 4HGOA 4K1LA 3S2EA 3ITNA 3SEQA 2AC2A 1TO1E 4TMWA 3W4IA 1I30A 3DBHA 4I50F 3L06A 4UUOA 4PSVA 1OB5A 1NOIA 5CU7A 1QRUA 5JRDS 4P7FA 3ZZ0A 1I6LA 2BGRA 4J0CA 3I61A 4WA7A 1E79A 1VF5B 4JEMA 5T8KC 1EJ2A 1SKUA 4Q1VA 5GQSA 3UWOA 5EXXA 4H60A 4JP1A 2IHVA 3VVLA 4AROA 3AR3A 4KRGA 4C4TA 2W42A 3W5AA 1PT8A 4GQAA 1U8XX 3PBKA 4B3RO 2YV4A 3BG5A 5I4KA 4EABA 4ZVTA 2X7RB 2ZS9A 1NLUA 4DYVA 4EAQA 2KBFA 2O8VA 2FPXA 5DGTA 5B6IA 1E5DA 2BEWB 3AESA 1GNSA 4UHHA 3NXKA 4V0QA 4GUAA 3VC2A 5C0OE 3SS8A 1MVLA 4DJAA 1YUBA 2QTZA 2H4FA 3MOSA 2CV0A 1CK2A 2WHPA 3PAFA 1VPEA 1UQTA 1Q3EA 1FLNA 4UQLA 5T3UA 2J1LA 3RR2A 2NT3A 2XLCA 2V7BA 3SOZA 3EMBA 5TIIA 4MQ5A 1HNNA 2H4WA 4M0UA 2BFDA 2RN9A 5EMKA 4B2IA 2P11A 3D7LA 3PL5A 3UCEA 3TETA 3JY6A 3TTVA 1FTQA 4YFVA 3RIHA 5HY4A 5CNJA 2FLWA 2ZQYA 3KPVA 4GOND 3ZK9A 3HXPA 2R8YA 1Z74A 1VRWA 2V0GA 3F3YA 3K58A 1IBMO 4UB6Z 5EP2A 4FKZA 2LVBA 4O4JF 1FW6A 2JJ8A 2YSUB 1CF2O 2VWKA 4P38A 4Q47A 3AFMA 4F7WA 2X8JA 2W2LD 2ZT7A 1T1EA 1YC2A 3OLXA 2JBAA 3O0TA 2J6IA 1WA8A 1QHNA 3N0RA 1KWGA 2ZWPA 4KRFA 1YI2V 4YXFA 3KSZO 1L7VC 4FEAA 3PT9A 1JHMA 1XHFA 3BJEA 4H08A 1TEVA 4F38A 2IX9A 1QD9A 1M67A 2LZ0A 4QVIA 3SJUA 1BX1A 2K1EA 3AGPA 1Z6ZA 1ZHHA 3MK31 3DNFA 3FAVB 4XDYA 2Y48A 1Z6YA 4GO1A 3BTVA 1DBPA 1G17A 1DPGA 3C3XA 3IP6A 4N12A 4YJ2B 2LFSA 4N03A 4ZAZA 1JECA 4DXAA 3VVCA 3U1BA 3LWRC 4DSOA 3STVA 2YI9A 1YBAA 1R6UA 4C4WC 2XJ4A 1SCUB 2XMRA 1G1MA 1GQYA 3B5JA 1TVCA 3GCGA 4OQLA 2GZSA 4HNVA 3PXDA 5EHIA 1XLTC 1H48A 1V6CA 4EX6A 3N1UA 2QXTA 2EILC 1E1QG 2QRKA 3DDUA 3DTVD 1OA1A 2WIAA 3HHEA 3P71T 4GS5A 5DHTA 4JODA 4YRZA 1FE8A 1GZ3A 4QBKA 1FXUA 5CITA 3Q8KA 2IYAA 1P29A 5DBEX 5JMWA 1CEXA 3FKQA 3HS3A 3O1IC 3O83A 5H68A 1JMKC 1X7PA 2O3RA 1AQIA 2IUYA 1UR5A 4HDSA 1G6HA 3A26A 3SLKA 3B3FA 1NBWB 3DEFA 3PQ8A 3L7LA 3CEMA 1FQWA 3WBFA 4A8PA 2DG2A 3DOUA 5EKUA 3SD7A 1ZUD1 4TTTS 4AY4A 3KSBC 4UVHA 2BUAA 2Q49A 1T13A 3ZXXA 2P3OA 4FCWA 1U7DA 1MW9X 2JARA 4DIUA 4Q37A 1CUSA 4MRAA 3KR1A 5LDDC 3P0EA 3VYTB 1N75A 2HP0B 2IJKA 1ORTA 4ML3A 4Q82A 1PX2A 3MWDA 4RIHA 4Y9DA 2NUTB 1YTFB 1TX4B 1F0YA 3PD0A 4Q1DA 4YMTA 1JLKA 2R5NA 2P3SA 2P30A 4GOJA 4LRUA 1BCRA 4UTOA 5EE0A 4CQMB 3K70C 3AP1A 4JA0A 2SKDA 3RVMA 3C2QA 4XVHA 2JJ2A 3D6VA 4DVJA 4FMPA 3OTIA 3NOVA 3N7UA 5LOVA 2L19A 3QBJA 4OHVA 4QFCA 1KSHA 3FCXA 4TUYF 2N04A 2BKXA 2I3GA 5AM1A 1ZCZA 2GN1A 3L7YA 1LPBB 1P7ZA 1QZXA 2HA6A 4DSTA 1QANA 5KWIA 2PQ6A 5EL0A 2ATXA 2B2CA 1SWWA 1XTVA 5C35A 3ESYA 4HDOB 5DSZA 4CETA 5FAKA 2Q62A 3R0QA 3IIIA 4ZGBA 4CG2A 1AKWA 1Q3HA 5CVVA 3ZZUA 1LBSA 2Q7HA 1NJ8A 2AZ2A 3C3AA 4TN1A 1TQDA 1J24A 4C3OB 1DQPA 3I2IA 4PVDA 4X93A 1S2LA 3R7WB 3Q9SA 4X20A 2XDQB 1HE3A 2AR7A 3PFHA 4AZSA 5EWMA 4X8AA 3AXTA 1L2TA 5A7HA 4BTLA 3MWKA 1KSJA 2CWJA 1ZUNB 3E1SA 3R5KA 3CYPB 4HFJA 3A6DA 4L4SA 4Y2UA 4L8FA 1NAIA 1ZAKA 1X8LA 3LNTA 1TA8A 4G85A 1VQVA 4PDMA 4IHAA 2NU8B 3KNZA 2JZNA 1AOXA 2W22A 1V5FA 2ET6A 1PGOA 3EDQA 4RFSA 3FTPA 1E4EA 3WADA 3F6BX 3SFTA 3QKUA 4QEZA 3OJFA 2LCQA 3PUWA 4DQDA 4R1OA 1R6BX 1H42A 5AUNB 3BGSA 4UHCA 1PK9A 1MABG 1M8FA 4K1XA 2Q6IA 4OOFA 4F5EA 1W48A 2YNMD 2EF1A 2G6TA 2KB1A 1NVVQ 1RWNA 4BQIA 3I0MA 3T5AA 3VNVA 3V1YA 4JI0O 3DNPA 3JWIA 1NVPB 3P0HA 5CPFA 4CHGA 4DT1A 3WLRA 2GBOA 2BZSA 1Y1KE 4DG8A 2J31A 1AHPA 2PKWA 4MIEA 2GNAA 4HXGA 5GJVC 3V33A 3GRRA 4Q1BA 1YQQA 3ESZA 1Y3DE 5IPFA 3ZRXA 3EVAA 3SHWA 5LD2B 4ENQA 3UO3A 3EXG2 4KR7A 3PHJA 4FFBA 3I0ZA 4RDIA 3A3YA 3P0IA 4F92B 5A0TA 3AIMA 5A1JA 3AVYA 3UCXA 2EIXA 3SNKA 2B5VA 4TZ6A 2ZROA 1WDLA 1OFUX 4EG6A 1M1YA 1XMSA 3NOOA 3QU7A 3VVMA 2F9LA 3C1OA 4JEHA 3AG4C 5EWJA 2H8GA 3BKWA 3R3WA 4H6WA 3V8BA 1P1BA 4RD1A 1U2EA 1Y67A 2O1SA 3PSHA 5LCXA 2IV2X 1MRSA 1U7UA 1AUQA 3RTDA 5BO5A 5CA0B 3S2IA 3SHFA 4GMXA 3QY0A 3NIGB 4H35A 3UHFA 3TM5A 3WDSA 3WJ2A 4BEWA 1L5HB 3D8HA 1ZOSA 2R1TB 4ZI7F 1S5LZ 3PFNA 3I6QA 5BPFA 4ZOLB 3TJRA 3U4GA 1YZFA 2EZ4A 3O4VA 2Q8QA 5L95A 3STHA 3UKOA 1WZUA 4OHCA 1ZU5A 1N8RW 4B3IA 5ANRB 4I0XB 4O2BA 2BOVA 4PZDA 4WACA 1MOSA 1DKQA 1Z7WA 2CL6X 2UDPA 3R24A 4JXZA 3E83A 3KOMA 5EYPB 1QYXA 1PTKA 3A6LA 4YRQA 1NC1A 1PR4A 1NMSA 1FRFS 2QZ4A 4IUYA 4OJTA 1FFDA 4PSKA 4QBTA 4J7AA 4RESA 4ND8A 1CY1A 4ZYZA 3L01A 5C80A 4LE1A 4TT8A 4ZXFA 3MHTA 1EZJA 2RCVA 4MYCA 4PAMA 5SY6A 3SF0A 3SKVA 4MT8A 3D4NA 3ENKA 3L05A 1H2AS 4U1RA 1TM1E 2FK7A 2DT5A 4Z4QA 3CSXA 1W0KG 4GPIB 4ILEA 3CCFA 3SHQA 5L3DA 1SIWA 2AR9A 4LWOA 1B43A 1II8A 2PGXA 3FHJA 3IT0A 3SJCC 4HAZA 1DTWB 4MLZA 4OUKX 1FDVA 2IYPA 2Y2VA 4JEUA 3BUSA 3GG9A 3B51X 5EMJA 4GEGA 2J5QA 4AJ1A 3FCUB 4HDNB 2X4LA 3ZTTA 2ZYGA 1TVEA 3CA8A 2AOWA 4RD3A 3D5QA 1E7YA 1Q7RA 2A57A 1J06A 2HH9A 4HAOA 1DG1G 4V2UA 3ZKAA 3WX0A 1DHRA 2I62A 3KJZA 3E35A 4Q3NA 3VNBA 3ZE2B 4AYWA 2WLLB 5K0FA 2D13A 4LNUB 2ZRHA 1KI7A 3CUKA 1VL0A 4QNNA 1OW3B 1KNXA 1UBEA 1ULTA 3TOXA 1N34O 5TVGA 4EHFA 5B2ZA 4JAVA 4U7TB 1JBEA 2WZBA 5CYPA 3I6MA 1LC0A 5KDDA 4AKHA 2ZJ8A 1Y6QA 2RMKA 2X9GA 1LZLA 1DLJA 4F1JA 3PF8A 2R1VB 3B1FA 3CX7A 3OE5A 3P9KA 3P9RA 1AUXA 3DDNA 4IWNA 4V3CA 4YRCA 4GKVA 1XPUA 4XB6B 5AI8A 1DHTA 1T3ZA 4PF1A 2IW5A 1NBEA 1MSDA 1PN3A 3DMDA 5BQFA 1YO6A 5KYWA 3SHVA 1ZH4A 3ORHA 4QULA 4OVKA 2KG7B 3G9TA 4G36A 5HFAA 4W63A 4R54A 1U0HC 2VTBA 3GT3A 3V4LA 2WNHA 4W5NA 2AR0A 2C03A 4BVTA 4BQFA 1OPRA 4IXMA 2YWBA 2J0UA 4BDTA 2V7XA 1KZ9A 5TGTA 5ADUS 3GRFA 1JIUA 4OU4A 4FFWA 1UBLS 3RTGA 2J6HA 4YC7A 4AMYA 2CF5A 1K0UA 1KC3A 3E8XA 3BWMA 5JW6A 2H48A 1SQQH 3A2MA 4NI5A 4QVKA 3HE3A 3AUKA 3WIBA 3HJUA 5D84A 3KC2A 4NCBA 3E8BA 4BW0B 5DXAA 4QJFB 1Y4UA 1ZD5A 3ILYA 2LWIA 3HTXA 3WDLA 1HQKA 3K3WA 3JQ9C 5EPUA 1L1QA 1WMAA 3LDTA 2X0RA 1SCKA 5TT0A 2ONKA 5B3JA 5IXYA 3U4QA 1OFHA 1W8IA 3M3HA 3ZLTA 4UV9A 3DLPX 3THWB 1MU0A 3KKEA 1I7FA 2F1KA 2O23A 4OLAA 5CUQA 2A0FA 3R40A 3I62A 4S24A 4QTYA 5IABA 2BH2A 1OCCB 1FVXA 2VRCA 4OM7A 4DLKA 4KMMA 5BW5A 1CUHA 4IGKA 1ELOA 5EMNA 4BV8A 5EZYA 1D3AA 2JFQA 1XQ6A 1Y33E 2ETXA 3CC4V 3I2GA 4GYJA 3VSCA 1MQAA 3BVPA 3E9CA 1BE3H 1L6RA 3UMRA 4BC0A 1L5MA 2ODNA 3OY7A 1N5OX 1EXMA 4OQXA 4CDNA 4CMHA 1J23A 2EFGA 5FORA 5BSFA 2FEPA 4WKOA 4RTRA 3U7GA 4URHA 4E03A 1BH6A 4UTRA 1KJWA 1C30A 2ZSIA 4C7UA 3G8YA 2V6MA 2WFMA 1XRNA 2IF2A 2XH8A 2XQFA 4PI0A 5HF9A 5FEMA 2L18A 3BIOA 3RTCA 4HDQB 4HDKB 3WQHA 3OU2A 1WXGA 4L6IA 3R76A 4OXKA 4U5XA 2WD7B 3I2KA 4NBWA 1XZIA 4KQKA 1WF6A 4ALJA 3I32A 4GMFA 5EHXA 1RQXA 2RI1A 3RV4A 1YBFA 4NL4H 3RBXA 3OWXA 4EW2A 5GTDA 3SJZA 1E3IA 5IJ0A 3NK7A 2QJFA 2NPIA 2PEZA 1P80A 3CCUF 1YASA 1HZZA 2QUJA 3NNNA 4DEXA 3PQEA 5IN5A 1NE7A 1CHDA 2P40A 2X4GA 4Q9LA 4MK4A 3P96A 1Y63A 1W34A 1UM9B 1JB9A 2AVNA 2DBRA 2NVWA 4KQ9A 5B36A 2YN2A 1AMNA 4BEVA 5CLGA 4FKMA 4JCOA 1P3DA 1HNZB 4UUQA 4TKUA 5KQMA 4KO3S 3OH8A 5J9PC 1Q77A 4KIWA 3TZBA 1IWPB 1K5PA 4R68A 5TC4A 2VQFB 1XF1A 2DSTA 1VJDA 1Z45A 3NV7A 3OZBA 4KN8A 5EJEA 4G8DA 1MB2A 4PSAA 1UDCA 3H5AA 1M57C 1WSAA 3QX9A 4EJ0A 4ETNA 2SCUB 4DR4O 3QMMA 1VL6A 4AZ0B 4BX3A 3OE7G 1HOTA 3AUFA 3PJGA 1UWCA 5KREA 2HJ9A 2GK7A 2R8PA 4MYHA 1COWD 1A8SA 4RBNA 2FGJA 3HDHA 1VCNA 2VNJA 2X8BA 3OZVA 1E6MA 1QO0D 2HPVA 1SBTA 3NK6A 4IJQA 3UN1A 3T61A 3H17A 4JBHA 3GXBA 3QTLA 3U31A 3KXPA 2X7JA 1P0FA 4HLNA 1YVDA 2JEXA 5CVUA 5FWYA 3AM4A 5AKIA 2PMEA 1PV2A 2HHLA 1BO6A 5HRUA 2SKCA 2OBFA 3ADKA 1WIWA 2QLTA 3BMCB 4NENB 4H1UA 1BWQA 1ZU4A 1ZM4A 3UV3A 2XVAA 1P2DA 3KZKA 1F60A 1KF0A 4J94A 1NY5A 1YVUA 3I4CA 1EN4A 4DLRA 2XQGA 5DT9A 5G0SA 1GT91 1ZA1A 2Z08A 3NALA 3CN7A 3SDBA 2ISQA 3UC9A 3QYAA 4L0QA 1WM1A 1VG1A 3V7NA 1Y89A 1YR1A 3OZGA 3RVKA 4CL3A 1CFJA 2AQHA 3GJXC 3ZBQA 2PY6A 1U8EA 2INGX 2FW6A 1MGPA 3LZDA 2QTVA 1E69A 1SZPA 2VFAA 5KNDH 2DKNA 5CH3A 5L3QB 1WX1A 2XIJA 1RE0A 1TQ6A 3K0FA 2IE8A 1CG6A 2Z2KA 3KT6A 1K0FA 3Q85A 4MR7A 4N5MA 3WL5A 4EW1A 2XHEA 3H5LA 1NJIW 5KC9A 3A6GA 2QD5A 5F51A 1Z4OA 1E1RD 3BD9A 1THGA 2I3AA 3BHMA 1T9AA 4INOA 3JCMM 3R9XB 2DWCA 1ZESA 5M5BA 2Q9LA 1HORA 1AA9A 1HNXO 1GVNB 3UT5B 1LU9A 3CCVF 4U0JA 1WB5A 4LOJA 3GLFE 5AOAA 2JDIA 3QX8A 3IPXA 1ID8A 3LRPA 4LBVA 3WTBA 5AO9A 4MUIA 4DB4A 1V4BA 3I9NA 4JT8A 3JSLA 1V35A 1G4YB 4NAHA 1SJ9A 1YJQA 1M5TA 1O0BA 3C48A 2GUZB 4FXPA 4OPHA 2NZ8A 3AFOA 2AOTB 5GAJA 4R2KA 3UMMA 1Z56C 1L4NA 3EZXA 5FLXA 4OL9A 3T6KA 4RK6A 3CF4G 3BDAA 3PEUA 2G63A 4LGVA 2ZUDA 4RH0A 3R7DA 3V8EA 4EUKA 4QM7A 1DDGA 1JE1A 1MB4A 2R6DA 4KWCA 3IC7A 4I1IA 4JCCA 4CUKA 3THRA 3Q8MA 4CNBA 4P83A 1U7TA 3EN0A 4YRTA 5ED0A 3V48A 3Q7PA 1UAAA 4DREA 1PNLA 3PA8A 3UTCA 1VSQA 1YB7A 4AO6A 1JYSA 5EG5A 2AC4A 2Y0CA 4BIMA 2BMWA 3EFEA 4OBBA 4G01B 5EZ6B 4QPJA 1JQDA 4YGXB 2V5VA 1E96A 2WSLA 1EWKA 3NWJA 3TR0A 3A3OA 5BSMA 5SYNA 5K1PA 3DKPA 1QGOA 4Q4AB 4UNQA 1U0OC 4TMFA 3GVCA 2RD2A 3V8NA 4B40A 4QBGB 3WL4A 1XJ0A 3DVQX 3K06A 4MKGA 4R9UC 3L0DA 4Z0PA 2VSNA 2B83A 1G7CA 3EMKA 1DZIA 2PT7A 4OFZA 4TZTA 2H5JA 3P3NA 5CLIA 2Y9PB 4GUNA 1VFPA 4GKBA 1ACMA 3O8BA 5ALPA 1Y6XA 3H8SA 3T3NA 3H0EA 4MHOA 3TAUA 1OAAA 3C5HA 2AFHE 4HOYA 1ZOOA 4FHEA 4PX9A 4XZ3A 1BGVA 1RHRA 2RGAA 3WISA 4WJZA 1D1QA 1H2SB 1G6KA 3E4CA 3OIGA 4QWMA 1YDEA 5I01A 2QRNA 3MM4A 5I3CA 3AR4A 1MF7A 1WZEA 2OBMA 2PGJA 4D4IA 5EIFA 3CXHF 2JGDA 1E3WB 4RC9A 3CE9A 3RUFA 1RKUA 3QXXA 4RWZA 3ZI4A 4DLWA 1EHIA 3LNNA 1Q20A 5IBQA 4ZV7A 3W1WA 1Z82A 1HF3A 1YTUA 4NE2A 2HKOA 1E59A 2ZITA 1NMZA 1JHUA 2YIJA 2AXNA 2G4VA 4NDZA 4WXEA 4DANA 1XQWA 2FL4A 3ZP4A 1BCSB 2VGMA 2VUTA 1M56B 5EKDA 1MA1A 3CCEF 1DFGA 3EDRA 3U6BA 2NUBA 4Z99A 4HNUA 2JCVA 4DZZA 2RC6A 1ZRMA 3L0YA 5KI6A 3E4DA 1AJPA 4JZKA 5ECDA 3DE6X 3VH1A 1RRFA 2A14A 2PMCA 4AY6A 3FFXA 1QTQA 1O95D 2DYRC 5E4TA 1Q7BA 5ICFA 2CKMA 2HXYA 3LUBA 3OCYA 1SVOA 1GCGA 3NBKA 1FYJA 1A8PA 3H5WA 3RUEA 2R8BA 1DJNA 2YDYA 5I45A 4NJEB 2P27A 4L08A 4RS4A 4EFEA 4Q4DA 4BMSA 1MZFA 5L6LB 4PG7A 3KZVA 2PGGA 4PDVA 3NVKE 2G8NA 2R25B 3EW7A 3LX6A 3QQ5A 3ZNQA 3LSTA 2EBHX 3QX3A 4ZOAA 4B46A 1XSEA 2AUMA 5KYUA 3SVTA 2CMFA 5IARA 4AJ4A 5ADWA 3FSJX 2JFGA 1B0ZA 4MMZB 4BY9D 1B00A 1YZKA 2IHKA 3OZSA 3W2IA 1OF1A 2JLYA 4WIAA 3EGXA 4RUFA 1M90W 1S2IA 3OM1A 3QE0A 5AUQA 1UKVY 1JGTA 1Y5LA 3TKYA 4BBAA 3FOEC 2WKWA 3ZOPA 2NW6A 2Y68A 3LUHA 1RDFA 2ZIUB 1PKEA 4IH1A 2VHYA 1OA0A 4QO7A 4NJMB 4RDCA 5BNIA 5TGDA 4ZRMA 4BRSA 3FD8A 4CR7A 3OC0A 1IC6A 1VJ5A 2P5YA 4M98A 2EIMB 2XXJA 3OLWA 3SIXA 3GP8A 3UG7A 3ICWA 3PRKE 4L6CA 4BNFA 3N2GB 1G60A 1AF7A 1EGMB 2R70A 2E18A 2FFJA 2VPZA 5FTMA 4YUAA 2GN8A 4YRJA 1VJ0A 4KDCA 4JGGA 3BHPA 2PRYA 4BIUA 1ACJA 1EEXB 1AV6A 2QZJA 4MCJA 3NVDA 2E3CA 5SZKB 3UMBA 3F6CA 4OYRA 5ITWA 3BCHA 2HK7A 4MIOA 4UQOA 2ZCUA 1UMDB 1QP8A 2QDOA 3N8DA 3QEJA 1L8DA 2C98A 3GRKA 2H5IA 3WVNA 2GD1O 4FP9A 1QRTA 3I9MA 3V2HA 4WKPA 1VG0B 1T2VA 1IEQA 1FNKA 4Q18A 3S1LA 1T8WA 4L22A 5KHJA 3HA5A 4G26A 1RCTE 3G8BA 4QDUA 3Q8LA 4DV7B 3T3OA 4DRZA 3P9ZA 2J30A 5FKJA 3HXTA 1I2ZA 4F6RA 3TB4A 3V4DA 3SX0A 4A8TA 4CLOA 2DWEC 4QXAA 3NQ41 2RAPA 3DEYX 1UPXA 2WD7A 2XNCA 3D4OA 3R0VA 1R00A 5DU2A 2Q2VA 5HNKA 1NQWA 2ZQ5A 1BW9A 3WJRA 1VKNA 3O7WA 4JK3A 4MA4A 2K4MA 5REQA 3QK7A 2IYRA 4ENUA 6ABPA 3GJSA 5IVIA 1CNEA 3LL7A 1P7WA 2YWGA 3BFPA 2C8VA 2ZT6A 1XIVA 4FILA 1B6QA 2ORIA 4MUMA 2WU8A 3L1IA 4A8JA 2AN5A 5DRTA 6CHYA 4BNUA 1NZDA 1UBKS 4JLKA 1KIAA 3Q41A 4LXQA 2NU9A 2Y3IA 2I99A 3FKSG 2PRSA 2ZBVA 3ESDA 3OZAA 4IBOA 5A6SA 5IFKA 3TS1A 1KNJA 1CQJB 4LG1A 2RJNA 4I3FA 4Y1RA 3LY5A 1CRZA 3RHTA 4UOEA 5LD2C 5ALMA 4A5UB 4UB8Z 1S0VA 3NJRA 2OEPA 3E7DA 4ASUA 3DXZA 2L6LA 2PLNA 3FI9A 4D82A 3E1GA 1P0IA 3WYCA 1YHZA 3DW3X 3IILA 5CNIA 1WQ4A 5KOHA 1H2XA 3UYLA 2PUFA 2ZRQA 2VSXA 2KQXA 4DCNA 2OPBA 2XCSB 3WLQA 1UH5A 5KX5F 3WYDA 1HR0O 3C0KA 4RHEA 4W6QA 2QAJA 3A70A 3VC1A 3WMFA 1FSZA 3QFSA 1GZVA 2I6FA 2JJQA 3EEQA 4MVOA 4YCMA 1HQDA 1VE9A 1P6UA 3TAXA 3ZJ5A 5IDXA 3OMLA 4E09A 3E9EA 4N47A 2J6CA 2WKPA 1JLRA 5EAZA 4ZRDA 4PX3A 4E07A 3DV0B 1RXIA 1C1XB 1KR5A 4C3VA 3ZXIA 3BH7A 4NS1A 1QFZA 2COKA 2ZSJA 2CXTA 3URKA 2H1VA 4EJMA 4PX2A 4TPKA 1HKUA 2CVZA 2FSUA 1KFKB 3R7AA 1ZVKA 4K6MA 1Y3AA 5KVAA 2JANA 4MS1B 3VZRA 2PAFA 3LUFA 4P5DA 4U2KA 1X94A 2HB6A 3OZXA 1RM4A 1IJFA 3UW3A 4EB8A 2R11A 1CUJA 1JS1X 1JG3A 3EK2A 4RV4A 5AKLA 5HFJA 1ZD1A 1IURA 1G1XB 4R16A 2CDYA 4L5YA 4WY8A 2HCJB 3E9RA 3UJ3X 3PRJA 1RHMA 2RMKB 4Y8VA 2LW7A 2Y69B 1JKMA 1V5IA 1SG0A 2O8DB 2Q69A 3F8WA 3HBJA 3NATA 1MGOA 2DF8A 4JIMA 2A0WA 5FL7D 3RS7A 4DRXB 1QX3A 5I9MA 4C7OA 3COPA 2O2ZA 4QYIB 4R05A 2NMUA 4B83A 2FW0A 5BN5B 3OM8A 4LNUA 3AEUB 4F3CA 1QPGA 1V1JA 3O9MA 1G8FA 3G6BA 3KQTA 4KQEA 1IHDA 3WK9A 2DERA 1PGPA 1VPDA 2XITA 3AWDA 2J6BA 4JB2A 4JELA 1M2HA 1Y3FE 3AFNA 4KRXA 3W2GA 1TC2A 2DWOA 2NPOA 2DULA 2HM7A 3QWAA 2YWHA 5HOEA 5KNLA 4MP6A 1TD1A 2P68A 4MV9A 1Z4PX 4HMOA 4N8DA 1YB6A 4BAZA 2WJGA 3GLFB 2CBZA 2HX1A 1HTWA 2Q2QA 4B3SB 2RK6A 3VU0A 5E2IA 3CJHB 1VQKF 4UUPA 3MHSC 3D8BA 1NM5C 1QAHA 1W42A 3RODA 2VDNB 5AP9A 4Q93A 5T4HA 4RW0A 4DMCA 2Q4TA 3VX3A 1SG9A 2GLZA 5ALQA 3BBPA 3BMQB 3O8QA 2WVJA 1I10A 2NTEA 3H0KA 3JVEA 5H70A 2G8LA 4KI0A 4OU5A 1SXJE 3ML0A 4HH0A 3NKLA 4G0OA 2VK4A 1VLLA 4PRYA 4U2BA 2GPNA 3WMGA 3IHWA 2QJTA 5A3RA 4XWTA 5F7ZA 3K9WA 3X1WA 1SUCA 5B3JC 3OF3A 2E4VA 2RGWA 5I7RA 1J0BA 4MW5A 1JEYA 1SHKA 5CVTA 3U3DA 3H5NA 4PDLA 4RMHA 3OM0A 3UJPA 2YXPX 4X95A 2QM7A 4DHWA 1EK5A 2DH6A 3ILSA 1XMJA 3DDCA 3H4TA 3L41A 2IWRA 1NVAA 4QBIA 2MK3A 1YD7A 3PGJA 4R2IA 4YMSA 3GT7A 2Q1YA 2DTXA 4OI2A 1W5AA 3A1VA 4UCVA 3S2UA 4HN9A 3KIPA 4XKJA 2XCOA 1FTWA 1CN7A 3PJDA 3VU1A 4R8RA 3RBAA 3W3AD 4CFYA 4RSMA 6YASA 2D6FA 1KVTA 2BMVA 1C1XA 4AJ2A 2DHCA 3FDIA 2RARA 1KXZA 3BGOS 4G0UA 2QSUA 4DV2B 3SBOA 3QIAA 5JTTA 4JD5A 5FL3A 1OZAA 1SNYA 3ANTA 1RVV1 2C84A 2IXBA 1VCOA 2Q0SA 3F5FA 3M6AA 3G85A 5FWAA 3VAZA 4ZMBA 2D06A 3ANMA 3MLEA 2ZB3A 3L6EA 3WK6A 2I29A 3MBIA 1I5OA 4I1VA 2XEXA 1S8AA 1Z6PA 5FO1A 4CNQA 3VYUB 3FB6C 5AJWA 4R51A 3TPFA 4O6VA 1NI3A 3G2MA 4CKEB 1PW5A 3AJDA 4HYEA 1UBOS 5ALXA 1K5QA 1NP7A 3QI2A 1WCXA 3OTOO 4AULA 3PF9A 3RQIA 1KE1A 2JGNA 1N5KA 2IP1A 2UXCB 2Q41A 2CMHA 2MSKA 4XYMA 2NZYA 4LY9A 2XQJA 4MLCA 5ENVA 5F23A 4GE3A 1SXIA 4O4LB 3GLVA 5JCJA 1NUTA 4D02A 1XNHA 3GIDA 4Y1RB 3PE4A 3DW1X 4J0IA 3NBYC 2V4UA 4LF7O 2ILMA 1Y81A 4HB3A 3BTOA 1IY8A 1WP4A 4UM9D 1DRVA 1TCBA 2NTJA 5ALVA 1WQ1R 4LDAA 1VB3A 3L7MA 3O4GA 3FMIA 3IXQA 4ZIBA 3K2EA 4WV3A 4BRUA 3TOZA 4ZZ0A 1C1HA 3OHMA 1V5EA 1K8AW 3AU9A 3EXG1 3NTLA 1SUFA 2FE1A 2CVPA 2ZUVA 3VSDA 1P2GA 1VM6A 3E86A 1EUQA 1YL6A 1CR4A 2GHYA 4Z1VA 3A8TA 2RHJA 1H4TA 1OZGA 2PZAA 2VHUA 4NZZA 3BH6A 3AK1A 3NHUA 3A10A 3ODPA 3WXMA 2PMKA 2CNOA 2JGJA 3ZCRA 1KJ9A 3QTBA 1EVZA 1XE3A 1Z2PX 2XIQA 1PL6A 5BN1A 3DOEA 2DBVO 5IUNC 2BSQA 4RTSA 5I7WA 3AG7A 1BEEA 1WUJS 3PWKA 4C08A 4IRUB 1YFJA 4WF9V 1N78A 3W8FA 1QFYA 2YTZA 3RVOA 3MQ4A 3RC2A 5GJWC 1OCCC 3DVSX 4QIWF 4G4JA 4NR0A 2JFPA 4YB8A 1UPAA 4JWKA 4QEDA 1UBCA 4S35A 4BVKA 1L7DA 1XKQA 1BOFA 4RH3A 5EJIA 2W6NA 3NHWA 1C9DB 1O6BA 2BKLA 3QMPA 2FVYA 4L8LA 1NMYA 2M6YA 2OESA 4KUHA 4U2CA 2ZUUA 5C51B 2A0UA 4IOLA 3M2TA 2W2XA 2EJ7A 1U2GA 2ZPAA 1TUEA 2WP8J 3DBVO 3ZRWB 2HGZA 2HO4A 2GHRA 4TKZA 4DQUA 2YVLA 1IDN1 4DV3B 3DAGA 4LN1A 5CYGA 3N8KA 3QUAA 4TYNA 3X2QC 2LXNA 4GSKA 2HP0A 5A9TA 3W6OA 3KZIZ 4Q1FA 3WRXC 2A0LA 4YXWD 5ECWA 1A95A 1XXHB 1ZMBA 1I24A 3UHPA 2C3OA 2RFLA 1FFXA 3WSWA 3GYQA 4N0PA 5BMVF 4G2NA 3HA2A 3Q9UA 2R66A 3CC4F 3E2PA 1OLOA 3D8UA 1JJAA 2NAFA 7GPBA 1DKUA 4R2WA 4ZBMA 1J49A 5EI5A 3REQB 3HLYA 4A0SA 2C82A 4PTZA 4ZO6A 3FFQA 4B2YA 4QXMA 3R6GA 1XQ1A 2CDNA 1XTJA 2HFKA 4LI0A 1Z0ZA 3N74A 4OUDA 4V0OA 2XMDA 4BP8A 1AJEA 5AKYA 1GNQA 3JPWA 3ER6A 3ZYCA 4BB0A 4DYLA 4LZJA 3NKVA 5FBHA 2E2WA 4N5NA 4MWBA 3SDSA 4CKCA 3OPNA 4HB2A 4J9VA 2W6PA 5ETJA 3HAXD 1O9GA 3AEQB 6GPBA 1WS6A 4IZOA 4EJSC 2A3NA 3ZVRA 3KXLA 3WTCA 2NO0A 1XC7A 2ODTX 3KL4A 1ZDMA 1BHQ1 4IKPA 2MIIA 4LV8B 4MVJD 4KG7A 2HUNA 3UJNA 2OR3A 3PC8A 5EPOA 2O8FA 2G9RA 1U3VA 1RRMA 4HO1X 4HPWA 4E46A 2WF9A 3N0XA 3LPCA 1JR3E 2DR0A 3WLAA 3TTSA 5E2BA 4KR0A 5IT9M 3HYCA 1V2HE 3UXHA 4RE6A 3W9SA 4MVXA 2OFPA 2G71A 3HLKA 4DQXA 3VM6A 3W1EA 1OTXA 2VQ3A 3MZ0A 1CPYA 1T0PA 3LDGA 5LC1A 3LXMA 2IYNA 2ENWA 4KFTA 3EZ6A 1AMUA 3JWEA 1DAMA 3GGGA 5BR8O 1MC4A 3OQJA 4HNAB 1OOEA 2H31A 5LMUO 4WY2A 4ZO9A 5IN4A 2RHLA 5M04A 4PPYA 2AG8A 2JLVA 4OPAA 1C8VB 1XZ8A 3FNGA 1N36B 2PRZA 2Z1NA 3BRQA 1IE3A 2P8SA 1N2HA 2AI2A 3LQYA 4UUAA 1QG2A 1YK0A 4WZZA 5DP1A 3D7RA 4EX7A 2V9PA 4JI8B 1EDDA 2PFSA 4YDRA 4HH4A 2HMAA 3H9QA 3PPIA 3T38A 1QNLA 3KQKA 4P32A 4A8JC 1G8AA 1Q22A 2H1SA 3HZRA 5E4YA 4YY3O 2ZRPA 2ZP1A 3QI7A 3IEQA 4P3NA 4PHHA 5F3RA 1Y1PA 3Q40A 4MTOA 1DC6A 2BELA 4NCNA 4KFMA 16PKA 2H0AA 2RSLA 4Q15A 4LJ7A 2GRJA 3KRTA 1IN4A 2VDUE 4OJKA 1E2GA 3HR7A 4PLZA 4QATA 4U2GA 3WSTA 4EEQA 4DOMA 1R0BA 5J1SB 2AJBA 3Q72A 3KB6A 4BVAA 1DCKA 2AEEA 5IAKA 5A4JA 3JR3A 2J5RA 4EP1A 2YN4A 3G67A 4PLPA 4DDVA 3OA2A 3A1UA 2NWQA 5H16A 2XTAA 1AU9A 2PANA 4BO6A 3D8TA 5DN6A 4QT4A 4U5QA 2WUWE 2JIBA 3CRZA 3GARA 3X2FA 3G5MA 2OXEA 2FPPB 1IM5A 1XNQO 3KQVA 1ZXXA 4YWHA 2R7NA 2JDID 3NAQA 4AJPA 1WMSA 2ZT5A 3MG9A 1YF2A 3A9VA 2XF2A 1Q1EA 3M8KA 3QNMA 5UKDA 3I8XA 3X1MA 5IJ9B 1SCJA 3E5HA 2BAGA 1UEJA 2XAAA 1USVA 3OLYA 2O2SA 5FBWB 2FMLA 2CLLB 2E3JA 1R0XA 1QR6A 3JRWA 1Y6RA 2Q3DA 1HT3A 3F49S 2VPXA 4KZPA 4L8GA 3GLSA 2Q46A 5CFNA 4FM9A 4G27B 2XGGA 3UQZA 5C8ZA 2XBUA 2GV9A 4RHFA 5B4VA 4RA6B 2D2VA 3UT5A 3PT5A 3T7SA 4EHBA 1E2BA 3DTTA 3E5RA 3ZEIA 1PFUA 2PQ2A 2JA1A 3L4BC 1WB6A 1R0YA 2Z58A 3VR5A 3R0ZA 2ATKC 1I01A 1M6VA 2EHDA 3CSDA 5CURA 3DO6A 1R3LC 3EFHA 2HBRA 1OROA 1WZCA 4PWTA 2OORC 1G21E 1LW7A 3KDSE 1Z2OX 2WI8A 3PI6A 4HL6A 4AURA 4BLTA 1EZ4A 3D3KA 3Q5EA 4GYYA 3EIEA 1LUVA 1R0ZA 1WCIB 2W6ID 3PX3A 4X64O 4YI3A 1V7QA 4GLXA 5T4FA 3QVWA 4HZUB 3VYVA 5IYBO 2RB9A 4LBZA 2OQ2A 3JVHA 4EJ6A 1TTTA 2J46A 1N0JA 1BKSB 3BZUA 2WA4A 3IC9A 3I9OA 2OBLA 3H0CA 2MMGA 3WLKX 1E7RA 2HQSA 2CV1A 3RA6A 2QTNA 4QSHA 1Z26A 4BWYA 1QV6A 4WADA 1QC5A 2AJLI 4JVNA 3V7EA 1ND6A 3BWEA 1YGYA 4J0EA 4PPFA 3UAXA 2CXSA 5B30A 3T0FA 2UVDA 3AL2A 2X0DA 5H0IA 5C37A 3M4NA 4YYZA 1H6BA 5K4GA 3GUCA 1JFLA 5AVWA 1V9LA 1QNFA 4LF4O 3GLHB 5A6VA 1PZEA 1SUPA 1M2GA 2QWQB 1O77A 1Z2EA 3AGQA 3KEFA 4OKSA 4R9VA 4FMDB 2OTLF 1P2BA 1SUDA 4RWEA 1F14A 3MTAA 4UUJC 1EP9A 1M34A 2V7VA 3KT0A 4WT7A 3UJHA 3WLJA 1C0EA 2EBWA 4NMWA 2A9FA 3I9JA 1C4OA 4CTKA 4QZVA 2BMEA 1OBOA 4URFA 4XWWA 1NNSA 3SJAC 3EVFA 3CO5A 2A06H 2BFAA 1Q1QA 3PP8A 3UYKA 4GMHA 4D46A 4YV1A 1GO2A 1UANA 4Q7LA 2GCNA 4D6XA 4BR6A 2F1MA 2ZBPA 1SVSA 3LKBA 4GEKA 3GIWA 4AZ0A 2Z04A 3VV2A 4DQ0A 4C6HA 4NQZA 3AG2C 1VL2A 2CGOA 2ZSDA 4XUCA 3ZX5A 2Q4PA 1KORA 4RVFA 4UTZA 3UA3A 5JH7F 2WW8A 1UF9A 3P94A 4MW9A 2Y69C 4TTJA 4X63A 2FSGA 4ABMA 3RNOA 2WBLC 4W5TA 2G9QA 4OQ4A 3IIEA 3LWBA 2AC7A 5HOQA 1EQAA 3RU7A 4EATA 2WIGA 4POAA 1W6UA 4DR3B 3R5TA 1P75A 1GTZA 3RRNA 1U2PA 1GG2A 4IMIB 2CCJA 3QBDA 4L6AA 3S70A 5JPDA 1FYWA 2X5XA 3CNNA 1L8QA 4R71A 1PNOA 3MW8A 4M8SA 4R1PA 1D2EA 1KWKA 2JA2A 5C7YA 1XTRA 4DC9A 1OI3A 4JOBA 5TQ0B 4EARA 5IAOA 1APBA 2O8EB 3OO0A 4X84A 5LYJB 2WALA 2W70A 4PIVA 2REBA 1Z0KA 2EYQA 3G79A 2EJCA 3P30A 3E22A 3ZE7A 4JV5O 4R7CA 1KMHB 2BRUC 4OV6B 1ZIXA 2ZSAA 4QRHA 4ZODA 1ZEJA 3SLGA 1S2DA 4HDKA 4RZQA 3ZK7A 3I5UA 2OCLA 3OT7A 3ESBA 4I5SA 2Z3ZA 4MSWC 4B3BA 3IOEA 3R3UA 3TLKA 2AG5A 4XDJA 3JAKA 3ZHUA 1N77A 1T2NA 2W9XA 4Z2YA 1KJNA 5B3SB 3E22B 2UYJA 2C0PA 4QXQA 2DQ3A 5FOSA 2IQQA 5LYJA 3D0OA 4PYJA 1M57B 3IEWA 1WDKA 1VHQA 3CZQA 5B1IA 5CFZA 5K5EA 1J33A 2I4RA 2VDOB 3AR9A 4HF7A 1Q44A 1STOA 4CM3A 4CMCA 1CJMA 2WLIA 2GCOA 4Q48A 1QVZA 2Q50A 1B74A 4BT3A 2R6GA 2YY7A 4JYAB 2QMEA 2WSBA 3M5WA 2PUHA 4BASA 4X5OA 1PR3A 2MYUA 4DR7B 1SIOA 5KYYA 5E9AA 3AJAA 2GEKA 1E8MA 2IRWA 1KJJA 2FHSA 3INNA 4P35A 1VBKA 5EJ4A 2P3LA 5FIUA 4JLOA 1NW9B 4RL6A 1F5SA 4ZZ3A 4IGGA 2CXPA 3DZCA 1Y76B 1VHJA 3JYPA 4B9AA 5JWRA 5LDHA 1GXSA 3ZN0A 2ID4A 3OSZA 2NR5A 2VDWA 3OX3A 4IO1A 4RPIA 1YSCA 4GSLA 4ESHA 4G1BA 1P5HA 5E0OA 4DNXA 5JNRA 1ZTEA 1A9PA 1JFVA 3ONVA 2ZYSA 5AJZA 3AM1A 3QEOA 3T94A 1ZWLA 2Q8VA 4FPPA 1JLHA 1U90A 2A5YB 1TB4A 3KKKA 4GR4A 4P80A 3ZWCA 2Y1XA 2KTVA 4RKYA 3ZHQA 2YDXA 2P6PA 1QGAA 1KZ6A 1DQZA 2Q4BA 3K1YA 1NTZH 3DULA 3R9IA 3CLTD 3D43A 3I5YA 4TSFA 2HRQA 1Y74A 2B0JA 3K5IA 4KL8S 4V1CI 5JYCA 5K9ZA 5HQJA 3KOXA 4JXJA 4R84A 1M7GA 4U2FA 2QTAA 1V37A 5ITZA 1KJZA 3BD6A 2R86A 1B42A 4LF9O 2NYAA 4FYIA 1C7ZA 5TY0A 3ADBA 2VTBB 3RJZA 4FYPA 1XN4A 1SVUA 2WTBA 5C1PA 3B77A 4FLYA 2EVWX 4C76A 3V2GA 5DK4A 2AF4C 4FIDA 3QRWA 4L57A 3RROA 1IPEA 2R44A 1IN6A 2Q6LA 3E84A 4DV6B 4WAUA 3TOCA 4MGZR 3AF4A 3BD7A 1ZI8A 2Q0AA 2RKBA 3PC8C 5J1TB 4Q4CA 4PBRA 2TSYB 5LBUA 5KINB 5AKKA 5LR6A 2XY4A 5HGJA 4GP9A 4MYUA 2R1VA 3KAPA 4JY7A 4CQLA 1TUIA 2NOAA 3AVQA 1U96A 3D1VA 1Y7HA 2G9ZA 3KQNA 4J0QA 3W7UA 4QUIA 3ZWXA 3WKBA 1R8SA 1QHFA 1PCXA 3QPBA 3ASNB 1YIOA 5HRCA 5LFAA 5BRJA 4Q39A 4Y0NA 1DWUA 1W5TA 1EWRA 4C0LA 1SCNE 5D8DA 2YWJA 1KPGA 2GBFA 2WHQA 4B75A 1TLLA 2W6JG 3NTVA 4H4CA 2H16A 3TB6A 1BE8A 2X8LA 1VQMV 1EUDB 3NVAA 4M37A 1S2NA 3AEKB 4NK5A 1KAEA 2B6NA 3H86A 2IIQA 3NM6B 2Q5CA 4UCQA 4K6GA 4PQFA 1CQIB 4MJ7A 2ZKIA 3UM9A 2Z01A 1VLMA 1L7EA 4DLTA 3DGEA 1L9KA 1P18A 3NW9A 2B20A 2D2XA 3AY6A 3D5EA 3NS7A 4BBPA 3KZMA 5BSVA 5EOVA 3H83A 4YUYA 2VCEA 1Q6YA 2GKSA 2Z4RA 2ZXFA 1KY3A 4X62B 3EVGA 5HF8A 1WPRA 3C1AA 1CY8A 3QGMA 5CRIA 3CCSF 4FOTA 1IAQA 4KMOA 3RI3A 1WUKS 4K9SA 2PU5A 1NJIH 1VDMA 4KWHA 4PLFA 3FB1A 5AM2A 4LBWA 5AUPB 4D3YA 1AHIA 3C1UA 3HMQA 1P60A 3ACDA 3E15A 4IGIA 5EYPA 1D8AA 2XDYA 1XVUA 3RYCB 5ARCA 4EHAA 1Y7IA 4DEVA 4JPRA 2D0PB 3C4JA 2AXTZ 2CZCA 1COMA 4B5CA 2YW2A 1MAAA 5EO3A 3CCQV 3E3NA 3FCAA 4N6OA 1YVWA 2XUJA 3NMUF 1OVMA 1JVSA 2UVQA 4PAGA 2C3MA 2JFVA 1DBFA 1UKZA 3X2SA 1XCBA 2Z1MA 1NV8A 2PSEA 3FMVA 5CT8A 4BT4A 4QE9A 1RHKA 2H1HA 1ZLYA 3CNQS 3CZ9A 5HKAA 1N2CA 1PR9A 2RBEA 4H0CA 4Z2WA 4BDSA 3EDOA 5L3GA 1Q0TA 2DKFA 4N21A 1SKYB 3SE0A 1TT5B 3CY6A 3Q3VA 1CCWA 1YQ9A 5B12A 2FPRA 1IJEA 4E5MA 1SA0B 2FFQA 3F7VC 3SC4A 3F90A 1NBME 3ND7A 4IVPA 4CTOA 4E7OA 4EKYA 4I36A 4HT3B 2F1IA 3U7EB 1U0GA 2JFOA 3MWFA 4JX9A 3RVDA 5IG2A 3SJCA 3R6TA 3N2YA 4C0WA 3U4HA 3FTNA 4FUQA 3TUJC 3CBGA 2Q29A 3HWWA 3QXCA 5DULA 5JDCA 4WCDA 2VXCA 4M4SA 3TQHA 4QQKA 1V55C 2PX2A 3B52X 2DHQA 2BGIA 4ZCIA 4LR3A 1AZLA 3VPHA 1GUZA 2BFBA 1TRKA 1Z0IA 2QVLA 1M83A 4YHHB 2X4DA 3F67A 1DRWA 3GDWA 3X44A 2YEVB 1ZD3A 1S72V 3L7OA 3NUGA 1R88A 1S96A 3MHHC 3UJDA 4GX2A 4CGYA 2LD4A 1RZRD 1UKCA 2NG1A 3GEPA 3MBKA 3UFXA 1VKOA 1RFLA 4BNJA 4S05A 3WE7A 4ZK7A 2C4WA 1X2BA 2Y99A 3LUJA 5BYJA 1KDVA 3WK5A 4BMDA 1U63A 4K9QA 4R01A 1USUA 1OREA 4YRMA 5A3JA 2AXQA 1M2VA 1RMQA 1K3UB 4HYTA 4WZAE 4UVCA 6REQA 4XSHA 1SU6A 5TMDA 5BUSA 4L95C 3VBBA 2XJ9A 1PGJA 3G88A 1N9GA 2YY5A 3RIEA 4PYMA 4CC5A 2V7PA 1XALA 3HBAA 3JCZA 1LQUA 4N0DA 1WZ2A 1SXJC 4BW9A 4B3TO 2YJ5A 2JASA 1N0WA 5GM1A 2IH5A 2RH4A 5K0NA 2FF5A 4BMNA 1O94D 1I1NA 4MVSA 1TJYA 4R4JA 1IOWA 3U37A 1RPJA 3QBTA 3EXHA 3FTCA 5K3FA 3TXAA 4C14A 3TLYA 3FHTA 1OZ0A 1YF3A 221PA 3ABMB 1ODCA 3G3EA 1V7ZA 1W0CA 4G5SA 4AY5A 1X14A 1AG9A 1OD6A 1G9TA 1YHQV 3MAGA 3QO8A 2EWWA 2GSWA 1QDLB 3WLLA 5JYEA 1M0SA 4X3LA 4FGWA 4I7ZB 1EA7A 2VF4X 4MEJA 4W82A 3U40A 4EKNB 1AJQA 1BRTA 1IMOA 2RB4A 3T35A 4AMZA 5COAA 1DLIA 5AK5A 3TZKA 3D31A 4YRIA 1GCIA 4YMWA 3QWFA 3P0FA 2G3YA 1ROPA 1JALA 5JCOA 4KH1A 5AICA 1O95C 1VK3A 3VHLB 3SYQA 2EFEB 4ZU1X 1GKYA 3MJHA 4EQ6A 4FMTA 4Y9UA 3RK4A 3RC9A 4D9JA 4RTKA 5BOSA 4EFBA 1QQCA 5ESWA 4M83A 3AU8A 4HSGA 2JJ1G 3QF4B 2XXBA 1H6AA 4WKBA 1GEGA 1R7RA 2B98A 2BDUA 1J1IA 2GDZA 2YR0A 3I09A 1XZEA 3ROPA 1WVGA 3ZHTA 3MJFA 1SPBS 4R98A 4KFCA 1QPZA 2VO1A 5I7AA 1R18A 1GG9A 3O85A 2DZDA 4BVSA 1NF2A 1GUAA 1JSXA 2O6HA 3CVJA 3DM5A 1I3MA 3QNEA 3KKOA 4OFXA 1O6CA 5E1MA 4ZRNA 3OEEG 1Y66A 3ZU4A 4W8GA 3DZDA 3K94A 4REQB 2NZUG 2X42A 1PDWA 4QUEA 5DOVA 2AKYA 5HCUA 5BNZA 4KZKA 4YBZA 1EG2A 1U9YA 4DBVO 4EHKA 2C9CA 3AOEC 4LC1A 3W8DA 1OX4B 2D3WA 4RM2A 1T1RA 2HVYD 1TMKA 2JGMA 1XDCA 3B8HA 4XTCS 3FPCA 5K8VA 4TYQA 2GXQA 5FUXA 1VMEA 1NVPD 2I2BA 3EG9A 4GC5A 3RRBA 3U2QA 2EJRA 2GZHA 2QR5A 2IUSA 2WFZA 1W40A 4I2NA 4YCBA 1R64A 4G5RA 2Q7DA 2Y0IA 1KAGA 3RVQA 2VOEA 521PA 1FX1A 1N0HA 1ORIA 1DQNA 2A9JA 5G0TA 1AB6A 2HIGA 3ZI7A 5JVDF 3I5DA 3JD1A 1GPNA 2WT8A 4JROA 1IXKA 4HK4A 3FHOA 2R5FA 3QW2A 4L4UA 1JLMA 2BE3A 3JZDA 2X7HA 1ZK1A 1GTJ1 1XD8A 4A92A 2OO3A 2IBSA 1S3FA 1YDXA 3LUAA 4MI1A 4MWSA 3SC3A 3EGVA 1U7ZA 3KLNA 3MGKA 5CA1F 4R1QA 3FA2A 4YJKA 4YJ2A 3DOFA 5TPZD 4GCZA 1XU7A 2C3YA 3LXRA 3NG1A 4MS4A 2I03A 4EG8A 3R5XA 4ZC1A 5DW0A 3KKMA 2QR2A 2P90A 2K9PA 1QLWA 2XA9A 4R7GA 1HYHA 4CV3A 3ZBUA 5F98A 1TF2A 4NCKA 3ZYZA 2ZIAA 5LZ2A 3CS5A 2CL5A 3YASA 2DYYA 4HNHA 1H3NA 3HJRA 4OAOA 1T2AA 4UBKA 2C9ZA 3E9DA 5D3ZA 3EIQA 3CNEA 4FWTA 1YQWA 4FFSA 2GA8A 2JVKA 1SGWA 2BN4A 5KZMB 1PS9A 2XYHA 3GG2A 4A10A 2BCJQ 1VARA 1G64A 1M5RA 4B6QA 3UMJA 1WAMA 2FEWB 2Y71A 3TSOA 4WK6A 4BGDA 3B20A 1X7YA 4M0MA 2BFDB 5DM60 3FDFA 1SZCA 1OYWA 1U3CA 3PXBA 1MABA 4Q12A 2QMQA 3FMGA 4CMIA 3F2VA 2P6OA 4EG4A 5BV7A 5KIAA 2OTMA 2XT9A 4J1SA 4U7HA 4O08A 3K9AA 1O03A 4ABYA 3S7TA 5A1TA 2ZI4A 3DZFA 4TRNA 4DN6A 1XKTA 3FPFA 4UMDA 4C6SA 3RHFA 3CVVA 2Z4SA 2NXWA 3DC7A 1F8FA 3ANNA 3LLVA 4WNYA 5CBPB 5KNDA 3DHEA 2BEWA 3DEKA 1EXDA 4ZICA 1YIJV 3BJZA 2PBRA 1V71A 4NLLA 3WGGA 1QGYA 1QCEA 5EEGA 3A11A 3U4MA 2O8CA 1U5AA 1YTFD 2Q0OC 1W1WA 2Q1WA 2ORWA 2ZU0C 3DEIA 2PSFA 3MVEA 4JAVC 4M9ZA 4NEHB 1JFFB 5L7TA 1ECPA 2OT3B 4IIXA 2CJWA 5K1XA 2VCYA 2NU6B 4M21A 2H7YA 2Z09A 1LQTA 2JCGA 5TQVA 4Y9TA 3BK2A 3DGEC 5KYXB 3B8MA 3JD0A 4JU8A 4YAOA 5I7VA 3MOGA 1QVRA 3O8DA 2BSKB 3ORRA 1NVWQ 3BMQA 3E27A 3O8QB 4LCJA 4MR9A 3LK6A 1UOPA 1KZGB 2FHPA 3F7OA 3KM0A 2PXCA 3ST7A 1DC4A 4ZZIA 1CEZA 2OXRA 1DJMA 2C5EA 4ZWNA 4B4DA 1LNQA 1VQ8F 5L4NA 3DXRB 2IUEA 3GH3A 3LX4A 3O90A 4BO8A 1JJ2U 4ISBA 2HS4A 1J2RA 4MI3A 4E12A 2J08A 1IBSA 4CTJA 1TKCA 4BO2A 3W6NA 1XQ9A 4EOGA 3GNQA 4Z7QB 3KJHA 1RWWA 5BVGB 1EUCA 4H3SA 3W4KA 3DGFC 1SERA 1GQQA 4JL8A 3C74A 3Q5DA 4HAYA 4DKJA 3HSYA 1JSRA 2N05A 2JH3A 3F98A 1RWBA 5I9NA 3OAAD 1YQDA 4XH9B 2ZAYA 5D3MB 5A5DA 1W5FA 4C2BA 2WFLB 1JEAA 2V7TA 1JH8A 2XCTB 4UV8A 3OMIB 3IPAA 3TUZC 4XB2A 2WIFA 2Q7OE 2O4CA 3OIFA 4J0DA 3T7EA 4BNYA 4UUMA 3UUGA 4UM5A 4O4JB 2I34A 4RKEA 4X9XA 2QE7G 1PI3A 2HSDA 1V4NA 2QMYA 1GTMA 2YWEA 1VQ8V 3N39C 3NH6A 4GFDA 4PRLA 3SK0A 3TMYA 3V00A 3UENA 4LTDA 2H8CA 1U0RA 4HN2A 2W8ZA 4R1TA 3VU9A 5KWEA 5KOIA 3ZV3A 2AGAA 2ZRGA 3KXIA 4JI7B 1EFRG 1TXGA 1Z8HA 2WFLA 4LIPD 4LJSA 4ROSA 2FMHA 1FK8A 4HVLA 1ZKDA 5ES3A 3W34A 4B2PA 1I2MA 4IV0A 1WPXA 4QGFA 4WW0A 2HNBA 1YXBA 3KR2A 4KKVA 4L8VA 4ZQCB 5K6TA 1E2UA 4GZMA 4KEAA 4MYTA 1QF9A 1KI3A 4QOHA 5ITVA 2WZQA 4FS8A 1K73H 3IXMA 1U0NA 4B85A 2Q6OA 2H2IA 3AW9A 5K51A 4E21A 2IXEA 2XYQA 1G8SA 2DQKA 2G4CA 1EBBA 1UK9A 2WUDA 4QOIA 4Q0MA 5B1OA 1U0BB 1Y8CA 2IZ7A 1PLJA 2G0NA 2Z8YA 4KI7A 4RJ2A 2QRVA 1KU9A 3B1VA 5FV4A 1A0OA 4G89A 4JP5A 5E7MA 2BSKA 5TMBA 4H7IA 5BP7A 5JSQA 1IHPA 1L4HA 4BRZA 3KKNA 3RYTC 4BNKA 2X5NA 3OPYA 4WOBA 4WBXC 4CQMD 5LXTB 2MJLA 1OXMA 4YASA 1H8ED 1YNSA 3CRCA 1TEHA 3PXXA 3J7AR 1AF4A 1NTOA 1GQRA 4MUNA 5HIJA 4YUWA 1JQEA 1H6CA 4YLYA 3GD7A 4R7TA 4L4XA 4F3YA 3QVGA 5I48A 1I7SB 1BDJA 2WT9A 5GOZA 1K6MA 1O96B 3L8CA 2GZ1A 3CRW1 2YIAA 2WU3A 3NGLA 4BV3A 5TLSA 4NH4A 3UHAA 1H8HD 3RM3A 3JCUZ 2RGYA 3EIFA 2CVQA 3QH4A 1E9SA 3B1WA 4YREA 1CZRA 4RVCA 2IH3C 1GTL1 4U00A 5AESA 3IJRA 2A79B 1PTJA 3LFHA 3V1MA 3CCRV 1DJQA 1AGYA 4C8GA 2YFYA 2MR5A 4JT2A 2IBMA 2PKEA 3FKJA 3TPZA 4I5DA 5DMXA 4I1PA 4J9UE 4ZCRA 4GZRB 4COKA 1T4BA 3T9DA 2AKAB 4OMDA 2G06A 1GA1A 2ICAA 4IKEA 2B36A 4FMDF 4RLFA 1PPJH 1TCVA 4KU4A 3UUFA 1VLJA 4BJ1A 4DAEA 1G8KA 1EDZA 3JD3A 2ZJYA 5DYIA 3X1JA 3COJA 1FZTA 3WLFA 2JFFA 3KTAB 1U3UA 1Z6GA 1T0UA 4E1VA 2JK5C 3C3SA 2P4QA 3U0BA 5JALA 3F8SA 4JLAA 1SVKA 5TX7A 1JL3A 2BGTA 2GYWA 4LVOA 5CT5A 1SKYE 3MMNA 2C2AA 3IAXA 4X54A 5AM0A 1X9IA 4FWIB 4RD4A 4QPPA 3OCWA 2ZIOA 3H6KA 1UMDA 2FOIA 1JDTA 2BUCA 1WHTA 1WXXA 1KAMA 5KA6A 4IW3B 1CDDA 4FD2A 5E1BA 1D5WA 5I7SA 3I34X 4MXDA 4ARIA 1MTZA 1XMIA 1E79G 3TBHA 4HUQA 4S12A 4FSHA 2QQ5A 2WP0A 5ESXA 1N2EA 2O0HA 1LFAA 5JQGB 4TGLA 3M84A 4P9PA 1J7HA 1E1DA 2I6UA 4RVNA 3EA4A 5DLYA 3PC4A 1P0CA 5BURA 1KI2A 1QU3A 3CT6A 1I0LA 3IUSA 4FC6A 4NBKA 2IK8A 3HADA 3LDFA 3OQMA 3L1JA 4W4KA 1N5DA 4ZTBA 3S5JA 1G98A 2QM8A 1XNJA 2EHJA 3MCAA 3S02A 4EMBA 1BYIA 4M9QA 1VZ3A 2FQXA 4WKNA 4XVCA 5JZMA 3IR9A 3U56A 2BTOA 4MVJA 1L5WA 1I4EB 4CKWA 3C98A 1YKFA 4TWZA 3WIOA 3QOXA 4C7JA 5MN5A 2QTTA 5A2QN 3A4MA 1JPXA 3MTEA 3E8MA 1PNMA 1PDVA 5B7PA 4XWKA 4YCNA 2HP3A 4GGOA 4KGVA 2DAPA 2O05A 2ZI7A 2B30A 3DTVB 4Q9IA 1EBFA 3UJCA 4L9AA 4GOLD 4OQQA 1YRHA 4B6RA 3LPNA 4PDRA 4I55A 1BWPA 2HDNB 2N75A 2JF0A 3DUFA 4UBMA 3UUWA 2E7ZA 4MEAA 4LOLA 1BAPA 1X9GA 2ZXWC 3PDHA 3PR2B 4H7PA 2O5EA 4DA8A 2G80A 2PD4A 5EIWA 2WQZA 2PV7A 3K1TA 4PCAA 3GT0A 3I92A 4NZMA 3KX2A 4IWXA 1ZCJA 3D0KA 3K0BA 1EXVA 2HQOA 3DKVA 3ZWYA 2CDBA 4BFXA 4W1RA 1OYOA 3IPLA 1Y1LA 3KWLA 5JMPA 2PMDA 3P4XA 5CLJA 5MGBA 2C2WA 1B41A 3F2IA 1W55A 3FYSA 4IIJB 3OO1A 4WHMA 1RQ7A 2PTHA 1WCIA 4ZT5A 1INLA 5KKCA 1J5EO 1LQ2A 2WHRA 5J2TF 4O4IA 1X1AA 4RZUA 3QKSA 1VZ2A 2NGRA 3IEXA 1AXGA 5EXTA 3T5GA 4S0ZA 1WPQA 4DLXA 1OT5A 4JQZA 5EHQA 1MVNA 2CLHB 1ZJWA 2QBYA 4RA6A 5KKNB 1SZTA 2J4DA 3SKXA 3JQGB 3VU3A 4N9WA 2CHEA 1CETA 1KI6A 4QAJA 4RY8A 1V3UA 1HXHA 1QZUA 2C57A 2CNWD 5DHSA 4D98A 3TDMA 4MR8A 5AOVA 2C5AA 2OGWA 2YXBA 3HJHA 4PFSA 1KZ7B 3VV3A 1ZVMA 4P7GA 2JFZA 3MB5A 1YAJA 4DLVA 1AGRA 3F0GA 1TCCA 2IJHA 3VOTA 1IRXA 1X8KA 3LT1A 5CAEB 2R65A 1TZMA 5ICGA 4K8ZA 1J5XA 4HS9A 2H59A 4KK3A 4B5LA 4Z1MD 1G291 3WP0A 1GSOA 2QWNB 3ABKB 2J3KA 2NYUA 3EIHA 4NV3A 4EEKA 1COWG 1EVQA 2ATIA 4WOJA 4CE6A 3ERCA 4CMAA 4INPA 3T54A 2XAJA 3JWGA 2PXHA 4ZJZA 3H13A 3IEVA 1BMQA 5H1YA 1GADO 1RI5A 5AG2A 1V4VA 3D2AA 3QPUA 3I3OA 2LKDA 1NUQA 1S02A 2JDIG 2CXHA 1F06A 1J8VA 5B1BC 1PFGA 1ZSVA 2HJRA 3FNQA 1Q7TA 4AQYB 4GZLA 1OLUA 3GF4A 3IUMA 3K1ZA 3IJ4A 2OBNA 3QMWA 4BE9A 3GJ4A 3KJIA 2YJTD 3CCBA 4CZ2A 3VKVA 1ZNWA 2I1VB 4O1IA 3C9UA 1QBZA 1CS4C 1XCGB 4X00A 4AYXA 1RACA 3PXCX 3IMFA 4KXWA 3ACCA 3IP8A 5FI0B 4ED9A 4S04A 4LQLA 4LRSB 4PE5B 3D3WB 1SO8A 4RETA 5A02A 1IM2A 3GR6A 3AYXB 2FZ4A 1TK2A 4U7JA 2QVCA 1GL3A 3ITDA 3N6VA 1I5XA 1KI6B 5FTJA 4AJ9A 1YJ8A 2IOQA 3NX4A 1V3QE 3IRVA 3OG9A 4HMPA 5ENDA 1VE7A 5LP6C 2ZR2A 2Q21A 4YJDA 1IOVA 3CF2A 3G2LA 3TD5A 5EQJB 5KDLA 4BAYA 1RI4A 2FNAA 3OQVA 3JAMA 4ZU3A 3FB5C 1E6WA 1ESEA 3EA0A 4ETIA 3BYQA 3SYAA 4ER7A 4E5UA 1TU3A 1W0JA 4I5IA 2EL7A 1NA5A 1OLXA 3EQ2A 4BVJA 2NQTA 3LK7A 1J9GA 3GUYA 2I33A 1N6NA 3B1JA 1KY5A 3IBGA 4PC2A 4M1MA 3NWPA 4DV3O 2G70A 3ON5A 4JDPA 1A7AA 1JDSA 1UBNA 4FLWA 2A58A 4L1KA 4OXRA 1CF4A 2OKGA 3A36A 5IXSA 1N6HA 1GTSA 2EFCB 1DWQA 1SG6A 5EK0A 1OXXK 4J9YB 3CXCU 3GY0A 4ZOQI 3HH8A 5H02A 1MOFA 1FU7A 1VQ4V 1KK1A 4LNHA 5DHFA 4C30A 4MICA 3RFXA 4AP5A 4B1FA 4BMVA 5KO2A 2VJPA 4OHXA 1PLLA 1RHUA 4B80A 3WLEA 3KKZA 3KVYA 4P7BA 4X1KA 3P27A 1PX0A 2ORED 3MTQA 3KQOA 5F5XA 5LYYA 1F4PA 1W3EX 1B14A 1DK1A 5AHRA 3FD9A 2WLMA 2UUAB 3EAQA 5J43A 3UH1A 3ET4A 1MOQA 1PR6A 5BQXA 3C14C 3KJKA 1HOXA 4H7EA 2C2OA 2PZBA 2W58A 2A33A 3ETLA 3COVA 4MZDA 5A7FA 4TYYA 4X1YB 4ZHQA 3TIFA 1CQWA 1M2JA 3TZCA 2AHOA 1WUIS 4BVEA 5BSKA 1XHOA 5L3BA 2O2YA 4MVMA 5FUMA 3MCAB 1YZ3A 2GPYA 4NU8X 4AKEA 1YOBA 4TZZA 4NKRA 2WNIA 3VHXB 2J3DA 4F4LA 3NYQA 1L6IA 1PZNA 4N0QA 4HZGA 4AUNA 4EMUA 4U6QA 1CE8A 3ZRWA 3FDJA 2ZNIA 1NRWA 1KP9A 1D2DA 1W25A 1XNQB 2BVNA 3BFXA 1VQOF 2CMGA 4WK2B 4ITUA 4DE5A 3E3MA 1SQFA 4NTXA 3T4UA 3T9BA 1VQ5V 3K73O 4EFMA 4D97A 5KHLB 2HQ1A 4JTAB 1T3SA 4PZYA 1KBZA 3NI2A 4XR4A 1ZUWA 1QMGA 2G67A 2QEXV 1F1JA 2KWIA 1K7SN 4I8XA 3U3RA 2BL4A 4WKGA 1K7XB 4E4YA 2UXCO 2QYOA 1L5YA 5TJHA 2JB9A 4MB2A 1Z88A 1ZC3A 3TSWA 4WLFA 3URMA 4URYR 3V34A 2IXAA 2WMOB 1LPSA 3ENZA 2VA9A 2O7NA 4A16A 3HUUA 4ZCLA 5EGSA 1NW3A 4FLZA 3VPDA 5GVSA 3C6YA 1BS1A 3KHSA 4LZNA 5ITZB 2WM8A 4C0HA 5JH7A 4CR8A 4F4HA 1S0UA 4YCJA 1LXCA 3L7BA 1NXTA 1PJ4A 3R5JA 3WHKA 3AR7A 1QOZA 2A7QA 5THQA 1D6SA 1QBKC 4AJJA 4YRSA 5E2AA 4EPTA 3W0LB 4R8CA 4BECA 5C8YF 3OBIA 1BHAA 3NUZA 4MTFA 4KQHA 1ZY2A 2IY7A 5FJ4C 2W83A 4GP6A 3GJYA 4L8JA 3ZCSA 3VDNB 3ZXUB 2JGUA 3H5OA 5CVCA 1QR9A 1EFDN 2LGJA 2R8EA 4YROA 4YPFA 1XV5A 2BW0A 1S5PA 2HIAA 5JWPA 1CY7A 4RSGA 5HMMA 4M76B 4BLWA 2CUTA 5F77A 5HQ3A 2DUUA 2F9MA 3FCSB 3B38A 2YZGA 3VBEA 4JXXA 1S89A 3KJNA 1G5FA 1HC7A 2VDWB 2ZIZA 4RPCA 4PPGA 2LCAA 4MOWA 4OI1A 1FJHA 3DD1A 3I73A 3MSCA 10MHA 1ADYA 2H1OA 2H06A 2YHAA 2HAEA 1U0LA 1B93A 4W1PA 3NT5A 4TT3D 1SBIA 1SU8A 1A3CA 2I4NA 3NIBA 2WZCA 3PPVA 4HWOA 2F64A 5A5GA 2X6RA 1VHTA 1UCFA 1M56C 4RFVA 2ID8A 4LFAO 1E2PA 3F3KA 1YRBA 2I4OA 1PZHA 2O20A 4BC1A 4E11A 5L45A 1DOHA 2REOA 4JI5O 3GLKA 4IHJF 5FHRA 1YU6A 4EO7A 3LCRA 2JLUA 3F0EA 2GJSA 3IEIA 3M1XA 3FUVA 4GLJA 2AEJA 6NULA 1AT1A 1MFPA 2CJFA 5JANA 1ENYA 4EUEA 4N76A 1A8IA 4NMHA 1OCRB 1NXQA 2F8TA 2Q3CA 3RRJA 1GL7A 2QVYX 5CA0F 2CXNA 1MJHA 4IOJA 4RDXA 1I5YA 2EBOA 4DIKA 5M7EA 3BPZA 2P4SA 3QVSA 3SQLA 3AINA 1IV1A 1PF7E 1YBMA 1EP1B 3OONA 2AQ8A 3CXCF 1Q7CA 1T9GS 2BEUA 5E8JA 3OJCA 5LQSA 3HV0A 3WIVA 2R84A 3HUDA 1JWAB 4Z9FA 4B08A 4D4JA 1D2RA 1MZEA 2Z3YA 1QHYA 2X86A 3PPXA 3GN1A 3L8FA 1S01A 3KYDA 1CUWA 3P2YA 4GC9A 3F5SA 5CB4F 2P9FA 3NAZA 4LF5O 3H6HA 3TLGA 1FTNA 4BRWA 3NHKA 4I99A 1XVVA 1KC8W 1U3PA 2YQZA 4QTTB 1KMQA 1LJ8A 1V16B 1N6IA 2IDJA 4KLRA 1U3WA 1J22A 2QAGC 5I47A 1RWKA 3HBLA 1G8HA 4WXRA 3EB9A 3VJLA 2X0EA 1EINA 2VLIA 3DE4X 3L6OO 2WA1A 4WLOA 2O1XA 2PK3A 1B2RA 1LPMA 1W0KA 2YXNA 2I80A 2BSXA 3MYRA 3JAWB 4FLXA 2BFNA 4M1ZA 1TGVA 2P6UA 1CQZA 4JLSA 4UPVA 1H2NA 2NSYA 1DRJA 1CE8B 3X0DA 1PV0A 4BE7B 1KRWA 3SBEA 4W4TA 5CNMA 3TQCA 1J20A 5EKSA 4FJ0A 4WUVA 2QYSA 1N0UA 2WICA 1X7XA 3R6LA 5JSUA 2QMZA 1I4TD 1X74A 2XCRB 5DN6D 1AQYA 3TQSA 4ZYUA 2G5CA 3HA3A 4DUGD 2XXAB 4ALKA 1Y9DA 2CLMB 5AH0A 3V3TA 4BZZA 4G4YA 5J2TB 3OE7A 4TKUB 1FOEB 2WYIA 3DJFA 4WLEA 3KQWA 5AW4A 1ONIA 2C2BA 1PNKA 3U4DA 4QARA 2B9EA 1Z18A 5C8YB 2R6FA 3FWHA 5A5FA 2ZQMA 2QA4V 2OYSA 3OESA 4KX5A 4QELA 3CJRA 4Y2SA 4TTAA 5CT9A 5E8RA 3ZLVA 4MR9B 4EUHA 5BN5A 4GLLA 3M5PA 4F9GA 1H3EA 1OE0A 3CJQA 3VR2A 3FNFA 1BE6A 3GJ3A 1LWNA 2Y1LA 1CDEA 4RZXA 2ZWMA 3W9UA 3LW7A 4KIJA 5DI3A 1BQ4A 4G5QA 4G2TA 4R8SA 1RBQA 3VOUA 3MUEA 2X0LA 5EN4A 1LCIA 1ICIA 3WYBA 5JASA 4IQFA 4NYIQ 2QE7D 4PYIA 1GAJA 1AZSC 3NOQA 4Q5IA 4A6PA 2FX3A 2VTKA 1KDPA 3F4KA 5K3DA 3T9CA 2V9YA 5EZ5A 1SM4A 2IM9A 2PMBA 2QMOA 2YUIA 3E7XA 3D2CA 4RZSA 1KDYA 3MS7A 3TQTA 5D3QA 1K2VN 5JHGB 3HXKA 3LF1A 5HKKA 3LPMA 3VKGA 1GRNA 4K8XA 2DSNA 2QIOA 1BXRA 4GSYA 1G5QA 1KYIA 3IMPA 1XEAA 3RA5A 3A4VA 4PA6A 5H6QA 2HZ7A 4PSUA 3DV0A 3TTXA 4P4LA 3J7TA 1PZGA 5LQCA 2QRMA 2OCPA 1T3HA 2OV3A 2VWGA 3S40A 2AF3C 2AJDA 5DGHA 2J9GA 4FTWA 3SXJA 2D62A 4D7SA 2ZODA 1KYVA 1QE5A 2YXLA 2DC1A 5TISZ 3B2NA 2UXDO 3BD8A 1HDRA 3BORA 5IJ9A 3F5WC 3JQBA 5FOXA 2CHFA 4BPBA 3RYIA 4MUJA 1UEXC 2OFFA 2HT6A 2VK2A 1NJSA 3H2HA 4DR4B 5CFLA 1RYZA 4RPKA 1QHHB 4Y6RA 8ATCA 3DBLA 4UCUA 3HB4X 2DB3A 4IEEA 1RMYA 5PNTA 3N2NA 3W7WA 4H37A 3RARA 2QS9A 5AK4A 3CR7A 2XF8A 1TAGA 4D9HA 2DGDA 2J3LA 1FQKA 4H3KB 4AKIA 2X0JA 1T8TA 3AG5A 3ND8A 3ZZMA 5JS6A 2YMQA 1BOOA 5LQNA 2AXEA 2JIMA 1OHHG 3RVPA 1BTOA 4LJKA 1QWOA 2UAGA 4RYDA 5ALOA 5AI9A 4Z0NA 5HWSA 5JO0A 3VJRA 1PUIA 4Q3DA 1GRVA 1NP6A 2HC9A 2NU8A 2HREA 3Q11A 4FBLA 4HQKA 4HUJA 3LHKA 5EE9A 4P9OA 4PGMA 1AROP 2QUAA 4PFKA 4AS3A 1M2FA 2ACVA 3MGBA 1JDUA 4GH5A 3DO5A 1ZUNA 4JGBA 4R31A 5DTIA 2ASEA 1DMRA 5CJJA 1GZUA 5REQB 5CX1B 2RG7A 4XLLA 2IS4A 1KI9A 4CL0A 2A0KA 2IYUA 3KJQA 2BKUA 4F6CA 1ZRHA 2XQKA 4AP9A 1DLBA 4X20B 1VQ7F 1QLEC 2XDQA 5KMGA 4ND6A 1FSPA 2Q7XA 2WVHA 4BJ5A 3PLNA 2DTDA 3ELYA 3LWZA 4FEGA 2W2MA 3AR5A 3EGEA 3C3DA 1A4XA 4LOKA 2IUUA 3EZ7A 5IHXA 5JD4A 3C6BA 3K12A 2W6CX 3ISJA 4C78A 4EKIA 5JC8A 4TQ9A 2EIHA 4BVGA 2H2FA 1TAQA 1L5ZA 3U44A 3ASZA 1MO5A 3V7UA 4TSRA 2EINB 4R41A 1V9SA 5LXTF 3ZXSA 3F7NA 4RIEA 1O94C 1WL8A 4HDMA 4LJ9A 1OH5A 4FHGA 4J2OA 5LOVB 4NYJQ 5J4YA 1N2CE 1D5CA 3WLPA 1YRYE 3OT1A 4MRMA 3EZ2A 2PTMA 4P3XA 1FS4A 2R751 1LNZA 2F1OA 3PRYA 4MARA 3Q3GE 5EC8A 3DJYA 2OTJV 3ZEDA 2OO5C 3AEQA 1GV0A 1B16A 3WGZA 3I2FA 3F1KA 1U8ZA 3OOEA 1YJCA 4OJNA 4N1AA 1AZTA 1ADFA 3JRXA 4NZYA 2HRBA 3LXUX 4HBZA 1R8JA 1E58A 3PQ5A 1I7PA 1YS6A 2R8RA 3EDCA 3NHSA 1QS0A 3EFFK 2VJOA 3G8DA 3H1TA 1HE8B 5E95A 3L92A 5AJUA 5JSHA 1PJBA 3VQWA 5BWNA 4PXSA 1JWLA 2VQEB 2FV8A 1PSDA 1Z37A 2ONJA 1X77A 5IKPA 2OL4A 1T9KA 3KUUA 3BMOA 3DOHA 2AX4A 4L5JA 1QFXA 4BNLA 1Q2XA 1YRAA 2O8NA 2MINB 1CR0A 3B13B 3NTRA 4DV2O 2W6OA 2ZJ0A 3EXHB 3NEJA 2D74A 3GFSA 5K3FB 3WLTA 1O8CA 1Q2UA 4D3ZA 4Z54A 3OCCA 2CHGA 1WW8A 5I9LA 3R65A 2WFAA 1MBZA 2I9PA 1SCAA 5EC2C 4F4UA 3LT2A 2WJ3A 5IF3A 3GPIA 5JJCA 4Q4JB 3U3MA 1SKVA 3SG0A 4IDFA 3KKPA 2YHIB 3KVOA 2IC5A 5DWVA 4FS3A 4LFAB 9LDBA 4FDAA 2E4ZA 1G66A 1E2MA 5GZ6A 5T3YA 1YDWA 5F73A 2OAP1 4C4PA 4D0SA 2G4LA 4MCAA 4QTXA 3DHYA 3S2FA 3TLCA 1XEWY 4Z7JA 3VJKA 4JT4A 1QKJA 4ZJYA 3WZLA 4EHHA 2VRWA 2O2XA 4KE8A 1FS0G 3Q98A 5HS6A 3ME5A 2KKWA 2V4ZA 1QUEA 4CBVA 1O6GA 1R5NA 2IZ0A 1VI5A 3TBFA 5HDQA 4JLBA 2EYUA 4Q01A 1XR3A 3WB0A 5TEVA 1BWRA 4J7KA 1KJYA 3MS2A 2G9NA 4E31A 4F2DA 5J4VA 4CEJB 1CUBA 4XM1A 1DEAA 2XUGA 1JQ3A 4K6HA 3VR4H 1WXFA 5DM4A 5I8PA 3K4HA 4QKQA 4E5PA 3H3FA 3GFVA 1FBNA 3SVZA 2AFHB 3PUVA 4LFCO 5COBA 1VLZA 821PA 4CM8A 5EEHA 2HV9A 3LSQA 3DFKA 2UZ4A 5LA6B 3OAAG 4JR1A 1YWGO 3K5HA 1VQPF 2DRIA 4FINA 4DV1B 4OAQA 4ETMA 3BF7A 4QICA 4K35A 1XZLA 2FLKA 1N0NA 4EQZA 5GINC 1HDCA 4NOMA 4OM8A 3VGJA 3B78A 1PYGA 1G7TA 4XLZA 1QFJA 4I14A 4L3OA 4REOA 5ALUA 1BJTA 4IDDA 1VXRA 1RKXA 4L4RA 3PZBA 2X9LA 5ADHA 2OORA 4J1TA 1RS0A 1BG6A 2J0EA 4CCWA 4YV2A 4ICGA 1Z62A 4JOCA 1ODKA 2FQYA 3OCJA 2P2YA 2B4QA 2X9QA 4YAEA 2PNJA 3V6MA 4YY3B 4C4YA 1ZIOA 1GO0A 2O57A 2OHFA 2OLKA 3G7UA 2AFIA 2P2LA 4H0NA 4GRDA 1V6AA 4ZP1A 4BB6A 3LSSA 5K3CA 4BFVA 1Z3CA 4BMZA 4TVSA 1W36D 2WF5A 3I0NA 1CVLA 2OHXA 3L7DA 3PD7A 5C4IA 3ICXA 2RJOA 3EODA 3WIEA 4KOEC 1G6Q1 3RYCA 1GAWA 3B9QA 4DFDA 2GM4A 1NJFA 1B8PA 3BXHA 4M0EA 1J25A 3ZRSA 4DIDA 2EV9A 2GPBA 1DUSA 1U11A 2QWXA 1VP3A 2QRVB 3D6TB 4WFQA 4CM9D 2P78A 3I2HA 2FMIA 3EWNA 3H1PA 3V46A 3OLCX 2V6GA 2GVZC 1MIOB 4OH1A 3C16C 2CNLA 4NYMR 2PMPA 1JAXA 1SD2A 3GD5A 1HPLA 4GX1A 4ZQGA 1TZCA 1PJ3A 2XSZA 3MPOA 5F76A 1Q1GA 1IHOA 4C43A 5B64A 4EKEA 5C7OO 3WB2A 2AW3A 1SQ0A 1UM8A 3O84A 3R9XA 1H9AA 4IIVA 2H6LA 4QOJA 2ZI3A 4XDZA 2BJWA 4IS3A 1PR2A 2R62A 2E74B 1YRLA 3BMNB 2RJZA 2AMFA 3GQVA 3Q87B 3FAZA 4DNPA 4ND5A 5AW2A 3D3IA 5JXJA 1L4LA 3RK0A 2NU7A 1TD9A 4LCEA 5F1PA 2HIMA 1ZL8A 3OCXA 4BTVA 5DV9A 3LS2A 5KQLA 1JEYB 1EAYA 3AQ4A 3P2IA 2BZ0A 4ABTA 2D1QA 1KMCA 1EB8A 3RO7A 1XRSB 4AG3A 1FNSA 1AKEA 4JJFA 3ZQKA 3BABA 4NYMQ 2NQ8A 4QLOA 4BU1A 1ISJA 2W6JD 4A73A 4C4XA 5A4KA 5K2OA 1T5HX 2YS7A 4UM9B 5HP7A 2ZJ5A 5BVHB 4CEIA 5J4LA 2CT8A 2V65A 1KR2A 1QCYA 1YNOA 1AUPA 2CSUA 4M86A 4PHTA 3FSEA 4LHXA 3AVTA 2PLFA 3BA8A 2N1BA 1NURA 1YE5A 1PR0A 2IF0A 4EVIA 1Z2AA 3SXUB 3K71B 3CCLV 3TZEA 2ZRLA 4KFSA 1N0IA 4QQRA 3K15A 4J4HA 4BVHA<