5EYPB

Tubulin-darpin complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
431
structure length
425
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Destabilizing an interacting motif strengthens the association of a designed ankyrin repeat protein with tubulin.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Cell cycle
total genus 178
structure length 425
sequence length 431
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5eypB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5eypB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5eypB01
5JVDA 3WGJA 5LP6A 1RLUA 2Q1YA 1Z5WA 1W5BA 5C8YA 1TUBA 4I55A 5EZYB 5FNVA 4O4LB 2BTOA 4WBNA 2XKBA 5LA6B 1SA0B 3JARB 1JFFB 4X1YA 1FSZA 3RYFB 4ZI7B 4B45A 5MN4A 4FFBA 5LXTA 4X1KA 3RYHA 3E22A 4ZHQB 3JATB 4I50B 3JALA 1RQ7A 5ITZA 3N2KB 5IJ0A 4IIJA 3N2GA 3HKCB 4YJ3B 5IYZB 5EZYA 4YJ2B 1OFUA 4O4LA 3VO8A 5J2UA 3JAWB 4O4JB 4DXDA 4E6EA 4O2AB 3RYFA 4ZI7A 3JAKA 4EI7A 2VAPA 5EYPB 3WGNA 4ZHQA 1W581 4I50A 5GONB 5MN6A 5LOVB 3VO9A 3HKCA 3JASB 4YJ3A 4O4HB 1W5AA 4X20A 4YJ2A 5LP6C 3HKBB 2BTQA 4U3JA 3UT5A 5JH7B 3JAWA 2RHHA 4I4TB 3VOBA 4XCQA 4DRXA 5J2TB 5M7EA 4TV9B 5CB4A 4HNAB 3WGMA 3RYCB 5KMGB 5GONA 3WGKA 2Q1XA 5LA6A 1SA0A 3JARA 1JFFA 4EB6B 3JASA 4O4HA 4EI9A 3HKBA 4O2BB 4X1IB 3CB2A 4F6RB 5CA0B 5JCOC 3ZIDA 4KWEA 3HKEA 5J2TA 3JATA 4IHJB 4TV9A 3WGLA 4TUYB 3M8KA 3ZBPA 4HNAA 3N2KA 2RHJA 5LP6B 5EIBC 3RYIB 4U39A 5KMGA 2VAWA 3M89A 5IYZA 4I55B 4WBNB 5LYJB 2VAMA 3HKDB 4EB6A 2R751 5KX5B 4O4JA 5MN5A 4EI8A 5BMVB 2R6R1 4O2AA 5CA0A 4O2BA 4F6RA 1W5FA 5LXTB 4X1KB 3RYHB 5EYPA 2XKAA 5CA1B 1FFXB 4IHJA 4ZOLB 5ITZB 5JQGB 5IJ0B 2RHLA 4IIJB 3ZBQA 4LNUB 3RYIA 3N2GB 3C8LA 5LOVA 5IJ9B 2RHOA 1TVKB 5LYJA 3VPAA 5J2UB 3HKDA 5JH7A 3VOAA 4I4TA 4TV8B 5KX5A 1W59A 3RB8A 2VXYA 3HKEB 4O4IB 5BMVA 4B46A 3JAKB 5JVDB 4M8IA 3RYCA 5CA1A 5C8YB 1TUBB 5FNVB 1FFXA 4ZOLA 3R4VA 3V3TA 5JQGA 1W5EA 4LNUA 4X1YB 5JCOA 5EIBD 5IJ9A 4X20B 2GVIA 1TVKA 1Z5VA 4FFBB 4X1IA 2BTQB 4U3JB 3UT5B 3E22B 1RQ2A 4DRXB 4TV8A 3JALB 5CB4B 4TUYA 4O4IA
chains in the Genus database with same CATH superfamily
2O8CA 4LDNA 3AKZA 4KGZA 1Q81H 1EGQA 3BA1A 1CNEA 2ZJ3A 2FPPB 3I39X 4K9NA 4NOLA 3A11A 1WDWB 2ZP1A 5FUVA 5L95A 4A6EA 1SCKA 2AN3A 1Z0AA 4CKWB 1A95A 2IH2A 1EP2B 3EGEA 1U65A 2UYNB 4MULA 2P7HA 1WD5A 3CW8X 1AG9A 5LM3A 4H44B 3EPJA 3MWLA 3ESBA 3CLSC 1E61A 4TV9F 1PR4A 1YHNA 1U8EA 4K9OA 1PZFA 3K92A 2FPGB 4DDHA 1TXGA 2J6BA 4HGYA 1KI6A 4F9FA 3D2BA 3S06A 4OL9A 3AR9A 4YI5A 3PNBA 1O94D 4FYHA 4H77A 2W8BA 3SKXA 1K5PA 5KTYA 4KIJA 5JSFA 4BKRA 4BFWA 1UC4B 1KUQA 2DX7A 2ZJ7A 1RPRA 1C50A 1FXUA 3EULA 4M6WA 4O1HA 1J8MF 5ALUA 1NXOA 1XZDA 5AQ1A 1GUYA 3AG4C 3BWDD 3AHDA 3Q0IA 4A9AA 4HFMA 5K6TA 4XDZA 3IAM1 2X1MA 1P2GA 3ZOZA 2BAGA 1AB3A 1LF0A 4R1PA 2HM7A 3EISA 2ZYAA 1XZAA 4QUAA 2MINB 4CUJA 3PXEA 1ZKDA 1YJNF 4R0NA 4HFNA 3U2QA 2QR5A 4WZBE 1V5GA 1QP0A 1NVKA 1PK9A 2B98A 1GAQA 3N27A 3OOWA 5EHXA 4RMJA 2PLWA 3LECA 7ADHA 3CT6A 1DC7A 2YRWA 3FN4A 3OZAA 1L9XA 2XCIA 4KV9A 5F5NA 2KG4A 4RQBA 2IV2X 1U7DA 2GFQA 1R6NA 3X1JA 1NMYA 5KJ6A 5F2NA 4EQZA 4IGGA 1UZAA 1TM7E 4DMFA 4RQFA 5K09A 1LFAA 5FTKA 3DDNA 4L6IA 4CXMA 5A4IS 2XI4A 1OT5A 4BU1A 2EFYA 3LG2A 2QQGA 1K88A 2RH8A 2QRLA 1OV4A 2JCXA 3TEFA 3P20A 3M9WA 1RC1A 2F43G 4P5DA 1UMKA 3FNRA 1R0LA 4LZOA 2YV5A 3WQRA 3TLMA 3R7FA 3V97A 5AJYA 2CMHA 5L3QB 3NHWA 2UXDB 5TB5A 5DE3A 5CNMA 5HX7A 1Y1TA 4BRSA 4IV5A 3CEMA 3HU5A 3OKPA 2LCIA 1ZCFA 3RARA 1N6KA 4BTVA 4FKBA 3P0ZA 2J3QA 1K06A 3ZLJA 2GRAA 3THSA 1X8XA 1BKDR 5ULLA 1W0CA 3AK3A 3LDHA 3AF3A 4PFSA 4KE9A 3V2HA 3TTUA 4JMPA 1PR6A 1Z62A 2BIFA 4G65A 1XQ9A 2GAAA 3UJDA 4JEMA 1P49A 4JASA 2Q2NA 4JLUA 3QO8A 4G4WA 2JLBA 2IYAA 4H6WA 2ZIZA 1DJQA 3HRKA 1WP9A 3WJRA 2VRCA 3GA7A 5JZOA 1WB8A 3K1AA 4U2FA 3G2OA 3S02A 1C4KA 5ITZB 3FA2A 5K8JB 2WI8A 2HHCA 2X23A 2X6TA 3K70D 3M81A 3I9LA 4O4IB 3CCLV 4PXSA 2Q5LA 4DUGD 1W5TA 4KAXA 1XQVA 4LV8B 1A76A 4L3WA 2D59A 3PQFA 4H3VA 1PW7A 2I99A 2ZITA 5AP9A 3LLSA 2XMRA 2GSMB 2F1MA 1UI9A 2NX2A 3W1EA 5HRAA 4R6ZA 1X7XB 4PU0A 2FRDC 1KYVA 3OOEA 3KXKA 2PTHA 3SQLA 2W2XA 2FVYA 2VWQA 3SYOA 1H8ED 3R8XA 2OOKA 4R5MA 1OD6A 3LKVA 4UCWA 1CUYA 1WVGA 1ZPDA 5FO0A 2V3WA 1E6LA 3B13B 4XYBA 2O6LA 4XGIA 3RH0A 3T5BA 1IBRA 3NONA 3LDEA 2W6IA 2WU1A 5ALJA 1N0NA 3OIYA 4MNTA 3VKUA 1WR8A 1NNSA 3G1WA 1ZP6A 3Q9UA 4YRCA 1GTOA 2VPQA 1AJNA 1GILA 5AESA 1WU7A 5LKRA 1T24A 1A3CA 1V6AA 1FNJA 5FPOA 2D8MA 1F5NA 3CE9A 2I4RA 5HUJA 3DOFA 2FPXA 1HNWB 2F8MA 1E5QA 2AMFA 2C4HA 3EXEA 5IWAB 2BO1A 3P27A 4NL4H 1GGMA 2FF5A 3U0VA 2HEPA 3M4NA 1M3SA 3SHVA 1E9EA 4DFDA 4LBYA 3K6JA 2MHCA 3VC7A 1RDFA 3DZKA 1FEZA 4TTAA 1ZOLA 4R2MA 3FLMA 4KDFA 5A9RA 1S0UA 1E2UA 4KH0A 4QLAA 4L07A 2VCYA 1X6VA 5BR7A 1NMZA 2J0UB 1H5QA 4B2IA 2X9NA 4LF7B 2FWJA 3P97A 4R8RA 3TLYA 2DLCX 1VHTA 2NMUA 1WMSA 4J3NA 1ORQC 5EAZA 3TJRA 3TSWA 4EY5A 3T06B 3NPAA 2D54A 1WXGA 1NJ6A 4JLSA 1ZONA 1PLLA 3OOJA 2IYEA 2FLVA 4A91A 2ZJOA 2R4QA 3B53X 2BTQB 4BTLA 1MNAA 3VR5A 1OASA 4W1RA 4KCGA 2A84A 2X58A 2X0RA 4DSZA 2HKIA 1V6SA 2OGUA 4S04A 1SQ5A 2E87A 4KR0A 2ACWA 3N2KB 5JATA 3QMVA 5KOYA 3EC1A 5IM5A 3CMAV 3D8BA 4GI1A 3OY7A 1XSEA 4LRXA 3D6NB 5DK4A 2HA6A 1QP4A 4EKDA 3IKMB 2FOIA 4DLSA 1IY2A 3KYCA 5REQA 1RVV1 3SEQA 3IKVA 3FKSD 2B1RA 2CJXA 3GA0A 4YAWA 4D42A 5K8UA 1RPJA 1GO3F 2A79B 2O7VA 2XADA 5JBNA 1GZ5A 3B3FA 2YXEA 2B4RO 1SUSA 2GAOA 1G8PA 1B6QA 2EWCA 2QROA 3N2EA 4D8TA 1N0HA 5KSPA 3INNA 2JAUA 3LVRE 1RMYA 5B66Z 2WWWA 2I4IA 2PT7A 4E2FA 4I3HA 5EWJA 2VBFA 1F4MA 3G80A 1JEYB 5HTKA 3EDYA 4MQMA 4EG1A 5AI9A 1ADBA 4J3JA 4HDKB 2WWYA 2N47A 1TAUA 2F2TA 4TQUS 1W4BA 2Q6AA 1SXIA 4CLRB 1WUJS 3K9GA 2WYWA 1JBKA 5AVJA 1TX4B 3BSSA 1H4VB 3H3XA 3CH6A 1ZHOA 2X6QA 4TVOA 1CEQA 2IJHA 5ALHA 1K8RA 3SPJA 1ZSNA 3JASA 1E1MA 4KPUB 3D4NA 4ZGBA 4L27A 4FD2A 1YTFD 1FFWA 4P35A 4QWWA 5AIBA 4CZ2A 4PZYA 4HKTA 1OVGA 2QTWB 2X7JA 3EFHA 3IAM6 3SSOA 3IXLA 4A8JC 1Y74A 1QH8A 1U0BB 3BIXA 3MTQA 1W0JG 1QLEB 1V25A 1L7BA 1L5VA 2VDWB 2RBGA 1NI5A 4TT3D 4R50A 1G5PA 5ALGA 1P4RA 2ZATA 2EW8A 1TJ5A 2I7XA 1PK8A 3SZGA 2QW8A 4Q1EA 1JAYA 2Y0EA 1XTTA 2PV0A 2Z58A 3UOAB 3RASA 3AFNA 5K1ZA 2P4UA 4JUBA 2C2WA 2I2BA 1RMQA 2PXCA 2YUTA 1P5RA 2MCFA 2C59A 4UZFA 2CF5A 1T36A 4XQCA 2LKDA 2YJTD 2FDXA 1EXMA 2PGNA 3IOCA 3OZTA 2V0GA 1U2PA 3DEYX 1GPMA 1F38A 3HR0A 1N8KA 4KJZA 2DYYA 3WTCA 5E0OA 2C3OA 3MUNA 3AR4A 5E3IA 4LZZA 3NNSA 5TMDA 4IO0A 3UA3A 2R6R1 4X8LA 5CBPA 1FVXA 4CH6A 3Q7PA 1PGNA 1ZX1A 3C3XA 4JDPA 6ADHA 3I6BA 2V5VA 3G6WA 2F4NA 1GX1A 3IVGA 2BSAA 5HZMA 1JX6A 4FM0A 1BXRB 3ACCA 5B7NA 4QYMA 5C3UA 3GFVA 2DBRA 3WLAA 1ZNWA 4RA9A 3VH2A 2JDIA 1UFYA 2OAEA 2CY0A 3F5DA 1KC8W 3V8VA 4D3XA 4P2GA 3OM1A 3RKSA 3G1TA 1G2OA 4FEYA 2GPJA 2YVKA 3ZXUB 4ZEMA 2BOCC 3D8SA 3WV5A 1UT6A 1XVIA 4MQFB 4ON9A 2WG0A 2Y1XA 1DCTA 4UZEA 1LJUA 3ZQ4A 4H4EA 1X38A 3R44A 4KRFA 4NCNA 1OAPA 3ANSA 2LBTA 4IBOA 2BH2A 2QD3A 4DMMA 1N32B 3G6EF 2I4TA 4ITVA 1WBBA 4QOIA 1VLQA 2KPOA 2HRZA 4KYTA 1TTQB 2QU7A 3DTTA 3K0FA 5DRYA 1E6UA 3GT0A 1K8AW 1M7BA 3LQRA 2E4UA 5IAEA 1H2MA 4Q5IA 3I37X 1AZTA 1T2VA 2JJMA 2VAVA 3U4HA 4Q4HA 2D2VA 1F51E 4NMMA 2D62A 1JSRA 3AOEC 2PG3A 1V55C 5BV2P 2E4ZA 5B7PA 1WXQA 1JKJA 1OWNA 2G5TA 4Y18A 3F6EX 2FOXA 2BD0A 3BUSA 1WZEA 3NKVA 2VYVD 4C5BA 2JH9A 1E9RA 1LWNA 1PP9H 1PCXA 3HXQA 1L7OA 3THOA 3I2FA 3LDAA 4IZIA 4H7HA 4TN1A 1RWOA 1K33A 4YACA 4P7KA 3FPAA 2HX1A 2ZSKA 4N6GA 4NF2A 1NE7A 4G5SA 4HRVA 3RVSA 3OAAA 4NOJA 1QIGA 4BIIA 2YWEA 1FNBA 2RHBA 1KEVA 4MR8A 4YCBA 1VF7A 4LNUA 3LO8A 4MO2A 3CKKA 4AY5A 5B4VA 4B7ZA 1SZQA 4YMUA 4PI0A 5CVVA 3LNTA 2G38A 4JZGA 4JUFA 1UBRS 1E94E 5BSVA 3CP1A 1QZZA 4X60A 2OZLB 2IW3A 1SG9A 1GN4A 3I23A 3RRNA 2VGNA 5GIPC 3ZV4A 2IBMA 1JHZA 1UCFA 2C20A 3CU5A 3ZGYA 3IE2A 1GLNA 5ESWA 3MZ0A 4MS4A 4V1CI 1E2GA 2UZAA 1U8TA 2XMGA 2P4KA 4KL1A 3LCVB 4RKYA 1CDOA 1ZD3A 1NNUA 5DTJA 1UUFA 2ACEA 5KLVH 2CJPA 2P9BA 2WKQA 5AW5A 1QV6A 4UM5A 2HIGA 4P0PB 2QTCA 2QDKA 2Z04A 2Y92A 2PSJA 3A0BZ 5AO9A 2P9EA 5EFZA 3D4IA 4JI2O 4NQZA 4PANA 3WBFA 3EMKA 5IF9A 1XTQA 1VI2A 1PLJA 2IP2A 1UQUA 2I6GA 4K5QA 4DYHA 4I36A 4TLAA 6CHYA 5JROA 3RW9A 1E1LA 1LQTA 3ZRSA 1NC1A 3L4SO 4ID3A 4JP3A 5KVQA 1SCUB 2ZSAA 5LP6F 4GI3A 2AOTB 2NR5A 1JILA 3BK1A 2FC3A 1IN7A 4BRZA 3DBLA 5MN6A 3F5QA 1DUVG 3BAFA 4PIPA 4ESVA 4GMDA 5J58A 3OQ6A 1ZY2A 3GFFA 2ZIGA 4HLDA 1W4ZA 1IHPA 3GEMA 4J16C 2YXHA 2QQ5A 4KAAA 4ER0A 3ZE6A 2YNMA 2VL7A 4BP9A 3GG9A 2P0YA 2LR0A 4RHXA 1G55A 4Y6RA 1SGWA 3NXSA 4MVQA 1P73A 2GA8A 4OJTA 3G02A 2UYQA 4CPDA 2QTSA 2RD2A 4PV1B 3CCJV 5AHWA 3PDCA 3QI2A 5KDLA 3VTZA 4JYZA 1C0PA 4NVRA 3K08A 4KC0A 4PPNA 3AWDA 1W1UA 3FD5A 3FTCA 3PUZA 2DETA 1IY8A 4BQSA 3CCFA 4EQ6B 4E7PA 3LVBA 5BSGA 1T1RA 4JBWA 1GKLA 1Z13A 3PNMA 1UWLA 2PXHA 3K1JA 1U4NA 4U3JA 2E4WA 2I91A 1KIAA 4YV7A 1JHRA 4HDNA 1T0KB 4RPIA 1MC4A 1W36C 2QD2A 3BK2A 2WLJA 2Q3DA 4N7MA 4REQA 3LDGA 1TLLA 1JLHA 1VHLA 4BNDA 3MAAC 2V03A 2D5LA 4FU0A 2O8FB 2FDCA 5DNEA 2JIMA 1QK5A 2FN7A 2ZWAA 4BB9A 4J0QA 3F9RA 1O6BA 3GEIA 1KE2A 3PC6A 3KPUA 1RXYA 4LJSA 5HVNA 3HO6A 3NHBA 4MV5A 1RAHA 2WZQA 1R3LC 3CPQA 1T8SA 1R3KC 4TXJA 2GAFA 5AICA 3O84A 3K04A 1QGED 1QH0A 3VMFA 1FDOA 5FB3A 4IFIA 3F8SA 4N6NA 4PJ0Z 3DDOA 4QRDA 5EPEA 2DKFA 4QJ3A 2EJ7A 1NT2A 4HEHA 3E18A 3T35A 3SPXA 3PAFA 2LBWA 5K51A 4X97A 1XRMA 4JI3O 2W2PA 5IS2A 2BE3A 3RI3A 5A4AA 3NYRA 2A3QA 4NJMA 4BLQA 3EGCA 2P9ZA 5DSXA 4Y9UA 4YJFA 3G4SF 2H1SA 2ISCA 2W90A 5ERYA 2V1XA 1NVDA 4DCSA 3GBSA 3OESA 4XGQA 1UPBA 3SLGA 2VJYA 1X7ZA 1B16A 4XIYA 4HQOA 3ZEIA 2Y9MB 2PUBA 5EPOA 1MRZA 2PSHA 3QNUA 5A5EA 1BCSA 2BKEA 5LHGA 3O9VA 1V47A 5DXJA 4YT5A 4A2QA 5GJVC 4UOQA 2VN8A 2QMEA 2B4KA 3QNWA 4IEFB 5KO2A 5KKNB 4NB5A 4RANA 1IVYA 5HHTA 2PUAA 1VP9A 3B78A 4RE5A 1WZIA 3IQFA 1SO8A 3WA7A 3SC3A 4G1MB 2XWQA 2PUGA 2HHAA 2DLDA 4JBIA 1UKCA 4C4TA 3DZHA 1VI6A 2EBFX 3L4BC 5JPIA 4RD1A 4IJ5A 3DA8A 5B1AB 4JODA 2ID7A 4QQRA 1EQAA 1YA6A 3UXEA 1C30A 3DBVO 2RHOA 2YYAA 1ZGAA 3FFWA 5BRJA 1GM9A 1WLYA 4L8FA 2M2IA 4X62O 4DDUA 4ENVA 1WTCA 5LB4A 4GEGA 4G07A 2CH7B 4C6TB 3VISA 4JB2A 3ELCA 2BT4A 1XOUA 1EBOA 1N9KA 1TTPB 1N57A 3AJ8A 4YQFA 5JHHB 1Y6ZA 4YUYA 4M22A 1SXPA 2R4TA 1USIA 5JS7A 4KR6A 3UMYA 4Z0PA 3D31A 4JU8A 4AQ7A 2DW4A 1L8OA 1DHTA 1VQ8F 1AUVA 3EIQA 4LH7A 2TYSB 2X0NA 1YOVA 1MJ5A 1E2PA 1BW9A 4MWBA 1M8KA 2WQ6A 5EE5B 4IS2A 1E9CA 2W6JA 4EDHA 4LF8O 5JC8A 1ZLXA 3B48A 4H4DA 4V0OA 2IU0A 2VFAA 3IPLA 2GLTA 5KUKA 1UC5B 1UEJA 1TLFA 3HUTA 3KOOA 4JB0A 3PWKA 2M6LA 4D9HA 1DLJA 4INPA 4G5FA 2A5JA 3E23A 1CDDA 5EIBD 2QTVB 4RTNA 4RIHA 2G80A 4Y7DA 3KRTA 4IL5A 1BE1A 2OE2A 5TMBA 4JX9A 4FFPA 5AXBA 3DG9A 4HNVA 3ITKA 3FMFA 1WQ1R 5JXJA 1YS4A 2YN0A 4DV3O 4BVTA 1NXVA 1BRTA 1L7MA 1H0SA 5L53A 3KHTA 4AG3A 1QQAA 4DQDA 3HYSA 3IAEA 2WLHA 3OI7A 1TFRA 3NHKA 3B9QA 1VMGA 3SSAA 4QU8A 4FK8A 3UAZA 3LUPA 2KW5A 1WDLA 4F6RB 1SUIA 2D2XA 3E0XA 1BT8A 3ZDYB 1XTRA 2I22A 4K88A 3UMFA 4J1NA 3QVSA 2NUAA 2PANA 3WGYA 2CLLB 3PLRA 4HY3A 3AGKA 1JDJA 4E7OA 4RHTA 4JIGA 3NKLA 1YMVA 2C7BA 3U61B 3RSQA 4CKEB 4U3FH 1XRLA 4A16A 5B3LA 3L72H 4MWZA 1TMOA 4BNXA 2O8DA 4TMVA 3MJ4A 2DY0A 2I76A 2XD9A 2HADA 4CQMB 4X1YA 3ZVKA 5HKAA 1N2HA 1T25A 5E7IA 5C1BA 4CCYA 1L4BA 2QKYA 4QYTA 4EI7A 4LBVA 4ZGWA 2O4CA 3OPYI 4P4SA 3NMUC 5GQSA 4YHHB 1EGMB 3IIMA 3GEHA 4ZREA 1QCZA 1XHZA 1VI5A 3EVCA 3CRQA 2VQEB 3EXHA 1P9NA 1KMIY 1KMQA 2HK8A 5KHJA 1GA6A 1PL6A 1RRFA 1VOTA 3DEIA 4PYJA 2O2XA 2P2YA 3U7IA 1GRQA 4NYJQ 3HRIA 4TZ6A 3F96A 2PLAA 1PQUA 1NZFA 4P2BA 1VIMA 4RFSB 2PLFA 2H59A 4ZAVA 3O8RA 3W4KA 2XXAA 2R70A 4RCVA 1PFWA 1XUQA 2OHJA 3ACDA 3W9UA 4X61A 5KTRA 1GU1A 4U8HA 4WLOA 2YFKA 4E5PA 5JWPA 5K0NA 2ZUTA 1R66A 5D2CA 1JL3A 1PJQA 2HC9A 3GFPA 2OPHA 1IATA 3REQA 3Q2KA 4RPCA 2PX6A 2B7LA 2GUWA 2Z1DA 3G2LA 4DEYA 1VDMA 3IFXA 4BQNA 2G7ZA 3UK2A 4X64B 3IE1A 3K15A 3F0GA 2RB9A 1I7LA 1L4UA 3E86A 4HDMA 1TECE 5FUWA 5KA5A 4Q82A 3WLHA 3BCUA 3FDIA 2FPIA 4Q4AA 5F77A 1L1RA 1GM5A 3VHRA 5BVGB 1SM4A 3NOOA 4RZ2A 2V9ZA 1JIXA 4NENB 2I55A 1CPYA 5DFAA 3PVZA 3RVKA 4FBGA 3N2IA 3K3WA 4PFKA 1O96B 3L4EA 4B3FX 4BB0A 4HVAA 1Y67A 2Q2QA 4Y6GB 4YX9A 5TT0A 2IJIA 2LD4A 4M8NE 1XEXB 5JDIC 3M3PA 1NA5A 1IY9A 5B5EZ 4IIEA 2OHXA 1NWCA 3EGIA 3OD1A 5AHXA 5JRZA 3HC7A 4IINA 1CUSA 4WKCA 2IXAA 1JR3E 3BGOS 4GKJB 1AGXA 1UT8A 4RESA 5CDFA 4O4LA 5CLFA 1XRSB 3H97A 3PN1A 4ENPA 3AVOA 3D7RA 1P5FA 4RGVA 4X7MA 1R9MA 1CF9A 1QC5B 3CVXA 2H2FA 3FY4A 2GM9A 2ZIWB 3JARA 2BRUA 4LFAB 3SGIA 3K0BA 1R6XA 5IKOA 1YMUA 1E9BA 3ZWQA 4MGEA 3U80A 4D8XA 2VAMA 5CJJA 4PHHA 3ZWVA 3L6CA 4R1TA 2POCA 5KI6A 3KDAA 1KC1A 1M8PA 1H38A 1HA3A 4JTAB 4BNIA 5LMNO 3FPSA 1KP3A 1AQLA 1VLJA 2YX1A 2DT4A 4ARAA 4M38A 2A1UA 4YAOA 4LXGA 1E2QA 3PGJA 1JDUA 2Z5UA 5EZ5A 4H1UA 5LA6B 4ZP1A 2BFWA 3N0RA 4X1KA 1BFUA 3JATB 4NU6A 3TW6A 2FX3A 3JPWA 5JNRA 2YIMA 3U10A 3N2ZB 3EY4A 1PI3A 4FHCA 3G2NA 1CQIB 5BWOA 1G8MA 2DHDA 3DYBA 4TTIA 1QYXA 1LPAB 4PYMA 4C01A 3I6MA 3EF1A 3ZD7A 3TLJA 3A36A 5CH8A 1AKTA 2W93A 3K3PA 2QVXX 3VVBA 1WWKA 4WUVA 1P33A 2QL7A 1UIRA 3ODPA 1BH2A 3R74A 4ZT6A 2GESA 4D25A 4B3TO 3I01M 5G3ZA 3CXCF 1NVXQ 2HNAA 2CFSA 5JO0A 4QYIA 1NE2A 4PS0A 4N7RA 3OZUA 2PUEA 2GK4A 4BQEA 1ZK0A 3WLKX 1WV0A 2X0FA 1QF9A 5ELXA 5M04A 2GBOA 1RCUA 4KQKA 2Q9AA 4FSHA 1SC1A 1BA2A 4LDAA 4WZAB 5BSUA 5T4BA 1RYNA 4UEQA 1XX6A 1IM8A 1ADYA 3Q9LA 3ILVA 4RM2A 1XMSA 2JGLA 1O8BA 2F9FA 3M2PA 5IP5A 4A8HA 4MUBA 4Z7OB 5B8FA 2F1KA 4ZCMA 4RLFA 2ESRA 4K26A 4IHJB 2X15A 3L0OA 3U56A 2LV8A 4HPJB 1MXFA 2ODBA 3E70C 1EZ1A 3NQ41 3UMGA 1RW4A 1V54C 3QPAA 1O4WA 2I6TA 4NJEA 4FWTA 1CJSA 5IYZF 1YRYE 3N28A 3R75A 4WX2B 4I4NA 4I8XA 3NDPA 2IYOA 3FVQA 1SS3A 2LDXA 4OJYA 3T99A 3FCYA 3PQEA 3ABZA 1RLJA 1AZWA 5IUKC 2Q0HA 3EVZA 3IT1A 2WSSD 1NP3A 4PVCA 4ESOA 2C8VA 1N6LA 4BBAA 1Q0QA 4HH1A 4BATA 4MKRA 5CG2A 3L6DA 5SY9A 2PMEA 2GARA 2DBVO 3PPYA 5DTEA 4IG9A 3KVNA 3A3PA 3BS4A 1EVLA 2FR8A 2X42A 2VF2A 1X0XA 2F1RA 1V7CA 3TLXA 2QMQA 2OOSA 2F95B 4Y2QA 1LW7A 3BMOA 3PE6A 1ZUNA 5KOIA 4DMGA 3OLVA 1GN8A 1L7DA 4HGOA 1T5LA 5JI3E 1QCYA 5L7TA 4LHXA 4G2KA 4UHKA 1IYZA 3WDLA 4QXPA 5E6SB 4RVUA 1GGKA 2A58A 1VHWA 3AHGA 1Y76A 2DWDC 2ODAA 5DCUA 3OJXA 3DC6A 1TCUA 5IAKA 3OMAB 3AR7A 2RKWA 3W5BA 5AM0A 1WPRA 1XK7A 1XK6A 2B8JA 1U31A 4MVMA 4OV6B 5DM2A 2EYUA 3INYA 4MEJA 1W46A 1ZA2A 4QPNA 1JXMA 4AY3A 3CCQV 4RF4A 1B6TA 5FBKA 3JWPA 1IIBA 4E5VA 1TK9A 1V6CA 4BKMA 5IWCA 3E2EA 3SEFA 4YJ3A 2E55A 3DB1A 5H70A 5AKEA 1L8AA 5DGCA 4GWKA 3VAZA 1F9EA 4F4UA 3NDRA 2QIPA 2ZYDA 1ULZA 4XWAA 1PNOA 2VJLA 1L2TA 4MAMA 2VHZA 4MICA 5DM6V 3DDHA 1TNDA 5JBQA 5EB0A 1Y4SA 1H6DA 1RHRA 4XSGA 2BFDB 3HCDA 2GS9A 3O5AA 5CA1B 3QY9A 3ZY5A 3AL0C 1F2TA 4EGFA 3PLNA 3DUWA 2WSYB 2C2XA 3MGKA 3RB8A 5CNKA 4HT3B 5KHKA 1QJCA 2ZBRA 4R8LA 3H6HA 4C0XA 3L70H 4WNYA 1DFIA 2XSZA 4INJA 4BNYA 2H07A 1XBTA 4JLDA 2QYTA 3H17A 5KX5F 3NIWA 2PWYA 2HCFA 2Q9CA 1SC3A 4LF5O 3QA9A 2JKVA 1AQIA 3QTCA 1YJXA 4M1SA 4MUKA 3ROGA 1EVIA 4YP9A 4MVZA 3TLZA 5AJUA 2YVAA 3BDAA 2QEXV 1Z5GA 5KREA 3RDPA 4B3RO 1FU7A 4I55F 3D36A 4IHAA 3A2MA 4BNVA 3TOSA 3CEPB 3RE1A 4XWYA 4LP8A 3P52A 4D46A 1N7GA 1KYIA 2QZ9A 3I09A 5CB4A 4O5AA 5IMSA 4IX9A 2H4WA 1OKKD 1MB4A 1LW6E 1R4MB 1TZCA 1X1AA 2C4MA 4MI1A 5FX2A 4NYMR 3I2YX 4LYFA 4BAZA 1J70A 5FXMA 3PR3A 4D0SA 3TTTA 3SJCC 4FKZA 3WWOA 4LF9O 4GYKA 3QG5A 1MO2A 3SYCA 4Z1OA 4ZK6A 3E8GA 3K8QA 5JI2E 3ZCTA 1WDKA 3I5DA 2DT5A 1JIIA 4Q37A 5GVSA 3S3WA 3F7NA 2IOFA 3HDYA 5B2ZA 2WR8A 5G4UC 2MSKA 3SJZA 3I4FA 4ER5A 3L02A 4EUNA 3RAEC 3ND6A 3A1CA 4HLNA 4M1QA 3FROA 4C4PA 3H2KA 2OK7A 1A9OA 3UANA 3ND8A 4Q02A 1EWVA 4LY0A 5BR4A 3LWNA 2VP5A 1D2GA 4CU2A 2XUZA 5DYWA 5HS4A 3JQDA 3UT0A 1XJQA 2FR0A 1MCZA 2AZMA 3X0DA 2QTMA 4EA8A 5B1BB 3G82C 4IXWA 4CEIB 4ZT4A 2C4UA 3O4FA 1GAJA 4ZTZB 5ALKA 2GUZB 4OP1A 2ZETA 5DP1A 4AYTA 5ENZA 2ECFA 4TTSA 1NTMH 5CDTA 4JYAB 4CQNA 1BEZA 3T0IA 1HZZC 1VC2A 3K12A 3SLRA 4YMWA 2HCRA 2HA4A 1N5DA 5IC6A 3DGEA 5KTOA 3BKWA 3RGBA 2I6SA 1UZMA 4FBMA 2VJMA 4ZZIA 1H8EG 4K9QA 2R4UA 2OGTA 5CK4A 5JQGA 4J2TA 1QR2A 2CDCA 1S89A 5A04A 1TAQA 2VOEA 1VLHA 2R7MA 1S77D 5I7VA 4KW7A 1F14A 3OX4A 4UAJA 1JQKA 3E1GA 5BN3B 2W6NA 2HMSA 4DIFA 1RYYA 1JXAA 4RO2A 2ZIFA 3WRYA 3AM4A 1XTIA 1E0SA 4TX1A 1FVHA 1ZSVA 1QG6A 1YA8A 3GJRA 3GLUA 5K3OA 1U7PA 1ZRNA 1YBMA 1L4FA 4BMDA 2WVJA 2J4CA 5FLKA 1MRSA 2B1QA 1UBTS 3KXPA 3U60B 3QYPA 4HS9A 4R1UA 3F7YC 3AJAA 1ND6A 3W8FA 3QKWA 5G3YA 3H5AA 6ABPA 2CHEA 4KXVA 1ZIXA 1Z73A 5K3FB 2CUKA 3M2TA 4DANA 3CX6A 1K08A 2AF4C 1JVSA 2JFQA 3HB1A 1TAGA 1V1MB 2VHQA 4CR8A 4MUXA 2B25A 4FCVA 2WLSA 1OX4A 2VA9A 1V8FA 2DR2A 2YXNA 1CUGA 1OLXA 3MS2A 2YXPX 4FIDA 4OQXA 1I3OA 1RWWA 1CUJA 2HNKA 4J9UE 2QUHA 4RNCA 5A6SA 3I76A 4O1IA 2CVQA 3MS4A 2HF7A 2W6ZA 1I1OA 5KTMA 3IURA 4JXXA 4OI2A 3TUIC 1QHEA 2QUKA 3E6AA 3R5JA 1B6SA 4OLHA 1U1EA 4E14A 2VRZA 5L45A 3LP6A 4ZZ3A 2VRCD 2CGOA 3LPMA 5EUBA 3CONA 3L75H 3NFYA 4EJ0A 3D8RA 2Y71A 1QQTA 2ETVA 4YQYA 3GFBA 5EEGA 4QBKA 4JZYA 2AJDA 3X2SA 4F3NA 3JQRA 3K1TA 3QBDA 1P7ZA 1Z2CA 4BFXA 3TQSA 2COEA 4C3OB 3H0KA 4JKIA 4QM7A 2VUTA 1BYUA 1IHYA 2AC4A 3F9IA 5A4KA 5JS6A 2L42A 5JAUA 4RF5A 4MDYA 1X80B 2IBZH 3EGVA 2Q67A 2WWFA 4M1OA 5HOQA 1KZYC 4C5CA 3V42A 2BEWA 2C0PA 3HCNA 4YAKA 5LQMA 1ISIA 4J10A 2O06A 1Q16A 4DV0B 1WMAA 1L7PA 3FKSG 3PFFA 4DDMA 4D8WA 2Q1UA 4UJ5A 5DN6A 3SXUB 3SS8A 2A9OA 2WA3A 3JD2A 3DBIA 5CPFA 1KYWA 1YACA 3P0HA 4WK2B 3M33A 4G0OA 4KLCA 3RVOA 4PLGA 4X3OA 4EFLA 1YS6A 2OTCA 3EVEA 1GXSA 4LQCA 3Q8XB 1C7RA 1EWRA 2X6CA 1E8DA 2O14A 3OKFA 2P2CA 1Z5OA 1WW2A 3VYWA 1YZBA 3RC3A 4RSHA 3QYFA 2D1TA 4IQ8A 4CIVA 3VYVA 1QO0D 4TV9A 1YULA 3HL0A 5HP4A 2WZCA 4TL6A 1QH1A 2R85A 4PYKA 3IQIX 4PYOA 1I7QB 1Q17A 3ICOA 4IQFA 3A3OA 2IUUA 2VH2A 3WKBA 5K7SA 3BWVA 4BR6A 4L4XA 1DO8A 3VKWA 3FNGA 1V96A 1Q82H 5EJGA 4BUCA 2Y1LA 5EL0A 3IVCA 3KX2A 4KFUA 1FFGA 2WLLA 5L3EA 3R4CA 1OXUA 5EERA 1RM4A 5IKEA 4C8GA 5LQUA 4ZAYA 2WF9A 4PSCA 3ZD9A 4PZLA 2ZPTX 3DBHA 4AJ9A 2XUKA 5G4LA 2ISQA 4E30A 1IMOA 1WMBA 2QT0A 4TQFA 4QPJC 4TT3G 5L3RA 5AVVA 3VH4A 1SERA 3ZW8A 2MR6A 1LTHR 4XGKA 2PZSA 3RD5A 1N0UA 4AWBA 4D43A 2PS1A 4Q7QA 5B3SB 3QHQA 4F97A 4J1QA 2VP4A 3A4VA 3OZWA 5TLSA 2DWOA 2NG1A 1H65A 1OU0A 4DA4A 4M1TA 1EX9A 1X42A 4DILA 4DDVA 2NSLA 3VR5D 4S1OA 4FNOA 2OIGA 3DL4A 3WMEA 4DR4B 1P1CA 2IXEA 3PQ5A 2OD2A 2C78A 1DINA 5E7MA 2GOYA 1YB4A 2NNUA 5JCOA 621PA 1QANA 1EB9A 3TJTA 3AM3A 4AB1A 1IZZA 2WAXA 4A82A 1IAVA 1XL6A 1Y9AA 3WDMA 1J5EO 1P1HA 2XMQA 5ELLA 5GJCA 5HZGA 4RAQA 3TZQA 3TQQA 2J30A 3O1HB 1QIFA 3UW3A 4RMGA 4X6LA 1W94A 2WT4A 2YWRA 2P9CA 1AKYA 4ZVVA 4MVRA 4AJJA 4YIPA 1G2PA 2RI0A 5ADWA 5ALFA 1BJRE 1FNCA 2X4LA 2B30A 2Z1TA 3V4OA 4KWTA 1QUEA 3IP8A 1DXQA 3W90A 2O2ZA 1QOQB 3PL5A 4Y2HA 4X3LA 2H1LA 1OCRB 2Y67A 4V38A 3TAUA 4IEEA 1TUIA 3TIXB 1VA5A 5KQPA 1N6RA 2JGMA 5C8YB 1FQKA 1PRYA 8AT1A 4W9MC 2CXNA 4UTXA 1UKYA 2CXPA 1Z4OA 1XVLA 3LMEA 4IMPA 1M8FA 1T4CB 3GCZA 1N3BA 4FQ7A 4C4ZA 3IJ4A 2CBZA 5CBKA 3ZIAA 1K7YA 1T26A 3O9ZA 1X1RA 4I50B 2V9PA 2CNLA 3TM5A 1A1VA 2JRCA 3R7LA 1HDJA 2UVQA 2WTMA 1C8VB 2GVDC 4UASA 3ILYA 1QE3A 1ZVVA 4NBVA 1ONIA 1E3QA 3FIJA 3CNLA 3PX3A 1M1NA 5A0FA 3U0ZA 2R7AA 3C8ZA 1HNXB 4TMWA 4AAYA 2PFKA 4XIGS 2R2GA 3C8HA 4RTQA 4E94A 3VOUA 4J7CA 4BIUA 1RPNA 4ZWNA 2MT9A 3U4QA 2D0PB 1EHCA 2UXBO 2FPLA 1FTWA 1RJEA 2IXDA 1RYEA 1UR5A 4R2WA 2VNJA 3I9JA 3LXXA 2OBYA 2VR1A 4TSFG 3LHKA 4KR2A 3A6EA 1MABG 4JJGA 5FO1A 4KLNA 1FXVA 2XAFA 4M49A 4TKVB 1GUBA 4RTMA 5ECYA 1XZBA 1IM2A 2PT9A 3DVRX 1QDLB 4F38A 2R6JA 5B1IA 2QAGB 3DEHA 4F72A 2WV9A 3GZNA 4NICA 1JMYA 3W8EA 1G7CA 2BJVA 1L4KA 4PCAA 2YHIB 3BH6A 3IKEA 3K5HA 2ORWA 3MQ4A 2CVFA 2Y1GA 2WMNB 1RJFA 2H8EA 2NQ8A 5JZBA 1KU0A 5AI8A 2ON6A 2GD6A 4HPXB 3MM4A 4N4AA 1T8RA 2CLCX 3M6AA 4KQIA 4BZPA 3W7XA 1U3UA 2IIVA 2ZM6O 4UB6Z 4RENA 2Z2JA 3NT5A 2OHIA 2Z30A 2JDID 1D2MA 5TPZD 2PZ8A 4M7OA 4FZ0A 4JEIA 3EBPA 4HTFB 1TUBB 5FNVB 2XT0A 4Q3LA 2DTDA 3Q7TA 5C5DA 2VNKA 3I8XA 5BVHB 3GRKA 3ZTWA 2G17A 2QORA 2Z3VA 3FOWA 3DPSA 1W1IA 3PDJA 1ZD5A 3QXCA 5BOSB 4EVQA 3UVEA 1N33O 3A9RA 2PVPA 1OLOA 2PX5A 3O21A 1CUWA 4D6TH 1C7QA 2RHGB 2JCBA 3RKRA 4NTXA 2NUPB 3ZPXA 1SC4A 4MW6A 5EGSA 3U44B 3N2NA 1Q6UA 2GCPA 4JBNA 3B8MA 1GL9B 5EWMB 2PX2A 4A73A 4BASA 3EFEA 3P9PA 3O4HA 3UWDA 5LMCA 2DR3A 4QSMA 3BVPA 1R37A 5G2OA 4FMCF 2RJOA 3ETCA 5LYJA 2Q3LA 1XV5A 2VDRB 3HO8A 3X1DA 5CA0F 1I6MA 1Q0PA 2O0MA 2WM8A 4M53A 2QSZA 5DEDA 4DY4A 3C74A 3EIUA 4BIZA 2IHVA 3TO5A 1YH3A 1Z5NA 4BVKA 5EIWA 5KYYB 4JSRA 2QTOA 3U7GA 4E5MA 4BX8A 2XASA 3OMIB 2VUHB 4LJLA 5BURA 4BJHB 4L2IB 1XNQB 4KK3A 3SNKA 4L85A 4U6NA 2Z5VA 1SHTX 4CV0A 4OKNA 4UFZA 3QFCA 3ZZNA 2FFAA 1JG6A 2AXNA 2W9XA 1KMIZ 1F5SA 3QBEA 2G09A 4UUMA 5ERGB 5L3SA 2VT6A 4WBNB 1DPFA 2UYGA 3ZN0A 1RAEA 2W2LA 4U7HA 3P4UA 4HUQA 3QXJA 3SR0A 1RKUA 2DFNA 3K31A 1IXKA 4IS3A 3DE2X 1DAKA 2ANCA 1CUVA 3H1BA 5JZSA 4MX8A 2G5CA 2QU8A 2A8YA 4BFYA 1EX6A 1XWFA 1A98A 3L74H 5EMLA 4QNMA 2BMVA 4JSTA 1G0NA 1B0UA 4GGMX 3NP9A 2BMAA 1LR1A 3DZDA 5IH3A 3IR7A 3UM9A 2HPAA 4M7RA 4D3ZA 4C7UA 4X90A 4BO0A 3IHLA 2AC7A 2YINC 4A26A 1GDTA 1HSOA 2J9GA 5KOHA 1YDEA 1MZVA 4PHCA 3OUFA 4OJKA 3B85A 4A8PA 5FL7D 2HL6A 1TRKA 1M8GA 4B3MB 2F67A 3Q3GE 1TW2A 3O8QB 1GZ7A 2AWNA 1L7QA 1BMFA 2IYWA 3CCMV 3H1HH 1VIAA 1NJ5A 1KMCA 2BCGY 2H29A 4YT4A 4ZVTA 3ZMSA 4G4JA 3KPYA 1S3FA 4YV2A 1JNYA 2VXYA 1WCIB 3NBXX 3GYBA 3CLHA 3BIWA 4EEKA 1JSLA 1AKWA 4CQLA 2NT3A 2V74B 1QQBA 2YEVB 1ISJA 3UB4A 4Q66C 4ZIRA 3P10A 1NVMB 1QZ3A 3K0CC 1A4RA 4PNHA 2CWJA 2YMPA 2WUGA 4BBJA 1U3FA 5K8TA 5D3ZA 3V4PB 3DNFA 5BW5A 3E53A 2YWXA 3UJPA 1TW3A 4BYGA 4NS1A 3E3OA 3MGGA 3JVDA 4WGGA 4FXPA 1NBMD 3WP0A 1X94A 4RQTA 3AR5A 4LCEA 5G40A 1LGYA 3BB3A 3C1TA 4NWIA 1NI4B 4XIIA 3PXBA 1DB3A 2FKAA 3RWMB 1F51A 4I0XA 1KP2A 3WLNA 4JVLA 1XF9A 3O4JA 2QLJA 1QMPA 3TAXA 3I1FA 1I80A 5CXUA 1UXJA 5K3SA 2QD1A 3SZRA 3OUTA 4WSOA 3KQQA 4C0LA 2E5FA 4JI5B 1B7GO 4RZIA 1HG0A 2G4VA 4DYDA 3AUKA 3CCEV 5F2OA 2J6CA 2XMBA 5IZ4A 2ETNA 3TL6A 2IX9A 1TM1E 2XKBA 2YN2A 3STUA 2IVFA 3KFXA 1RRGA 3ZKWA 3EZFA 1G291 4AN4A 1CK2A 2G9RA 1XQWA 1OXKB 3MJCA 4Y2YA 5HK9A 3PDIB 4IVPA 2W43A 3I04M 5F9FA 1ZCJA 1X1SA 4WXPA 1QS0B 4R81A 3KZOA 5B1AC 3RUCA 4ES6A 1MB9A 1L7RA 1P61B 3WVNA 3OT7A 3U1VA 4KNYA 1SVLA 2NVUA 1CERA 2BFPA 1FFEA 3AKCA 3LUJA 5E9AA 3ZBPA 2RE8A 2C61A 1BU5A 1N77A 1E2NA 2VTBA 4RKEA 2MQEA 1VB3A 2UUCB 2E1RA 3FW1A 1C3VA 1Q84A 1NV8A 2BONA 3HP7A 4BFCA 3QUTA 3IRVA 5ARDA 4PA7A 1U0EA 2FEOA 3GLTA 5F1YA 4BV9A 3SZMA 3UT5B 4FXOA 1T0AA 1XLTC 1E5VA 2FGKA 4QYXA 4CIWA 1B14A 3B9PA 1YR7A 1Z4IA 2N3ZA 1E99A 2II6A 1QYCA 1CY7A 1L5NA 5IJ0A 4D4LA 3E2PA 5IVDA 1YKFA 2E6KA 5AM5A 3VR4D 3VR1A 2MSCB 5T6BA 1ZW6A 4FMDF 5CM9C 4XUCA 2ONZA 4BKPA 1UAGA 5B30A 5DF1A 1I2DA 5TR9A 2YC2C 5ENDA 1V3TA 3ADBA 1WA8B 3R3VA 1GSOA 4QA9A 2C2GA 1IXMA 2HLPA 3QWBA 2D0IA 4GP6A 1C3LA 4G8BA 4TRJA 4X92A 4JBXA 4Y0VA 3G13A 1I2CA 2IEDA 3KSDO 4G6ZA 3MJRA 3HP4A 4FOSA 3I7TA 1GDDA 4LY9A 3HUUA 2XH8A 4CTNA 2FZLA 1X9GA 2ZBEA 4KZPA 1UOPA 3KCQA 2D5AA 5EQTA 2DQ3A 4I5EA 1DZIA 2JCSA 1QLJA 1CZNA 4DCOA 3COSA 3SF0A 2I8AA 3H1AA 1LBSA 2IHZA 2B21A 3EDMA 1Q3KA 3RTBA 3Q98A 3HYTA 4M4SA 3ZE7A 4S1VA 4OHKA 4B08A 1UQTA 1O5IA 3ZK8A 3ZDXB 2H1CA 3MTAA 4P93A 1KWKA 2CN1A 3WBKA 4DR2B 3CF4A 4EKNB 3OPXA 4X20A 4KSCA 4W7IA 3D02A 3LTEA 2OWDA 3QLUC 2BKLA 4TYMA 3EGOA 4G9BA 3AKYA 3A1SA 3VTKA 2IP4A 1PZNA 4H7FA 2I03A 2QF7A 3V7UA 2YJNA 2ZK7A 2VBCA 4RCZA 3ZS8A 1AGNA 5BRAA 1S7GA 4AMBA 3LT2A 3M5WA 3OEHA 2OP0A 3LUCA 3I05A 1JH9A 3SMVA 4MVXA 1MQ9A 2DMRA 4L22A 2PS0A 3RJ9A 2Y27A 3NASA 5F1OA 3VJRA 4J43A 2P6NA 3JALB 3N07A 5LP6A 2FZEA 1JJBA 2Z2KA 4TXNA 1FSZA 5IW8A 4C7OA 2B3DA 3H83A 5E8RA 2XWJI 1II8A 2PL3A 1LLFA 2YI8A 1U8AA 4LHEA 2AOWA 3LF2A 4UEWA 4D98A 1G7RA 3P96A 1XDSA 3KO8A 3M7MX 2Y0BA 4QARA 4J0CA 4DMRA 1KVTA 4Z54A 4AVYA 1ZW1A 1FRVA 2HS3A 3DCIA 3H19A 3W78A 4TKUA 3JYNA 3G8BA 3RYIB 2X5KO 1LQUA 1PJAA 2HU2A 3E61A 1U3LA 5GJWC 1M6YA 1QONA 4GM0A 1Q82W 3F3MA 1OXSC 1CJBA 2VHWA 4UOZA 3DLIA 4QVKA 5DYNA 3ZTYA 2YZ2A 3PFKA 3C3WA 2VKTA 3GLIB 4I2NA 5B12A 1POXA 3R8FA 1Y1PA 3MELA 4OX9B 3U9LA 4DV7B 1A32A 1OWOA 5KDDA 3ZJVA 5CD9A 4KN5A 3ZHQA 1EN4A 2WVAA 1QYDA 1QKIA 4ZGGA 2C5HA 5C2JB 1BFKA 2RB5A 1F4VA 1PZXA 1ZYUA 1I9GA 4B9EA 1Y89A 1JG7A 4KVZA 2HZ7A 1CETA 3NP7A 5AJTA 3W6PA 1Q1ZA 3JCUZ 1V39A 3T52A 1FJXA 8MHTA 1C9DB 3KQNA 1OFUX 4EX6A 1PR1A 2DBYA 2VT3A 4DC1A 3LSUA 1KQNA 3DMPA 1YD7A 5A03A 1NQTA 3ZZ1A 1VE1A 4CG0A 1J4AA 3ERCA 2QR4A 4YUXA 5BW8A 4US2R 4BN4A 1D9ZA 1UBHS 1FFBA 4LGVA 4AIIA 1SURA 1V2HE 5EC8A 4YCMA 1DC4A 1LNQA 2VJCA 3F8TA 1J2UA 3AHCA 1FXKB 1NVWQ 2I80A 2YXLA 3WK7A 2ZSIA 5EJ5A 1XHXA 3LUDA 1CHNA 1A4IA 2VKQA 3P9ZA 5BQ3A 3UJNA 3OPVA 2OV8A 1JLRA 1U8UA 1OAOC 2B1JA 3L7OA 3QVNA 2IXBA 3CNHA 4MUJA 1ZAYA 1SOVA 4UPVA 3ASNB 3OPQA 4UMEA 1NJGA 3RC7A 3A4LA 2VLBA 4CM5A 3G85A 1FNDA 5JH7B 2WAYA 3GIWA 5CAEA 4Z7QB 3KZIZ 5FJ4C 4AO6A 1Z28A 3H5RA 1D5AA 2DKNA 4P7GA 3BJEA 4DEVA 1QG2A 2HU7A 2P2LA 1X70A 4ZVLA 3EIWA 1OLSB 2ITDC 1BGYH 3KYBA 1E79D 3K58A 5FAKA 2H11A 3AXSA 1MR3F 2A9RA 1OA0A 1GZDA 2WJAA 4HZUB 2FSVC 2EQAA 1TVKB 3QE9Y 2X8JA 3ZE2B 2RGBA 3WZ2A 1A8IA 3OTGA 5DCWA 2CLKB 4QPDA 5CK5A 4GUAA 5EJMA 4C05A 4F4IA 4OQFA 1TQHA 4YAJA 1R0XA 4NCBA 1XZFA 4EG0A 2IZ0A 3ECSA 4ONEA 2CYCA 4M0KA 2NTYC 2CJFA 3DTYA 4KRYA 1AHIA 3Q3VA 2BGLA 2NPOA 1U9IC 3RS0A 2KMLA 2FFHA 3LX4A 1N9GA 4ZQCB 4NMLA 1Q2UA 4ROTA 4R8VA 3RT3C 2PV7A 4TXHA 5BYAA 2WMOB 3RUIA 3W5VA 5GM1A 5ICCA 1PT9A 4I9GA 4UM8B 4XKJA 1P4AA 3ZY6A 1X14A 1IBLO 3ENKA 3MWEB 4LH6A 4EOGA 3UO2A 5WRFA 3OJFA 2IS2A 3H9VA 1XEFA 3A9VA 1OBVA 3UMCA 3DP7A 4K0KB 4KRXA 1XYVA 3A9UA 1GTZA 3F46A 3RRBA 4LF4O 1LTKA 3K16A 2GFHA 2MR5A 2IZ6A 4FNMA 5BORA 4BP8A 3BKXA 2NSJA 4QDUA 3KAPA 1MX3A 4GZ3A 1GZVA 3UV6A 4HZGA 121PA 2R8OA 1DC3A 2QNRA 3ABLB 3TFQA 5JLJA 1AN9A 2L82A 3DOOA 1EU1A 4K0RA 4IIJF 3EZLA 4EIWA 1WM1A 1R7RA 4P08A 3NBQA 2WSSG 5AHRA 3BXFA 1H47A 4BO9A 5HW0A 5AWFC 3JQBA 3ZO8A 3BERA 1RWVA 2TMDA 1AE1A 1XDBA 1YR2A 3SC2B 1IB6A 4FLEA 3KVVA 4GR9A 3K9LA 3TTXA 3L0CA 1S3IA 1H93A 2L0XA 4QBFA 3JAKB 3ST7A 3HCCA 4GP9A 1K0UA 5F98A 3LW8A 1TAHA 2C3MA 3QEMA 3OZGA 2V1DA 3DAYA 2GK3A 3IAUA 3VR5H 2G9QA 2J5XA 3ZK9A 1VPVA 2J46A 1U3CA 1RYMA 1C9YA 5AJZA 1HY3A 2UZ0A 3IPAA 1TZ2A 1XCGB 3DXRB 4FUTA 3H4VA 4C4YA 4I1PA 1OFTA 2D3WA 1UEIA 5A7FA 5KU7A 3M4SA 4IR7A 3BRCA 5HZHA 4TLBA 1MPTA 2H2WA 2JEZA 2VQSA 4K8OA 4OJQA 4ZVNA 3OFVA 2ZI6A 1NTZH 3VPXA 1EB8A 5IASA 3ABRB 3LUGA 1V9CA 4PV7A 1NF9A 3WLFA 1KB9F 1Y6JA 3JZAA 4E13A 4D74A 2R8XA 1NHWA 2MU1A 3EHBB 3EEIA 4ZZ2A 1US8A 1GAEO 3RT1A 2CSXA 2R8EA 2A1IA 4LMBA 3R9XB 5C8XA 1AQUA 1X7YB 4YCDA 2OEPA 3EGDB 4NNPA 3ZJZA 4YASA 3CYQA 3CCRF 4AS3A 2W0SA 5BN4A 2XWBF 3MPOA 1KTIA 4BV2A 1E89A 2IV7A 2GDSA 1WPGA 3QKSA 1KY2A 4ISBA 3QE2A 4AF7A 3D8HA 3OQBA 3A32A 3RE3A 1E6WA 1ST3A 2D5CA 3D7SA 4TKZA 3E3NA 3JWHA 3FZEA 4KPFC 4U0JA 2J45A 1SBNE 3THRA 3FB1A 1DQZA 3TE7A 3MCUA 3J7AC 1GSAA 1JT2A 3CVOA 2OV1A 2JJ2A 2P9HA 1SQFA 3WWEA 4N76A 1YI1A 3RF7A 1PT5A 3FD8A 4YP0A 1NW6A 2G1PA 1EFKA 4JZKA 4LFBO 3I3FA 3AY0A 4B3JA 2OHOA 4BX9A 3WIOA 5GIPE 2ZTSA 3WNDA 4TVBA 5AKKA 1NN0A 4CLEA 3PQCA 2D6FA 4G5RA 4LRSB 1ZK3A 3FMOB 2CWWA 1KH1A 2A35A 5EBLC 3N0TA 2O52A 4L3OA 2JVIA 1NJ8A 1LWOA 2FDRA 1VQPV 4D6YA 3DOHA 3ZQJA 1GUDA 1JDTA 4Y2UA 2Z6UA 3Q7RA 1MT0A 2YYYA 4IDCA 3GEBA 4P1ZA 3VTFA 4F3CA 2Q46A 1WNSA 1V1JA 5F3DA 3AY3A 3I6ZA 2P2NA 4JP8A 3WK4A 4KVFA 4C0SA 4UKDA 2X4IA 1QLWA 4TWIA 2HJFC 3UBMA 4CWAA 3OEEA 3EMVA 1I2BA 5U1PA 1FMJA 2ZFUA 1JPNA 4J7XA 3AX6A 3W5SA 1I4OA 1AF7A 3AUFA 4AICA 3GEGA 3M1LA 1HV8A 3H9EO 4N3GA 3P32A 1N2GA 5ALYA 3IT0A 3FFAA 2PX8A 4WXEA 4BW0B 2PBRA 3GUUA 5LZ4A 1LVUA 1FNNA 4X3CA 1DV2A 3TRJA 3EPLA 2JFZA 2GB4A 3CC4F 4GI5A 2WJVA 3CKMA 5HY1A 3BXHA 2EFEB 1CZOA 3JQEA 2H0QA 1IJKA 1YWGO 1M0TA 4GDFA 2EFGA 2X77A 2SBTA 5JD4A 1XOIA 1IK6A 3LBNA 2C88A 3ZZMA 2WD7B 2RG1A 1QYRA 2JF0A 2HRDA 3T1NA 1RI3A 4Z3KA 2FJUA 4WH0A 4PYNA 2WQZA 1N2ZA 5A2GA 1B8NA 3C5EA 3BEDA 3CXCU 2C5FA 1PV0A 5F5XA 4BNMA 4WWHA 2WIBA 2HWYA 4AK9A 5FBLB 3VX3A 4QUDA 1TK2A 4FEAA 2WOJA 4DLVA 1L7AA 5EINA 1BZYA 5FEMA 2DWEC 4EG6A 1TE2A 3DMRA 1VFPA 3K9AA 1YVWA 4OSOA 5EE0A 2A94A 5ILGA 4DR6B 5TF4A 2VQFO 4DV5O 3HB4X 2PZKA 1B73A 4RKWA 2CFIA 1F4NA 3HEMA 1RQ2A 1R88A 3E0QA 1Z39A 4IMIB 4PYRA 1BHQ1 5SYAA 3MRVA 3OOYA 2PLRA 3NZEA 1MPXA 4YLYA 5FQNA 3EGXB 4J0DA 4UU1A 2XAQA 2C5GA 3IXMA 1HNWO 2H3HA 4AG5A 1O2DA 1RYFA 4PWTA 2LTAA 1WQ4A 3C3DA 3LWPC 3HB7A 5I9MA 4JB8A 1P3DA 3VSEA 1L4GA 5KHAA 2OZKA 1JV2B 4ICIA 4Q3NA 2GLUA 1GG5A 1K98A 2CWDA 3F7OA 3CEIA 2ZVDA 1B00A 3HXKA 4RADA 1G1MA 2FXVA 3D7LA 4C08A 2RMKB 1DOHA 3WQHA 1N7HA 4C7BA 2GJ4A 1XVAA 2WILA 1TF5A 5FWXB 1SUFA 3TRFA 3D43A 1A9ZA 1ZGCA 2CMKA 4V3CA 4ER7A 1NTKH 4P4NA 4CM8B 1CUEA 3AG5A 3J80M 4M8SA 5EJFA 3RTAA 3RHZA 2GN8A 2HXYA 2W5UA 3H75A 1RJDA 3D0KA 1HYQA 4AXBA 2ATIA 3H11A 4RA6A 4WGFA 3OE7D 3W2IA 4KIUA 3EK2A 3QXHA 1JFFB 4S35A 4L4SA 3Q2IA 3L7BA 4LBWA 1UK8A 1FXSA 1ISPA 3KOWA 3V1LA 2A0FA 2Y66A 1D6NA 2EW1A 2EV9A 1BGXT 3NTQA 1A9SA 3PA6A 2JJ1D 1UDWA 2O57A 3F6PA 3FGPA 1CLUA 1M75A 2B34A 4M89A 4LCBA 3UV3A 1E2HA 3TMAA 5T3UA 1M2VB 4ECAA 2O5RA 1YXMA 5JD3A 1JGTA 2KJQA 5IYZA 2R9IA 1U2EA 2QMHA 3UY4A 4B6PA 3F5TA 3FF4A 2QN3A 3HDGA 4IJKA 2WKSA 2Q5EA 4GPEA 3Q2OA 3IJEB 4Z53A 2ZRFA 3VOTA 1K3UB 2EATA 2K2QB 4M0UA 2ZRCA 1Y3FE 3HN2A 4G0ZA 3TNDA 2I6RA 3PKZA 1BD3A 4TQAA 3AC0A 3GWGA 3VV2A 4ABTA 1HZJA 3PU6A 1HLGA 3P1JA 4P34A 4QRHA 1SFRA 2B6HA 3CUWA 2QX4A 3H3JA 2JJ8A 3MF4A 1JJ7A 2VP3A 1VQ9V 2H2GA 3KQHA 4DTCA 4UVHA 4URZR 2H5IA 3TLGA 3ZOPA 2BTUA 3LQQA 2C2ZA 1Y8QA 5SZHB 1PJBA 2PAFA 4MZXA 1DI0A 3U37A 3DTVB 3GOQA 3CF6R 5FWYB 1U8XX 1AXGA 2NU6A 1I13A 1J6UA 5H1YA 1PUIA 3VVCA 4R1QA 1HNZB 2AW9A 1XQ8A 3RIHA 2JHFA 2C5AA 1MENA 4JEUA 4LMRA 5BWNA 4EL0A 1Q2XA 3C9SA 1HP8A 1U2RA 4R9RA 1KJNA 2XGOA 5JSZA 4D8UA 5AKLA 3WGOA 2A3NA 4LE0A 3WOHA 1M83A 4EJSA 1P1FA 3VSDA 4B8YA 1UL1X 5KNBA 4EBBA 5JXHA 3OZIA 3DWEX 1FFAA 1HUQA 1PLKA 1OREA 3APQA 4J7KA 4OFZA 3TD3A 3DUFA 1H69A 5LLDA 3Q6IA 3LVFO 3JWGA 5FJJA 1RHKA 3EG9A 5F21A 3NMUF 2XCSB 4Q1DA 4F3YA 3Q0TA 3T5AA 3MHHC 5B3SC 3SJBC 2CDRA 3FE2A 3SNHA 2IUSA 3BE8A 1AC5A 1PJ2A 3QVVA 1ANKA 2GXSA 2ZUBA 4PAMA 3DMTC 2HUNA 3GP3A 3LOUA 1PSZA 2O8NA 5DM70 5HKLA 5A7HA 2VATA 3I9FA 1TQDA 4Y1RB 1U9JA 4XR9A 2Q4OA 3GRUA 2ZG6A 2HREA 4C3ZA 3UGJA 1IBMB 3IT3A 5EHQA 2V6MA 4C14A 1KWGA 4F56A 4HJRA 2AYZA 2BI7A 4EG5A 1X1BA 2QMZA 4KUHA 3AVQA 1DWPA 5DLYA 5KX5A 2XD4A 1BRMA 2POQX 4BPBA 4Z99A 2OXCA 5KA6A 3BMCB 3U1BA 4DLLA 4Q9HA 4G88A 4PDVA 1EVZA 1RBZA 4DA8A 3NIFB 4I55A 3KZ1E 5I7UA 1KBOA 2XCLA 4M99A 3UXMA 3JVHA 4MQBA 1SCJA 2ZNJA 2GCNA 1YJ5A 2C2KA 1YK0A 3IL2A 4RY8A 1N1DA 2OM2A 2ZJ0A 1PV1A 4IDDA 3HKCA 4QWMA 5HKBA 4LK2A 4UHDA 3BB4A 3ROZA 1WU8A 2H6EA 1VJRA 5I4CA 4K6OA 1KZ7B 3R5XA 3DOJA 2IOFK 3KAKA 3FWKA 2GCOA 1CTQA 3VR4H 1GG9A 3DMFA 4I5DA 1S8OA 5HK8A 1P4HA 3OFNA 1FUYB 1EFTA 1RZRA 2H5EA 5EQFA 1O97C 4CKXA 4KTTE 1WKVA 2PGAA 3ZWKA 3V4DA 1F8FA 4RVDA 1N32O 2FE1A 3CLRC 2GD0A 4C87A 3ZCPA 4EENA 1VQNV 3P4YA 3VU9B 2QRHA 5FOSA 4MYUA 3UHPA 4Z2YA 4CS4A 4DV4B 1RHMA 1HE2A 1ZOPA 3CC8A 5CIYA 4UHHA 1KI2A 1CQZA 4YRJA 1BX0A 5EIHA 4BMXA 2OWEA 4QRIA 1O8CA 3JQFC 2HU5A 5J43A 1KAHA 4GQBA 1FZTA 3A6PC 1AX9A 1VBKA 1PTJA 1SCIA 2XRYA 1KKCA 4K9DA 1V3QE 1NVVQ 2P90A 1T2EA 5TQVA 1UPUA 1WLEA 3KBOA 3KJGA 1TVCA 3GJ0A 4M76B 1IEXA 2Z0MA 4DR3O 2OL4A 1TEZA 4HUTA 3ZDFA 4Q00A 2EULA 2C0CA 3WLTA 1QBZA 1KH2A 1JAZA 1VKJA 1J95A 3I45A 3BMNB 1Z15A 3LOQA 4I5IA 2GBCA 1BSVA 4PAQA 4N82A 1RQXA 4QEKA 3AOGA 1QHTA 1WB7A 3F3SA 4WZBA 1C8BA 1JIKA 1LC3A 2CE2X 1HT1E 3TTWA 3CD6F 2ZAOA 4U7FA 2W6ID 1G9SA 4MVWA 2QTAA 3IV9A 4A2PA 3LUAA 4MR7A 4YJ2B 4EG4A 4AWXA 1H94A 4WJKB 2EBWA 3JQ8B 2Q6OA 3FWHA 2HMWA 4LZPA 1FA9A 5IVIA 4KLRA 1EJBA 2CXTA 4Y9DA 2A0XA 4CEHA 3FVVA 4Q3BA 1IY0A 1MNQA 2J3MA 5CVJA 4TL8A 3DL2A 2IQQA 1E0DA 3SICE 3LUKA 3CYOA 3C39A 4IJVA 4AF8A 2ZYSA 4IXDA 2BTEA 2PWAA 1W7AA 3QGMA 1O6ZA 3HJNA 1NNEA 1SUBA 4A6DA 3IR9A 1J2EA 1R8QA 3KZMA 3ZIAD 2YW2A 3BL5A 2D0OB 5EAIA 1MJHA 5I5EA 3K72B 3KZKA 1KL7A 3BFXA 5F64A 2OYRA 2GRJA 3U17A 4IIFA 1Y8RA 3NBKA 1SEVA 1CUAA 3ZDBA 1XA3A 4N3BA 1LVGA 2O7NA 1R3UA 3WMWA 3HYNA 4LISA 4PDRA 2FZKA 1QLEC 1EWKA 4JEHA 3T1QA 3ORFA 3PBKA 2ZUUA 1DCKA 3R6TA 5CMUA 4EVIA 3KALA 4P9PA 2Y0IA 3P4EA 3HB9A 3PGVA 4G8DA 2P40A 2GZ2A 3PJEA 3C3KA 2R5FA 4G2TA 2EKZA 2ZVQX 3X44A 4MTGA 2D1QA 2ZOVA 5AT1A 1FDWA 5B3AA 4AN1A 4MGZR 2GAIA 3VZRA 1KNKA 1NW5A 1VK3A 4JC8A 1V26A 2PZMA 3W6OA 1V41E 3IJ5A 2UVPB 5IKXA 5HMMA 3OBIA 2C8LA 3BRQA 1VE6A 3M34A 1IU9A 5PNTA 1L5HA 5DBOA 4HWSA 1Q7CA 2G72A 4MT8A 1KETA 3GCWA 3E8MA 1X9HA 1I33A 4FQ5A 1Z5UA 4MW5A 2PFGA 2ONCA 5DU2A 2XRZA 5LQRA 1W19A 5B1HA 5JD6A 4S2EA 1JTVA 3LDTA 1E2KA 1OB2A 3VQWA 4FOTA 2NTVA 2LUOA 2C9CA 4ZYLA 4J7ZA 3VSAA 5JZMA 3FFTA 1FDVA 4DCMA 2IPXA 4MTXA 3GXBA 2VNHA 3DAPA 1SBQA 1T6YA 2GHQA 1NTOA 2ZIXA 4BLWA 3BHPA 1D03A 4ZVPA 3KQSA 1H3EA 2MW2B 3G5TA 1X19A 3B2QA 1T9HA 1DKRA 4HEA1 4OMCA 2NP6A 2QT1A 2XTAA 1PM9A 1IONA 1MDFA 3U7RA 4MWGA 3FSEA 1U8ZA 2P9JA 2WA1A 1H2KA 2B6NA 4EHAA 1TU0A 1E20A 5K8CA 3ZU3A 3FJ1A 3T1YB 5FL7G 1T5BA 3PD0A 3SP1A 3WL6A 4TM7A 3X1XA 2W6CX 2O2GA 2JK1A 2NXWA 1FJ2A 2BFFA 1YRHA 4Q19A 1M1YB 4K9MA 2QMUA 2R84A 1ZEJA 1AXRA 1KPIA 2NZUG 1THGA 5IEBA 2QAIA 1SXJB 4LX0A 4A5SA 1VQ4F 1RLTA 4KQ2A 2R1ZA 1G63A 3AV3A 3I55V 1ULBA 3AF5A 4NTYA 3SYAA 3RAFC 3TR5A 3AEUB 1KJ9A 4WFBV 2HBQA 4KXYA 1X4TA 3FCEA 4Q01A 2HQRA 4I1VA 4DCVA 3H5WA 3W2HA 4CM4A 2XUQA 2RONA 3RFRA 3WWDA 2H9AA 4Q4JA 3RBXA 4F96A 1NBMG 1AHHA 4HBNA 4J2OA 4AL4A 4M0CA 3NOQA 2CZWA 4UREA 1W59A 3ZXXA 1XPJA 3GBVA 5BT9A 5IT0A 2GEUA 3L46A 3C7CB 1G5QA 1YDFA 3BF8A 2ZUFA 1ZH2A 1NMEA 2HK7A 1EK2A 3IEPA 3CC7V 2QVCA 4JP5A 4GLOA 2QYHA 2IM9A 1T34A 1QU7A 1YDGA 1T3SA 7MDHA 5CLHA 2IHNA 4IOJA 5G4KB 4OQYA 4ZAWA 4MYRA 2XCUA 3K9QO 4LVUA 2XBLA 4Q21A 2EZPA 1TK3A 1M0EA 3PICA 3GLFB 3DR3A 3MNFA 1DWOA 3AEZA 1XNHA 1I3NA 3OZVA 1FRQA 3BCCH 1J7KA 3OZXA 1MNGA 2F90A 1L4EA 2FZCA 4LOLA 4L73A 5CFQA 2C84A 3URMA 3ZI0A 1W48A 2NU9A 1NKDA 3K0KA 8GPBA 4NXNB 3IAS1 1T4MA 1AGRA 3GV0A 3G6BA 2XWSA 3UFXA 3H9BA 2V97A 3DEZA 4D3YA 1OAKA 4QU9A 1ORHA 3HACA 4B35A 1P2FA 5CVTA 1Z7BA 2PYJA 1AB5A 3CH7A 3AMVA 4Q05A 1RIIA 1U7TA 5BWBA 4LXTA 3GZJA 4I9WA 4D80A 3A1DA 2XNHA 2C2MA 4MV0A 2XDWA 4JSYA 4NCIA 4D44A 2PT5A 3N8HA 3UGQA 6Q21A 1SN7A 3RRXA 1Z18A 4JELA 1QNMA 3W2TA 4MJXA 4Z8YA 2I67A 2HHHO 3STYA 4RPGA 1FS4A 2ATCA 4M9SA 1FRFS 3CPHA 4ZYXA 1V8DA 2ZS7A 4C0QC 3GMSA 4LGYA 4RBNA 2WUDA 2JFPA 2Z6QA 4QJ4A 5F4ZA 5HUHA 5K3DA 5SZKB 5JCJA 3QX8A 4ZQFA 2CHFA 2GHRA 3RIYA 1L1FA 3DCYA 2C7VA 4W5JA 5AHKA 2YFYA 4G28B 1YO6A 4ODIA 3PD1A 2GPBA 2WC1A 3DT9A 2B92A 4IXNA 2VPWA 4ZI3A 3TCXB 2H54A 3IP1A 4HF7A 3A3KA 1G8YA 1DJLA 2WE7A 2ENWA 2FW8A 2P6YA 3RYFB 2Q5OA 4MYHA 2WIKA 3WISA 3P5BA 1ZI6A 1E69A 4J9ZB 4NHEA 3RR2A 2G5GX 1AURA 3OAAD 1L4MA 4AF6A 3B38A 5I3CA 2NV0A 3OIWA 1H05A 1LFDB 5JEDA 5AR1A 4NUTA 1DJNA 1V11B 4NE7A 1DVRA 1AMOA 4H16A 2YWGA 4J80A 5K5EA 5HJ7A 5F1KA 1KJ8A 2HRQA 2QL6A 4FLZA 2WFAA 4URWR 3DCNA 3N0XA 4JI4B 2DP4E 3TZ6A 5DX1A 3THXA 4ZZ0A 4I46A 5CT5A 2RHLA 3K53A 2AK3A 1FMLA 3N8KA 3ND9A 3VQXA 1B8OA 2ZJBA 3BMXA 2G0TA 3FPFA 5H3LA 1KBHA 3O91A 3FF1A 5FRDA 1CNFA 1U81A 3WYGA 3KT6A 1I7PA 2ZB3A 1KXJA 3IMPA 1D2DA 2C4VA 3V4SA 1LV7A 1TIPA 1GKUB 1S5PA 3HGTA 5KNLA 2E48A 4JUCA 4AMZA 1IBKB 3CJQA 4OHXA 3L8ZA 1A5TA 3L92A 1J0EA 3NBZC 2QPAA 1HDXA 1YJ8A 4E21A 4X45A 3MFQA 4BMZA 2Q21A 3RHTA 3FLEA 1F6DA 4J6EA 4AX4A 2K1SA 3SQWA 5EXDA 4AUEA 5HF6A 1DAHA 4HAYA 2V6IA 1W47A 3SBDA 2ZWPA 3B9BA 3TSZA 3CH4B 2FMTA 1FDUA 3EJWA 2PMBA 1EK5A 3B20A 5CA0A 1I3CA 3K30A 2Y1EA 3V8QA 1YRBA 5ER9A 1T0BA 3NDIA 3RWOA 4TQ9A 4LYEA 3I53A 4GGOA 3WJPA 3AUJB 2W83A 4JBLA 4Q9LA 5CEFA 5L6LB 4FT4A 3SI7A 4B4KA 2EP8A 4X84A 3MHSC 4AJIA 1E3TA 1JKMA 1SUWA 1LCIA 2YNMD 1NLZA 2P4EA 4U2GA 5E4JA 4IEIA 4ECEA 1U7XA 1VRVA 5ENVA 3IHKA 4FHEA 4MITA 1YR8A 4GX0A 1PJ3A 1BZKA 4HI0E 3F4BA 3B1ZA 4PINA 4YRMA 1XCBA 1WXEA 1FOEB 1EFPB 4KXLA 1NONA 3TMYA 2AZ2A 1GD1O 5JZ9A 1XAGA 3KPWA 5AW2A 1MT3A 4N01A 4X64O 3ZV7A 1AXEA 4CTKA 2UU9B 5DW3A 2O3JA 1YI8A 4PI2A 1YHQV 1UFQA 2QY9A 1R9NA 5EIXA 1WNTA 2UZ1A 1ESEA 4EYKA 3IO3A 3WQQA 1QF6A 1LPNA 4HEA6 1Q1AA 2XEDA 1A82A 2Q41A 3G9UA 3N8NA 3R77A 5GY7A 3BQNB 2ALJA 2Z8ZA 3NRCA 1YCGA 3C70A 1E63A 3R41A 3DOIA 2LIPA 4RIGA 2GZHA 4GLJA 4HMPA 2HQOA 4JJ6A 3TNLA 1C4OA 2V65A 1UOOA 3ER6A 2P3LA 4OPHA 4OFBA 2UZ3A 5DIFA 3GPCA 1QDEA 3KHNA 1A5ZA 3GWOA 4ID9A 3H8WA 2J0SA 1C2TA 4DIUA 4WHMA 3DKKA 3ETHA 2GZDA 2O8BB 1Z2EA 4U1RA 4GKJO 3WLOA 1KA9H 1DBVO 3HCBA 3O0TA 2A7QA 1WZCA 3OEHD 3QLVC 4OQMA 4TTTS 1U6IA 1HFKA 3GWZA 1JQJC 1YZTA 3DF9A 3L7IA 1GU7A 4AG6A 3IDOA 2WLKA 4KX5A 4LFAO 3DAGA 2I2XB 2O1WA 3T38A 5KVAA 5D6NA 4ZHSA 4QO7A 3QU7A 5CT8A 5KHIA 3HKEB 3EB9A 2E49A 5BY2A 1JFLA 4ASUA 1V8PA 3LDDA 5K6RA 1B4DA 1DKMA 1VYUA 2CF6A 2HBYA 4C6SA 1E79G 4YAIA 5HMLA 1J49A 2FVXA 2GN9A 2PEYA 4XGRA 2YJ5A 4BX0A 3FUWA 2WOOA 2PHZA 5I7HA 3C7KA 5T6MA 3HNPA 3HJRA 2ZT7A 2VHCA 2DM6A 4C22A 1HGXA 2AXQA 2R60A 2P1ZA 1AROP 5T5QA 2Z2YA 4MCJA 1KOFA 5AVKA 1K8XB 3EC7A 3HDHA 4CEJB 3FCXA 2CEKA 4L4YA 4YR7A 3PJSK 2DFTA 2ZBUA 2BE9A 1TO2E 1I5OA 3HKDB 1CRPA 2X41A 1ACJA 5LQCA 3ABMB 4JI6O 1NBOA 3IAS6 3UH0A 1N4DA 3JSLA 3CZAA 4NE9A 4WT7A 1MZEA 4RD3A 3FFMA 4H0LB 4Q03A 5SYNA 3TCKA 2XNDA 1VP7A 4HVCA 4C43A 2VRBA 3QVGB 3CC2F 1JT9A 2QRPA 5BQFA 3UCEA 1NXPA 2Q1YA 5EE1A 1MOFA 2AEFA 5C51B 1BE6A 4F04A 1GN9A 1M0WA 3EFOB 3Q12A 3KPVA 3FPCA 4UB8Z 5B2EA 2YJGA 1JG3A 4OHPA 4KDCA 2OP1A 3TKLA 3GJXC 1J0BA 5DN9A 1DSSG 5HXUA 3U39A 3OD4A 2XCRB 2A06H 2VJQA 3H4MA 2Q07A 2LW7A 4D57A 1IV4A 1I1QB 3LQKA 2DYKA 2ZVJA 3BK7A 1U9ZA 3BOSA 1V1RB 3D6FA 4DLZA 4ND7A 2AXEA 3UCFA 1EE9A 4I9HA 2WWIA 3EF3A 1XU4A 1O77A 2RI1A 3IDFA 4LC1A 4I8IA 1EG2A 3IXQA 4PLHA 1FDSA 4RAOA 3U48A 2GX6A 4H37A 2PGLA 3IHTA 1P8JA 3WB2A 1ENYA 1IK4A 4EG7A 1H4SA 2C04A 1KNJA 3V1NA 3SF8B 1CE8B 4EUFA 1UBGA 4JF3A 2W6JD 3CEHA 5KYTA 2AR9A 2FRDA 4EBFA 2IWRA 2B94A 4D7TA 5L4LA 3M1YA 4GQAA 4F11A 4EHLA 4BXOB 1NPYA 2JGAA 5H83A 1L4LA 1M6HA 3HZHA 2PGGA 3JX9A 4C21A 3MRXA 3RSZA 4C6HA 1O6GA 3NUGA 2F48A 2FCRA 4E2XA 3D3KA 2FMXA 4NQ3A 3OLXA 3A4YA 4KACA 5T4HA 4O0LA 2HLDA 2HUPA 3OCVA 3HKBB 2GZAA 4NU5A 4GWLA 4AJ2A 4CMIB 3S1AB 2C2OA 3DLBA 4HNAB 2HDHA 2B3TA 3DZ8A 3KB6A 4W5NA 3D1VA 2DG2A 2IE8A 1CP9A 4MJ3A 2Q45A 1BD4A 5I7RA 1WUHS 2A5YB 1NOJA 2PKWA 3MINB 2GKOA 2MJLA 5I9NA 2X3YA 2XKAA 4MDFA 1JQEA 2QPTA 1D2RA 3I56V 1ZN9A 4AJEA 4ED9A 3HCEA 1W2WB 5D3MA 3MXTA 1AV7A 1YNSA 2YQZA 3AUXA 3DHEA 3SBXA 2EGGA 5GPBA 3EDCA 3ZP4A 3TTYA 1UBOS 3AB3A 1ISFA 2CE7A 1BDMA 4LWPA 4YROA 4V3BA 4DUYB 3SYQA 4NS4A 2P0AA 4FFWA 4QU0A 1VQ6F 2WMYA 1TRHA 1UK9A 1VG0B 5DTQA 1KQPA 1Z16A 1IZ8A 2ZIVB 9LDBA 2W11A 3LA6A 3O47A 3S8MA 1Q7RA 1RWPA 1XKLA 3PUJA 4U2DA 2P91A 1T15A 3UICA 5HGXA 4R7CA 1FP4B 2VH5R 3UJ6A 2G6BA 2DWCA 4FVTA 4S12A 2IOQA 2FW1A 2Z2XA 1GVNB 2CNBA 4UVIA 3BHMA 4HNQA 1VQLF 2HGZA 1TMKA 1R16A 3ZIDA 2JIBA 5IEJA 5DNDA 5JPCA 1GPAA 4QO8A 3EOZA 2R751 1ZC3A 2WDZA 3QPUA 1D09A 3KLMX 3QW2A 3MD0A 4Q18A 4FOOA 2GJ9A 3G0BA 4XXHA 1ORTA 3VI6A 1NY6A 2DFVA 3O9MA 4KE6A 4X65O 4BAYA 3EE6A 1OOEA 1DXHA 3R7SA 3S55A 1XWIA 3ZYZA 2ZTLA 2O2JA 5KKAA 1ZUWA 1X0VA 1NIJA 1O54A 2VT7A 3ESRA 2QSYA 4D9IA 4EL5A 4F4JA 1EESA 4RZUA 4YPFA 1JMKC 4G4GA 2ZYHA 2XT9A 3ABQB 2LFRA 1EMDA 3CLUD 2PUFA 4B80A 1Y42X 1FYXA 4FBLA 1G3UA 1P4GA 4RAIA 3MTIA 1ZI9A 16PKA 2ZM5A 2UUPA 1QU3A 1VGVA 4LS3A 4RQUA 3DVAA 2RIRA 2FPWA 3SX4A 1DT9A 2Z4TA 4RLHA 2ASVA 2JAPA 1JAXA 2DUUA 3CG0A 4FMPA 5JXGA 1X87A 3FBAA 5D5HA 3EWIA 4M46A 4EGQA 2FKXA 2VWGA 3E1KA 1QX4A 5ICMA 3WIVA 4GLXA 3ZXIA 2WIDA 3VYTB 3AGPA 5THQA 2JFXA 1X7WA 1JR4A 1IRIA 4MKHA 4HLUC 3WJQA 3EODA 3PF8A 3WO0A 2J41A 4EPRA 3FJOA 1EINA 3RG8A 2G82A 5KTPA 1U7ZA 5K20A 3R9IA 2IW1A 1WDMA 4Y2PA 1C1XA 3T7IA 5AOBA 1UBSB 4O0MA 3QW4B 2Q1TA 3MMSA 1GWNA 4Q39A 1U3DA 3DLPX 3DT6A 1XU7A 1EFHA 1P0QA 2OCBA 3DMGA 4ZOAA 3BYZA 4A27A 2VPIA 2YXZA 4PA4A 4A8JA 2DOKA 2AGVA 1OILA 3BY6A 5FJIA 1XJCA 3SS7X 4WCEV 3X1YA 1IVSA 3L8GA 1GTL1 2ACVA 1O95C 2OO5C 4ZOBA 3QV1A 2QZSA 2F43B 1U4SA 4MQLA 4MQ4A 1A72A 2CD9A 4ZK7A 2BGRA 3WGUA 2NUTB 2J3HA 3MD9A 4MUIA 1AT1A 3CWZA 2F9ZC 2RAFA 1PFKA 5BR8B 2KE5A 4TL7A 3R4VA 4AILC 3SZUA 3D3WA 3OSZA 1TMYA 4F2WA 2BR3A 3AFOA 2JJ2D 1PX0A 4W5TA 4W5RA 1E4YA 4TVKA 3C3PA 4D3SA 3AEXA 5ICSA 3BE4A 4HN2A 5IFLA 3I5MA 1FSFA 5IU6A 5HCUA 3E8XA 4IFBA 1BIFA 2FQQA 4LI3X 1OIXA 4J0EA 1BCCH 2J4DA 2Y48A 1OWLA 1RCTE 3LUBA 1RA4A 3H1TA 4OQDA 5FBQB 1I7DA 4L78A 4ZO4A 2COUA 3MFYA 4RH0A 5C1IA 4WFQA 4XJVA 3EVTA 3Q7QA 2RGEA 2GWHA 4AZ0A 3ZU6A 2ICAA 4KWEA 5HJ2A 4Z5XA 3H1KH 1JB1A 1MLDA 2YY7A 4MW9A 5EC1C 1ZKMA 3RTCA 3G0OA 2IPLA 3W5HA 1ECLA 2D8AA 3DB2A 3N0WA 4M9CA 2BF7A 2JAHA 1ZH4A 1V5FA 1KECA 4EKWA 2E9SA 3OLQA 5ILQA 3VHXA 1KDRA 2Z5GA 1URPA 3I5XA 3DZGA 1JH8A 3E22B 2AUTA 1QIHA 5CM8B 1VQ5F 5FLXN 1Q95A 1GUZA 4GXNA 4TWAA 3AB8A 1RAAA 3IUYA 4HN4B 2WUVA 3P2MA 4RJ2A 2AKAB 2F93B 2XRMA 1I5YA 4HDSB 4TROA 2NU7A 4ER3A 2I7CA 3PQ4A 3QUCA 3NDBB 5JG7A 5JU6A 3C1AA 4RD4A 2IF0A 5DNAA 2FUKA 4CKBB 3MC1A 5FI1B 3OE7G 5JMPA 4LWSB 1A9QA 5AW4A 3GRZA 1BXGB 4ZHQF 2ONJA 5TGTA 5AI4A 1HDCA 3OCUA 2OO7A 1YB2A 4HDRA 3KYJB 1W9HA 1ZAKA 4KO2S 3ONDA 3FM9A 3EHEA 1FAFA 1QVWA 2W6MA 4OQEA 3WZLA 2IU4A 1G1AA 1FB5A 2QXUA 2GPTA 3FZYA 4D41A 1SG0A 5IMBA 5D85A 3V46A 4R31A 4K9SA 4ARZB 2JJ1G 3AOEA 3NJ8A 1CK4A 1JSCA 1TT5A 5JS8A 3NCHA 4XB2A 4L87A 3HHPA 4GC5A 1WY5A 2LKCA 1V95A 2CCGA 1W85B 2GEDA 1LPOA 4UAUA 3QVXA 4PW0A 4C81A 2BM9A 4F71A 4IIVA 1OXMA 1PVOA 3BFKA 5IX8A 3QLTA 4IIJA 4DV0O 3KKQA 1C7JA 3C9RA 4MTCA 2F1HA 4J1TC 3RN4A 4G2NA 1JR3A 3DQZA 3F6RA 3M7IA 1FX0B 3F90A 3B7GA 3DM5A 3LCJA 3MDOA 2O59A 3I8SA 2HP8A 6REQA 3A7EA 5IDQA 2GF2A 3S1SA 1DC5A 1ML3A 4R69A 1GZHB 3S5UA 2FHSA 4BGUA 4H15A 4YUAA 2AW5A 5GZ6A 1XDGA 4K3VA 3PRKE 1PO7A 5IDJA 2UXDO 1SC9A 3EW7A