5EYPB

Tubulin-darpin complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
431
structure length
425
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Destabilizing an interacting motif strengthens the association of a designed ankyrin repeat protein with tubulin.
pubmed doi rcsb
source organism Synthetic construct
total genus 178
structure length 425
sequence length 431
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5eypB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5eypB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5eypB01
5EZYB 3WGMA 3WGNA 3JALB 4O4JB 5LYJB 1FFXA 2RHJA 3RYHB 4O4LB 5JH7B 5ITZB 3VO8A 1W5EA 5BMVA 5IJ0B 5KMGA 5J2UB 3ZIDA 5CB4A 3HKDA 4X20A 3UT5A 5LA6B 1FSZA 2RHHA 3WGLA 1TVKA 3JASA 5CA0B 4LNUA 3R4VA 5J2TB 3N2KA 4TUYA 4YJ3B 4O4HB 3RYCB 5KX5B 3HKBA 5JQGB 3WGKA 4YJ2B 2XKAA 4WBNA 3JATA 5JVDB 4U3JA 3JAWA 4X1KA 5EZYA 2RHLA 3RYIA 4DRXA 5EYPB 1TUBA 5GONA 2R6R1 4O2BB 5IJ9B 3VOAA 5FNVA 5IYZB 5MN4A 4F6RA 4EB6B 5J2UA 1JFFA 2BTQB 4O4IB 5CA1B 1RLUA 3JAKA 1W5FA 5JCOA 2VAPA 5LP6B 3HKEA 5C8YA 4ZI7B 5LXTB 3N2GB 3RYFB 4ZOLA 3V3TA 4I50B 4I4TA 5EIBC 5LP6C 2R751 4B46A 1W5AA 5JVDA 4O2AA 4TV8A 3M8KA 4TV9A 4XCQA 4HNAB 2VXYA 1Z5WA 4ZHQA 4EI7A 4X1IA 4IIJA 2BTOA 5MN6A 4X1YA 1Z5VA 3JARA 1SA0A 4I55B 4M8IA 4KWEA 4FFBB 1W5BA 1RQ7A 3JALA 4O4JA 5LYJA 3VO9A 3RYHA 4O4LA 5JH7A 5LP6A 5ITZA 5M7EA 3E22B 5IJ0A 4B45A 3HKCB 3RB8A 5LXTA 4IHJB 5LA6A 1W59A 3M89A 2GVIA 5CA0A 1FFXB 5J2TA 4YJ3A 4HNAA 4O4HA 5BMVB 5KMGB 3RYCA 5CB4B 3HKDB 4X20B 5KX5A 5JQGA 3UT5B 4YJ2A 2VAMA 3JASB 3C8LA 4LNUB 2Q1YA 4EI9A 1RQ2A 3N2KB 5EIBD 4TUYB 3HKBB 5EYPA 5MN5A 4O2BA 5IJ9A 5IYZA 4WBNB 3JATB 4EB6A 2BTQA 4U3JB 3JAWB 4O4IA 4X1KB 5CA1A 1OFUA 1W581 2Q1XA 3RYIB 4DRXB 2RHOA 1TUBB 5GONB 2VAWA 4EI8A 5FNVB 4ZI7A 4F6RB 5LOVB 3N2GA 3RYFA 1JFFB 4I50A 4U39A 3ZBQA 3JAKB 3VPAA 3WGJA 3VOBA 3HKEB 5C8YB 4E6EA 5JCOC 4ZOLB 4DXDA 4I4TB 1TVKB 4O2AB 4I55A 4TV8B 4FFBA 2XKBA 4TV9B 4ZHQB 4X1IB 3ZBPA 4IIJB 3E22A 4X1YB 3JARB 1SA0B 3HKCA 5LOVA 4IHJA 3CB2A
chains in the Genus database with same CATH superfamily
3EXFA 5LZ8A 4BASA 4M22A 4JCCA 2C5GA 1MAVA 2JRLA 1F12A 1Y5NA 4TKUA 3ZZTA 4RPHA 5BUSA 5D5PA 1UDAA 4IGIA 2ATKC 4JLSA 5YASA 2PYDA 4HEA1 3M0EA 2VDKB 5KSYA 5FBKA 2GZ1A 1MFZA 4B5CA 1P73A 3LVQE 3JARA 3ZXIA 4YMLA 2GCOA 3IBGA 4L3VA 2ZCUA 4LY0A 3WMGA 2O2SA 4ER6A 2Q8VA 3R0IA 3TRDA 1I0ZA 3HCFA 4LFAO 3OMIB 2JARA 2R0QC 1M7HA 5CB4F 2EBUA 4BY9D 2H11A 4J49A 3VR5H 2FB5A 2BFDA 1A9PA 4B3BA 2VT7A 5KEIA 2VUTA 4PYQA 3NTQA 3SYMA 2ZWVA 4BZQA 3RIHA 5DOVA 4PANA 5BV8A 1C9MA 1TZBA 3NPMA 3IL2A 3WNVA 1REQB 2HEIA 3JQAA 3O95A 3OOHA 5T4EA 2GCGA 1YBFA 4FD2A 2YWJA 3AL2A 4XD7A 4MYHA 4OJYA 4NBUA 1ZM4A 4CS3A 5LA6B 2P2YA 1L5QA 3HGMA 1GL7A 4Q1EA 1TO6A 1W36C 2I4OA 4NHEA 3VMMA 1JEOA 2GPJA 2HWKA 1SH7A 1PJRA 4MZDA 3NTLA 3EXG1 3TG8A 1XREA 1QFXA 1Z7EA 4BTVA 5B3SB 1E7WA 1SIOA 1W34A 2UXCO 2R9VA 3FG9A 1V2HE 3UOAB 3A8TA 2D5LA 4B80A 4TQUS 4BW5A 1UP4A 1IXZA 2XOKG 1E4YA 1I08A 1UM9A 3CU5A 4GKVA 2F1JA 1FNBA 3C1AA 2M6KA 1JDPA 4TM8A 2H1LA 1JE0A 3D1JA 2ZSAA 2Q3FA 2D7CA 1WHSB 2C0QA 3GBVA 4QU0A 1GWNA 1E5TA 4CLXA 4ZVTA 1JJIA 2GHYA 5CBGA 4ENWA 2CLCX 1PQ4A 3AUUA 3CZ5A 1T5IA 1NURA 2HBZA 1FNSA 4BJHB 1USVA 5ALYA 4GUNA 4BVEA 4EEKA 2ZRKA 3IX7A 3Q9SA 2B37A 2ZS7A 4ACAA 2Z3ZA 4X90A 1LD3A 4YJGA 4NF2A 4ABYA 2P5YA 2F9MA 2W7TA 3E53A 2XGMA 2WINI 3V1KA 5ADWA 1YJ9V 4CH3A 3SQWA 4J1TC 5BRAA 3LHKA 2WJPA 4QUIA 2NTYC 5K6TA 1W76A 2FMHA 2ZYDA 5B5EZ 4HCJA 4US1R 2XF8A 3N2EA 1ETUA 1SDSA 5K1XA 2PTHA 5A9SB 3OCXA 3GWKC 1M7GA 2ZS9A 2EINC 3F4BA 4GP6A 5G0TA 3HYRA 4J0FA 4XB6B 3MINB 2G06A 3ZIDA 5JDCC 4FN5A 3D8BA 1IQPA 3NMUC 4L08A 2IYVA 1QR6A 3BTOA 4JBIA 4AJLA 2QVGA 3IKFA 3J7TA 4J80A 1FAFA 2WAYA 2AKAB 1R6NA 3USZA 2JDIG 2F43B 3UXEA 3FZGA 4XYEA 2YI9A 1EM1A 4CLOB 4BNVA 3OQJA 4K2AA 1ZJZA 4KVAA 1DF4A 2I55A 4UQOA 4G41A 3HXPA 3VO9A 2W71A 5TC4A 2WSLA 3O5AA 3CIFA 1W29A 3GDWA 3S40A 3GOQA 3IFSA 3O0TA 1PR6A 5KYYA 3OE4A 3OM3B 3JATB 4FMDF 1E8MA 3I53A 4QTZA 3USCS 3JPWA 4F6RB 3TBHA 2WFZA 1KUQA 2O2CA 4GVPA 1N6KA 3L46A 4NJMA 4QQKA 5E9WA 1EG7A 2NR5A 3W4IA 2QGNA 3EORA 4WXRA 4DWOA 2A86A 2CAZC 4CG1A 4W5RA 1G2IA 2YV3A 1U4NA 3KZ1E 5CT9A 1H2SB 2OAEA 2G5CA 4UXNA 4YUVA 3ZWMA 3EUWA 2P6UA 2HHAA 3W5HA 1Y42X 3S44A 1E6KA 1T1IA 1XTZA 3GH1A 1SULA 5C1IA 1JJAA 1H8HA 4TVSA 4TWBA 3LUPA 4NE7A 1IG0A 1ZMRA 3F6YA 1Q1ZA 4QT0A 3EHDA 1UBKS 2CYBA 1NL3A 3IAUA 2I03A 3G68A 3I3OA 1QPZA 3DV9A 1RQ7A 1I0LA 4EGQA 5BXZA 1UF9A 4Q3BA 4EYOA 2DT8A 3Q8WA 2G71A 2RB9A 2UYYA 1KFKB 3QKIA 1UOQA 2P8JA 1PTJC 3LC1O 4P4GA 4ABMA 3NC1C 2HCTA 1YZGA 5DEDA 2HKOA 1NFFA 1XXHB 2P22C 5TPWB 3GT7A 2XOEA 4HDQB 1V3UA 1R16A 2PH1A 4JL8A 1KIMA 3DNFA 3I2KA 4BO4A 3HKDA 3UC9A 1XMOB 5HP8A 4MPDA 2BFBA 4A2WA 1X38A 4AF6A 1L4HA 3UO8B 3ZDAA 2D2CB 5IJAA 5AHKA 1EH5A 1YQXA 3SPJA 3RJMA 4MJLA 4ZHVA 3OSUA 1CRLA 2IY7A 4JQYA 1X52A 2AJBA 4MIOA 3A37A 2EBHX 4ZDWA 4YCSA 4DIOA 1LBEA 4TMFA 3HHEA 1IPAA 4G4XA 3E1SA 5E2AA 3M89A 2B1JA 1Z33A 4JJFA 3MUFA 5LVAA 3PN1A 2MDTA 1I6MA 2VZEA 5JR3A 1NQ3A 1TYCA 1NE7A 3I3FA 1EK1A 3H11A 4N76A 1JAHA 1WJZA 3B9BA 1STOA 2PSSA 4QG7A 4FDMA 3PE6A 2PX8A 3WNDA 4WF9V 3UG7A 1WA5A 4UCVA 4FZ5A 2PM8A 4XYLA 1UJ4A 3T7CA 3IMFA 1S3IA 1R0SA 4L4SA 5EWLA 4EJMA 4EHKA 4MO9A 2W6IA 3Q3HA 1K6EA 2J67A 4RAIA 1Q95A 3GFQA 1GN2A 1YS2X 3PS9A 5BXYA 4MW3A 1NUAA 1EXWA 4LXUA 2ZRMA 5EKDA 3AF6A 1BWSA 5PNTA 3PXEA 2BAGA 4FINA 3R3JA 1S3JA 3K0DA 1XI2A 4ZQBA 3MWFA 2J33A 4GEGA 1O6ZA 4G97A 4D6PA 3T9EA 2IHBA 2A9HA 3X1DA 4JKIA 3DLTA 1PYGA 1OZFA 1F5SA 1O58A 1BIFA 3C3TA 5KVQA 1CULC 4RSMA 2YWCA 5EA2A 3N27A 1C3LA 2QTVA 3KQWA 1UK6A 4YRIA 1KI6A 4D3FA 5CA1A 4OOFA 4ZANA 2SNIE 3QPDA 3UV3A 2I8AA 4Y9SA 3QZUA 4LGYA 4EGFA 2ROQA 5IXJA 1PUIA 3PYMA 3LQ4A 1AR5A 2SHKA 3CZRA 5LQMA 1ISSA 2Z6AA 1G9SA 2X76A 5KYNA 3OQIA 1I51A 1UXIA 1FFTB 4DHWA 2QZ4A 3E8SA 3ZHUA 1P3JA 4P5EA 4JUCA 5CB0A 5K20A 1R6DA 4MP3A 2WNIA 4ZEMA 2YX1A 3SQNA 1LLDA 1ODEA 1O54A 1S9DA 2Q5CA 2CVLA 2NT3A 1S4QA 3PDIB 2GTPA 2P65A 3ZD7A 5FO1A 1A9RA 1LVUA 4M7WA 1U40A 3DLPX 2Q7XA 2K9PA 3OLVA 4DG9A 4EHJA 5ARBA 3TZ6A 2OWDA 4PVCA 4XJTA 4K86A 3IMKA 2UZ1B 1H0SA 4HNHA 4NENA 5CAEA 5A7HA 1YCHA 1ZH0A 1G8FA 4MUEA 3K70C 1SC4A 4F3TA 1R6BX 3A11A 4IT5A 3GVHA 2P06A 2FFBA 4BRSA 5K3BA 4Y0VA 4TSFA 3HJBA 1XTPA 1BS9A 2WD7A 4MI3A 1NBME 4EP1A 1Y8QB 1IXRC 4AUNA 3NG1A 1QFYA 2OBBA 3DOOA 4IV0A 5DMXA 4WOKA 3GJ4A 1Y6FA 1OH8A 4EG7A 2ZULA 1UBGA 2PT7A 3D6TB 3AW8A 3I8OA 1WCYA 1I10A 4MCHA 2JVKA 3Q7QA 2X3YA 3PE3A 4C76A 5DO9A 3L8DA 4EI2A 5J23A 5TPZA 1A9TA 3HTXA 4YASA 1JEDA 4AS3A 1SWWA 4M9XA 1Y74A 1KYWA 3VYTC 4CW7A 1GXSA 1OCRB 1V39A 3JAMN 1IL0A 4LSWA 2V65A 4JSRA 1JILA 2FPIA 3KYIB 1JA9A 4HUQB 1UMCA 1R00A 1ZXXA 2ONJA 2H2FA 1UQRA 2FQWA 2X2FA 2GJAA 4CCWA 2F8LA 1ECLA 1KL7A 4GKJO 2WKQA 3JAKB 1I2BA 4XB1A 2ZE6A 1YE5A 1EN6A 4C0SA 4EA7A 1X7OA 3BBLA 3KL2A 4BB0A 3SBXA 4BNFA 1T8RA 1QGED 1K4DC 4DMMA 3W3AH 4N0PA 1OBCA 1Q20A 3PP8A 4ZTZB 1E5DA 3AKZA 2XDYA 3BK2A 2Q7DA 4QNMA 4G3XA 3EDYA 5KQRA 4GBGA 3K9BA 4CT0A 2W98A 3TM4A 1N3LA 4L87A 1N9ZA 1WVGA 1YMQA 2PGDA 5ALTA 5BSGA 4X1YA 1I7LA 2W2PA 3V1LA 4LFBO 4E4RA 1M33A 4PLFA 2WIAA 1LDEA 3AU8A 2HU8A 1VPEA 3TKLA 3QYFA 4LTMA 3SR2C 4DWVA 1JQAA 1OCOC 3H5TA 3U7QB 3VR2A 1PL0A 4RSHA 2YRFA 4PNEA 1T6YA 2AK3A 4C8GA 3GJ3A 3LT1A 4HB4A 4NXMB 3DM5A 3OE7G 1W85B 3FOCA 3FHCB 1H2YA 3GDGA 3DTVD 1RXYA 2VJMA 2DOKA 2YKGA 2ZR2A 5JNWA 2I1VB 3QFHA 3H1EA 1ULZA 4OO3A 1UFVA 3TDNA 3TQQA 3PTLA 1EA5A 2ALJA 2PDAA 1BXGB 4JD5A 4AILC 2XDQB 3QXHA 4D25A 4NEHB 1TUEA 3FKSA 1G3IA 3R5KA 2DPYA 5LBUA 3GGDA 2BTOA 1XMJA 2EAUA 1DT9A 1YDGA 1YDXA 1FBTA 2BE7A 2XAAA 1XVLA 1SHUX 2R00C 1QF9A 3MJFA 2WRZA 4XOUA 4N40A 4F3KA 621PA 4JUFA 1S0UA 2RG1A 5BXQC 3AB3A 1IPHA 4P0TA 4L3OA 1UZMA 1FX1A 1PGNA 4K88A 4ZQFA 1LEHA 1HDCA 1GZHB 1PR4A 4FZ1A 1LDMA 4WKPA 4BNMA 1IH8A 3A0BZ 2VDWB 3IHTA 4MEBA 4UFPA 1NOKA 1WG8A 2IWRA 3TS1A 3B85A 4AUEA 3FIUA 4GLJA 4GZ5A 4C0QC 2FFHA 1Z75A 3DT6A 1Y1TA 4W5OA 5A3SA 1Q1AA 2HSWA 3H16A 2ZR3A 3FLBA 1PL7A 3AK4A 4DUZB 1I6KA 3EC7A 5K0EA 1R1DA 1QK3A 1ZGJA 1SESA 3GBPA 5CCEA 2Z56A 3TNFA 4YPFA 5FLXN 1BW9B 4RD6A 2FVXA 2OG1A 4ZRNA 5LP6C 2WMYA 5BRJA 2QN8A 2X3FA 2Q5JA 3DDZX 4YRRA 3DDUA 2VPIA 5CXQA 5DT9A 4L0CA 4BFCA 5DHRA 3RS0A 3B1KA 4OQEA 1ZEJA 4O2BA 2BD0A 2PBRA 1FDRA 1Y4DE 3VZSA 5I4BA 1MORA 1JDVA 3HUDA 5FOWA 3CBGA 1Q83A 1TFUA 3KXPA 2D7JA 4ZZ1A 1NM5A 2LR0A 2Q4PA 3N8HA 1EUYA 4OQMA 2OD7A 3IDFA 3QKRB 5JZ9A 1XRGA 3NBZC 2JI8A 4JLJA 4IL5A 2WWYA 2DWPA 5BV2P 4YXFA 3EXIA 1DAGA 3RKUA 5I7UA 3RFRA 4HNGA 4W7SA 2NUAB 1O1YA 5HKAA 2BI8A 4JB2A 4Y2XA 1SAYA 2B21A 3E8FA 4XOIA 1UWCA 2HZ7A 4G65A 3TM5A 4HGOA 3HADA 2AI3A 4CL8A 4ZO6A 4UBJA 4E46A 3MLBA 5HCIA 2QMUA 3ONEA 5FAKA 1TKAA 4RJ2A 4F3RA 3KCYA 1RQLA 3NR7A 4HAIA 4IJ6A 1EX6A 1G16A 3H2ZA 5G1NA 4KO4S 4CEHB 4B35A 1T6XA 3QXJA 4L6CA 2V9YA 1D2EA 3NPAA 4JDUA 3SR0A 5AM3A 3U56A 3K6RA 1ZY2A 1RBZA 3BIOA 3QUTA 5KTPA 2B36A 1HKUA 2UYKA 1OJ7A 1YZBA 4FFBA 4C7VA 1XVAA 3IT0A 3KYDB 4UHCA 4BU0A 2DQSA 4ARCA 3ZH2A 5K8VA 5KYXB 1T2NA 3K2BA 1R4ZA 3DCYA 2H9IA 4LMPA 1QBZA 4TUYA 2XRZA 1I3LA 1PFQA 5LJLA 4LGMA 1KVSA 1SHZA 3S5UA 4ZIRB 2ZI4A 4D6TH 1WCXA 1B42A 3AFMA 3L18A 5J1SB 4QFCA 3SVTA 1LWNA 1K7CA 5JXWA 1H2HA 5K8UA 1YIJV 3MD0A 4WBSA 4HVCA 1RLMA 2WTBA 1YI2F 3WGHA 3ZKAA 5I6DA 2ORED 4M87A 4IXWA 2BGJA 4NTWA 1KJIA 3CLTD 4JJAA 4XJXA 5ALEA 3JRWA 4IHJB 2FN7A 3A6JA 3KE9A 5DHTA 5FPRA 2CHEA 2L42A 1M2VA 2E76B 2BFOA 2GTSA 4XVQA 4DO2A 2RAVA 4JTDB 5LD2B 4PYMA 1JFFB 1WCV1 3I8XA 3PRYA 1HR0O 4Q1BA 1EFPA 5TEWA 2JFQA 2VLBA 2FN4A 2FWJA 1V45E 2QDKA 1SS3A 1L4LA 1ZC4A 2QKAA 3KSZO 4UHKA 2XHBA 1Z6PA 3DULA 4N54A 1WPRA 3P4UA 1BQ4A 4FLEA 4GRDA 4BBPA 4O2RA 5JQGB 1PJAA 3GNSA 2IU6A 1YUBA 5LLDA 2QM3A 3WGIA 1ZOLA 2CY0A 4QOFA 2B4YA 3RJTA 4RKQA 2TYSB 1IZZA 4QL3A 4YJDA 1Y8AA 3KJJA 1HT1E 4E5UA 2Z5GA 1D1SA 2BSAA 1GDTA 2F3SA 1U98A 5CM9C 4I3GA 1VB3A 4FTWA 2ZIXB 3PC8A 2PZBA 1Y3HA 4KE9A 4J7JA 1QH8B 3OT7A 3ZW9A 1NH2B 4KGZA 4LF7B 3PVCA 2YY5A 1W0CA 5BYJA 3NEJA 2FDRA 4MV6A 4JASB 3IV7A 5FI0B 4L76A 3PVZA 2NZVG 3H9QA 2BTQA 1W2BU 2Y6UA 1C3EA 1GLVA 5A6VA 5FR1A 3FBGA 4PS0A 5IFLA 1YACA 4D56A 3AT1A 1QV6A 2WNSA 1NC1A 3ETCA 2KSQA 5BZBA 1QGDA 3LT0A 4D7AA 4REQB 5DCVA 3HR0A 4TLDA 4D0RA 3WIDA 2M98A 3L8GA 2RD2A 1UWVA 2X14A 1YQQA 1CE8A 4YIHA 5IKPA 1SZJG 1NR7A 5ALMA 2CFRA 4MS3A 3CCBA 3P27A 4X7MA 3RBZA 3L1HA 2FWAA 5AW0A 3RPEA 1RRCA 1VCNA 3CW8X 1PX2A 3RFVA 3CNQS 4J9YB 3Q4HA 4AJOA 2XSZA 1BCRA 2LBPA 1FP7A 5LDHA 4ZZIA 1NTZH 4LS3A 3RNLA 1DU4A 2P9JA 2R79A 4X64B 3GFBA 3JZDA 2CZGA 1YH3A 2HNKA 2F59A 1H42A 1PL4A 1YRQA 2PQ6A 5L45A 1HDYA 5GONF 4Y1FA 2IYTA 4TTJA 5L9AA 5K0FA 3ZCSA 3IEWA 1YONA 5KPJA 1N8NA 3LTEA 3PFKA 2P8SA 1NVBA 4HH4A 1IMJA 1JLLA 4V0OA 2UXBB 3WKBA 1F0KA 1GR0A 3A6HA 4A8JB 4HLUC 3UUWA 4ISCA 4H4CA 3SDLA 3QJYA 2YSUB 1XJWA 2R96A 1SQBH 1CF2O 3TQTA 2WTUA 1LCIA 3Q0EA 1YRHA 5CD9A 4RVUA 4K3VA 1GUDA 4PEVA 1CXZA 2KWIA 1EP2B 4LECA 3ABQB 2VQ6A 2V6IA 4QDJA 4JI7B 1QBKC 3HCOA 4OHKA 2RJNA 2ZTMA 1HDXA 3D4PA 2VYCA 4B3TB 3NANA 1VQNV 3SJAC 4CM9D 2JRCA 1NVTA 1AKRA 4ENUA 3H97A 1RS0A 1JEEA 1I30A 1XMIA 2VEDA 2JCVA 2WUGA 4WUVA 4LCBA 1PHRA 1NR1A 1JDBC 3E5NA 4LYDA 3NBAA 4L78A 2Q1XA 1Q43A 4Q39A 1SKQA 3HCBA 3HB0A 2JIZA 1CIPA 4GPEA 2Y76A 3PSAA 2CSUA 1WCIA 3GAMA 2IYRA 2Z2XA 4C7XA 1QQ7A 2L0XA 3LTNC 1KMNA 1THMA 1Y34E 2GAAA 3PDHA 3DLHA 1GNPA 3NRJA 2QTWB 3TZHA 1BS3A 5LB4A 2V3WA 3TGLA 4PE5B 2QD3A 2YICA 4BZPA 1NJGA 5KVCA 2P40A 1GK9A 5DW3A 4G1MB 4KVZA 5CT8A 3QEMA 1NP7A 4YK7A 1WMAA 3TW0A 5KYUA 2Q29A 4DQ0A 4K9LA 4M6WA 1EBBA 2G7ZA 4YMUA 4IXTA 2ZODA 3V42A 4YCBA 4MVRA 3G6EF 3OF3A 1AVTA 2ZOVA 2VT3A 1KAOA 4LV8B 1JQLB 1PSWA 4B82A 5KVSA 2WJWA 1ECPA 1KQFA 4Z4CA 1JNXX 2IIPA 4URUR 2QN9A 4XRRA 2P9TA 4K9MA 5L3RA 1F48A 3SS7X 5F4ZA 4UW9A 4JEIA 5TGZA 3F0FA 5GVRA 1TEZA 3VX4A 1NNSA 3A9RA 2CCKA 2GMWA 4FEGA 2Y1XA 1AKEA 3G88A 3H1AA 4NQRA 3ADBA 2YIBA 3V2IA 2BH2A 5FA6A 2ISCA 5FUMA 2OVFA 4LC1A 4BMDA 3IE1A 3WMFA 1XZIA 2GUZA 3CXCF 2CXXA 2IW5A 2PKYX 1G18A 4UULA 3AMVA 3T5CA 4IDCA 2RH8A 2ATEA 1AUPA 5ALFA 4D96A 3CRNA 4G9GA 1MJFA 3U5ZB 4B6FA 3ZX4A 1O4WA 4Z1MD 1E0DA 2JANA 1UBCA 2HBRA 1XZEA 4GSYA 1ULBA 3TQRA 5IAJA 1U5BB 4EM6A 2MR6A 4JV5O 2PLRA 2XAQA 3FVVA 4AICA 1G3RA 5JFOA 4XUDA 1L5KA 1F3LA 2W6PA 4GPAA 1I36A 3JAMA 5SYMA 4K6FA 1MVLA 3GVIA 1MTZA 4YCCA 3TLXA 2A0KA 5ICSA 1CNMA 1TT5B 2IK8A 3QU4A 5G3YA 4CVNA 3ONVA 5IYBO 1E2LA 2PD4A 1JA1A 5HM8A 4JAVA 2R86A 3NBMA 3SN6A 1YS4A 1T8UA 4AMVA 1IWBB 1YZFA 3SGLA 2Q6VA 5A7GA 2A2ZA 4GYCB 1S5LZ 2VWKA 2FQ1A 1G21E 1BSVA 3R6DA 4MHSA 1K5DA 3KQOA 4H0CA 1JD1A 3UH1A 2WZDA 1A9QA 5L8VA 4DMLA 2H4YA 2IJGX 4H1VA 4IGEA 4YRBA 1YDWA 2V1UA 4PM4A 3LXUX 4RVCA 5K51A 1YJCA 2WMOB 5JCPA 1NAHA 3U44A 4H6PA 4UAUA 3PCXA 1OCCB 4IAOA 2B4AA 4PLWA 3F98A 2WPDA 4YMTA 3IIIA 4P30A 1R1MA 3IQHX 2BEUA 4PZDA 1JVMA 3RYIB 3D6HA 2XUFA 4RVNA 5L3QA 4NK5A 2G9UA 3UCSC 1HBJA 2EGGA 2HK6A 1XA4A 1L7PA 4G0MA 2ZJBA 4FLYA 5TS2A 3ND6A 5DGIA 4KXLA 5FNZA 1GV0A 1FFXA 1J2TA 6AT1A 4BLUA 3LBHA 1MAWA 4IZHA 5F1KA 1BE0A 3VHLB 2HIMA 2REQB 4UARA 5DV9A 1VHQA 2V98A 2P7TC 4JR0A 1A8QA 1Q74A 1A9XA 4CZZA 3EUFA 4GMGA 4CQMA 1ZFNA 4YCJA 1E2GA 5TQVA 3IESA 4A10A 1T0AA 2EIMC 4D9JA 1T2AA 2ASVA 5B58C 5D6OA 1VE7A 4BP3A 1RKXA 1U9IC 3WP0A 4J6FA 2FR8A 3LDCA 3ANYB 3NOVA 4IILA 5G4KA 1KO1A 2PWZA 4ZAYA 1NTRA 2FZGA 5J9PC 2ZG6A 3B6MA 1H6AA 1A3CA 4YCMA 4HPXB 4KP4A 1CY2A 4ARVA 4TMWA 1VIAA 4Y18A 4CR7A 3SC6A 5L7WA 5JASA 2R1TA 1M8FA 1NBOA 2ZJ2A 1EA7A 3C3DA 2QLLA 2ZBGA 3SYPA 2XQJA 4M1OA 3HFJA 3NM4A 4J7CA 4C2AA 1PKEA 2PBZA 3I04M 5TT1A 3ZE9A 4B8ZA 2YWHA 2HX1A 1T1SA 2QPAA 2HT6A 5AKGA 2N42A 3OJCA 2IOQA 3A6DA 4ER0A 4F60A 3RU3A 1AH2A 1D8TA 4IG4A 4HDRA 3SSNA 4JGBA 3PT9A 1ZOSA 3SIUA 4IH4A 1FVFA 1B74A 1SXIA 2HCJB 4PO8A 1W88B 4KNWA 4Q3EA 2YDEA 3A7EA 1XJCA 1ZK1A 2ZQ5A 3U4HA 1LS1A 3WK4A 2XVMA 1J99A 2ZITA 5GZ1A 1B3RA 1NW3A 5KAPA 4IGAA 4ZPXA 1SPBS 4AYTA 1FUEA 3K09C 5J3JA 3AWDA 4BO9A 2P6RA 5C31A 4QUGA 2OK8A 2VBGA 2RGNA 4NCIA 1P7PA 3H75A 1KJNA 2ZI7A 5B3SC 4EB6A 5K0JA 3TL2A 4DXAA 2N46A 3TL6A 4Z4IA 1RSZA 4CMGA 1Q90D 5AK3A 5BQ3A 1Z8NA 4HQ0A 1I3OA 2YW2A 4INJA 3AR9A 3DFIA 4DQKA 2WJYA 5G2OA 1B15A 5BR4A 1I13A 2BN4A 2C4WA 3YASA 2ZRHA 4RA9A 1BT8A 2BGLA 1T3TA 1Y5RA 4KZKA 2H16A 3TFOA 4CH6A 2B6HA 3M4ZA 2AC2A 4OBEA 4BEBA 3DE6X 4IRMA 1KFJB 4K6CA 5IJWA 2QUKA 1XUOA 1Y1QA 4LJ9A 1EXDA 1JA8A 5EMMA 2I9KA 4DCPA 4OK5A 5HGJA 1GCIA 4BV2A 3TZLA 2OQ2A 4PHGA 1VH8A 4B5KA 3IGFA 2NUBA 4BQQA 4DCCA 2C98A 3EMVA 3T4EA 4DYLA 1DFGA 1ANKA 5JHHB 3GPIA 3U9LA 1AI6A 3W5UA 4J0IA 1DADA 4GGMX 2C20A 4CI0B 3PJEA 1VBFA 2QRMA 1OX4A 3HYNA 4MW4A 4RC9A 1CIVA 1XL1A 4IMIB 3ABRB 2OZVA 3LDAA 3UHPA 1XDCA 4EK9A 3CYFA 3MJRA 2LTAA 3JZIA 1EUQA 2AR0A 3DE7X 2M6YA 1E4VA 2E5WA 1LLCA 1CEYA 1TAGA 2G83A 2HA5A 2B4QA 3IEVA 4LWPA 1M6EX 4ZFNA 2GM9A 3B8EA 2BGKA 4XQ9A 4CL0A 3PX7A 4OXQA 3PEFA 2X4GA 1XFDA 2R87A 3D7RA 2DKOA 3OPNA 5I4CA 3ZU4A 1FSGA 3EASA 2BR5A 1VJ1A 3CZMA 1SCNE 4YX9A 4GF5A 4QXQA 2C2KA 4IDQA 5ALQA 4G5GA 1PP9H 5JVDA 1RHJA 1S2DA 3KUKA 3WLEA 2BFCB 1Z5VA 4U6SA 4DZZA 4JI1B 1W5BA 3CNHA 4OHVA 1MA1A 2Z43A 4U2BA 4Z1OA 3GGJA 2FOXA 3HHPA 3RS5A 1YR6A 5CFPA 3UJ8A 2VBFA 4HN2A 3RBAA 4ETNA 4C7OA 3D5EA 1P81A 2O1XA 1UJ5A 2QHXA 1XZAA 1JBQA 3QK7A 3ZE7A 1ZI6A 4H17A 1JZQA 5H80A 3FSEA 4DA0A 1YVPA 1FLNA 4ZMSA 3S2GA 5KHLB 3U13A 1PVOA 4XDKA 1E4EA 3WL8A 4Q4HB 2B34A 1WOYA 1DBRA 3W3AA 1UPUA 3TLEA 3ON5A 3X2QB 4ILEA 3O03A 5ALGA 4JYAB 4G25A 3IEMA 5D3QA 1JAXA 4XJSA 4M0MA 3FBWA 2VLIA 3A6ZA 4ZEWA 1YF3A 5IDJA 1WUTA 1EGVB 3WJ2A 4E21A 1NQXA 4FYXA 5HJ7A 5LZ7A 1UBRS 3ZC3A 5EZ6B 4YP5A 5TISZ 2P3OA 4HDOB 3INYA 4REOA 4I1PA 5KMGB 2EGHA 1F2TB 1UBFA 7YASA 4LWQA 1NRJB 2DFKB 4MDHA 5H70A 1E2PA 2NTVA 4W7HA 5FBVB 3LT5A 1RYMA 1TJYA 2VP3A 3CJRA 3EGDB 1QVGU 4EI8A 2Q5FA 5JSHA 2IJKA 3IP7A 4MVOA 2JL1A 3VX3A 4WA7A 4P22A 4I4TB 1Y7LA 4AQYB 5DK4A 5HUQA 3P9NA 1D4ZA 1UFQA 4Q9KA 1BWPA 2UYCA 2ZRAA 1O96A 4FJ1A 3BB3A 4RZUA 4LRWA 3OC6A 5KBYA 4X88A 5ELLA 4LOLA 2E74B 3INTA 4D8WA 2EERA 3OQNA 4JOCA 1ZD2P 3FDZA 1AS2A 5IYCO 3L6UA 4RF3A 2YZKA 4R5HA 1OV4A 2VQSA 2WT4A 2QAGA 4RDHA 4QM6A 4MVJM 2V1XA 4GYYA 1JIXA 5E1DA 3AJEA 3LPMA 4PRZA 4N65A 3MFYA 4KRFA 4HNAA 4Z49A 2JGNA 2JHFA 1EUDA 4HPWA 4DARA 1JX9A 4FFVA 4MSUA 1WD7A 5FOUA 1W6RA 3QXGA 3O21A 3I37X 2CVOA 4Q03A 2QR3A 5GW7A 3QTBA 1NBAA 4V3BA 1P3Y1 2WOJA 2A14A 4II2A 4BCDA 4D4IA 5KYVA 2V7QG 2HQ1A 2XR1A 4I7EA 4BE9A 3ZLJA 5KSOA 1V96A 1FFAA 2FAXA 4ZV4A 2DWCA 3FCYA 1IWOA 4GGPA 4PQGA 1YNOA 4IWYA 1G1AA 2PMKA 3UAWA 5G0UA 3VI4B 1AS0A 4LDRA 2IDKA 3DXZA 2DMRA 1UOPA 4RM3A 1ECFA 1NMUB 3BILA 4CV2A 5F76A 1FMCA 2YNMC 3UANA 5LWQA 4WV3A 2QD2A 1OAOA 2LKCA 2F6RA 1EHCA 1NF8A 5FLYA 2JAOA 3OZDA 1J23A 4Z7OB 2CDNA 3HAXD 5BSKA 2LDBA 2G1KA 1IN5A 2PJUA 1O95C 2ZAYA 4F4FA 3PFBA 1IIRA 5BSUA 3NM6B 1GCOA 2Y69B 2A4KA 1W4LA 2V7VA 3VQTA 3N2IA 1WZEA 3K06A 1N5OX 3IQDB 3TCUA 4D0NA 4XDYA 1ATIA 2OEPA 1ADYA 2PGAA 4OHYA 5CCBA 2VI5A 2JJ2A 2C03A 3EUAA 4UNRA 4EUNA 5FBHA 5COQA 1JH8A 3ADKA 3LK6A 2W4IA 1GTL1 4K0KB 1TYAE 1U8YA 5JZBA 3S2FA 3Q9LA 4K3UA 1Q3KA 3IRVA 1QHFA 4U7PB 4CUZA 3J7AU 3DVAA 3QQ5A 4ZK7A 4IIVA 4UNIA 2X3UA 2YY6A 3WRXA 4LC0A 2EP5A 1T91A 3EGVA 4DUGA 4M98A 3L04A 2PRZA 5A2GA 4RAOA 1L8OA 5KQLA 4K5QA 2GJ4A 4JOSA 2Y1FA 3H86A 3F5FA 1KYVA 1RWKA 3G4SV 2QTRA 3VKHA 1L7OA 1BU8A 2EV9A 1JSRA 4NCAA 5EP3A 3GZJA 1QMGA 5BY2A 4NXNB 4PXAA 3UJHA 4GLFA 4FEYA 3VYVA 1ZNYA 2DQ4A 4LY6A 1H1LB 3T3OA 5KUKA 1B6RA 1KE1A 5IUNC 4D8UA 4AJKA 5AM5A 5LOVA 3SZLA 2KS6A 1O57A 1PR0A 3OKPA 1AN9A 2CGEA 1QF6A 4D0LB 3EZNA 3L0OA 3LWVC 2FSIA 4WINA 5BW5A 2CEKA 3D43A 1XZKA 1BQ3A 5EZYA 4Q01A 2QN6A 5FHQA 1SUAA 2A6PA 5MFZA 3OFND 2DC1A 4Q7MB 3T7IA 1VLVA 2EDCA 4M1ZA 4RM2A 1SQ0A 4C04A 4LE2A 3KHNA 3CLSD 1OAPA 2DP4E 1SKYE 4IIEA 3K4QA 3R7WB 4Z4EA 3GLIB 3B3QA 1EZVH 3OHMA 3TPZA 2BCJQ 4ENPA 2ZXUA 4BCBA 1KZ9A 4QO7A 2AZTA 1F1JA 5T7BA 4DA6A 4CC5A 5CYFA 3TOCA 3SIXA 3O92A 2I2XB 2E4VA 1L1RA 1IV3A 1PT9A 2ODEA 4ZGBA 3QVNA 3DF7A 1DC5A 4OFWA 5BWOA 4ZOLB 3FF4A 3EQ8A 1ZNWA 2OG2A 3FD8A 3ER6A 2Z98A 3HCWA 3JWPA 3W7BA 5JSUA 4XZ3A 5IH7A 1P77A 2I66A 2R5WA 1IVSA 2JK1A 3L1IA 1XEQA 4G8DA 2ZDQA 4YJ3B 3A06A 4WK6A 4Q4LA 5J63A 3LGXA 3TZEA 5K03A 3IEIA 4MB0A 4BU1A 2E4WA 3P2EA 1QHTA 4CLRA 3MBOA 3FCCA 2RI0A 3I6IA 1K5PA 4J3FA 2EEPA 4UCSA 4AVYA 5HJ2A 2QB5A 4FXPA 5AI9A 3MELA 5K6AC 3F7TA 3K0CA 2R7AA 1JH9A 3B1WA 2YV2A 1CKEA 1ESEA 1U11A 1R3IC 4Q1CA 2EHDA 1TAHA 4BO6A 1OHHG 3CWZA 4RUKA 2OCGA 3UWMA 2RH4A 2PKQP 4MMZB 1O5IA 2ECFA 4Q5IA 5FTLA 3KQPA 4FLXA 2NT4A 5K1PA 6YASA 3AHJA 1XDWA 3GWGA 4M55A 4MS4A 3N4ZA 1P0QA 2JD1A 4UEOA 3DQZA 3W5BA 3O2SB 4LBWA 2V9ZA 3C8UA 3RJ9A 1EFRA 4R9NA 2XYHA 3UBMA 2IZZA 5CYOA 1VQ9F 3V34A 4KDFA 3LDGA 2XE7A 2FLKA 1XMSA 1WEHA 3WJ7A 2D6FA 4LRUA 2DFPA 1QHIA 1AR1B 4KO1S 4EJ6A 1JJ2F 5IHXA 3BA8A 2C82A 2YI8A 4LG1A 3E48A 5PGMA 4D9BA 3O26A 4UPEA 2OTJV 1NXWA 1DGQA 4JVOA 1T9AA 4ZTUB 3THRA 3NHWA 1G8AA 2AE1A 2ZPAA 4LH6A 2VWGA 3GWZA 4LFCB 1G41A 2CK3G 4HH3C 3EYWA 2WLHA 5LZ2A 4J75A 3JCUZ 4D42A 1C3JA 4Y1GA 2OV6A 1O2DA 1DCKA 4B3XA 2B5OA 3S0HA 4QXRA 1OCZB 1AGXA 5CH8A 5JCOC 2A5FA 1ECGA 3U60B 1E1YA 2B9ZA 2ZD9A 2XMRA 1AQLA 5KOJB 5GMOA 4QHSA 1QGYA 5BOVA 4DW1A 2E4AA 3KQVA 4MW0A 3ELUA 3SYOA 5AH0A 1VF7A 1L8XA 2FHSA 3DBRA 2R8PA 3PIRA 4CM1A 1TQDA 1VJ5A 4MS1B 1F7UA 1RHKA 2R62A 2L26A 3CTMA 3K16A 1OE0A 2A9KA 2WHQA 3OZXA 4R9RA 3MNFA 4HOYA 3V8BA 1VQ8V 2BO1A 1CERA 1X3LA 4RWZA 1QIMA 1RYDA 5I7HA 3U31A 2RCVA 1MFPA 1UINA 2PTGA 1MSDA 2OPBA 1XPUA 3QG5A 4AZ3B 1F20A 4R9SA 3ASOB 2ZCJA 4EZEA 5JEEA 3S2IA 1VDZA 2E4ZA 1X80A 3LSYA 4CMEC 1WVIA 4JYBA 3QPUA 2OXIA 5KHOC 1QRRA 4NS4A 4OJTA 4RESA 4P2BA 1KQNA 3MOIA 3IHWA 3IKVA 2GN6A 1EP3B 4O4HB 1NI4B 4GNKA 4YJ2B 3H3XA 2OZKA 2WLSA 3LYUA 2Z2YA 4Y6RA 4OI0A 3P9YA 1PUXA 2CV0A 4HEQA 4OIMA 1VXRA 1TKCA 1IJEA 3AF3A 2XZOA 1SQ5A 1QE5A 5CEFA 3RFXA 2CXHA 3SYLA 1JDJA 3KDPA 4CMCA 2E82A 2YWFA 1EE1A 5JE8A 1V4VA 1TYBE 3L8CA 1XNGA 1UOOA 5BR8B 4BVAA 4GUDA 1NLZA 2FWIA 3KKZA 4LJYA 4UAJA 1M0TA 4R7CA 4NCNA 5EKXA 3C98A 2K5UA 1KJZA 5AUPB 2W6OA 1COWA 3QVOA 2IYNA 2HUNA 4ZJYA 1F7YA 2ILMA 3T1QA 3LVFO 5ALOA 5B1AB 2GYYA 2LKDA 3LY7A 3WV5A 3O1HB 2D2EA 5CBHA 5JROA 3PE4A 5EAIA 2RBKA 1XX6A 5CMLA 1II8B 2WIJA 1LVHA 4I6GA 4BEVA 1CUCA 16PKA 4YDRA 3R0QA 1JLHA 3G2IA 4J1QA 2IE0A 1XTTA 4QHTA 3FI0A 4I5EA 3LMKA 4XM1A 3KJGA 3HL4A 5HCUA 2BHRA 2J3JA 4CKYA 1N8SA 4KQMA 3HGTA 1VPTA 2V4UA 1U02A 1M1YA 4A0FA 3CN9A 3JPYA 1WXDA 2JFWA 1VGVA 5CRIA 4EABA 1WBDA 4YCNA 4AMYA 3EPJA 1KDTA 2DPGA 4IIGA 3EZ6A 4BRWA 5IX8A 2DMXA 3TR6A 3AJRA 4DLYA 4UTPA 2QL6A 3AEIA 2P75A 4EA6A 3QUWA 4Y9TA 4L5YA 2AF3C 4J3NA 4YFYA 2ZJ3A 5EG5A 1JOYA 4P86A 1W35A 3WA7A 5LD2C 4PHCA 2DEUA 4NOKA 5CTJA 5CDSA 3ICCA 4IRXA 1SUEA 4K9DA 5GM2A 1EWKA 5EJEA 4A6DA 3X2SA 4FLZA 1TYEB 4Q9NA 2C7VA 1SERA 1R8SA 2IV2X 3D36A 3B3FA 1Z0JA 1QF7A 4AMZA 3OOJA 5TDHA 3MCUA 2VSYA 1D04A 5EKSA 1Z88A 3L0PA 5NULA 2IZ0A 2BL4A 3W5DA 3L0YA 2IPAB 4HDNB 5GVSA 2WLLB 1JKJB 4UMFA 1HE5A 4U00A 3NONA 2YDYA 1GTMA 4EDFA 3ABIA 1RYNA 4GC9A 2FETA 4C4PA 2VJQA 3MWJA 5DHSA 4WK4B 1TEXA 1COZA 3PPVA 3A0RB 3HKEB 4DV3O 5JO0A 2KBEA 1Q17A 3ZS8C 4NAHA 4BBJA 5A4DA 4IVRA 1JR4A 1ZIOA 3RSQA 5CMUA 5LKAA 3CGWA 2RHHA 3PGXA 2RMKA 4QPKA 1WL8A 2NXJA 5KOHB 5JATA 3PA6A 1KJ9A 5H2FZ 4BCCA 2J46A 3ZXUB 1CRWG 3H18A 3I0MA 3KV1A 3MJHA 4BFSA 3QW2A 5GV7A 2ZUEA 4EB3A 2IHYA 2XRMA 1CRQA 1YR9A 2HJGA 1JFSA 5DFAA 1LBSA 3N1UA 3B52X 3WB2A 4JIGA 3EJ6A 2HDWA 1CY4A 4CETA 2EWCA 4M54A 3ED1A 1GPBA 3C4VA 3PQFA 1G63A 1TGOA 3OFKA 1QVWA 1XJ5A 3IUMA 1ZS9A 1U0GA 4BFYA 2VTBB 5KNCA 1ZJ6A 5IMBA 3P9CA 2AI2A 4KVFA 3O65A 2CJPA 5B55A 4UFOA 2N47A 4EPYA 1NKVA 3VQXA 1RMTA 2CYAA 4DIBA 1VPVA 1C3XA 3D3NA 2OENG 3A9VA 4NONA 2YFHA 2WSYB 1IDOA 2AMLA 4WN9A 4Z9XA 5EJ5A 4AJ4A 3DF9A 3OO0A 2H4ZA 1YRWA 3HBNA 1YTUA 1VGRA 2YUAA 1RLUA 4FR0A 4BVFA 1JZTA 3EG9A 1JL3A 3BSWA 2CUZA 3G79A 3F3SA 5LP1A 3ZHCA 1ZW1A 1C1YA 2H2AA 3FYCA 4OB6A 2JEUA 5HHTA 3QUQA 1LTQA 1FP1D 2ID4A 1K0UA 1M67A 3T5MA 4QGBA 5DBHX 1H1TA 5FOSA 1NW5A 2Q21A 4P4TA 2GSDA 3T1TA 5HY1A 1Y76B 1PNLA 3PXBA 1K6XA 1IHUA 1ZSPA 1XEXA 1VQLV 3ES9A 3ET4A 1DX9A 2IYEA 4CIWA 3P2KA 4AWXA 4JX8A 5BUZA 3W9BA 5LNK6 2E48A 3LG2A 1WXGA 4NR1A 1XDBA 3OLXA 3WAJA 1G1XB 4M0LA 1BHSA 3WGGA 3DJYA 3W9SA 1G98A 1YIDA 2OM2A 1QVZA 3KX2A 5GINE 4L2IA 1Y6ZA 4IGKA 2EFEB 2X6RA 3RVOA 3KR0A 5EC8A 4OKIA 1KO4A 4X6YA 1AK1A 4LZLA 1RPJA 3OBYA 5IK2D 3U4CA 1NJ5A 3WLQA 2Q1WA 4DY4A 4E07A 4B3RO 2W8ZA 4H6WA 3VH2A 3NKFA 3P45A 1BGVA 4ITVA 1H22A 3EDMA 2HVJC 2Q8QA 1EZZA 5EJ7A 2BEWB 3JWEA 1I14A 4UZEA 3GXOA 1J07A 1L5RA 4BP8A 4ZMRA 1WMDA 4MVJA 1Z4OA 3UW1A 3HY3A 2VSQA 4J91A 3KYCA 5JY6A 3ENZA 2OD2A 2PGLA 1GTSA 3KHUA 5TSDA 4LOJA 3K4HA 5F3DA 2B69A 3LIPA 1TTQB 1KKLA 1EUCA 4KI0A 3DZBA 3ILHA 1FSZA 4NV1A 3IAAA 1PJBA 5CFOA 1B0AA 1XNQO 4HFRA 1XU7A 2O3SA 4KXRA 1F4PA 4NU8X 3AL0C 5B1OA 5AM1A 4FU0A 1UBEA 1QC5B 1GU7A 2X2PA 1EFAA 3T54A 1XDUA 4F5WA 5EUCA 4DUPA 3OOWA 1YQDA 2AFIB 2YOGA 3K94A 3H9BA 3WX0A 3CEMA 2H1VA 4JI3B 4OSPA 3I7TA 2H1OA 3GT0A 2G0AA 3V1TC 3PQDA 3P71T 3V8NA 3DEKA 3IB6A 1E3IA 3WGZA 4YHHO 1EK6A 3F5SA 2CD7A 2H7YA 3FMFA 1WU8A 3OF5A 3RUCA 3BXZA 1CR2A 4NTZA 4AC9A 3BE6A 5IAAA 4URHA 1SHLA 3V6LA 5AVZA 2JI7A 2QZZA 4B40A 2OYSA 3K53A 1PNRA 1HMPA 4L4ZA 1VIDA 4LSGA 1KYXA 3RSLA 3ABTA 3BGSA 1R0KA 2PS0A 4D99A 2Q0AA 2PT5A 2J5RA 3V4LA 1VJDA 4IM7A 3MHTA 2HYDA 2IS6A 4MRVA 3OICA 1EM8B 3CPQA 4MKIA 3GD7A 3U26A 4LF8O 4XVRA 5ALNA 3UUGA 5G0SA 2IITA 3HJAA 1NT2B 4D7TA 4Z5XA 5AI6A 4PHHA 4MDYA 5M29A 3GJYA 1GSIA 3O8RA 4IJUA 1JSXA 3T4PA 3NAGA 4KFRA 3W3ZB 3GJTA 3CCQV 4BGUA 3WNCA 3THXA 4N47A 3C48A 3VZBA 4FJ0A 4UVEA 1T4CB 4S1PA 4RY9A 1KH3A 4KO2S 4REMA 3B36A 1RQ2A 3TXQA 3GJ0A 1W7AA 3ELYA 4N0QA 1R8JA 1ONIA 2Q9AA 1J5EO 5ALDA 3KS9A 1I7DA 1VI2A 4E6EA 1H2XA 4MWBA 4OYYA 3KSDO 3L74H 4UUBA 1OCCC 2V5VA 1DJOA 3NWOA 2VJOA 2D0IA 3DUWA 4WY8A 1DI0A 4ESHA 1ETHA 2I4IA 1OW3B 5DECA 4A1OA 4Y6PA 1IXYA 1P2GA 1YJBA 4DJJA 2O3QA 1HUQA 3FSGA 1P45A 2Q2VA 1XPRA 2ZJ4A 1J06A 1JR3D 1JECA 6NULA 1N2CB 4R1QA 3EZGA 3JTMA 1W5TA 1Z17A 5CNMA 3FNRA 1Y66A 1RM3A 1Y5IA 2VHQA 5F2OA 1WLSA 3IMCA 1NUUA 3ZXSA 2VQEB 2OKGA 4E08A 3G2KA 1CC1S 5IWCA 5L53A 4JZKA 3D8TA 1M8KA 4XVHA 4JR2A 4BX8A 4PX9A 3PFGA 1YS9A 4G63A 5EVJA 4QUAA 1EHYA 4R2IA 2WHPB 5FNVB 4OHFA 1KY3A 1NBMG 2V8OA 2QVXX 1QTQA 2CE4A 6ABPA 3LRTA 3EISA 4R8KA 1BD3A 4IV5A 1M0WA 1GJRA 2CH7A 4DV7O 3JQ7A 4IJWA 2BBOA 5KU1A 4EW2A 3MJSA 2D0DA 4BBZA 1T9CA 3EEYA 4UCQA 2QDXA 2HS0A 3LLMA 1E3WA 3CC2F 3STVA 4H16A 1U2DA 3ZEIA 4P32A 3L2OB 1XKQA 2XNSA 2AFVA 2G1PA 3SKVA 2UXXA 3R65A 5DI3B 2W6QA 3FHJA 3OMAB 2ZFUA 1LPNA 3QKSA 2PVCA 2ISSD 2ZIAA 3MMSA 3IO5A 3SZMA 1TYDE 4I8DA 1H85A 1GAJA 2ADPA 1EU1A 1W0KG 2FPPA 3IUPA 4WEQA 2OSBA 2VRZA 3V4PB 1L5OA 2PMEA 1IDN1 2WQ6A 4DWWA 4DSTA 3CYQA 3U62A 3KKKA 4LDZA 4E1VA 5KYTA 2F17A 3F2IA 4I1RA 4O3FA 3LWRC 2OXEA 3FDXA 5JD4A 4L0DA 4OUDA 2R7MA 3EWSA 3LDUA 1J2RA 1ORIA 2CWJA 2UYGA 3FCOA 4R6XA 3EG5A 4PLGA 5CA0B 1RXIA 2C54A 3KJNA 1NXSA 1GQFA 2FP4B 5TMEA 4GR9A 5K3CA 3PWKA 4Y2HA 1DCTA 3FUTA 5FWXA 4FR2A 4P7BA 2CV2A 2ZRGA 2IV7A 1RLJA 2I2DA 4I50B 3DXRB 4LI0A 2I4RA 4RFLA 2PXAA 3D4IA 3DEAA 3U3DA 3DMTA 3P4YA 4X95A 5BN3A 4CFYA 1FQKA 1GGJA 2Y3IA 3NDPA 3C24A 4Q82A 1E3LA 4R51A 1LW7A 1R6XA 4F2DA 1ZCJA 1MBZA 3P9RA 4OBWA 1ZQ9A 4MRRA 1WB4A 3IQIX 1GM8A 3SYNA 3D8SA 1T9GR 3MM4A 4AZWA 3JWJA 2OAQ1 3V1NA 1SCKA 1JG7A 4DLAA 4BT7A 4XR9A 1THZA 3GN2A 4EFMA 1EFHA 4BP9A 1X25A 4DQVA 2AI1A 1XQWA 4FGSA 1NYQA 2HA6A 5KHJA 4MR9B 1ONSA 5KWVA 3IT3A 2JZCA 4XQ0A 4GECA 3SIVA 1KI7A 2A5DA 5EBWC 1B04A 3H6GA 2LE0A 1WXWA 4PRKA 4AB1A 1DNPA 5LXTB 1HQYE 3WBFA 2DERA 3ZV3A 3UQYS 4IIJA 1NULA 2Z8XA 2Z1MA 1ISMA 4N7RA 5LUBA 2GESA 3CHYA 3I9MA 1CBUA 1J5PA 3K03A 1V47A 4ENSA 3I5MA 1MZFA 1U3WA 1X1RA 4CI9A 4ZO4A 1YK0A 4WBNB 3KE8A 3FOAA 1XD2B 3TKYA 1NVVR 2ZE7A 1CDOA 3ZNOA 4KBGA 3MS2A 3AFHA 1E2QA 2FK7A 3V8MA 1XQ8A 2B4KA 3AM1A 2NADA 2FJPA 3DFZA 3HQ4O 2XUPA 5AR1A 2X1MA 3E8HA 2QOEA 4ZALA 4DCTA 1GX1A 3D2LA 3KZMA 1X4TA 3O4VA 2NN4A 1N0VC 3NOXA 2JHPA 5ADVA 1PJ3A 1NUHA 4XQCA 1Z4MA 1H5QA 2WP8J 3K35A 3S1AA 2FXVA 1RYEA 3QWHA 1YNSA 2FYUH 3DLCA 3LX5A 2C4KA 1R0XA 4Y2YA 4EATA 1TM4E 3RODA 2PL5A 2IHKA 3TOZA 3ZZNA 2CMHA 4AROA 2FFAA 5DB4A 2QUBA 1R9NA 2IXGA 4L85A 3AVYA 3MQWA 4XDLA 2I9PA 1EUZA 1XA3A 4OHPA 4XE5A 1MABA 4ONEA 3QX3A 3HRIA 3OCUA 1KY4A 3UV7A 1GKFA 3DW1X 1A8UA 2BH9A 3ZWCA 3E7PA 5L6MB 1WW8A 2BF7A 3MBMA 2WSSG 3G17A 4N8EA 4LEIA 2ETVA 3MRSA 3A2NA 3RSFA 1YOVB 3EQ6A 3ME5A 3NWPA 1N2EA 2HRCA 5HF6A 2UVQA 5HGXA 3IR7A 2V6GA 1SRYA 3B6KA 4D98A 5TMDA 2AGVA 4GNRA 4XUGB 3K9QO 5BR7A 2XPCA 1S1MA 3EOBI 3NGMA 2VDPB 1MB0A 4CM6A 1OWOA 2A7WA 1ST3A 1RRFA 1RYYA 1ENVA 2ZSDA 2AXPA 2AUTA 5JSZA 2C3MA 1YS7A 4DB4A 1P3DA 1TAQA 3GPBA 3D3IA 3MA0A 4N3GA 2D2FA 4R40A 3A32A 4B3JA 4QLBA 2ZATA 2ONZA 4XEUA 2E7ZA 1XZQA 4WL0A 4WXYB 3U7JA 4ZYXA 3KM0A 2B2CA 3SAJA 3T4XA 2EJCA 1N8RW 2O8CA 4YLYA 3WIEA 3CUVA 3NUZA 2C9ZA 1OJLA 3NVMB 3ZHYA 4ZEXA 1JR9A 4IHAA 2YXYA 3VPBA 4R4JA 2WKRA 1P0PA 3VPSA 1PEYA 1NXQA 4JJZA 4RVHA 4RGYA 2OC9A 3PGA1 2IVFA 4FIPC 2YXPX 4WK0B 2BGMA 3ISTA 2V7WA 1VZ2A 4H9GA 2OZEA 4FMCF 3LHIA 3ZWBA 2VH5R 3K5NA 3M1IA 4F7DA 4V1CB 2PA3A 4O29A 5BVGA 1Q86H 2IHVA 3WSVA 5L3FA 2VNJA 1AZWA 1CZLA 5KJEA 4KXFB 2ZE8A 3U7HB 2DQKA 2CL0X 4WY2A 4QQNA 3EPLA 2RK6A 4IYRA 4OKNA 1DKRA 2PN1A 2DYKA 1SXJA 5CFZA 4Q4JB 1SC1A 4QM7A 3OQVA 1TW3A 3HU2A 4WBXC 4CKEA 2A1IA 2VO1A 1JQ0A 5F1PA 1RXSA 5IASA 3KVVA 5HFJA 1OSNA 3ANLA 1NMYA 1TD1A 4BO1A 3GJ8A 3OONA 2X22A 1E9RA 4KPGA 2FA9A 5TQ2B 2R72A 4Q16A 2JEOA 2Y9PB 2GGSA 1J2JA 5JD6A 4BW0B 2H6LA 2XTAA 1U8XX 4MXDA 3DHNA 5HQTA 1TOAA 5I3ZA 2Y69C 1UCFA 1UDXA 1B1CA 2ZSBA 2LFSA 1FC0A 4NRDA 4OAOA 3VZQA 5IVHA 4L9AA 4XIFA 3OWOA 4DBLE 1LY1A 2WYUA 3KQHA 1S1CA 4P3XA 3EW9A 3Q7PA 5K9ZA 3CB4A 1K5QA 1K88A 2UZ3A 5M7EA 5KNCH 3T0FA 1F0NA 3U6KA 1AKMA 1QAHA 3BD8A 1U2GA 2Q3EA 3ZTYA 4LIPD 3BSYA 2O2EA 1DVRA 4X5OA 3CG0A 3QVGB 1YZHA 3VMFB 3CE6A 4RNDB 3LDDA 4D92A 1E7QA 1UJ6A 3WLNA 4BO8A 3M3HA 4V0QA 3RVMA 3D6UA 4JBLA 1LNQA 4J03A 3MAQA 1W6UA 3MWKA 1YFKA 1WS6A 1JHRA 1YDEA 2FEKA 1P1BA 1NW6A 3IOCA 4UVDA 1J0EA 2V7PA 4BUZA 3RYHB 4AIIA 1AXEA 5D2CA 3HDVA 3K6SB 3URMA 1K6JA 3W7AA 4GLXA 4IDAA 4PI2A 2AQHA 2CCJA 3KKMA 1I1QB 5KA5A 4XLTA 3WLAA 1A5BB 4FVMA 1Z4JA 3EEBA 4RV4A 3MCZA 2OHOA 1E1RG 1JDUA 2Y4OA 2I65A 1JP7A 3H17A 1NZFA 4B7UA 2ZK7A 2M32A 3CA8A 1NWHA 3DPIA 2X0LA 5KAIZ 2FSPA 2X8JB 3EVCA 3PXGA 4M3NA 4XPIB 3P2JA 4UM9B 1E5XA 4L57A 1RWXA 2DYSB 4R7TA 3DMDA 4RHFA 3OCZA 3DD1A 3QNMA 4CKBB 2B94A 3K2IA 3ZU5A 1YZYA 3NC0C 4XDJA 2J6BA 1H2MA 4YAWA 4UE6A 3TLJA 3C5EA 3LKVA 4FQ7A 1VBKA 5A6SA 2XNHA 1FYEA 4CUJA 1GD1O 3NHAA 3UGTA 2CWDA 3C7KA 2FSVC 4TXJA 5DNYB 4BO5A 3ZQKA 5T67A 3FYDA 5DDIP 3V2HA 1XGKA 2P30A 4HDSB 2QRVB 1CQXA 2FG6C 3CKKA 4D4GA 1ENYA 1DEKA 1K8AW 5GM1A 3AY6A 3BYZA 3B1ZA 3GEGA 2GAIA 4RCYA 4XPZA 1CP9A 1O8BA 2JNBA 1JIQA 1WB5A 3DE1X 2WUEA 4MVJH 3M82A 1M1YE 2XB8A 1DRKA 1A9ZA 4UOZA 3WL5A 1EMDA 2OLKA 1P9LA 1R10A 4D9EA 3CPJB 3CSXA 3IJRA 3LCJA 4Q6GA 4OPHA 2C2HA 3GZNA 2Y1WA 4G85A 4Q9JA 2PS1A 2XNDA 4MI6A 5JCXA 1FYJA 3R09A 4KFMA 3U61B 1US6A 1VF6A 1Q6UA 2BIFA 3OX3A 1BE1A 4UAGA 3AETB 1ZEMA 3VHQA 3RWOA 3BD6A 1C2YA 3HKCA 1JPVA 2GD0A 2Q50A 3VVBA 4F4JA 2PCJA 3DH0A 2FW0A 2OP0A 3TIVA 5BWNA 3VBCA 3RROA 3PEEA 4D57A 1KBOA 3ITNA 5IDWA 3SX2A 3T5GA 2C2OA 5I4IA 2VDLB 4K03A 2YUTA 4INOA 1FDSA 4ZVQA 3FWHA 2Q49A 4KH0A 5K4AA 5J4VA 1K27A 3G9UA 3ASYA 4MS2A 1CY0A 1H66A 3PUWA 4MTFA 1K66A 3O8NA 4OMUA 4Z0TA 4GZRB 3ILSA 2JHCA 4FFOA 4P9PA 1VRWA 2W6JA 2ZZNA 3ZI0A 3ESJA 1U3PA 3GUVA 2ZYUX 1XZPA 1AK9A 4XBFA 3EVAA 3C8HA 4PSKA 1C1DB 4FR5A 1OGYA 2JK0A 2E1PA 5I9NA 2OB1A 2CMDA 4PAGA 5K05A 2B5VA 4O4JB 4HF7A 5J58A 6ADHA 1AB5A 1XVVA 3MF4A 3CH7A 2XXAB 1YJAA 1OCZC 1GKYA 5GZ6A 4CLEA 3QF7A 4MKFA 1R0WA 4X54A 1C7RA 1CZNA 3NHSA 3OQ1A 2CXUA 4EY7A 2OUIA 4OH7A 2QTPA 3IERA 2QU7A 4LUCA 1PL6A 3KYBA 3BPZA 3LNCA 2VP6A 1FXSA 2XQFA 3OJLA 3M7MX 1KIFA 3HYTA 3LWNA 5B3JC 1RP3B 4RK6A 5HNKA 1JYEA 2VCEA 2VFAA 5T4BA 1YTFB 5GAJA 2HUPA 1WNTA 4LJ5A 1DKNA 4Y2GA 1YSCA 3X1ZA 5C18A 3ONNA 4CKCB 2DKFA 3KEQA 2GBLA 1XQ1A 4DTIA 4LOKA 2ZI6A 1V1RA 5H6QA 2AQKA 3CC8A 2BMVA 1E3DA 4OYLA 1MGOA 1PJTA 1WB8A 3DDWA 3ASOC 2IYQA 1H9BA 3TSZA 5BV1A 1J21A 5JRZA 1PNMA 2K4MA 5LYYA 2R6R1 3SSAA 3LFTA 2DHEA 3JRNA 3TH5A 1H2RS 4R0VA 2ATCA 5BN1A 1QH1B 2QW8A 3NDRA 3DC5A 3HWSA 3JQFC 1A4UA 1CLEA 4RDIA 4MICA 1BXKA 2OZLB 4DLVA 5KX5A 4HYEA 4IINA 3DBHB 3Q1KA 3BMQA 1A0OA 4UVAA 4RELA 4HWPA 2ZJ1A 2QI9F 3LOUA 3O47A 4OQFA 2AKYA 1MX3A 5TLSA 2LBXA 1M8PA 1QHYA 1W96A 2KB1A 4ZU6X 2IXDA 1IV4A 1X8LA 1FS5A 3QI7A 4D9KA 3L07A 5EWMB 5H82A 4DM4A 5I3CA 2GI4A 2QX9A 4PQRA 4RTJA 4BHTA 4DNXA 5CK5A 1DAEA 4E31A 1LA2A 4M0CA 4NTYA 1DAMA 4ZAVA 1EZ1A 4TN1A 2C04A 4IDPA 4EARA 4CF4A 4F2WA 2Z6QA 4ENRA 2GLUA 3PQ2A 3CEJA 4DV0O 5B1AC 2HS3A 3E20B 5BSVA 4X91A 1CJCA 3H1HH 1EBOA 1S3SA 1H8HG 1TTHA 4K0RA 4A5OA 4V0RA 5BNFA 2GEBA 4YCLA 3A9WA 1P4SA 2ZUCA 4X1IA 2D1YA 1DV1A 2CFIA 2FPKA 5C4GB 2C5LA 3GYQA 4IPTA 1QZZA 5DNAA 3LLSA 3ER8A 2XTMA 4CQNA 4KG7A 5AHWA 1Z0AA 1DIBA 4FW8A 4DSAA 3IVCA 2HBYA 5EP2A 3S99A 1ZA2A 3QLUC 2CLLB 4PFJA 3RHSA 3EBLA 3N7UA 2EJVA 2SKCA 3KL4A 4Q9LA 4C0AC 4TZZA 4QQ8A 2GZ3A 3OTOB 1Q1NA 3GD5A 1GMGA 4C0BA 3GRUA 1L4BA 1SD5A 3ZDDA 2BT4A 1JALA 3LSQA 3DOJA 1L6IA 3C4QA 3DCJA 3L7NA 3IRUA 1RKBA 2XZDA 5J5VA 3DV0B 1JN1A 4G8CA 4ALLA 2BEVA 4FYJA 3SDSA 1GYPA 1Z39A 2RI1A 1IC6A 1WZ2A 2F1HA 1S02A 1WZUA 3CZCA 3L8HA 3HJHA 3TD3A 3VKVA 3SC4A 1ZH8A 1OY1A 5HQ3B 1KETA 3LUBA 1JX6A 4V0KA 2XNKA 4LYHA 1EIZA 3RVJA 3GFFA 4EUSA 2XJ4A 2FSGA 4GZMA 2RCYA 3R5JA 2JCXA 2AJDA 1WE2A 3JASB 1D09A 1EYZA 3ACBA 2PZLA 1GA4A 1VMKA 2QQFA 4I8IA 4EO9A 4OHUA 4LQDA 2HHJA 1OA1A 3RIEA 2P2LA 3BEDA 4QUHA 5F5LA 1GSAA 5E9AA 2BONA 2PHNA 4HDCA 2FOIA 1M76A 4IDOA 3R40A 1BVYF 2W6IG 1ZK0A 1A5AB 3Q0TA 1DQRA 3CCEV 3RFCA 1WDTA 3L01A 4AF7A 3EGOA 1E2EA 4X24A 5K8LA 4CT5A 4C7MA 1YRLA 4RTNA 4HJXA 3ZHBA 3T5DA 1EEHA 3C7AA 1O94C 9LDBA 4LFAB 4RTPA 4ZCRA 5CLIA 3OPYB 2WV9A 4ZP1A 4IKOA 4XGRA 1NF2A 2I4NA 1R4NA 4JBXA 4ND6A 3BWMA 1MOPA 1RWMA 4FGJA 5I9SA 1OCRC 2HSZA 4F8JA 2W6NA 3A1DA 1CZOA 1ADJA 2Z1EA 5B57C 4QRIA 1BEEA 1K7FB 2FZVA 4IX1A 3ZKWA 3OZCA 4IMJB 3Q2KA 1IU9A 3REFA 4GC5A 4K1XA 1XZNA 2IDJA 3OZUA 3KNZA 1EK0A 4DIKA 4FWIB 2A5YB 4LF6O 1XQ6A 1Y6QA 4EL0A 4BMXA 3RVSA 4BLSA 2J07A 3EVTA 2D1FA 1Z8HA 2OESA 1OH7A 2UXCB 1KK2A 5JJKA 4LRSB 2HJFC 3MUNA 1U04A 2WY2D 2A9OA 4YT2A 4JN6B 1WA8A 4MCAA 4YYZA 3RC2A 1FTSA 3L9DA 2QW1A 2AQ8A 2VWQA 4O1IA 2FB9A 2IQQA 2VIIA 4MUKA 4WD3A 3WRYC 4XIYA 5HQJA 1SQSA 2P4HX 3CPWF 4D82A 2H2WA 5IEJA 3BK7A 1JSZA 2Q4DA 1CWUA 2GN2A 1C30A 4UHHA 3I52A 3TOVA 5K8CA 2GLXA 4U0KA 1ZD3A 1C41A 1YIAA 1UK8A 4PWTA 4EJSA 4HO1X 1GZSA 3CD6V 4TSFG 1R9JA 3I1YA 1GQOA 4HP8A 4TZ0A 3H4IA 3PJFA 1QM5A 4A7PA 4LZZA 1X3SA 1NKDA 4UATA 3GX1A 1Z2PX 1XQXA 1OASA 1X7YB 2ZR9A 1IOVA 4PFKA 2HL6A 3C74A 2ILTA 3G8DA 3MEQA 4O4LF 1P19A 1JYFA 3FOWA 1N7GA 1Z7BA 5L3DA 1G9TA 4RU1A 3D8RA 1QO0D 1AKVA 4IFEA 4RD0A 2HI0A 4HZGA 5BR1A 2Z04A 4FMPA 1VQOF 4CWAA 2X5KO 3MTBA 1OR8A 2DQ3A 1MPTA 1PFVA 1UFIA 3NKLA 1WXHA 5AI0A 2VDJA 3S8MA 3O4IA 2FUKA 1K9MH 2V7TA 2NU8B 1W3EX 4E11A 3L0IB 4K9NA 4XKJA 1XWWA 5D3ZA 4C1BA 3H19A 4HQOA 2JGJA 4YV2A 2G0NA 1L5SA 1NKSA 3GJ7A 3E18A 3I2HA 3HR8A 3MTAA 3ECCA 4O1MA 5CB8A 5BVHA 3PFFA 1T8TA 3QXCA 3QELA 1M2OA 1RIFA 3OURA 1HYQA 1ZM7A 5FPYA 3HKBB 1TYZA 4JBHA 1TM1E 2F1KA 4QYMA 2NZUG 5DWDA 1N9KA 3IJ4A 2ZSHA 4IF6A 2I6QA 1AP5A 1W0JA 4LJ7A 4HUTA 2ZB8A 3L49A 4Q0MA 5I7SA 2FGYA 1WUHS 1N77A 1GN9A 1UAGA 3QU7A 3VU9A 3DZIA 3EEFA 2K6GA 2PUHA 4EYQA 3RVLA 5TRTA 4HH0A 1G7CA 4AO7A 2PUSA 4DV5O 1JEYA 3NZEA 2Z4RA 3DR5A 2WIKA 4NG4A 2ZBDA 2C1XA 1BQZA 3FVTA 2JLUA 3SXUA 2NMVA 4XSGA 3M8KA 2WD8A 2IJIA 1KO7A 3L4EA 4TKVB 2X6CA 2H2GA 3UF0A 2NTEA 1SC5B 3I2YX 1FRVA 2Z9CA 2FMTA 1Z0DA 5KHAA 1I4OA 2JZOA 1Y9JA 3LBIA 2O3UA 5DNDA 1RI3A 5EIBD 1JXMA 4EQ6B 3CZPA 1GFWA 4FQ5A 5FI5A 1H8EA 1RZRD 4DSZA 1JQ3A 2OO5C 4A8PA 5CYPA 3HVHA 2QT0A 4AI8A 4JAAA 4U7HA 4DILA 3LFHA 5FWYB 4MYUA 5AT1A 4C30A 3DUFA 2D4HA 1UKBA 4MUJA 2BGNA 4YS6A 2G70A 1G21B 3H5RA 3CGGA 4ZMBA 1BKDR 1YO6A 4YXWD 521PA 2HQBA 1RAEA 4AG6A 4PA9A 2A92A 3CPEA 2IT1A 4KR0A 1FDUA 1KZGB 3FFBA 1EVLA 1G66A 1E89A 2PPLA 4ARUA 1JDSA 3N58A 3TIIA 5H59A 2Z2IA 3H4TA 4DCJA 1JUDA 2OV4A 3FKSG 4MVXA 3M3PA 4ZHQA 3R74A 4WKBA 1N34O 2H2HA 4D6XA 3VU8A 1NDUA 4E4YA 5KYYB 4ICIA 5B37A 1LRJA 2XRFA 3SIWA 1AOXA 1R50A 1EGHA 2WA1A 1JLSA 1F4MA 2AC7A 2X8BA 1MZEA 1IUNA 5D01A 4MW9A 2CV1A 4X1KB 2AJTA 1G7TA 4DNOA 1W47A 2VAWA 3NBXX 1YJXA 1SKVA 3QVLA 4DR4O 2PXXA 3UAYA 2IYOA 1UPCA 1ZRSA 2RI6A 5TGDA 3CWBH 3UZUA 2ZJ7A 5CT6A 3AIMA 4Z4QA 3B5JA 3U3ZA 3BDVA 3S5JA 3H2YA 1NV8A 2VZ8A 3AFNA 1VYVA 3QU2A 3I04A 3OU7A 3C39A 4G5FA 4HB0A 4OI2A 1OWMA 5KIAA 2PYLA 5FOQA 2IUEA 4UHDA 3R4CA 2H3OA 4QZVA 3VH3A 3SC3A 2EX4A 3IBFA 5IZCA 3FKQA 1HA3A 1SJ9A 1A5SB 1IEQA 4KSCA 1OPXA 3ABMB 4XCQA 1E0KA 3B9RA 4Q7QA 2ATXA 1IN4A 3RB8A 1VQ7F 2HYIC 3W79A 4DXHA 1PFKA 1GCAA 2OHVA 1L4MA 1CUGA 3EXHB 4MR8A 2OTLV 2UUAO 2WKPA 2M2IA 4P54A 3RABA 5DF1A 1BJRE 2AEMA 1HDIA 4GHWA 1NZJA 1T2EA 1B1AA 1U28C 3L40A 4WESB 2PCLA 3FDIA 1Y80A 4FKBA 3SZ3A 4HADA 3KFVA 4MTCA 3J80M 1NAIA 4YYEA 5JH7F 3UG6A 1UIMA 3VHRA 2FUNB 4NPCA 2VXBA 3TW8B 5DPMA 3F6RA 3VYRB 4HDMA 1HT2E 2CF6A 1NONA 4O2LA 3CRVA 3U17A 1CD5A 1BJTA 3FZYA 3DFKA 3R0PA 3FUXA 5FHRA 3KR2A 4B62A 1O87A 2D4AA 4JJGA 3A4TA 4YUXA 2JHAA 2NLOA 4KI7A 2V54A 2QTSA 1U9JA 3W77A 2O8FB 3D7NA 3MTEA 3O1IC 4LC9A 1QHHA 2BBSA 3COSA 4HBZA 5LMUO 2O3TA 3DNMA 1GA1A 1L3CA 1V41E 3VTAA 3S81A 1WDLA 2YMPA 3K14A 5TB5A 4FYPA 1VDMA 4JJ7A 2IYXA 3CCVF 1HYBA 3RGWS 1FQJA 4QDUA 3A4NA 4YRMA 1NTMH 1U9CA 5LYJF 1N2XA 1XBIA 4UE2A 2ITCC 4AZTA 4EKIA 5BQ5A 2Q9BA 1I4TD 1ULAA 2FW7A 4GXRA 3C41J 3QTCA 1KOFA 2G5PA 4KOEC 3BHMA 5FOVA 1KK0A 3W5JA 2QR2A 3VVMA 4MEAA 1HE8B 4MUFA 5JJCA 2OXFA 3DPSA 1H65A 2IYWA 2GX6A 1KI6B 3W78A 1ROPA 1VSQA 1FX0B 3F73A 2O6HA 4TTIA 1SXJE 3H5AA 5G4LA 2EIJB 2IHTA 2YVKA 1NBHA 3ESAA 3TSOA 4HYTA 3ER9A 1MSWD 3P9IA 5BW8A 4RMHA 1NJ6A 3AK3A 4URXR 3L6OO 4QAQA 4KQHA 4HSGA 4AFNA 1N1DA 4R8SA 2CDRA 3TW6A 4PLVA 1PSDA 1U1DA 1QP8A 2GFIA 3EF0A 3RUEA 1NW4A 1V16A 4E4TA 3TW4A 2HSJA 5ANRB 4OXRA 1KMHA 4BVRA 3PKIA 4UEQA 4BWFB 4LNUA 1MAHA 3G59A 4OF4A 1UDBA 2DFVA 1WTCA 4JODA 4A8JC 4GKKO 4E5KA 3C14C 4CUKA 4RIEA 1U7TA 1NYLA 3PKJA 3GYGA 4ZCLA 5JS8A 4AD8A 3HRHA 2BHTA 3U80A 5JXHA 4JJIA 2VDRB 2EXXA 1BGWA 1PDWA 4L6IA 4PX3A 3L43A 4GKJB 3L05A 4P4LA 1NMEA 1BGXT 3IIMA 4QBKA 2W83A 1C3OA 4M53A 1U31A 4RIGA 5E7IA 4A0GA 5HX7A 4AF8A 2JS5A 3FAVA 2NVWA 1O5TA 3F90A 1ZGCA 4OCZA 5K3FB 1IUPA 4UHJA 4MGHA 3PFHA 2IYUA 2Q0XA 2UYQA 5BQFA 4F6EA 1LS6A 3FHOA 3NNNA 3A3YA 4LDAA 2N3ZA 4BKOA 2WA2A 2P2SA 2JF0A 4BIIA 2B8EA 5HXAA 5CG1A 1QYXA 5HP7A 1TA8A 1GZVA 4LFBB 1CUSA 3CINA 4CDRA 5TY0A 4X65O 5LU8A 4TPKA 2FX5A 3ISJA 4S1TA 3B82A 1CVLA 1DC7A 1O95D 1OI7A 1PRYA 4X8OA 3GJRA 3V8VA 3OD5A 2VTKA 5AKLA 3HO1A 2P35A 1K9SA 4X66O 5ECDA 4MPTA 3WWYA 5EMKA 3MYRA 1X7ZB 3TQFA 1P39A 5DCUA 1PN3A 3NIFB 5JW6A 1Y4UA 4F38A 1X86B 3HYSA 5B7NA 1GNQA 4B71A 2F3PA 3F1KA 2BSQA 2ZW9A 4IZOA 3BG5A 5F52A 4D9NA 1KRHA 3NAMA 4QLAA 3GUHA 1SPXA 2YJ5A 3QENA 2AEEA 2RE8A 4TL7A 4NI5A 3GAAA 2VC2B 4CIBA 1ORHA 1U8CB 3ZX6A 2WU3A 1FU8A 5F4BA 1Y9ZA 3GY0A 3AKYA 3T5PA 2E75B 3ND5A 2KG7A 4I9QA 2PX6A 4L7VA 4R2XA 4ZC1A 2DVMA 4TLMB 2EKLA 3KB8A 3D7KA 3FSRA 4LX8A 3FYUA 4O5AA 3IUJA 5DP1A 5EIXA 1PGOA 4BTEA 1W36D 2D2IA 3WXMB 3VBEA 4XTCS 3OLYA 4NMWA 5T8KA 3V4VB 1LDBA 4ZVMA 4QYTA 5ILOA 1HC7A 4PHFA 5DGTA 4OHOA 1YB5A 1TU0A 3OE1A 5KQPA 1JWBB 4CIXA 4O1HA 4LJRA 3DCNA 1X92A 3NHFA 1ZU4A 3GA0A 2CC2A 2JIZG 3AU9A 2PY6A 4W9NC 4MLZA 3VDRA 5FX2A 5J43A 1D4FA 2JAHA 5K8JB 4AHCA 2CXQA 3P97A 1FRZA 3VC1A 1ZWIC 4D46A 4Q7JB 2GBPA 1IEWA 2DFNA 2VK1A 5JWRA 4JNCA 1JG1A 4EF5A 3UV6A 4P08A 4DCGA 2QEQA 4RSGA 3FMOB 3SQXA 4HBGA 5CIYA 3AEYA 3EWAA 2VTVA 1SCQA 3MPUA 3LKBA 2W0MA 2C1EA 4J41A 3K0EA 2NP7A 3QM1A 4AZ0A 2QVCA 2IYZA 1IOZA 4C2BA 1IY8A 3BFPA 1IXKA 1KPIA 4Q4DA 3LH5A 3WMEA 1SG9A 4EKNB 4MR7A 2BSKA 1PFUA 4PN3A 2XEDA 3I30X 4AK9A 5F12A 5CM2Z 4MUHA 2G0TA 2P3SA 5DGHA 5A1TA 1O97C 3R3YA 3CNOA 2GR9A 3IIJA 3NMUF 5IJZA 2I1WA 5DCYA 4AN4A 4TWRA 3CVJA 4B7CA 2XB4A 4L5AA 4PAQA 1GM7A 2TECE 4TYNA 4UD2A 3SNHA 3HA3A 4NDAA 1VLQA 1ISFA 4Y9RA 3SPCA 4NMHA 5JARA 4ZCMA 1ABBA 5FULA 3VPXA 5AJVB 2HP3A 3V32A 4J11A 4GM1A 1W19A 3C3WA 5DHPA 4H15A 3AYZB 1FDTA 1NFRA 4CCAA 1R6UA 1ML4A 4BV9A 1N5DA 1A8HA 1PDOA 2H00A 5CITA 4BDTA 1WO8A 4FM2A 1P18A 4EMTA 2ZUDA 2J9XB 3N53A 4IDGA 3RV4A 4G28B 1FTQA 5HIMA 2RJ3A 1NZDA 3Q8XB 4YV0A 1SD1A 5FPQA 1X0XA 1G5IA 2Z08A 5D5HA 4D79A 3C15C 3HEBA 3LPNA 4PPGA 1WB9A 1H2KA 3QY0A 4C4AA 4IW3B 3CY6A 1U8AA 4O4IA 2IS4A 2H94A 4EHDA 4FK8A 1AJNA 2ZB4A 4NBLA 3CZAA 3R3SA 4FLFA 2WHXA 4Y6OA 4TTRA 4DEVA 3K0KA 2Q4RA 1LW6E 2NVBA 5K8TA 4U6QA 1E60A 5FPOA 1Z37A 1EP1B 1Q0QA 2RHDA 2OCPA 1NFQA 2VF7A 4WZAA 4Q1AA 2P1DA 1RPAA 3OLCX 1R5OA 1GZ7A 2ZIMA 2LBWA 4UBOA 3GR6A 3TJTA 1CDEA 3IDZA 2F3TA 4FBGA 2ZUBA 4NJEA 1JTEA 1WW2A 1P5FA 4PSUA 1FLVA 1A88A 4JFRA 1UXOA 3ZWDA 1IV1A 2QL7A 5DOZA 3GFVA 4M9QA 5FIUA 2JAXA 3QBJA 2NUTA 4WNAA 3RK1A 1QP7A 1PI3A 3LKDA 1M34A 4G4SO 1HR0B 3OPMA 3FSJX 4LPSA 4P6VF 4GYKA 2WPDG 3PFWO 2NQ8A 3LPLA 5JCZA 4BXOB 1Z9BA 2CL6X 4I08A 3DO6A 2JJ1D 3CV3A 3ZIAA 1ZGGA 4XM0A 3F74A 3GZTB 2FEXA 2F1MA 1T5DX 1G4AE 4H3VA 2VUIB 1WAZA 2C07A 1AUXA 1FKAO 1ID1A 1C4KA 1X14A 3KKEA 4GPZA 1RXWA 1T10A 4H7PA 1OMOA 3MCAA 3CW2A 2AMJA 2PO7A 2VF2A 3FWYA 1QO7A 3I58A 3UVEA 2PZAA 2ZU0C 5BMVF 2HA4A 1WSDA 1RCFA 5J47A 4ML3A 2C5SA 1W8DA 2J4DA 3AK2A 3I32A 3C9SA 2P9ZA 4G0WA 3CCMF 3H1LH 2DLCX 1Z0ZA 3GARA 1VKJA 2YYEA 2GYWA 3SD7A 3NBFA 3DXFA 5JAUA 4X8LA 3F67A 4IR7A 3LT4A 3QW4B 1GEEA 3DOEA 3FNIA 5JWHA 1E3QA 3ZDCA 5KCMA 3RYFA 1SRRA 2D3OW 4UUAA 3IKMB 3PA8A 5ECWA 4D80A 5HWSA 2QTMA 4HYYA 5FL7D 4Q9HA 1HY3A 2H18A 4EHBA 4AS2A 2QA4V 5JNTA 1RRKA 1YASA 5IYZF 3RRFA 3B78A 4G8JA 4X0EA 3SC2B 5J2TB 5ALVA 1ODLA 3V1UA 2CNBA 3AB7A 5F7JA 2CMGA 3R41A 2C5HA 1C1XA 4HS9A 4RHYA 4QIWF 5EBLC 3FFMA 3BCUA 1ZHHA 3TI7A 2NVUA 5FWDA 3CVUA 4O2AA 4XIIA 2QJ1A 3NGXA 3B13B 3IUBA 2ZYRA 5ER6A 1A1VA 2NG1A 5LLSA 1NP3A 4GZLA 3G82C 4PW0A 4EW3A 3NIGB 5JS2A 3IOYA 3CNLA 1BU5A 3IVRA 4QYWA 2XUDA 5FA8A 1A76A 2Z1NA 3V8EA 4GLOA 5D7NA 1GL6A 1IIBA 1SZDA 5J5AA 2WHEA 4JXJA 3SBOA 3IUYA 2ST1A 3ZS9A 4C4YA 3L0DA 3PQ8A 2GLTA 3OZFA 2OK7A 5TQ0B 4CFSA 4ASUD 1ZCZA 4BIZA 1Y5MA 4P83A 1X1QA 3F6CA 1PU2A 4IFIA 4N23A 3HO8A 3KJZA 4MO2A 5ICCA 2FUEA 2D54A 3PQ4A 1DJLA 5DI9A 1X1AA 4OSEA 3X2QC 4DMRA 2QTBA 3PHHA 3JWIA 3QU9A 4QPPA 3DAOA 1U0OC 1ENPA 2VNSA 2IP2A 1VMDA 1IB0A 4LXYA 2ZRFA 5K4HA 1Z29A 2KM1A 2I3DA 4EUHA 3AF2A 1Z6GA 2FSHA 4PLTA 1VPDA 2HSEA 2O0KA 4KO3S 3RTAA 1U3TA 2R7NA 2Q9CA 1SCUB 2CTRA 2KSDA 1ZSVA 1VJGA 5DYTA 1R8QA 2I34A 1G5TA 3COWA 1CQPA 4ON9A 1P5RA 4RZIA 4E5MA 4ENTA 4ESOA 4UNNA 5KOYA 3UPDA 3K70D 1FQOA 2DPHA 3FCAA 2HEPA 3LBYA 1S72F 1BDIA 1E1CB 2WJZB 2VS0A 1XLTC 3VO8A 3I42A 3LUHA 3HC7A 1PVVA 1JIUA 3ZMUA 3ADPA 3U11A 1IFXA 2W22A 2GRJA 5IU6A 2E6KA 4B7XA 2JC3A 4EITA 3QLJA 4K35A 1CIJA 2J9YB 3P9QA 4KQKA 1C9YA 1X59A 3H7IA 4HQNA 3QVWA 1CUDA 3HDYA 3I61A 2MMGA 3IUNA 4YWHA 4TTAA 1SB9A 2ES4A 3IV6A 4NVRA 3CS3A 4P4SA 3G67A 3CF4A 3AHDA 2DWQA 2CUNA 1U2TA 4B09A 3BRQA 1Z0UA 2Z2ZA 2OXCA 3BMCA 1OFVA 3AK1A 3PC3A 1WCIB 1WKVA 4M2LA 3OBIA 1AY0A 4ZCIA 1N9GB 4E5DA 1DCFA 5K01A 1OKKD 4IIDA 3RH0A 3ZR4B 4DXDA 8LDHA 4XARA 4MV8A 1Z2AA 3U1VA 3VISA 3RWBA 2QRJA 4D9HA 4WPGA 5HKBA 1E79A 2HMVA 2BUCA 1KP9A 1UL1X 3VR3A 5DN6A 3VR4D 3PYXA 3MB8A 2CXPA 1S2IA 3FYSA 1EP9A 3PD0A 4R5MA 1Y67A 3QOXA 2JAWA 4J0QA 5F73A</