5EYXA

Monoclinic form of centrolobium tomentosum seed lectin (ctl) complexed with man1-3man-ome.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
DSLSFSFINFDQDERNVIAQGDARISGNNILQLTRTDSDGTPVRSTVGRILYSAQVRLWEKSTNRVANFQSQFSFFLESPLSNPADGIAFFIAPPDTAIPSGSAGGLLGLFSPKTAQNESANQVLAVEFDTFYAQNSNTWDPNYPHIGIDVNSIKSAKTVRWERREGVTLNVLVTYNPSTKTLDVVATYPDGQRYQISVVVDVTTVLPEWVRVGFSAASGEQFQTHNLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Centrolobium tomentosum seed lectin with inflammatory activity.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Centrolobium tomentosum lectin
total genus 60
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5eyxA00
3IMNA 2WSVA 1UZYA 2D6PA 2OW4A 2A6WA 4RA0A 5GZFA 3WDYA 4YFZA 2BQPA 4XIKA 4XHXA 2YMZA 3JUUA 1J1TA 1AXYA 2ZGLA 5T5OA 4YFWA 3IN9A 1SLAA 2D6LX 5DZEA 3M2MA 4Z8BA 3AYDA 1CPMA 3O0VA 3RG0A 1GBGA 2ARBA 2YV8A 2W68A 3RMXA 2GMPA 4PCRA 3VKFC 2CTVA 3N7MA 4BLIA 2EXHA 3O0WA 2I2SA 5T5JA 3WV6A 1LEMA 1D0HA 2TEPA 4Y24A 1CJPA 4LBNA 2CL2A 1Q8VA 4YM0A 1MVQA 3V64A 1KDKA 3AP4A 5F5QA 3T1LA 1LTEA 1W6PB 2DVAA 4BM8A 3O12A 1LODA 5JVVA 1QOOA 2NP0A 1S1AA 3DGTA 3WLUA 3AYAA 1WW5A 1NLSA 1DQ4A 1UZZA 3LSDA 1JXNA 2EF6A 3M1HA 1LJ7A 1G7YA 1V6IA 2WNEA 5IK7A 1DQ5A 2LTNA 4R9AA 2C5DA 2ZMKA 4ATEA 2SBAA 4CRQA 3LCPA 4FOYA 1F31A 1MS4A 2KM2A 5CA6A 4WVVA 5IK8A 1WBLA 1OFSA 4YZ2A 5IK5A 1MVEA 2D44A 3INAA 4CTEA 1A78A 1CR7A 1AXKA 1SLTA 3AZZA 4WVWA 3RSJA 4JRAA 4FPGA 1MS5A 1VALA 1LECA 1LOFC 5CNAA 1V6LA 1KRIA 1WD4A 1RITA 2CWMA 3A0NA 3Q9OA 1LULA 1FNYA 3B01A 2HYKA 3U4XA 1GNHA 2ZGMA 3PVEA 1WCSA 1GANA 4Y1XA 4Y22B 1V6NA 4FPKA 1VAVA 1SFYA 1G9DA 3MW2A 3AXEA 1LHWA 2E7QA 2ZABA 3VKNA 1LU2A 2GNMA 4FP2A 4M3CE 2ARXA 3AP9A 3B00A 5F9TA 4XBLA 3TAYA 1N3PA 1WW7A 2ZGRA 4JCKA 1VAMA 2GMEA 3R4SA 5GZEA 3MEPA 4ATFA 2P3KA 3R4UA 3WDUA 3KM5A 5H9SA 3W58A 2ENRA 4M3CB 3QCWA 1IS6A 1Q8OA 4CZSA 1S0DA 5KXCA 1W6MB 1LGCA 4Q26A 5T54A 1DIWA 1V6OA 1AX0A 4P9WA 5E89A 1S0BA 1ULCA 4TYSA 1QKQA 4AGRA 1WLDA 1R1ZA 3AP5A 4YGEA 1IOAA 1ZA4A 3GALA 5KXDA 1X50A 1W6OA 1SLCA 2P37A 1SBFA 1QU0A 5FREA 4BMBA 3AZYA 4FVVA 3D4KA 4Y20B 2ZBJA 1DHKB 3AP7A 4FPLA 5GLUA 4DRVA 2P3IA 1O4YA 3GNEA 3HR9A 3SNMA 3WG4A 1DYKA 4XBNA 1KQRA 3ZSKA 1HQWA 2EALA 1FV3A 1WW4A 1GV9A 2EXJA 2FMDA 2EXIA 5JDBA 1N1VA 2ZACA 5BYNA 1GKBA 4IQPA 4K20A 1GZCA 1LENA 2OVUA 4YG3A 1WLWA 3V0AA 3POWA 4NOTA 2ZHKA 1URXA 5KXBA 4YW4A 3N35A 1QNYA 3WUDA 3LSEA 5T5LA 3CNAA 4YG6A 1UPSA 3ILFA 2EAKA 4K1ZA 3WCRA 2DUQA 4XXAA 3L2YA 2ZGPA 1V6MA 2DURA 4Y1VA 3N36A 3WDWA 3N7LA 2CY6A 4R9DA 4XIOA 3MW3A 1PZ7A 2ZHMA 3POSA 1GICA 2ZGNA 4P9XA 3IPVA 3V0BA 2R0HA 3WDTA 1YO8A 2CYFA 5EWSA 4DPNA 3V0AB 1ENQA 3OYWA 2D43A 3W59A 3A0KA 3AFKA 3WHTA 1SBDA 2YROA 4Y1UA 1C4RA 1NXD1 3MPPG 3ENRA 4XYXA 5JOXA 2D6MA 1BJQA 1ULEA 1TEIA 2DVFA 3NV4A 4K21A 5FRAA 4DS0A 4YZ4A 4NO4A 3B9CA 2A6YA 1PZ9A 1XQNA 4UW4A 1C1FA 4BMEA 1AXZA 3BODA 4Y20A 2PHXA 4BLJA 1HKDA 1LHOA 1I3HA 1YXWA 4ZKTB 1I1EA 2DVGA 1BYHA 1O4ZA 3ZSLA 1G9CA 1IS4A 1W0OA 1SCRA 4C1WA 3RQ0A 4YZ1A 5GALA 4Y26A 4GA9A 1YIFA 3H0OA 1LEDA 1BKZA 3FLTA 2AYHA 2GN7A 2D3RA 4YW1A 1QNWA 1FX5A 2JDZA 5GLWA 4Q8KA 4XILA 1CPNA 3M3QA 1S0FA 1DBNA 1YRZA 1FATA 3SITA 2WT0A 3V65A 4PBPA 1N1SA 1QOTA 3O0XA 4LBQB 2UWBA 5DUXA 1W6NA 3ZXFA 2Q5TA 1IKPA 3AJZA 1WLCA 3ILNA 2GDFA 2A7AA 1G86A 2D6OX 5EXOA 4XDQA 1N3QA 2ZHNA 2FHRA 4JC1A 1UMZA 1LCLA 5JOZA 2UURA 3AP6A 2A71A 2WT2A 5T50A 1QDCA 1DGLA 2A3WA 2R49A 4XHBA 4AVSA 2WQZC 2JECA 1VLNA 3QLQA 1BZWA 1AZDA 1CN1A 1DQ0A 1W6QB 2UU8A 3I4IA 3POYA 4YW3A 3WCSA 3D6EA 5CB7A 5SV8A 2JE7A 1U0AA 4TZDA 4Q1PA 5KXEA 3OYWB 1DQ6A 1V6KA 3WNXA 3ZPYA 1JBCA 1AVBA 4YM1A 2YZ4A 4U36A 1S0JA 1MS9A 2B7YA 2WKKA 4FP3A 3UK9A 3R05A 5DZGA 3FLRA 2WT1A 2PHTA 2ZGKA 2XB6C 2A6ZA 5H9QA 1IS5A 1RINA 5HCFA 4FQZA 4FPCA 2ERFA 3OBTA 3ZXKA 1F5FA 3T1MA 1UKGA 1HDKA 3BTAA 4XE9A 2VW1A 3ZXLA 1CIWA 1GYKA 1LOGA 2NN8A 5T5PA 3UL2A 3ZXEA 5EYXA 2VY0A 4ISRA 2H0BA 5E8AA 3AJYA 1LU1A 4R9CA 3WG3A 3OY8B 2E7TA 4I30A 5DZFA 2RHPA 2NZ9A 1JYIA 5LK5A 2GALA 1D2SA 2CWSA 1APNA 1LHUA 3ATGA 4Q27A 2V73A 2R0FA 2AR6A 1EPWA 3RS6A 2GMMA 2DWRA 4ZXKA 3M3EA 5H9RA 3SISA 1HLCA 2W08A 2A3XA 1KDMA 4LBQA 4AVTA 1W6OB 1JUIA 4XJ8A 3VKLA 2D3PA 2E51A 2ZGSA 2P3JA 2R1DA 4ITCA 2DU0A 4OZXA 4XOGA 4MYEA 4YM2A 5L73A 4AGGA 3O5SA 5GLVA 4YG0A 3ILRA 5IK4A 1SLBA 2ZGUA 1LOEA 2ZHLA 4GXLA 3WG2A 1JW6A 1Q8SA 2D6KA 1FYUA 1A3KA 1RIRA 2VW0A 5T55A 5CAZA 4LBMA 4H55A 1YYNA 1MS0A 3I8TA 1ENRA 3APBA 4UW3A 2WSUA 1FNZA 2D3SA 2NMNA 4XMIA 1LGBA 2C9AA 2DYCA 3B69A 5CBLA 3WG1A 1V6JA 1H9PA 4WZFA 5GLZA 1S0EA 3ZVXA 1CESA 1PZ8A 4XTMA 2JE9A 3WVJA 5JMCA 1HQLA 4PF5A 2AH2A 4Y22A 4LBOA 2ZGOA 1UL9A 3WOGA 1IS3A 2A5ZA 3HMYA 2OUJA 2EIGA 1SACA 3OJBA 2DUPA 2LALA 5AVAA 4C1XA 2ZAAA 1JN2P 3VKMA 1AJKA 3IPVB 4W65A 1N3OA 4XJ9A 4AWDA 5GZCA 3V0BB 4FOWA 2DU1A 4WV8A 2UWAA 1V00A 1KJLA 3WHUA 1N47A 4YGBA 2VU9A 4AYUA 3HN1A 2UWCA 4DRRA 1H9WA 1AF9A 4FPYA 4GALA 4XJUA 2AREA 3FUOA 4M00A 3SLIA 1VIWB 1Q8QA 4FOQA 5DUVA 1GNZA 3MW4A 4Q2FA 3N3HA 5HCAA 1BQPA 2D6NA 2GN3A 3PVNA 4DFSA 2E6VA 3ZXJA 2DTWA 4YM3A 2PHWA 2VH9A 1GSLA 2EXKA 4YW2A 4PBOA 1AJOA 2VUAA 1JOJA 1SCSA 1YI7A 3ZSMA 3OGGA 4Q1RA 3NWKA 3NV3A 1DZQA 1Y7BA 2V5YA 3ASIA 4YW5A 1ONAA 2ZMLA 4FPJA 3AZWA 1Z78A 2A3YA 2P34A 1GZWB 3VUOA 4U2AA 1DLLA 3A4UA 5GLTA 1SLIA 4ASMB 4L8QA 4LBJA 4PQ9A 4XJZA 1C1LA 1SBEA 1WUVA 5JOWA 4LBLA 1ZM1A 5T52A 1JHNA 4XBQA 1DFQA 2AENA 4YZ5A 3TB0A 4HANA 2VXRA 4LBKA 2ZGQA 3OPZA 4LBQD 2G4IA 2DUOA 2GNDA 2Z42A 4UW6A 5IT6A 1KJRA 1W6MA 2GNTA 2NM1A 3UJOA 4D69A 2WLQA 4XXPA 4BOWA 2P2KA 1H30A 3FFZA 4XJAA 1KITA 1N1TA 4UW5A 4M3CA 2AUYA 1S0GA 4YZ3A 1AX1A 1MS3A 4KBBA 1QF3A 5JOYA 2JKBA 1WD3A 3N7KA 1LOFA 4FQ4A 1FAYA 1B09A 2GNBA 2A6XA 3DUIA 4M3CF 2PHUA 4YLZA 2ZMNA 1QOSA 3WDXA 3ZYPA 2ZA9A 4FPHA 3PJQA 2D7FA 1SLLA 2NMOA 3FUQA 1ULGA 1MR5A 3USUA 4P14A 3WZ1A 5DG1A 1FV2A 1G9BA 3AX4A 3B3QE 1LOAA 2DVBA 3D5OA 4AGVA 4BQ1A 2ES3A 1CQ9A 1LOCA 3IM0A 4XZPA 2PELA 1JYCA 2XG3A 5E88A 3PMEA 1LESA 3SH4A 2YY1A 2PHRA 2PHFA 1IKQA 1ULDA 3FLPA 2VW2A 1GZWA 1G9FA 2A75A 2JD4A 3KQRA 1OKQA 4AVVA 3PVOA 5DXDA 3AZVA 3RRDA 2ZZJA 5EYYA 4GKXA 4K1YA 2A70A 3NV2A 3M3CA 1N1YA 5JLVA 2DVDA 4R9BA 2R16A 3OY8A 4GWMA 3VV1A 3T2TA 3NV1A 4FPFA 4DQAA 1G9AA 4Q8LA 1G8WA 1MZ6A 3M3OA 2ZKNA 5H9PA 3VKOA 3ZYRA 4GKYA 2NYYA 2W39A 4BPZA 1MACA 4Y1ZA 1F9KA 4M01A 1LHVA 1UAIA 1MZ5A 4XMAA 1W6PA 1LHNA 3IKWA 5DG2A 3WDVA 4YGCA 2A6VA 1WBFA 4F83A 1MS1A 1AX2A 3SH3A 4GWNA 1BXHA 1CONA 1A8DA 1LOBA 5GM0A 3WUCA 1UN1A 5IUQA 3ZSJA 1DQ1A 1Z0HA 1WW6A 2JJ6A 1ENSA 2CNAA 2R1BA 1Q56A 2W52A 2DTYA 2ZGTA 3FBYA 3AK0A 3N7JA 4FPOB 1MS8A 1DQ2A 5HCBA 4ISQA 4RL7A 3JU9A 1W6QA 2OUHA 2DV9A 4HL0A 2E53A 2YXSA 3OBRA 3RMYA 5GZGA 3C2UA 1OQ1A 1S0CA 4XJWA 1GZ9A 1QMJA 3AZXA 4P9YA 5DUUA 3SH5A 3USUB 3AXDA 1DYPA 1UX6A 1C57A 5GZDA 5GJ6A 4FPEA 1GLHA 3AYCA 1LGNA 3AYEA 5DUWA 1CVNA 3BIWE 4SLIA 1W6NB 4YGDA 3BOPA 2SLIA 2WJSA 4Y1YA 1QGLA 4XTPA 1W0PA 4FOVA 1QDOA 1ULFA 3UJQA 1S0IA 1Q8PA 2AGSA
chains in the Genus database with same CATH superfamily
3VBUC 4DOUA 2WSVA 3J7LA 2DFCA 2OW4A 4RA0A 3VBSC 4NN0A 3IMMA 4QXHA 1L7RA 5FK7A 1J1TA 2CAVA 2OKXA 3ABZA 1H8VA 4IGQA 2HH9A 3IN9A 3OBZA 3BKZA 1SG3A 3O14A 1CPMA 3MLKA 5I0SA 2ARBA 1W9SA 4L97A 2AZ5A 2YV8A 2JDYA 2GMPA 3SEEA 2CTVA 3N7MA 4KWJA 2WA4A 3WV6A 3ZR6A 4BCUA 4IDZA 5HXVA 1R091 3VN4A 4DZGA 4R4ZA 4LBNA 4PLNA 2EA7A 3V64A 5FAXA 3OD0A 2JE8A 4XF9A 3T1LA 3ZFGC 1C8NA 1AYN1 2VZTA 5JVVA 1QOOA 2VECA 1FPN3 3WF4A 4HT1T 1QJFA 3SCFA 2YU1A 4MGQA 2PAEA 1UZZA 3LSDA 4UF0A 2YPDA 1O8SA 2OQ7A 1POQA 2X53S 3OPTA 5A70A 1D4M3 3SKJE 3KT1A 1UYYA 1V6IA 1DQ5A 2LTNA 2QKDA 2C5DA 1E57A 2X5IC 2ZMKA 3E97A 4LKDA 3RYPA 1JYTA 4AOCA 1F31A 4AHWA 2W1WA 4BXFA 5IK8A 4KU7A 4QB6A 4YZ2A 4OFGA 3CF6E 1CR7A 4XFCA 3UKNA 5ANNA 3DCQA 3JD71 3C8XA 3SC7X 4JRAA 4KNCA 2FQPA 1MS5A 4KGQA 4OULA 4CEYA 1YI9A 4MGSA 1KRIA 5FZIA 2CWMA 1QJX3 2CGNA 2MNGA 3MFCA 1WCSA 1GANA 2FDIA 2CV6A 2DDUA 2FCUA 2OQ6A 4FPKA 5FJHA 4ZS2A 3KHCA 1LHWA 5J7MA 1ND3B 3B00A 4XBLA 3ZLIA 2WS92 1WW7A 4COYA 4LO4B 5C3SA 2GMEA 3MV11 3RPQA 5GZEA 4LITA 1J3RA 2JKXA 5FZ7A 3UV9A 3W5NA 5LBCA 2HWB3 2ENRA 4M3CB 3TBDA 4LNVA 1QJY2 1PGL2 1Q8OA 4BK5A 2GC0A 1RUH3 3Q8CA 4JGZB 5CG8A 4CZSA 4JVAA 4QX5A 5FBZA 2GH2A 1OOPB 4EQVA 1TME3 4LHLA 4Q26A 5IATA 1JU3A 2X8KA 5K8SA 5E89A 1ULCA 3ACIA 1EAH1 2IXJA 3K46A 4TYSA 1H6YA 2VZ1A 2WQ8A 2ZEXA 3AP5A 3GALA 3RYKA 4CDXB 4BA6A 1H4HA 4FBFA 2CDOA 3CJXA 1QU0A 3PUQA 4BMBA 1MQTB 5FZBA 3ZYGA 1WKYA 4FVVA 3KGZA 4Y20B 2ZBJA 3Q8EA 1DHKB 4FPLA 3VHNA 3TEWA 3SNMA 3WG4A 4Z2AA 3PU8A 4BQ5A 3ZDVA 4XBNA 2RMU2 5A3UA 5L7OC 3LFMA 5FPLA 5FZCA 1ND2C 1X9TA 1ZREA 1GV9A 3J7MA 1WLTA 1O91A 1GKBA 1XPWA 2WR9A 4PQQA 1AYN3 2JICA 2LS6A 1GP5A 4OHYA 1WLWA 3V0AA 2GZWA 4YYOA 2UY9A 4MADA 4FAGA 4EN8B 3AMPA 3N9PA 2KR2A 5KXBA 3AFGA 3N35A 3BUCA 1QNYA 2V4VA 3CNAA 4BB3A 1UPSA 5CU1A 1F4AA 2XWBB 5KHGA 1R083 1XNTA 4QQOA 3POIA 1AL23 2DURA 3PJYA 3B94A 1RUJ3 4KGGA 1J58A 3POSA 3KF5A 1PO23 1VBA2 2ZGNA 3IPVA 1RVF2 3WDTA 4B7KA 4DPNA 2CYFA 4GIQA 3BU0A 1ENQA 2BEOA 4AL9A 3AFKA 1SBDA 4MUVA 2YROA 4IV1A 4OUSA 1DCSA 3I2FA 3DPRC 4INDA 3V56A 4QWNA 1C4RA 1S55A 5FZ4A 3ENRA 3TWIA 3T2OA 1QIQA 2VMEA 1BJQA 5JOXA 2QFEA 4K21A 5L36A 4NO4A 3B9CA 1PZ9A 3KHBA 3WT3A 4FTSA 1W8NA 1YQ5A 2PHXA 2V72A 3VHRA 4EV0A 1I3HA 4ZKTB 1BYHA 3WY6A 5FZFA 3U0ZA 1YFXA 1W0OA 3SCGA 1LKNA 1ASJ3 2OA2A 5EFUA 3O1VA 1LEDA 1BKZA 3FLTA 4YW1A 5I8SA 2Y64A 2B42B 1TNFA 4GJYA 1FX5A 2JDZA 3IIAA 3LEGA 4Q8KA 4IXLA 2WN3A 4AEJA 1H8TB 3C3VA 1FATA 1JI6A 5DABA 1H8TC 3V65A 1HX6A 4A7ZA 1J1LA 1N1SA 1QOTA 1RMU1 2IXLA 2QZ3A 2R061 2JXAA 3O0XA 5FZ0A 2UWBA 4A44A 4ZU5A 1IKPA 1UWWA 3HT2A 4UFMA 4AAPA 3AJZA 3ILNA 1NG0A 3H1MA 2JG8B 4CYDA 4MHUA 1KS5A 2YBSA 3AMMA 1N3QA 4XDQA 1VMFA 5F2WA 5AFBA 3E6CC 4Q0PA 1UMZA 2GC2A 1UOGA 1VBC2 4AHYA 2C1FA 4AQSA 3POYA 1OXCA 3VDDA 4GJZA 4NWWA 1OA2A 1U0AA 1W3VA 1TG7A 4MV2A 2D93A 3ZPYA 3WNXA 2RR11 4YM1A 2FMYA 3PTRB 4QAWA 2B7YA 1MS9A 3GGLA 4FP3A 5KC6A 1OH4A 4MSVA 1OQDA 4WM8B 5DZGA 5LBBA 2WT1A 2IFRA 2ZGKA 4JQTA 5D8AC 1LR5A 4URAA 4XAAA 2JENA 5EQUA 2WNUB 1AR93 2DCTA 5HCFA 4FPCA 3OD4A 5FZ3A 3WQ7A 3OBTA 1DGWA 3ZXKA 4JQRA 3ES1A 1HDKA 2VW1A 3ZXLA 3NL1A 5A3LA 3QH6A 1UZWA 3P6BA 4H14A 3UL2A 1V9U3 3W5MA 2Q8DA 4B3NA 4ISRA 4PT6A 4XW3A 1VPHA 3AJYA 2BGPA 1O59A 5BNQA 5A32A 3WP4A 3WNKA 2RHPA 4QX0A 2E31A 4CDQB 2J1UA 1APNA 2ARCA 1I5ZA 1RVF1 1CZVA 4Q27A 4IEVA 2V73A 1W04A 5EIYB 1ODNA 1RUG1 1EPWA 3RS6A 2DWRA 4IEUA 4OHZA 3T0BA 3TN91 2F17A 4ZS3A 1ZRIA 3MUY1 4ASLA 4QQHA 4OMDA 2FDJA 3UKVA 3DXUA 2UYAA 1RXFA 3IWZA 1TZOA 1VBE3 4XJ8A 3DYPA 3VKLA 4BZ4A 2D3PA 2VVFA 1H8TA 3H3UA 3IDBB 3MBWA 4LO7A 2WFF3 4DO0A 3ZFEA 4AI2A 4LE4A 2P3JA 5D1IA 5FO8B 1HRI2 1OH3A 3NNMA 1UY4A 2XBO3 4XACA 3U11A 3WW1A 2HBUA 1AYM2 3POGA 1VBD2 3ILRA 1SLBA 2ZHLA 4JV4A 1U5ZA 4YG0A 1Q8SA 2Y6GA 2WWSA 4KG0A 1NQDA 3D82A 1A3KA 5T55A 4LBMA 1FT9A 1ST8A 1EV12 1MS0A 3ACLA 2C26A 4HVRA 3APBA 4I3GA 4CDWB 1FNZA 2D3SA 3RZMA 2W87A 2VZUA 3WG1A 5GLZA 1H9PA 1QJEA 2WFF2 3NNJA 4UFKA 3ZVXA 2FBEA 4GD4A 1ZRCA 1RUOA 2JB8A 4QQPA 4AW7A 2B5HA 4XQWA 2Y8KA 4PF5A 4XUPA 2AH2A 4JGYC 4Y22A 3WVJA 4LBOA 4QT6A 1JZ5A 4IV1B 3KMHA 5EPAA 3PMSA 5FPBA 4S2GA 4AI0A 1ZBA3 1SACA 1UY2A 2EIGA 5AVAA 5FZ8A 5IAVA 4Y4YA 3VKMA 3IAPA 3IPVB 4QPGA 1N3OA 3ZR5A 1OA4A 2DU1A 1V00A 4LHSA 5A7SA 2RS53 4IEPA 3ACFA 5DN2A 4BQWA 4HPKB 3D0JA 4PI2A 3HN1A 2UWCA 5EJZB 3SLIA 2YFZA 2AREA 3FUOA 2J1RA 4HBNA 4KBZA 1K5JA 3DF0A 3J26N 2Q8CA 3N3HA 3PTYA 3PUHA 4IEWA 5IYYA 2P3YA 1OC1A 1NY71 2QQNA 2D5HA 2QZ2A 1GSLA 2VH9A 4CUBA 4RR3A 4P08A 3VBFB 1H6XA 4L0PA 1SCSA 4I01A 1RUI1 2VNRA 3ZSMA 1C28A 3VD3A 1Y7BA 4UFHA 5AC91 2V5YA 3N9MA 2TNFA 4FPJA 1U12A 3AZWA 2P34A 3EJKA 3ON7A 1Y43B 3ZPOA 1RUE3 4XJZA 1BBT1 2RJLA 4LBLA 1ZM1A 4CCOA 2WAAA 1EPZA 2AENA 3TB0A 3OPZA 2C4XA 2G4IA 1Z7S2 4ASKA 2RMU1 4IV3B 2ET7A 1O6UA 1NYWA 4XXPA 3JBG3 1ULOA 2P2KA 3FFZA 3P3NA 2Q8OA 5FCCA 3RJ2X 3CJIC 2D98A 4QM8A 3OBAA 1DP0A 2AUYA 4XZUG 5C3QA 2R30A 1AX1A 3ZYJB 1AYM1 5JOYA 2JKBA 3Q8AA 1LOFA 1H2KA 4WM7B 1B09A 4MGYE 3JB4C 2VE1A 2XH6A 3MIEA 3CJIA 2ZMNA 2QQVA 3WDXA 1COV1 4W6WA 1UKRA 5L9VA 2NMOA 3FUQA 4IEYA 3USUA 4P14A 3WZ1A 4NHLA 1G9BA 4O7XA 2ARAA 5FXVA 2VOVA 2ES3A 1CQ9A 1LOCA 2PELA 1UYXA 2JDNA 2XG3A 2QJVA 3UJOA 1LESA 3VZNA 2YY1A 3M7AA 4Q4W2 3ZYIB 2PHRA 3EO6A 4FT8A 4S2HA 1IKQA 4K8RB 2K0GA 3I3BA 3WW4A 4BQ3A 1OFNA 1JHJA 5FJKA 2A75A 4AVVA 3PVOA 4CCEA 3AZVA 1WMDA 2ZZJA 1ND2B 2XLAA 4GKXA 3ZN6B 1QJY1 2A70A 3N9OA 3M3CA 2DFBA 1X33A 2UY8A 4NIHA 3OY8A 4GWMA 2IFWA 5CFDB 1NLQA 2ZX2A 1G9AA 3CO2A 4FPFA 1HRV3 5H9PA 1G8WA 3M3OA 2ZKNA 3VB9A 4RYDA 5I8TA 1CZSA 3I2JA 4UF0B 5IVVA 2W39A 3MGUA 4BPZA 2BERA 1JODA 1Z7S3 1NA1A 1RVF3 1UAIA 1MZ5A 1SPPA 1W6PA 4AAXA 4EN0A 4YSFA 5CISA 1W8UA 4FCAA 4YGCA 3ZMNA 4F83A 1MS1A 1X8MA 3BTZA 5A33A 2ATFA 1BXHA 3BCWA 2PLV2 5FYIA 5GM0A 4AEMA 3C7HA 2QQWA 3UGHA 5FYBA 1GFF2 4E9KA 1DQ1A 1Z0HA 3OG2A 4LO6B 3RDIA 2P5BA 1K3IA 2DTYA 4AFCA 5IVBA 2P6CA 3T30A 4JRLA 4AG4A 3FBYA 3OPWA 1AYN2 4FPOB 3J9SA 2VPVA 1WGPA 4BJ0A 1DQ2A 2XQXA 5HCBA 4RL7A 4CXYA 2VMGA 4BHPA 5GZGA 4EJRA 3CLPA 1U5IA 1XNAA 1JU4A 4XPVA 3W21A 3WF2A 1C57A 5BPXA 1HXS1 3OB8A 4PHZA 4XF0A 5SV5A 5I93A 5J3UA 4HONA 2NPIA 4LHNA 3CQOA 1Y3TA 2VZOA 3BIWE 1W6NB 5FZ9A 5L9RA 3BOPA 1YQ6A 2W95A 5FZDA 4NRPA 3RWNA 5A1LA 3MF6A 2WJSA 5BNOA 3E6BA 3VBSA 2BVBA 4Y1YA 3ELNA 1VRBA 2QTWB 4OUMA 2CGOA 4IE4A 1QDOA 1DU3D 1ULFA 3PIJA 5FYCA 3BTXA 1CZTA 5FMCA 1JZ4A 1RL3A 5GZFA 2O8QA 1EP0A 4UWDA 4XF4A 3GZTB 4Q4X1 2YMZA 4MLOA 1MPXA 4LLFA 4ZZ8A 3NJVA 3OGJA 4L11A 4C0BA 4O61A 1YHFA 4Y33A 4YFWA 3VZOA 2VUJA 1W99A 3GCWA 3KT4A 2RS52 5DZEA 3HVDA 2E63A 4Z8BA 1UD1A 1J84A 3O0VA 3WW2A 3TOJA 1GBGA 3OCPA 5C8CA 2VNOA 2XVKA 3RMXA 1A34A 4N53A 3VBHA 5K4LA 4B1LA 4A7YA 3JCIA 4BLIA 2EXHA 3O0WA 3SCHA 4QX8A 4OQ8A 2B46X 5CEHA 2MEV3 5C4WA 3AP4A 5F5QA 4BM8A 2DVAA 1W6PB 2BVVA 4MHRA 1U5YA 2WZEA 1LODA 3O12A 1HRI3 1S1AA 3QD6A 2G9GA 3HBZA 5LWBA 3ZFFB 1WW5A 2YG0A 2XDVA 1LJ7A 3AMQA 5LATA 2MEV2 1G7YA 2WNEA 1VBE2 1X9PA 4YRDA 5C5TA 5IK7A 4ATEA 4KMQA 4PLMA 4FOYA 4Q4Y1 3LE0A 4WM8A 1UIKA 4HVOA 4QU1A 4N90A 3LA2A 5JCTA 3ZN6A 5KR7A 1C8M3 4QM9A 5IK5A 1D4M2 2V4AA 1K5MB 3FMGA 4CTEA 1ZRDA 3GZUC 3P3PA 2P1BA 3RSJA 3AMHA 4FPGA 1VALA 1V6LA 2VOWA 1PHMA 4D6QA 3A0NA 1MZFA 5CG9A 4RHV2 1LULA 1FNYA 3B01A 2HYKA 3PVEA 4AE2A 4IE6A 1VP6A 4UAPA 4I2OA 1SFYA 1SFPA 1YIPA 4OI2A 4YVSB 3VKNA 2QDNA 2ZABA 3I3QA 5FZOA 2GAUA 4TN7A 2GNMA 4FP2A 3AP9A 5FMBA 3FX3A 5HXMA 2Y60A 1N3PA 4JGYA 5BNOC 1VAMA 3CJIB 3T0AA 1W28A 4QU2A 4WM7A 1YEWA 5APAA 3MZHA 2E32A 3VL9A 2WWUA 3KM5A 3MHZA 4NR1A 5FZEA 1KS4A 1GOHA 5I0TA 4MXWB 3ZIXA 5DPNA 4A41A 2BGCA 2WAOA 1AR82 5JPMB 3ACHA 5J98B 3I2OA 2XGXA 4CDXC 4COVA 1TE1B 4IV3A 1PX4A 1V6OA 4J25A 1AX0A 2ZCWA 1RJ7A 1SMVA 4V2WA 1D4M1 3MO4A 1CAUA 3N9NA 3RZGA 5F5AA 2ZEZA 2OYZA 3POEA 5KXDA 1X50A 1W6OA 1W8WA 3G7DA 1IPJA 1VBC3 1KXGA 5F39A 5FREA 4DXSA 1VRH3 1CD3G 3AZYA 2XJRA 1VMHA 4I0WB 4S2FA 4XFBA 4IGPA 2RS32 2YPJA 4XAEA 1UMHA 3KVAA 3AP7A 2G19A 2DCYA 3GDBA 5C71A 3HR9A 4N9IA 3GXUA 4YVWB 1IGOA 2AEZA 3HAGA 2PLV3 4OLLA 4WZCA 1WCUA 4YW7A 2YBPA 5EP9A 1ALYA 1PO13 1N1VA 4E2QA 4RR3B 2YDEA 5BYNA 4DUXA 3UYJA 4GULA 3EB7A 3LWCA 4PJYA 5ACA2 2BU9A 2BZDA 4FFIA 4NOTA 3N4MA 5FY0A 4D7TA 2IXCA 3PURA 1URXA 4HSLA 2YBKA 2VQAA 3LSEA 2O8OA 5LY2A 5JIAA 3RNSA 3ILFA 3SMHA 1IQDC 1PM4A 1OQEA 3I2GA 3ZO0B 2ZGPA 4CP0A 1V6MA 1DLCA 4I09A 1VBE1 3WEZA 5JZGA 4MGIE 1HN0A 1FMD2 3A22A 2XLFA 4DEQA 1PZ7A 4LA3A 2ZEWA 2J22A 4F7ZA 3OEAA 2ET1A 1UU5A 1XU1A 3OYWA 3W59A 1GP4A 5C3OA 4QHOA 2PQQA 2XKPA 3WHTA 2GH8A 2Y34A 3M70A 3CZJA 2B9UA 3K3OA 3FHAA 2ADDA 5FY1A 1ULEA 3U37A 3NV4A 4CA9A 4DS0A 2XMLA 2Y6HA 2BWAA 2E7AA 3EBRA 4R52A 4XURA 3RVHA 4UW4A 4LIVA 3HNMA 4OHXA 1AXZA 3BODA 4Y20A 4CUCA 1IG3A 4EZ4A 1HKDA 1J3QA 1MQTA 2ORZA 3HJRA 4XDOA 2VJXA 3PUAA 5JWPA 4DEVA 3KCXA 1R082 1E5RA 1ZZ9A 1KGYA 4IV3C 3HN3A 2B39A 1D0GA 4GA9A 1MQTC 1YIFA 1RUH1 4CU6A 5FOBB 2AYHA 3RWKX 2RDNA 1QNWA 3PVBB 2RE9A 1TME1 3S5AA 2AACA 1CPNA 5J36A 4JGZA 3I2KA 1DBNA 1UYPA 1XNCA 3T0DA 3HQRA 1X8EA 3ROUA 4LKFA 4MGZE 5FUNA 1SHWB 3WG3A 3ZXFA 4CEWA 1AL22 2ZX4A 3JXSA 1NA1C 2DBNA 2HJIA 5B4NA 1G86A 2GC3A 5LA9A 3TNPB 4A6OA 3E5QA 1NKGA 5JOZA 3D8CA 2CHHA 4J1XA 3U14A 4FTBA 5T50A 2VMIA 2WT2A 5FZOB 1M4WA 3AMNA 4CDQA 1DGLA 2PLV1 4LHKA 4YVSA 4AVAA 5DAWA 1QQP1 4HK9A 5D21A 3VZKA 3VZLA 1BZWA 1AZDA 1CN1A 1W6QB 2UU8A 3DN7A 3I3DA 4NPRA 1PO11 4YW3A 1HB2A 3FL7A 3WCSA 1GUIA 4XF3A 2MPFA 4QB2A 2IWGB 2ZJCA 1NCQB 5FY7A 1S2KA 5D8AB 1J59A 4CU9A 1K5MA 5JZGC 2VXJA 1RUH2 1S0JA 1TMF2 5LZ6A 5FUPA 4HVQA 5FFOC 3ZFFC 2PHTA 3I59B 1HV1A 4HZFA 5BY5A 5H9QA 1RINA 4YPJA 3J8F2 4FQZA 4AEDC 3ZFFA 4L2NA 3BTAA 2X09A 5HCHA 1CIWA 1LOGA 5A7OA 2E33A 2BFUL 2VAUA 1SFNA 4NAOA 5EYXA 4PIZA 1AR62 2VY0A 2H0BA 1W8HA 2FZ2A 2ORXA 4P00B 4NPLA 1OUXA 1EYBA 2IC1A 1EUUA 3MUZ1 5DZFA 5LK5A 1CGPA 4Z82A 2GALA 1D2SA 1S4CA 2K46A 5CADA 1COV2 2R0FA 2VZQA 4YVWA 1QXPA 2W0XA 3H8UA 5FZMA 2CAUA 3J7HA 3GHNA 3VBRA 2K2SA 3SISA 4DIQA 1HLCA 2XJPA 3KSCA 2A3XA 5K9YA 2QBXA 4AXOA 3WQ1A 2OXBA 3ORJA 4YVWC 3FE5A 2WABA 1W6OB 4FSJA 3GCXA 5ABJC 5FY4A 2E51A 2XJQA 2ZS6B 3ZMOA 4H7MA 4Q0QA 3G6JB 3M3IA 2G9FA 4S2DA 2DCJA 1OD5A 4ORFA 1EUTA 5C4WC 3O1OA 4BIFA 4AGGA 4WVMA 4LOSA 1O8PA 2PHLA 2ZGUA 4RFT0 2IVJA 3WG2A 2IVIB 2BV4A 1JW6A 5IVYA 4QQ2A 4E4DX 5FO9B 3IIIA 2XONA 2ZZQA 4RSUA 1Y9MA 3GJBA 4UI9L 4NHXA 4XFIA 2ILMA 1YYNA 3T09A 3I8TA 5FXXA 3JZVA 3VDCA 1AR73 2ZEYA 4XMIA 4JGYB 1LGBA 2DYCA 5J48A 2WZR3 4Z92B 2HBTA 4IETA 1O5LA 2WUHA 4K9SA 4LUMA 4QDRA 4WZFA 5F32A 4JKKA 3DL3A 1PZ8A 4XTMA 4XUOA 3WNPA 1XJAA 4QKNA 1HQNA 2ZGOA 4QDQA 4NMIA 3WOGA 2O0OA 4A2UA 3HMYA 4B4RA 1JS9A 4HK8A 4C1XA 1OPOA 2LALA 2DCZA 4A3ZA 1JTZX 4GMP3 1RUG3 3WF1A 3HOBA 3VBOB 3NNGA 4JTOA 4UYBA 1HW5A 4XJ9A 4XUQA 5GZCA 5IAXA 3C7GA 5FWJA 2UWAA 1PGL1 4AEDA 4QPWA 1K12A 4Q4W1 3A21A 4E8DA 4DRRA 3MICA 1H9WA 4XJUA 4UFLA 3ZXAC 4FOQA 1Q8QA 4FXKB 3ZN5A 1AR63 4BYYA 4DB5A 1DG6A 5F5CA 3OSDA 2D6NA 3PVNA 2W1UA 4DY5A 2DTWA 4PIYA 2AEYA 1HXS3 1IHMA 2HYXA 4YM3A 4YW2A 2KA3A 2WNVB 4OI1A 1RUD2 3GBFA 1I9RA 1YI7A 5E6HA 2BNOA 4XQ4A 4PIXA 5FZHA 2WO3A 4JHZA 5LBEA 3TEYA 2I74A 3NV3A 2A73B 3PHMA 1REFA 3ZKUA 5CIRA 1FOD2 3DXTA 4AEDB 4AVBA 3KT7A 3GZAA 3JD72 3U78A 4D3WA 2ZMLA 5EHDA 2EIBA 1Z78A 2A3YA 3H7JA 5C8CB 3GYDA 4QGLA 4U2AA 2BUKA 3RJRA 4ASMB 1SBEA 1WUVA 4AF9A 1DFQA 1VBB2 4CDUA 4COWA 3I7DA 4HANA 1Y9GA 2ZGQA 4HKOA 4YZ5A 2G1MA 2MHFA 4LUKA 2DUOA 2Z42A 3KS7A 4UW6A 5IT6A 3NVCA 3O1RA 5JPNB 4H7LA 1JH5A 5IJRA 2ZPXA 1OOPA 1STMA 3NRUA 2QQUA 4M4RA 4NAMA 4BQ2A 2XBO1 2AC1A 5BV6A 2JD9A 3MYXA 1PX3A 1KITA 1AL0G 2H0VA 4M3CA 4CSWA 1S0GA 4QPIB 1MS3A 1QF3A 3SXWA 2WDBA 1YJKA 2GNBA 4P02B 3DUIA 2VTXJ 4M3CF 3VHPA 4YLZA 4EWAA 1QOSA 4HFSA 3PJQA 1PK6A 4UT5A 3VGIA 1B35B 1FV2A 1PNFA 2PN5A 2BFUS 2VQ0A 3B3QE 4AGVA 2YFUA 1UOBA 3IM0A 4XZPA 2C0ZA 3L2HA 2BOJA 1R092 1CAWA 2B9VA 2HWE3 2K9ZA 3F95A 2WLPA 4QPGC 4A4AA 4P5HA 2IZWA 3I3MA 1NQJA 3TN92 3VHOA 1C8M1 1ZBE1 1BCXA 4CEYB 3FLPA 2VW2A 4EYUA 2ZX0A 2X5IB 4G3YC 4A45A 4FI9A 4CCNA 1PIV3 3ZKYA 1RUJ2 2VCCA 4K1YA 3RZZA 1XXNA 4A6SA 1BK1A 1UYZA 2XQRA 3NV2A 1HIXA 2JIGA 1RHI2 1K45A 1ZZ7A 3U4SA 2DVDA 4B1MA 2B8MA 1V70A 3WR0A 2CGPA 4OQ9A 5A1FA 2DBIA 3OUHA 5HPOA 4F8AA 1ASJ1 3OF1A 3ZYRA 3BVCA 4LEJA 2JDUA 1H2MA 1MACA 5BUVA 2WN2A 3PIGA 3WDVA 2ID4A 2LROA 2A6VA 1WBFA 3LZZA 1AX2A 2WBKA 5FLIA 3AVRA 5FYHA 3K4AA 3WW3A 1BBT2 2Y0IA 5CFCC 1GQHA 1XBFA 2CSGA 2GC1A 2ZXQA 4FFHA 4CUGA 4D0QA 5A6QA 1ND2A 5F3CA 1W8FA 2JJ6A 2RVAA 1ENSA 4AVCA 3SHRA 2CNAA 4C0HA 2WNVC 3L9JT 2ZGTA 2QQOA 4LK7A 3NNFA 3VDBA 1UOJA 3AK0A 1MS8A 4CDWC 4Q4V1 1B35C 4RFRB 5J1XA 5C70A 4ZHNA 1RUD3 1OOPC 2PFWA 3LGRA 1AR71 2DV9A 5EJ3A 3LEMA 4CCDA 5JI7A 1OQ1A 1GZ9A 1MEC3 1XB9A 3AZXA 3B7MA 5DAPA 3R6SA 3U10A 4CDWA 1B35A 5DUUA 4QX7A 1CX4A 3USUB 4JTNA 4LO8A 4QKBA 5K0UA 4BU2A 5GZDA 5DDJ2 1W8TA 1QJY3 2PAKA 2VZ3A 4Q4X3 3AYCA 5FOJB 3AYEA 3LB9A 4SLIA 2WL1A 2EVXA 2HWF3 1K5MC 1DZRA 2SLIA 4B7EA 4B4QA 5CFCB 4DINB 1W0PA 1R1A1 1RUG2 2JWPA 1HXS2 4FOVA 2EIDA 2VUDA 4GALA 3VZMA 4LTAA 3BU7A 4XDPA 1Y9QA 4HN1A 2WYFA 4PDWC 4YFZA 2I07B 3EMRA 5DAVA 1CJDA 4XHXA 3NMBA 3JUUA 3TEZA 5JSRA 2VG9A 4L92A 3KV4A 4PLOA 1AXYA 3PUIA 3HQUA 4HN0A 4QMAA 5FKCA 4PDWA 1SLAA 2PMWB 2D6LX 3M2MA 1WMFA 3CIHA 2D40A 4BQ4A 4OVEA 2W68A 5F6LB 5A7NA 1U5XA 2R072 5A80A 5T5JA 1D0HA 1W8OA 2L9LA 2TEPA 1W9WA 1T6BX 2CL2A 1Q8VA 2Y33A 3BPSA 1MVQA 3WSOA 1KDKA 2WNOA 3VBRC 4TLFA 1LTEA 1NCRB 4IUGA 3ZXDA 4FO9A 4LLOA 4HKWA 5FTTC 5A1AA 3T08A 1CWPA 5DQ0A 3AYAA 2VQUA 4WM8C 2BPA2 1NLSA 3M1HA 1JXNA 2EF6A 5GKAC 4BH9A 2XXZA 4NIGA 4R9AA 3U75A 1IQAA 1H1MA 1XNBA 2SBAA 4IGOA 3LD8A 2YGLA 3ZM8A 3MFAA 1MS4A 2KM2A 5D2AA 1RGSA 1W3XA 1MVEA 2D44A 2OZJA 4QDSA 5IVJA 3INAA 3MIDA 4LT5A 1AXKA 3VBOA 1LOFC 1AUYA 4EN7B 5FPAA 4EWEA 4NVPA 3Q9OA 1OT5A 4COUA 5IVCA 2JG9B 5I0RA 3VBUB 2QQJA 3C7EA 3POJA 5FPZA 5JAXA 3H42B 2ZGMA 4M4PA 3U4XA 3B93A 3LF7A 2W3JA 4Y1XA 4Y22B 1V6NA 4W4ZA 1VAVA 4LULA 2VCAA 5FK8A 2VZRA 2E7QA 1LU2A 2ARXA 2LW8A 5JUVA 4Q0VA 3KLSA 4P9JA 3TAYA 1HJGA 5C9AB 1NZCA 2BDRA 4NJ4A 5FY5A 3VBFC 5A3TA 1ZBA1 5C33A 3J8F3 1COV3 3KCYA 2VCBA 3AKSA 1RYYA 3QACA 3LDRA 3ES4A 1QQP3 4BQYA 4TTGA 3H3ZA 3MV01 3R4UA 3WDUA 5H9SA 3W58A 4Q4X2 2BRTA 3QCWA 1IS6A 5DDJ3 1ULPA 4COZA 2B45X 2YYOA 2JG8C 2JB4A 2RG4A 1S0DA 3C7OA 4QQLA 1YUDA 1MEC2 1R1A2 3CDZB 5T54A 3USSA 5CZKA 4LE3A 3AVSA 4L99A 3ZFEB 4AGRA 3WP6A 4IERA 5FKBA 1PIV1 2ZX1A 4YGEA 1ZA4A 2OIIA 3S7IA 1BK0A 2J1AA 2PHDA 4Y5Z0 4PF1A 2P37A 5AVPA 4N53C 3UGFA 1XSRA 2QQKA 1DYOA 2HWD2 4JDOA 2WS91 1UO9A 3KGLA 5DAQA 5AC93 1HRV1 3S57A 2RM23 4JX0A 3IAQA 1BBT3 3ZSKA 5JSOA 1HQWA 4GWIA 4C8DA 1FOD1 1Z7S1 2RS13 2EALA 1FV3A 1W2OA 1WW4A 4LKSA 2QCSB 5LASA 4EE2A 5KHHA 4URTA 2ZACA 5JDBA 4IQPA 4IESA 3KCCA 3M4FA 5CKMA 1LENA 1RUF3 5IW0A 3I3EA 1ZX5A 2XR4A 3POWA 4ZY9A 5J09A 2RV9A 1UXZA 4YW4A 4BDVB 4P9LA 1YCIA 3WUDA 1H1AA 5T5LA 4UXAA 2QVSB 1L7LA 5C5UA 4K1ZA 3WCRA 1OBNA 2DUQA 1GWKA 2WNUA 4XXAA 5I0DA 5KHIA 1F5JA 4KWLA 1OI6A 1F2NA 4MGTA 1PGSA 1REDA 4Y1VA 4MG2A 2FZ1A 3N36A 4META 5FPVA 4RGAA 4XFHA 1RUC3 3S5QA 3IDAA 1OUSA 3GHMA 4UFIA 1J3PA 1PIV2 4O9GA 3HWJA 1I5PA 2XL9A 1GICA 4NPMA 4KWKA 4P9XA 3V0BA 2BJSA 2R0HA 2YHJA 1JYVA 5FZKA 5EWSA 3V0AB 2E9QA 1MEC1 2RJ2A 3J4UH 5G05L 4XCBA 1SDWA 1JZ3A 4ZONA 4IE0A 3AKRA 1H2NA 1GR3A 3MPPG 2C24A 1VJ2A 4XYXA 1UQXA 5FPXA 2DVFA 4A3XA 5ABJB 1QJU2 4YZ4A 5B2GB 2VZPA 2A6YA 4OI4A 3S7EA 2YC0A 1C1FA 3VBHB 4BMEA 4DY3A 2Y26A 1EY2A 3LFIA 4RS5B 1REEA 5JR7B 4BLJA 1IZ3A 4NRQA 1LHOA 4Q0SA 4AVSA 1NZIA 1UXXX 2VNGA 3ZSLA 2JG8A 5FP8A 5C8WA 1CIYA 2Y0OA 5ANQA 1SCRA 4CDXA 5JXJA 2VGDA 1PGW2 2XUMA 1OHFA 2W5FA 3WNLA 3PLQA 1GOFA 3FZ3A 3RQ0A 4C1WA 5IVFA 3K4DA 4Y26A 3JQXA 1I6XA 3H0OA 2GN7A 3WD5A 2D3RA 3HIFA 1PMJX 5BNNB 1YQ8A 1FXZA 4XILA 1S0FA 4QPYA 4AI8A 1YRZA 1W06A 1BEV2 2BP6A 3EXUA 2XHKA 4UOJA 1QJZA 3LPFA 3SITA 4KQ7A 4PBPA 3O7OA 3KD4A 4YARA 1FMD3 4AEKA 2ADEA 4LBQB 5BNNC 5FZGA 4NIAA 5FMOS 4EN9B 3SQOA 3TEXA 3OUIA 1WLCA 1ZVFA 2GDFA 2A7AA 4XC9A 2WRAA 1PVC3 3OEBA 2YB7A 3H7YA 4N43C 3JBG2 3WNMA 5FV3A 3AP6A 2XWJB 5ACA1 1FOD3 1VRH2 5FXWA 2VQTA 2R49A 2TUNA 3BGAA 2WQZC 2JECA 1UZVA 4K40A 4GB32 5FO7B 2WZR1 2FDGA 1XU2A 1DQ0A 3I4IA 2R062 4N43A 3FC0A 5EZWA 5A3OA 3O1UA 3D6EA 2JE7A 2VVDA 1ND3C 3OOXA 4TZDA 1W2AX 4Q1PA 2XOMA 5KXEA 3OYWB 1DQ6A 3E6DA 1OF4A 3DV8A 4QPIC 3O1PA 2YZ4A 1AR83 4K3UA 4LK6A 1RXGA 2VZVA 2WKKA 4OMCA 3UK9A 2GP5A 2RS33 1EAH3 2W46A 2Y6LA 2BWCA 3NAPA 5IFPA 1UCXA 3FLRA 2XB6C 3ZXGA 5JZGB 4J6GA 3FFQA 2A6ZA 1IS5A 1QXJA 2ERFA 2JDAA 1SPPB 1QEXA 4WM7C 3NAPC 4AI3A 5LEKA 1F5FA 2EAAA 3ZYFA 3T1MA 1UKGA 4XE9A 4OCTA 3H9AA 2RR12 2XHNA 3PU3A 3MDPA 2VTXA 2WWJA 3I2HA 4Q29A 4WVZA 3GZEA 5E8AA 3J8F1 1LU1A 2FCTA 2PTMA 2D5FA 4R9CA 4TXWA 2W94A 3OY8B 2E7TA 2G9ZA 4RHV3 5FYMA 4E4HA 4I30A 2NZ9A 2ZAHA 1BLZA 1JYIA 1HB1A 2WZR2 2FCVA 1LHUA 4TWTA 1IPKA 1O4TA 3I97A 1WCKA 1XYPA 4UFJA 1OF3A 4ZXKA 1C8M2 3B5LB 1C5HA 5FY9A 5H9RA 4LMFA 3IDCB 1PMHX 1X82A 1IPSA 4QXCA 5BNPA 4LBQA 1CAWB 4RHV1 3CHXA 3LIGA 4AVTA 4JGZC 4QX1A 3VBHC 3X29B 2Q8EA 1QH6A 1JMUB 1UY1A 2MEV1 3AM2A 1UU4A 3DKQA 2ZGSA 5LEJA 2WZ8A 3KB5A 3SEPA 2DU0A 1OA3A 1PK6B 4B29A 1TVGA 4OZXA 4XOGA 2RS11 4MYEA 5L73A 1FMD1 3O5SA 5GLVA 1ZNPA 2C9KA 1EV13 3P1IA 1ZZ8A 2Y6FA 4GXLA 4BISA 4E2SA 5LW9A 5F3GA 1YFYA 1RUI3 1FYUA 2VW0A 1PVC1 1RIRA 2C6SA 4H55A 1W2NA 1VBD3 5FXZA 2BYVE 1G6NA 4DUVA 5FP4A 1ENRA 3ITQA 2WSUA 2VOTA 3LEIA 5JIUA 3RZKA 3RI8A 1ND3A 1V6JA 3J7NA 3ST7A 1S0EA 3VDAA 4CDUB 3ALQA 1XYOA 1ZRRA 5A3MA 3VBOC 3LDKA 1W9TA 1UL9A 2GSYA 2VMHA 5FP3A 2X05A 4CP9A 1IS3A 2A5ZA 4HSJA 4IV1C 2Y38A 4MXVA 3OJBA 2DUPA 4OZOA 2ZAAA 2Q30A 4XFGA 3W20A 5C3PA 3V0BB 4W65A 2JG9C 3GM8A 1JZ7A 1SZBA 3NSTA 4WV8A 1KJLA 1VBA1 2O1QA 3CEWA 5FBJA 3WHUA 4X8NA 1W39A 3DEMA 4YGBA 4NROA 1XE0A 3M8LA 4CXXA 2VU9A 3LDBA 1CX1A 4AYUA 4K6BA 3VBFA 1AF9A 1W90A 2XKOA 4M00A 1VIWB 2HWB1 5DUVA 3ZN4A 1GNZA 1V9U2 3NQHA 3MW4A 5JXHA 5LY1A 1BQPA 3ZXJA 3BB6A 4NRMA 3UKTA 2YUEA 4AQ6A 1VB4A 4GH4B 2WZPP 3LQCA 2EXKA 1GWMA 3K3NA 4RS5C 1AJOA 1DGRN 4QXKA 2VUAA 5HI0A 1J83A 5C4WB 4HPKA 3OGGA 4BK4A 5I0UA 2BW8A 1NE4A 5JXIA 1XRUA 5LA2A 3NJYA 5L7OA 1ONAA 1E5HA 5BNPC 2DF7A 4QPGB 4KG8A 1WWYA 4RGKA 5EJ1B 1DLLA 1PM7A 2XVLA 4HKLA 5FIXA 3RI9A 4PQ9A 3WF3A 4Z2WA 1C1LA 5JOWA 5T52A 5A7WA 3QOPA 4IEXA 5FUIA 5L19A 2Z79A 1OMIA 2GNDA 1YFWA 2LM3A 1KJRA 2O14A 4I0BA 3MI8A 4RN5A 1W6MA 2R6QA 4D69A 1GMMA 3PUSA 4HMZA 4NIDA 1H30A 4JHTA 1HRV2 3NW4A 2XJVA 1V9U1 4LQRA 4ET7A 2VUCA 4RQPA 2JIJA 3VBSB 4LA2A 1RMU2 2RDSA 1T2XA 2WA3A 3N7KA 1R081 1RC6A 1FAYA 5FYUA 2A6XA 5FZ6A 4WVMB 1UW8A 2VCMA 1AR61 3ZYPA 2ZA9A 1BVVA 1SLLA 5FYZA 5C9AA 5JSPA 4OUEA 5FZ1A 3I49A 3D5OA 2VBBA 3MLLA 5A7WB 2Z2SB 3HBKA 3WP5A 5E88A 1JYCA 4GQ7A 3PMEA 5C9AC 3AL5A 3VBUA 1UNBA 3T3YA 4AFMA 3KV6A 1ULDA 4OHVA 4ES8A 1GZWA 2F4LA 2IUWA 4LIUA 4XUTA 3VBRB 1UX7A 2QE3A 1OKQA 1QHDA 2I45A 1H4GA 2WC2A 1YWKA 5DXDA 4LORA 3RRDA 5L7OB 4GAZA 1KFXL 1QJU3 3VD4A 2QQIA 1D4VB 1N1YA 4L9BA 5JLVA 4BE3A 4SBVA 4Q4W3 2VVEA 4R9BA 5FQ0A 3VV1A 5A33B 5A32B 3NV1A 2JDPA 4GH4A 2HWC2 2JX9A 5FYYA 3A7QA 4H2AA 2RDQA 1KFUL 4GKYA 3MLJA 2NYYA 2BNMA 1NA1B 4OHWA 3FBMA 4YNIA 5CFDC 1YJLA 3HT1A 4K8FA 4Y1ZA 4M01A 4Q5OA 1LHVA 4ZZ5A 5AFEA 3IKWA 2FDHA 1XSQA 4NE9A 4R8HA 1PO12 4A42A 5C7GA 3ZFEC 4DXTA 3HEIA 5CFDA 5F3EA 3I59A 4CCJA 1RMU3 1RUE2 1NUKA 2J42A 2PQSA 2R042 3ETPA 3F2ZA 1UN1A 1LB2A 1NCRC 1BMV2 4E4ZA 4P9IA 4QHZA 2YU2A 1P8JA 3VDDC 3H8XA 1WW6A 1Q56A 2VMDA 1NCQA 2VR4A 2GP3A 4CP2A 4N7IA 4CVUA 4CP9B 5C3RA 5K7PA 2HEWF 2RS51 4MVTA 4XF1A 2HWC1 3D0SA 1GQPA 4KL1A 4C91A 1QH7A 3PL0A 1JOPA 4IEOA 1W6QA 2OUHA 3AKPA 4XABA 1VRH1 2E53A 1VB2A 2YXSA 3OGRA 1KEXA 2V5DA 1QMJA 4UBHA 2RM22 2R7EB 3CMGA 2WQ4A 3NNLA 4K7JA 1UX6A 2BOIA 2WINB 3FN9A 2BNNA 4NUBA 5AC92 1ZBE2 3RZLA 2IXIA 3D3AA 1CVNA 5LA1A 3WX5A 4CEWB 2W9XA 3BTYA 4BQXA 1UF2C 4IE7A 4XTPA 1SDDB 5M0TA 5DDJ1 3H50A 3KV9A 4MH0E 1ZBA2 1S0IA 1Q8PA 2AGSA 3IMNA 5A3NA 3OTFA 1UZYA 5F3IA 2D6PA 3T2PA 2A6WA 3WDYA 3JQWA 2QQPA 2BQPA 3TYJA 4XIKA 3URFA 4X6RB 4QD2A 1OLRA 1RHI1 2Y6JA 1LAJA 2ZGLA 5T5OA 5LA0A 3AYDA 4XETA 3RG0A 1C3HA 1W0NA 2WS93 3ME2A 4CE8A 1QJU1 1ODMA 4PCRA 3VKFC 3BN6A 1HJFA 3ZIWA 4ZPIA 1A6CA 2I2SA 2JDMA 1LEMA 1OVPA 1NXMA 4JKLA 4Y24A 1CJPA 4W6XA 1OURA 1X36A 4YM0A 1AYM3 4PI0A 3RYRA 1RB8G 4RD7A 1JUHA 4CCMA 4ES9A 2XBO2 1Q43A 1QWRA 1QJX2 3O1TA 3ZYHA 2NP0A 2Z4FA 3DGTA 1WCQA 3DYOA 3AL6A 3WLUA 1GOGA 3RGBA 4AHZA 2IXKA 1DQ4A 2VL4A 4CDUC 4FFFA 5CKQA 3ZFGA 3RZHA 2VMCA 3K4ZA 4CUAA 2HWD1 3GBGA 1OVSA 3KZ4C 4CRQA 2HWF1 1NLRA 2W91A 3LCPA 3NAPB 1RUI2 1NCQC 5CA6A 1O3SA 4WVVA 1NT0A 1WBLA 4LO5B 1OFSA 3VD7A 2BGOA 1XE8A 1A78A 4BIOA 1SLTA 2X5IA 3AZZA 4WVWA 2N7GA 3POFA 1LECA 4QGNA 5CNAA 4X8PA 1WD4A 1RITA 3KV5A 1W05A 1RUD1 1GNHA 3N9QA 4Y4RA 5ERLA 5A3WA 5I8YA 1G9DA 4CEYC 2EICA 3MW2A 1JZ6A 3AXEA 2DCKA 3LAGA 4CPBD 4M3CE 2BBVA 3DPRA 3MF9A 4KU8A 5F9TA 4KH9A 2R073 2P6HA 2JDKA 2BBAA 2VC9A 1ZZCA 4LKEA 2ZGRA 4NWVA 4JCKA 4ONUA 3VLBB 2FDFA 4M0NA 3AKQA 5FMDA 3TNQA 3R4SA 2HWE1 3MEPA 4ATFA 4CPBA 1GZTA 2P3KA 1CAXB 1S2EA 2QDRA 3K77A 4W6YA 3VL8A 5FYSA 3T2QA 1ZBE3 4DXZA 3Q8FA 1EAH2 1WMXA 5F8PA 1CAUB 1F15A 4W8JA 3TRSB 5KXCA 4I0AA 1D7PM 1VAKA 4AI1A 4AR2A 4D94A 1W6MB 1LGCA 2KXLA 2R32A 3DYMA 3KVBA 1DIWA 4TSVA 4P9WA 3WF0A 5HV0A 1DGWX 1S0BA 2BTVC 1ZZ6A 1QKQA 2WO1A 3AB0A 3O1MA 3QBQA 1WLDA 4D6RA 1R1ZA 4MXWA 1AR92 1IOAA 2R063 3E1F1 3N9LA 1SLCA 2Y6KA 1E5SA 2HWF2 1SBFA 1H2LA 3B02A 3I2DA 5LRRA 5IFTA 4RS5A 3D4KA 2EIEA 5GLUA 4DRVA 4E8CA 3IB3A 1GQGA 2P3IA 1O4YA 2WIIB 3GNEA 2HKXA 4R4XA 5KHJA 1DYKA 5ABJA 1KQRA 2R043 1YQCA 5JR2A 3A23A 2FMDA 1POV0 2EXJA 4QX3A 4EWDA 2EXIA 4C90A 1IG0A 2P17A 3K51A 2WNVA 4K20A 4D6SA 1GZCA 2W2IA 3MPBA 1W2UA 2OVUA 4YG3A 4GB33 4AI9A 2XL7A 1YQ2A 3IZOA 2ZHKA 2WNUC 1YNAA 3JBG1 3LOIA 1OSGA 3E5UA 2E26A 4IE5A 2HWC3 2X29A 4YG6A 4OI0A 1PVC2 5J96B 1AR81 2EAKA 2ZOEB 3H3LA 1O7FA 3WINE 1W8ZA 3LIHA 3L2YA 5KWRA 4D7SA 4JKMA 1OD3A 4ZU4A 5FZLA 4XVHA 5EV7A 3WDWA 2XLGA 3N7LA 2CY6A 2W47A 3T4VA 4CCKA 4R9DA 4D8MA 1YC61 5K0UC 1WMEA 4XIOA 3MW3A 2ZHMA 4OYUA 4Z07A 3WQBA 4AFAA 4AZZA 1YO8A 5LRSA 1VE0A 2D43A 3A0KA 1RUNA 4HOOA 3CU7A 3Q8BA 1QY4A 4IW3A 4HXCA 1H1IA 3LPGA 4XUNA 4Y1UA 2WO7A 4FAHA 1NXD1 5KHKA 2D6MA 3MIFA 5FRAA 1TEIA 1RUJ1 2R071 3I2IA 4IEZA 1YFUA 1L3JA 4O65A 1XQNA 5FZAA 2FD8A 1HV0A 4E27A 2RM21 1RTVA 5A6ZA 1YXWA 2J1TA 5FDBA 1I1EA 2DVGA 3NKTA 1O4ZA 3UETA 5CVRA 4P9GA 1G9CA 1IS4A 1NX9A 3WNOA 2HWE2 2KD7A 3CKHA 4YZ1A 2B4KA 2WO2A 4ZU7A 5GALA 3FWEA 5FP9A 4O9EA 1RUF1 1M06G 5A6YA 1WCDJ 4QX2A 1ZRFA 2GU9A 1Q5OA 4NHMA 5IWFA 4N9HA 2CU5A 2VTFA 4G4FA 2HEVF 1RJ8A 5GLWA 3DECA 3H8OA 3M3QA 3S30A 2CDPA 1D2QA 4XQDA 3O1SA 1Y4WA 1PO22 1VBA3 1LRHA 2WT0A 3NKGA 4AFDA 4DNYA 1GWLA 4CXWA 1RUC2 5CKNA 4KI5M 5FLJA 3CBNA 4CCLA 5DUXA 1W6NA 5BNOB 1UY0A 2Q5TA 2Z69A 2RMU3 3AKTA 5LBFA 5BNPB 5LK7B 2J1EA 3FHQA 2D6OX 5EXOA 1O3RA 1BEV1 1CAVB 2FHRA 2ZHNA 4HETA 4JC1A 4XEZA 1LCLA 2VOKA 4P5YA 2UURA 2A71A 2HWD3 1L7QA 1QDCA 3EQEA 2R041 2A3WA 3NJXA 4XHBA 3P5BA 4Y3OA 1VLNA 2WFPA 3QLQA 1RUF2 1UPIA 3RFRA 5JI9A 1HB4A 3W9AA 3FHIB 1JZ2A 2OX0A 1GP6A 5CB7A 5SV8A 4DMIA 2H6BA 2RS12 4QGMA 4MGKE 4FTEA 1UIJA 4BWOA 3WQ0A 1V6KA 3OGSA 4RGGA 2XPJA 1JBCA 4JDMA 1AVBA 1E5IA 3DKWA 4U36A 5FYTA 1XYNA 3U07A 4H3WA 3UGGA 5A3PA 4D7YA 3R05A 2PA7A 2JEMA 1AL21 1BHGA 2W1QA 3HQXA 4JDNA 4AQTA 2X10A 3MIGA 2W1SA 3ETQA 1PK6C 3BYWA 4G9SB 5E1RA 2XJTA 1PO21 4Z1VA 3QH7A 5IHRA 3SKVA 4E4SA 2QNKA 3LEKA 1DZTA 2H6CA 5D8AA 3H8RA 4AHXA 1R1A3 3I54A 2NN8A 1GYKA 5T5PA 4FFGA 3GF6A 3ZXEA 1GNYA 3B9IA 3R0RA 4LXLA 3C7FA 4Q0UA 1ZYBA 4N43B 5FLHA 2QUOA 4NHYA 5FY8A 5F5IA 3ZX7A 3CL1A 1UMIA 3BOWA 3MIBA 2CWSA 2XJUA 1QQP2 4V1PA 1OLQA 1JYNA 1JYWA 3ATGA 1TMF1 2AR6A 2IXHA 5F37A 2GMMA 4W50A 1VR3A 3EYPA 5LB6A 3IT8A 3M3EA 2YGMA 3IDEA 3MIHA 3ZSEA 1K42A 2W08A 1KDMA 1F35A 4MZUA 3BPZA 2LRPA 1UZ0A 3BIEA 1JUIA 5JMOA 4HG6B 3K75B 1W2TA 3GJAA 1PMIA 1WZXA 1OKOA 4QKDA 4EZHA 1S2BA 1PNGA 2R1DA 4ITCA 5BNNA 1HRI1 2PXJA 4YM2A 5IVEA 1AR72 1ENXA 2RS31 3NJZA 4GWJA 4DUWA 1MZEA 1LNSA 5CFCA 5IK4A 1FI2A 1LOEA 4CU8A 2D6KA 4XCAA 4GB31 5HV4A 2HLEA 3H1WA 5CAZA 1CAXA 2J7MA 2PYTA 4XFFA 1SQ4A 2TBVA 2ZX3A 4I02A 4UW3A 3KWVA 2NMNA 1US2A 2JDHA 4MOAA 2C9AA 3B69A 5TSWA 5CBLA 1BMV1 3ZDSA 3DPRB 1FPN2 2VZSA 4WBBA 2ZTNA 5HBAA 1CESA 5B4XA 2OS2A 2Q1ZB 3K48A 3PNAA 4N8MA 3ZYBA 4EROA 2JE9A 5JMCA 1HQLA 3KF3A 2VM9A 4IEQA 2RJKA 2VOXA 2RR13 3NO8A 2OUJA 4ARYA 3S0MA 2A1XA 3HNYM 3VZJA 1JN2P 1V0AA 1AJKA 4AWDA 4CU7A 1AHSA 2D97A 4FOWA 2J1SA 3RZJA 1JYXA 2V09A 4MX3A 4YW6A 4AQ2A 3LKJA 1N47A 2Z5WA 1O3TA 4BXSV 1KD7A 4FPYA 5F6KA 2XVGA 2YC2A 5G04L 4DXRA 1SEFA 3IBMA 4TLGA 4NIIA 3ZFGB 4B4PA 4Q2FA 1Q3EA 2VD7A 5HCAA 1H0BA 4NHKA 1DF0A 2GN3A 4DFSA 1QXRA 2E6VA 1ACCA 3UT0A 3K2OA 3POBA 2PHWA 1XOYA 4X6QB 4PBOA 3ACGA 1JOJA 5FQ0B 1F8VA 4AFBA 1VBB1 5C8CC 5FMOL 1FPN1 4Q1RA 3NWKA 1DZQA 4LR4A 4F3JA 1VBD1 3BALA 3ASIA 4YW5A 4QHBA 2NQYA 1VBC1 3LA3A 1TMF3 2J1VA 4RR3C 1VMJA 1GZWB 3VUOA 3ZOIA 5F7UA 5GLTA 3A4UA 1SLIA 4L8QA 4LBJA 4I3PA 4EN6B 1ZA7A 1JHNA 4XBQA 3WNNA 3THTA 2VXRA 1BEV3 2WFF1 1AR91 4LBKA 4LBQD 4V2VA 2OPKA 2HEYF 4Q4Y3 4RQPC 3EHKA 4YWAA 3H1YA 1WA4A 2F6BA 2GNTA 2NM1A 1F4HA 3CZUA 2ZKLA 1XE7A 2WLQA 4IL7A 2ETEA 2W92A 1QJX1 4BOWA 1NE6A 4XJAA 1RUE1 1N1TA 1ASJ2 4UW5A 2Q4SA 4YZ3A 1RUC1 2VNVA 4E2GA 5L9BA 4QPIA 4KBBA 3UNPA 5E16A 2F4PA 2WYSA 1W9FA 1WD3A 3FJSA 1PGW1 4FQ4A 4FXGB 4ZXEA 5BXXA 4CP1A 1TNRA 4LPLA 2PHUA 5DAXA 4QKFA 3THDA 2NLRA 1XNKA 4FPHA 3HPNA 1XC6A 1W03A 2D7FA 5FYVA 3BI3A 5CYYA 1ULGA 1MR5A 1DDLA 2FDKA 5DG1A 1HB3A 3TN93 4HLTA 3OGVA 3AX4A 1LOAA 2DVBA 3AC0A 2VULA 3PDQA 3VD5A 4BQ1A 3T4HB 1BVP1 4Q4V3 1GU3A 2XJSA 2JG9A 3KQ4B 3SH4A 1NY72 5FPUA 2PHFA 1NOVA 2QQLA 2Q1FA 1RHI3 5KC5A 4A7KA 1G9FA 4J1WA 5LCWL 2JD4A 3KQRA 3E5XA 1OPMA 1OLME 4LJHA 5EYYA 4GH4C 2VO5A 2RDRA 4KWUA 1TQ5A 4UBGA 3THPA 1ZZBA 1JOBA 5J37A 2R16A 1R093 1X7NA 2OZ6A 4GMP0 1C5IA 4N7UA 3T2TA 4Q4V2 4DQAA 4Q8LA 1MZ6A 3VKOA 1O3QA 5A7QA 3HD8B 1A8MA 1NAEA 1UOFA 2Q0AA 3OUJA 4CEWC 5F1RA 5FR3A 1F9KA 4M0HA 2OT7A 5ISLA 5A6XA 4XMAA 1NCRA 1LHNA 1UY3A 5DG2A 1VBB3 3HNBM 4GZ9A 2LUWA 4MO3M 3SH3A 5JXGA 1O5UA 2XUEA 3WP3A 1DGRA 4GWNA 3JB8A 1YLLA 3WXPA 1CONA 1A8DA 1LOBA 2VBPA 4YVSC 4XFAA 5IUQA 3WUCA 4CDQC 3VD9A 3GBWA 2PAMA 4N53B 4JZRA 3ZSJA 5KBFA 1OLMA 3JD73 4GMP1 2UYBA 2VBDA 3S6PA 2YC4A 2R1BA 4QB1A 1EV11 2W52A 4ARXA 4Y5TA 1PVXA 1POV1 4PDWB 5A7PA 5ACA3 4LOTA 5DMYA 4Q4Y2 1R64A 3N7JA 3THCA 5FP7A 2Q1MA 5F2SA 3LA7A 3VDDB 4ISQA 3JU9A 5C6CA 1JZ8A 4HL0A 3OBRA 4QXBA 3RMYA 5FWEA 3C2UA 1S0CA 4XJWA 1TME2 4B8EA 4P9YA 1UU6A 3SH5A 4CCCA 3AXDA 1CAVA 1DYPA 3R4DB 1US3A 5T3NA 1POV3 3U1XA 2HWB2 5GJ6A 4FPEA 1GLHA 3UESA 1LGNA 5DUWA 1XNDA 3ECQA 4YGDA 1W9YA 1WA6X 3LOBA 2P4EA 5I91A 1T6GC 4AK3A 1QGLA 2QQMA 4RQPB 5K0UB 4Y5SA 4JAAA 3UJQA 2OPWA 2VMFA 1HN1A
chains in the Genus database with same CATH topology
3VBUC 4DOUA 2WSVA 2DFCA 2OW4A 4RA0A 3VBSC 4NN0A 1J1TA 2CAVA 1H8VA 3IN9A 3O14A 1CPMA 3MLKA 5I0SA 2ARBA 4L97A 2AZ5A 2YV8A 2GMPA 2CTVA 3N7MA 4KWJA 2WA4A 3WV6A 4BCUA 5HXVA 1R091 3VN4A 4DZGA 4R4ZA 4LBNA 4PLNA 2EA7A 3V64A 5FAXA 3OD0A 3T1LA 4XF9A 3ZFGC 1C8NA 1AYN1 5JVVA 1QOOA 2VECA 1FPN3 4HT1T 3SCFA 2PAEA 1UZZA 3LSDA 2X53S 1D4M3 3KT1A 1V6IA 1DQ5A 2LTNA 2QKDA 2C5DA 1E57A 2X5IC 2ZMKA 3E97A 3RYPA 1F31A 4AHWA 5IK8A 4KU7A 4YZ2A 4OFGA 3CF6E 1CR7A 4XFCA 3UKNA 3JD71 4JRAA 4KNCA 2FQPA 1MS5A 4KGQA 4OULA 4CEYA 1YI9A 1KRIA 2CWMA 1QJX3 2CGNA 2MNGA 3MFCA 1WCSA 1GANA 2CV6A 4FPKA 1LHWA 5J7MA 1ND3B 3B00A 4XBLA 2WS92 1WW7A 4COYA 4LO4B 2GMEA 3RPQA 5GZEA 1J3RA 3UV9A 2HWB3 2ENRA 4M3CB 3TBDA 4LNVA 1QJY2 1PGL2 1Q8OA 2GC0A 1RUH3 4JGZB 5CG8A 4CZSA 4JVAA 4QX5A 5FBZA 2GH2A 1OOPB 1TME3 4LHLA 4Q26A 2X8KA 5K8SA 5E89A 1ULCA 1EAH1 2IXJA 4TYSA 3AP5A 3GALA 3RYKA 4CDXB 4BA6A 1H4HA 4FBFA 3CJXA 1QU0A 4BMBA 1MQTB 3ZYGA 4FVVA 3KGZA 4Y20B 2ZBJA 1DHKB 4FPLA 3VHNA 3SNMA 3WG4A 4XBNA 2RMU2 5L7OC 1ND2C 1ZREA 1GV9A 1WLTA 1O91A 1GKBA 1AYN3 2JICA 4OHYA 1WLWA 3V0AA 2GZWA 4YYOA 2UY9A 4FAGA 4EN8B 3AMPA 5KXBA 3AFGA 3N35A 1QNYA 3CNAA 1UPSA 5CU1A 2XWBB 5KHGA 1R083 4QQOA 1AL23 2DURA 3PJYA 3B94A 1RUJ3 4KGGA 1J58A 3POSA 1PO23 1VBA2 2ZGNA 3IPVA 1RVF2 3WDTA 4B7KA 4DPNA 2CYFA 4GIQA 1ENQA 2BEOA 3AFKA 1SBDA 4MUVA 2YROA 4IV1A 4OUSA 3DPRC 4INDA 3V56A 1C4RA 1S55A 3ENRA 3TWIA 5JOXA 1BJQA 2QFEA 4K21A 5L36A 4NO4A 3B9CA 1PZ9A 3WT3A 4FTSA 2PHXA 4EV0A 3VHRA 1I3HA 4ZKTB 1BYHA 3WY6A 3U0ZA 1YFXA 1W0OA 3SCGA 1LKNA 1ASJ3 2OA2A 5EFUA 1LEDA 1BKZA 3FLTA 4YW1A 5I8SA 2B42B 1TNFA 1FX5A 2JDZA 3IIAA 4Q8KA 4IXLA 4AEJA 1H8TB 3C3VA 1FATA 1H8TC 3V65A 1HX6A 4A7ZA 1J1LA 1N1SA 1QOTA 1RMU1 2IXLA 2QZ3A 2R061 2JXAA 3O0XA 2UWBA 4ZU5A 1IKPA 3HT2A 3AJZA 3ILNA 1NG0A 3H1MA 2JG8B 4CYDA 1KS5A 4XDQA 3AMMA 1N3QA 3E6CC 5AFBA 4Q0PA 1UMZA 2GC2A 1VBC2 4AHYA 2C1FA 4AQSA 3POYA 3VDDA 4NWWA 1OA2A 1U0AA 4MV2A 2D93A 3ZPYA 3WNXA 2RR11 4YM1A 2FMYA 2B7YA 1MS9A 4FP3A 5KC6A 4MSVA 1OQDA 4WM8B 5DZGA 2WT1A 2IFRA 2ZGKA 5D8AC 1LR5A 2JENA 2WNUB 1AR93 2DCTA 5HCFA 4FPCA 3OD4A 3WQ7A 3OBTA 1DGWA 3ZXKA 4JQRA 3ES1A 1HDKA 2VW1A 3ZXLA 3NL1A 5A3LA 3QH6A 4H14A 3UL2A 1V9U3 4B3NA 4ISRA 4XW3A 3AJYA 5BNQA 5A32A 3WP4A 2RHPA 4CDQB 1APNA 1I5ZA 1RVF1 4Q27A 4IEVA 2V73A 1RUG1 1EPWA 3RS6A 2DWRA 4IEUA 4OHZA 3TN91 4ASLA 4QQHA 3UKVA 2UYAA 3IWZA 1VBE3 4XJ8A 3VKLA 4BZ4A 2D3PA 2VVFA 1H8TA 3H3UA 3IDBB 4LO7A 2WFF3 3ZFEA 4AI2A 4LE4A 2P3JA 5D1IA 5FO8B 1HRI2 2XBO3 3U11A 3WW1A 1AYM2 4YG0A 1VBD2 3ILRA 2ZHLA 1SLBA 4JV4A 1U5ZA 1Q8SA 2WWSA 4KG0A 1NQDA 3D82A 1A3KA 5T55A 4LBMA 1FT9A 1EV12 1MS0A 3ACLA 4HVRA 3APBA 4I3GA 4CDWB 1FNZA 2D3SA 3WG1A 5GLZA 1H9PA 2WFF2 3ZVXA 2FBEA 1ZRCA 1RUOA 4QQPA 4AW7A 2B5HA 4XQWA 3WVJA 4PF5A 4Y22A 2AH2A 4JGYC 4LBOA 4QT6A 4IV1B 3KMHA 3PMSA 4S2GA 4AI0A 1ZBA3 1SACA 2EIGA 5AVAA 4Y4YA 3VKMA 4QPGA 3IPVB 1N3OA 1OA4A 2DU1A 1V00A 2RS53 4IEPA 4HPKB 3D0JA 3HN1A 2UWCA 3SLIA 2AREA 3FUOA 4HBNA 3DF0A 3J26N 3N3HA 3PTYA 4IEWA 1NY71 2VH9A 2D5HA 2QZ2A 1GSLA 4RR3A 3VBFB 1SCSA 4I01A 1RUI1 2VNRA 3ZSMA 1C28A 5AC91 1Y7BA 2V5YA 2TNFA 4FPJA 1U12A 3AZWA 2P34A 3EJKA 1Y43B 1RUE3 4XJZA 1BBT1 2RJLA 4LBLA 1ZM1A 1EPZA 2AENA 3TB0A 3OPZA 2G4IA 1Z7S2 2RMU1 4IV3B 2ET7A 1NYWA 4XXPA 3JBG3 2P2KA 3FFZA 3P3NA 2Q8OA 5FCCA 3RJ2X 3CJIC 2D98A 4QM8A 2AUYA 2R30A 1AX1A 3ZYJB 1AYM1 5JOYA 2JKBA 1LOFA 1H2KA 4WM7B 1B09A 4MGYE 3JB4C 2XH6A 3MIEA 3CJIA 2ZMNA 3WDXA 1COV1 4W6WA 1UKRA 2NMOA 3FUQA 4IEYA 3USUA 4P14A 3WZ1A 4NHLA 1G9BA 2VOVA 2ES3A 1CQ9A 1LOCA 2PELA 2XG3A 2QJVA 1LESA 3VZNA 2YY1A 3M7AA 4Q4W2 3ZYIB 2PHRA 3EO6A 4FT8A 4S2HA 1IKQA 2K0GA 3WW4A 1OFNA 2A75A 4AVVA 3PVOA 3AZVA 1WMDA 2ZZJA 1ND2B 2XLAA 4GKXA 3ZN6B 1QJY1 2A70A 3M3CA 2DFBA 1X33A 2UY8A 3OY8A 4GWMA 2IFWA 5CFDB 2ZX2A 1G9AA 3CO2A 4FPFA 1HRV3 5H9PA 1G8WA 3M3OA 2ZKNA 5I8TA 2W39A 3MGUA 4BPZA 1Z7S3 1NA1A 1RVF3 1UAIA 1MZ5A 1W6PA 4EN0A 4YSFA 4FCAA 4YGCA 3ZMNA 4F83A 1MS1A 1X8MA 5A33A 2ATFA 1BXHA 3BCWA 2PLV2 5GM0A 4AEMA 1GFF2 4E9KA 1DQ1A 1Z0HA 4LO6B 3RDIA 2DTYA 4AFCA 4JRLA 4AG4A 3FBYA 1AYN2 4FPOB 3J9SA 2VPVA 1WGPA 1DQ2A 5HCBA 4RL7A 2VMGA 4BHPA 5GZGA 4EJRA 3CLPA 1U5IA 4XPVA 1C57A 5BPXA 1HXS1 5SV5A 4XF0A 5I93A 5J3UA 2NPIA 4LHNA 1Y3TA 3BIWE 1O3TA 1W6NB 3RWNA 3BOPA 5BNOA 3MF6A 2WJSA 3E6BA 3VBSA 2BVBA 4Y1YA 3ELNA 4OUMA 2CGOA 1QDOA 1DU3D 1ULFA 1RL3A 5GZFA 2O8QA 1EP0A 4XF4A 3GZTB 4Q4X1 2YMZA 4MLOA 4LLFA 3OGJA 4L11A 4C0BA 1YHFA 4YFWA 3VZOA 2VUJA 3KT4A 2RS52 5DZEA 2E63A 4Z8BA 1UD1A 3WW2A 3O0VA 3TOJA 1GBGA 3OCPA 5C8CA 2VNOA 2XVKA 3RMXA 4N53A 3VBHA 4A7YA 3JCIA 4BLIA 2EXHA 3O0WA 3SCHA 2B46X 2MEV3 5C4WA 3AP4A 5F5QA 4BM8A 2DVAA 1W6PB 2BVVA 1U5YA 3O12A 1LODA 1HRI3 1S1AA 3QD6A 2G9GA 3HBZA 3ZFFB 1WW5A 1LJ7A 3AMQA 2MEV2 1G7YA 2WNEA 1VBE2 4YRDA 5IK7A 4ATEA 4PLMA 4FOYA 4Q4Y1 4WM8A 1UIKA 4HVOA 5JCTA 4N90A 3LA2A 3ZN6A 1C8M3 4QM9A 5IK5A 1D4M2 1K5MB 3FMGA 4CTEA 1ZRDA 3GZUC 3P3PA 3RSJA 3AMHA 1VALA 1V6LA 2VOWA 1PHMA 5CG9A 3A0NA 1MZFA 4RHV2 1LULA 1FNYA 3B01A 2HYKA 3PVEA 4AE2A 1VP6A 4I2OA 1SFYA 1YIPA 4OI2A 4YVSB 3VKNA 2QDNA 2ZABA 2GAUA 2GNMA 4FP2A 3AP9A 3FX3A 4JGYA 1N3PA 5BNOC 1VAMA 3CJIB 4QU2A 4WM7A 3MZHA 3VL9A 3KM5A 4NR1A 1KS4A 5I0TA 4MXWB 3ZIXA 2BGCA 1AR82 5JPMB 5J98B 2XGXA 4CDXC 4COVA 1TE1B 4IV3A 1V6OA 1AX0A 2ZCWA 1RJ7A 1SMVA 1D4M1 1CAUA 2OYZA 5KXDA 1X50A 1W6OA 3G7DA 1IPJA 1VBC3 1KXGA 5FREA 1VRH3 1CD3G 3AZYA 2XJRA 4S2FA 4I0WB 4XFBA 2RS32 2YPJA 3AP7A 2DCYA 3HR9A 4N9IA 4YVWB 1IGOA 3HAGA 2PLV3 4OLLA 4WZCA 1ALYA 1PO13 1N1VA 4E2QA 4RR3B 2YDEA 5BYNA 4GULA 4PJYA 3LWCA 5ACA2 3N4MA 4NOTA 4D7TA 2IXCA 1URXA 4HSLA 2VQAA 3LSEA 2O8OA 5JIAA 3RNSA 3ILFA 3SMHA 1OQEA 3ZO0B 4CP0A 2ZGPA 1V6MA 4I09A 5JZGA 1VBE1 4MGIE 1FMD2 2XLFA 1PZ7A 4LA3A 4F7ZA 2ET1A 1UU5A 1XU1A 3OYWA 3W59A 2PQQA 2XKPA 3WHTA 2GH8A 3M70A 2B9UA 4DS0A 1ULEA 3NV4A 2BWAA 2E7AA 3EBRA 4R52A 4UW4A 4OHXA 1AXZA 3BODA 4Y20A 1HKDA 1J3QA 1MQTA 5JWPA 3KCXA 1R082 1ZZ9A 4IV3C 2B39A 1D0GA 4GA9A 1MQTC 1YIFA 1RUH1 5FOBB 2AYHA 1QNWA 3PVBB 2RE9A 1TME1 1CPNA 5J36A 4JGZA 1DBNA 1XNCA 1X8EA 3ROUA 4MGZE 4CEWA 3ZXFA 1AL22 2ZX4A 1NA1C 2HJIA 1G86A 2GC3A 3TNPB 3E5QA 5JOZA 3D8CA 4J1XA 4FTBA 5T50A 2VMIA 2WT2A 1M4WA 3AMNA 4CDQA 1DGLA 2PLV1 4LHKA 4YVSA 4AVAA 1QQP1 4HK9A 3VZKA 3VZLA 1BZWA 1AZDA 1CN1A 1W6QB 2UU8A 3DN7A 4NPRA 4YW3A 1PO11 3WCSA 4BE3A 4XF3A 2MPFA 2IWGB 2ZJCA 1NCQB 1S2KA 5D8AB 1J59A 1K5MA 5JZGC 1RUH2 1S0JA 1TMF2 4HVQA 5FFOC 3ZFFC 2PHTA 3I59B 1HV1A 4HZFA 5BY5A 5H9QA 1RINA 3J8F2 4FQZA 4AEDC 3ZFFA 4L2NA 3BTAA 1CIWA 1LOGA 2BFUL 1SFNA 5EYXA 4PIZA 1AR62 2VY0A 2H0BA 2FZ2A 1EYBA 2IC1A 5DZFA 5LK5A 1CGPA 4Z82A 2GALA 1D2SA 5CADA 1COV2 2R0FA 4YVWA 1QXPA 2W0XA 3H8UA 2CAUA 3GHNA 3VBRA 2K2SA 3SISA 1HLCA 2XJPA 3KSCA 2A3XA 5K9YA 4AXOA 3WQ1A 4YVWC 3FE5A 1W6OB 4FSJA 5ABJC 2E51A 2XJQA 2ZS6B 3ZMOA 4H7MA 4Q0QA 3G6JB 3M3IA 2G9FA 4S2DA 2DCJA 1OD5A 4ORFA 5C4WC 4BIFA 4AGGA 4WVMA 2PHLA 2ZGUA 4RFT0 3WG2A 4E4DX 1JW6A 5FO9B 4QQ2A 2ZZQA 4RSUA 4XFIA 2ILMA 1YYNA 3I8TA 3JZVA 1AR73 4XMIA 4JGYB 1LGBA 2DYCA 5J48A 2WZR3 4Z92B 4LUMA 4IETA 1O5LA 4K9SA 4WZFA 3DL3A 1PZ8A 4XTMA 1HQNA 2ZGOA 3WOGA 2O0OA 4A2UA 3HMYA 4B4RA 4HK8A 4C1XA 1OPOA 2LALA 2DCZA 1JTZX 4GMP3 1RUG3 3VBOB 4JTOA 4XJ9A 5GZCA 1HW5A 1PGL1 2UWAA 4AEDA 4Q4W1 4DRRA 3MICA 1H9WA 4XJUA 3ZXAC 4FOQA 1Q8QA 4FXKB 3ZN5A 1AR63 4BYYA 4DB5A 1DG6A 2D6NA 3PVNA 4DY5A 2DTWA 4PIYA 1HXS3 1IHMA 4YM3A 4YW2A 2KA3A 2WNVB 4OI1A 1RUD2 3GBFA 1I9RA 1YI7A 2BNOA 4XQ4A 4PIXA 2I74A 3NV3A 2A73B 3PHMA 1REFA 5CIRA 1FOD2 4AEDB 4AVBA 3KT7A 3GZAA 3JD72 4D3WA 2ZMLA 1Z78A 2A3YA 3H7JA 5C8CB 3GYDA 4QGLA 4U2AA 2BUKA 3RJRA 4ASMB 1SBEA 1WUVA 4AF9A 1DFQA 1VBB2 4CDUA 4COWA 3I7DA 4HANA 4HKOA 2ZGQA 4YZ5A 4LUKA 2MHFA 2DUOA 2Z42A 3KS7A 4UW6A 5IT6A 3NVCA 5JPNB 4H7LA 1JH5A 2ZPXA 1OOPA 2XBO1 5BV6A 3MYXA 1KITA 1AL0G 2H0VA 4M3CA 1S0GA 4QPIB 1MS3A 1QF3A