5EYXA

Monoclinic form of centrolobium tomentosum seed lectin (ctl) complexed with man1-3man-ome.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
b'DSLSFSFINFDQDERNVIAQGDARISGNNILQLTRTDSDGTPVRSTVGRILYSAQVRLWEKSTNRVANFQSQFSFFLESPLSNPADGIAFFIAPPDTAIPSGSAGGLLGLFSPKTAQNESANQVLAVEFDTFYAQNSNTWDPNYPHIGIDVNSIKSAKTVRWERREGVTLNVLVTYNPSTKTLDVVATYPDGQRYQISVVVDVTTVLPEWVRVGFSAASGEQFQTHNLESWSFTSTLLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrolobium tomentosum lectin
publication title Structural analysis of Centrolobium tomentosum seed lectin with inflammatory activity.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 60
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5eyxA00
1G7YA 2P3KA 1GZ9A 4P9YA 2JJ6A 5GLVA 1AX0A 1MS4A 3NV2A 1MACA 4I30A 3WDXA 5E89A 2ES3A 1BQPA 1HLCA 2DURA 3IPVA 3ZYRA 3MW2A 1ULEA 3WLUA 3ENRA 2EXKA 4YZ3A 1FATA 2NMNA 1G86A 2KM2A 1UAIA 1LENA 2ZGLA 3AYAA 2FMDA 4P9XA 1G9FA 4ISQA 1WBFA 3U4XA 1H9WA 3MW3A 1GZWA 5HCFA 2XB6C 1KITA 3VUOA 2R0FA 3UK9A 2VUAA 3ZPYA 1FNZA 2ZACA 3FUOA 4PF5A 1S0FA 1N3QA 5CAZA 4XMIA 1DQ4A 4ZXKA 2ZHMA 1FX5A 2JDZA 2VW2A 4XDQA 3D5OA 1ENQA 3N7LA 1AXKA 2R0HA 1AZDA 1YXWA 1F5FA 2A6WA 2ZMKA 3AP9A 3BTAA 3N3HA 2VXRA 1UPSA 1IS5A 2D43A 3NV3A 1B09A 2GNDA 2YY1A 1DYPA 1IOAA 2NM1A 4JCKA 3WVJA 3AZYA 4Y1ZA 1UN1A 1MS9A 3WCSA 2ARXA 1PZ9A 5GZGA 2A6YA 5BYNA 3AXDA 2WLQA 3POYA 4YG0A 2NP0A 2DVAA 4FPFA 1GICA 4K1YA 3R4UA 4Q8LA 3M3OA 5DUVA 3WG2A 1WW6A 2R1DA 3AYDA 3ZSJA 1W6OB 1Z78A 3POWA 2PHUA 4UW5A 3V0AA 4KBBA 3VKFC 3OPZA 5SV8A 1MZ5A 4XBNA 2UWCA 3SH4A 4PQ9A 2NN8A 1DZQA 1DHKB 3B3QE 2VH9A 5IK8A 4AVVA 1G8WA 5GALA 3ZXKA 4Y20A 2GNMA 1CQ9A 1JN2P 2D6MA 3O5SA 4M3CA 3H0OA 5HCBA 2WT1A 2ZGNA 1F9KA 1Q8VA 1V6KA 3IMNA 4CRQA 1Q8PA 4Q8KA 2ZMLA 1W6MB 4FPEA 2ZGQA 1YYNA 3MPPG 4GWMA 2CWSA 3D4KA 2A6XA 2LALA 1SBDA 4M3CF 1ULFA 4FOVA 4HANA 3SH5A 5CBLA 1QGLA 2E7QA 4Q2FA 4RL7A 3UJOA 4FPHA 2AENA 2P34A 2YROA 5KXCA 1KJLA 3N36A 2EXHA 2ZGOA 3V65A 2Z42A 4U2AA 4FPJA 3A4UA 4ATEA 2Q5TA 3B01A 4JRAA 2CYFA 2PELA 4YG3A 3RS6A 4AVTA 2E6VA 4C1WA 2CTVA 2ERFA 1SLIA 3JUUA 1I3HA 1JYIA 2D6NA 1H9PA 3VV1A 1CESA 4Y1YA 1ENRA 1UL9A 5LK5A 3HR9A 4YGDA 4ZKTB 3AXEA 1W0PA 2SBAA 4LBMA 2EXJA 4YZ4A 4BPZA 1GBGA 1FYUA 1O4YA 1SBFA 1S0GA 2PHFA 2WKKA 2ZHLA 3D6EA 5EXOA 1LHOA 4F83A 4BLIA 2P3JA 4BMBA 3A0NA 1R1ZA 4Y22B 1V00A 1A8DA 2JD4A 3APBA 3USUA 3POSA 2WT0A 2A7AA 3A0KA 4FOYA 1MS5A 2A71A 3QCWA 2LTNA 3VKOA 4MYEA 3N7KA 4TYSA 1ZA4A 2UWAA 1ENSA 4L8QA 3WOGA 5T5PA 4YZ5A 3ZYPA 1MVQA 5E88A 1LEMA 1SBEA 3M1HA 4XXAA 1QDCA 5H9SA 2D6PA 2DVGA 5CB7A 1LGNA 5KXDA 1QDOA 1W6QA 2GN3A 4C1XA 1DQ1A 1F31A 1D0HA 2PHRA 1V6MA 2OW4A 4K21A 5GZCA 5GLWA 2VW0A 1WLDA 3AYCA 4DQAA 1MS8A 1BXHA 1SFYA 2A3XA 2ENRA 3B69A 3OY8A 1DLLA 2ZGUA 5JVVA 1Q8SA 4XOGA 3FLPA 5EYXA 1DIWA 2DYCA 2PHWA 1X50A 3VKMA 5GM0A 4FPLA 1CN1A 1JXNA 5FREA 1JUIA 3N7MA 3O0XA 5DZFA 3AZVA 4ITCA 1LOEA 3OJBA 3V0BA 1DBNA 4FP3A 1ZM1A 3WG3A 4CZSA 2AR6A 3TAYA 3IKWA 3O12A 1SACA 3AJYA 5T50A 3ZSMA 3IPVB 4WVWA 4XILA 1GANA 1RINA 3ILFA 3ZXLA 3RG0A 1LHVA 2E7TA 1U0AA 1S0DA 3QLQA 1GNHA 3JU9A 2DUPA 1GKBA 3OBTA 4R9AA 3RMYA 1W6PA 4YFZA 5DXDA 5EWSA 1QOTA 1GZWB 3M2MA 4BQ1A 3BIWE 1YRZA 1N47A 1V6OA 4K20A 2D3RA 4FVVA 4JC1A 5JOWA 3W58A 2DU0A 4XJ8A 1LHNA 1W0OA 2D6KA 4LBJA 4SLIA 1RIRA 4XHBA 4BLJA 2A6ZA 1YI7A 4P9WA 1LHUA 5T5LA 2AH2A 3AP6A 1QU0A 1C4RA 3N7JA 3PVNA 4YM0A 4YFWA 4W65A 1AX2A 1G9CA 1A78A 1YIFA 5IK4A 5JOYA 1WW5A 1N1VA 2WSUA 4LBNA 5H9PA 2P2KA 4DRVA 4FPCA 2ZAAA 3OYWA 3WDWA 2JECA 2AGSA 3ATGA 3GALA 3MW4A 4XIOA 2VY0A 4R9CA 4YW5A 3NV1A 1DQ6A 3KM5A 2R1BA 2UURA 4YM3A 4TZDA 3WHUA 1LEDA 3V0AB 4YGEA 1LOGA 1DQ2A 1RITA 3UL2A 1IS4A 1V6IA 5AVAA 2DVDA 2D6OX 1LU2A 2DVBA 1N3OA 3OGGA 4WVVA 5JOXA 3DUIA 2ZHNA 1WLWA 3M3CA 4Y20B 5HCAA 1N1TA 4M3CB 2EALA 3SLIA 1LOCA 2VU9A 1VLNA 2P3IA 4R9DA 2A3YA 1CPMA 4GA9A 4BM8A 4YZ2A 3VKNA 1FNYA 2R49A 1WBLA 3BOPA 5DZGA 1MS3A 5T5JA 3WV6A 3WDYA 1QNWA 1LULA 1CIWA 1HQWA 4YW3A 3Q9OA 5H9RA 1LCLA 4GWNA 1SLCA 4UW3A 1LOFC 1ULCA 3PVOA 4AGVA 1LOFA 4LBQA 3RRDA 2AREA 1UZYA 2YZ4A 2GNBA 4XTPA 2EAKA 2JE9A 3SITA 2ZGMA 4ISRA 1VAMA 1SCRA 4LBLA 4XHXA 1C57A 5DG2A 3AK0A 5H9QA 5KXEA 3AFKA 4ATFA 2YV8A 4AGGA 1SLBA 4GALA 2HYKA 5F5QA 2D3SA 3AZZA 2C5DA 4BMEA 1AXZA 5DUUA 4LBQB 4H55A 3C2UA 3AX4A 2ZHKA 2R16A 4NOTA 1KDMA 2ZA9A 1VAVA 2D3PA 5DUXA 4XZPA 3NWKA 3R05A 4XMAA 1GYKA 1BJQA 2H0BA 4GXLA 1DFQA 4YGBA 3N35A 5GZEA 3PVEA 2E53A 4M01A 3ZXEA 3SH3A 3FLRA 3O0VA 4FOQA 2P37A 3SNMA 3PJQA 3MEPA 4Q1PA 3V64A 1UMZA 1BYHA 3AZXA 2GMPA 4YW1A 3USUB 1FAYA 3M3QA 1FV2A 1AX1A 1DQ0A 2ZGRA 4LBOA 4XBLA 3M3EA 3SISA 1Y7BA 2C9AA 1D2SA 3HMYA 2YMZA 3IN9A 3I4IA 2D6LX 2W52A 3R4SA 2OUHA 2A75A 1G9DA 3ZVXA 5GLUA 1AXYA 5GLTA 1OFSA 1LESA 2DUOA 4FPGA 1AF9A 3T1MA 4FOWA 1S0CA 3WG4A 1WD3A 1W6QB 1W6NA 1S0EA 1WW7A 5IUQA 5GJ6A 2ZGSA 4CTEA 4YM1A 5FRAA 1BKZA 2CY6A 2ZGPA 4NO4A 3CNAA 4LBKA 1CPNA 5GLZA 1LU1A 3WUCA 3PMEA 3LCPA 3OY8B 2V73A 4R9BA 3ZXFA 1APNA 4Q27A 1YO8A 4XXPA 4AVSA 3ZXJA 2OVUA 1QMJA 1URXA 5EYYA 1UKGA 1WUVA 3V0BB 1WCSA 3FBYA 3FLTA 3T2TA 4Q1RA 1AVBA 4FPYA 3ZSKA 2JKBA 1J1TA 1QKQA 3I8TA 3AJZA 1HKDA 2ZGKA 4YZ1A 1IKPA 4DFSA 4FQ4A 1PZ8A 1W6PB 5E8AA 2ZGTA 2AUYA 1AJOA 3O0WA 4K1ZA 1N1SA 1N3PA 3BODA 4DPNA 1MS1A 3AYEA 4Q26A 1C1FA 1KJRA 4YM2A 3B00A 2NYYA 2DVFA 2UWBA 2TEPA 1QNYA 1W6OA 5L73A 4GKXA 1UZZA 3NV4A 1DGLA 4FPOB 1DYKA 4UW6A 1CVNA 3UJQA 4DRRA 2WT2A 3LSDA 1CONA 1MZ6A 1A3KA 2GMMA 3VKLA 1LGBA 1S0BA 4XBQA 3LSEA 4Y1UA 1C1LA 1GZCA 1JYCA 4Y1VA 2A5ZA 3RMXA 3OBRA 3WG1A 3OYWB 1AJKA 2WQZC 4LBQD 2G4IA 1H30A 3WHTA 2RHPA 3DGTA 1LJ7A 2B7YA 1QOSA 1V6JA 2ZABA 1GV9A 1W6MA 2VW1A 4YGCA 4M3CE 1PZ7A 2DWRA 1G9BA 1NXD1 2CWMA 2EF6A 3INAA 2W68A 2BQPA 5JOZA 4PBPA 2PHTA 1G9AA 4AWDA 4Y26A 1ULGA 2ZKNA 4XJ9A 1KQRA 2EXIA 1IS3A 4FPKA 2ZMNA 2GALA 4D69A 4YW2A 1QF3A 4XTMA 4YW4A 1BZWA 4M00A 5T5OA 2JE7A 2FHRA 4Y1XA 4WZFA 3WZ1A 3WDTA 4YLZA 1CJPA 1S0JA 2A6VA 1LOAA 4RA0A 5JMCA 3ASIA 4OZXA 2PHXA 1O4ZA 1VALA 2AYHA 4XJUA 4IQPA 3RSJA 5JDBA 2CL2A 1N1YA 3B9CA 1OKQA 1V6LA 2NMOA 4HL0A 4PBOA 5T54A 5IT6A 2I2SA 4YG6A 1ULDA 1Z0HA 1WW4A 4PCRA 5DG1A 1UX6A 1VIWB 3L2YA 1HQLA 3AP7A 3ZSLA 2EIGA 3WDUA 1SLLA 4XYXA 1SLTA 2DUQA 2A70A 4U36A 4Y22A 1KRIA 4FP2A 1Q56A 1Q8OA 1LTEA 3HN1A 5T52A 4Z8BA 5F9TA 1WD4A 1I1EA 2GMEA 3T1LA 1KDKA 1GNZA 2A3WA 1JHNA 2DTWA 2WJSA 1CR7A 5CA6A 3WNXA 3WUDA 1JBCA 1GLHA 1GSLA 1HDKA 3WCRA 1WLCA 5CNAA 2W08A 1S1AA 2CNAA 4XIKA 4XJAA 3ILRA 2WSVA 4AGRA 2XG3A 5DUWA 2GNTA 2ZBJA 1IS6A 3AP4A 4AYUA 3FFZA 4Y24A 1Q8QA 5IK7A 3IM0A 3FUQA 1LECA 2W39A 3AP5A 3W59A 1MVEA 1S0IA 5DZEA 4XJZA 1QOOA 2OUJA 1SLAA 4BOWA 4FQZA 1MR5A 4GKYA 2WNEA 1SCSA 2D7FA 3ILNA 1JOJA 1LOBA 4XE9A 1OQ1A 5GZFA 2GDFA 2SLIA 2E51A 5JLVA 1DQ5A 4UW4A 1EPWA 1TEIA 3AZWA 1ONAA 2UU8A 2DU1A 2ZZJA 2YXSA 4P14A 2DV9A 3TB0A 3KQRA 1JW6A 1IKQA 1LGCA 4WV8A 4ASMB 4XJWA 2V5YA 5IK5A 2D44A 2GN7A 2NZ9A 5GZDA 1XQNA 3GNEA 1LHWA 3RQ0A 3WDVA 1LODA 5KXBA 1V6NA 5T55A 1FV3A 4DS0A 1W6NB 2ARBA 1MS0A 1NLSA 2DTYA
chains in the Genus database with same CATH superfamily
2P3KA 5FXXA 4CDQC 1XJAA 2JJ6A 1OLRA 4HSJA 2KD7A 1MZFA 4HVRA 1MACA 1RUJ1 2JG9C 2VOKA 2ES3A 2AEZA 3HJRA 2DURA 5HV0A 4OI0A 5DAQA 1RJ7A 4AK3A 3TNQA 1HJGA 3AC0A 2OS2A 3E97A 4HOOA 2FMDA 4N7UA 1VRH3 5HCFA 3E1F1 1NY71 3WEZA 4COZA 1RUNA 4I0WB 1JS9A 2XJRA 4P9IA 3FUOA 4B4PA 3TEXA 4ZXKA 2BOJA 1RUI1 1QJZA 4QX5A 4NRPA 4DUWA 4GMP1 3N7LA 3UKNA 4I0BA 1DDLA 4JZRA 1Q3EA 3WQ7A 1BK1A 2Y34A 1W28A 1FXZA 1RXFA 1IS5A 3NV3A 4RYDA 4E2QA 1EV13 5FMCA 5EFUA 2YY1A 5JSOA 1DYPA 1IOAA 1FMD1 1V9U1 2VVFA 3DF0A 4A4AA 5JMOA 2HJIA 3D82A 5EZWA 4Q4X3 3CJIA 5GZGA 1PO11 5BYNA 3RZZA 1EYBA 1W05A 5DUVA 3E5QA 5FZ6A 3BIEA 4LK6A 1UKRA 2BBAA 4MGYE 2WZR3 5FZDA 3ZSJA 3GYDA 4N7IA 2MEV3 3V0AA 4OI2A 3ETQA 3JCIA 4XBNA 1QH6A 3SH4A 2AEYA 4CDXC 2NN8A 1DZQA 4MGKE 3DXUA 2VH9A 4Y5TA 1XNCA 1AR91 4UOJA 2OYZA 1GP6A 1T2XA 3KT7A 4KU8A 1RHI3 4L97A 1ULOA 4YVSC 3MLKA 5BNOA 3VD9A 2QJVA 2JE8A 5BY5A 1AR73 1EY2A 3IMNA 1Q8VA 3D0JA 2G9FA 1UD1A 4UF0B 2FDGA 1RUJ3 2IXJA 3N9LA 2X5IA 4IL7A 3OGVA 4XFGA 1YYNA 5A6YA 5LA2A 3GJAA 1SBDA 5BNNC 4M3CF 4HANA 1ZA7A 3THTA 3I2JA 4RL7A 2ZXQA 3CL1A 4I09A 2P34A 2YROA 3VBSA 1WKYA 1KJLA 3LA7A 5FOJB 1W3VA 5BXXA 2ZGOA 3V65A 2B39A 2Z42A 5AFEA 1U5XA 4U2AA 2VO5A 1IQAA 2WO1A 5FR3A 3NRUA 4RGAA 3TEYA 2Q5TA 1VE0A 4K8RB 4YG3A 3RS6A 1RUI3 4N53B 3BKZA 2HWD2 3RZGA 3EBRA 5FKCA 3DV8A 1SZBA 4I3PA 1SLIA 3ZYFA 5LA0A 3ZFFC 1H9PA 4G3YC 1XU2A 2Q0AA 2QFEA 1OT5A 4BIOA 1K42A 5LK5A 3HR9A 1RMU2 1IPSA 3AXEA 2BBVA 2YUEA 1EAH2 1W0PA 4RR3C 5EPAA 5HI0A 2EXJA 1G6NA 1SBFA 4BDVB 2ZHLA 3CEWA 3MIBA 2WKKA 5EXOA 3D6EA 3HQUA 3VZJA 2C4XA 1MQTC 1R1ZA 4Y22B 3VDCA 4NHMA 1V00A 4LLFA 4P9LA 5LBEA 3APBA 1ND3C 2UY8A 3POSA 3HQRA 1OC1A 4QKBA 2VTXA 4YVWB 2A71A 2WR9A 4UXAA 1H2MA 1YI9A 1VBA1 2I07B 4IXLA 5EJZB 5FV3A 4WVZA 4MYEA 3N7KA 5T3NA 3PIGA 1AR93 3RGBA 1ENSA 3WOGA 4YZ5A 1JOPA 4DXZA 5C9AA 1LEMA 3M1HA 5A6QA 4XXAA 4CP2A 2D6PA 2DVGA 4XFFA 5CB7A 4LTAA 4P02B 1QDOA 5KXDA 1W6QA 1X33A 3LIGA 3LOBA 1DQ1A 2DBNA 3MDPA 2PHRA 1L7RA 2AZ5A 4HK8A 1V6MA 2ADDA 2OW4A 2ZX2A 4XUQA 2BNMA 4FI9A 2EA7A 2KR2A 4S2DA 4DQAA 1F5JA 5F8PA 1MS8A 3VBHC 1YC61 4XABA 4AQ2A 4QU2A 5LBFA 2RS12 4XOGA 4J1XA 2B46X 5CIRA 3VKMA 1ZVFA 4LJHA 3C7HA 1SDDB 3N7MA 3W20A 2A73B 2GP3A 1PO22 1SG3A 3V0BA 5FQ0A 2V4AA 5F3GA 1D4VB 2D40A 5FY5A 4A3ZA 2C6SA 3AJYA 4CCEA 5F32A 3GHMA 4EE2A 3T0DA 3IPVB 4WVWA 4XILA 1GANA 4LOTA 3ILFA 4NMIA 1LHVA 2R072 2E7TA 3B93A 2DUPA 3LOIA 4R9AA 5C3PA 1DLCA 2Y60A 3VHOA 1XYNA 1W9TA 4FCAA 1YRZA 4P9JA 5EP9A 5BNPB 3RNSA 2WS92 3GBWA 2D3RA 3J26N 4IEPA 4JC1A 4COVA 3BTZA 1ULPA 3OUIA 2BPA2 4OHVA 3Q8CA 5LA9A 1VBC3 4XHBA 4KGGA 5LATA 4P9WA 1HRI1 3HT1A 2AH2A 4K9SA 2K46A 4IETA 4IUGA 4MO3M 2EICA 4PI2A 3PVNA 1VBA3 2FCVA 1REDA 4W65A 1OI6A 3I2GA 4XZUG 3SXWA 4MXWB 1W06A 4IV1C 2HYXA 2WINB 3NAPB 2P2KA 4XETA 5IAVA 5JI7A 5C5TA 2CSGA 4FPCA 1W8FA 2ZAAA 1BVVA 4RGKA 1QJX2 2RS52 2V4VA 2YC0A 2YHJA 3MW4A 4JDOA 5FJHA 3ZFGB 1DQ6A 2VNGA 3KM5A 5JSRA 1J59A 1NUKA 2R1BA 1IZ3A 2E33A 2HEWF 4N90A 5F7UA 4TN7A 5A33A 3WHUA 4TZDA 1REEA 1CAXB 2ET7A 4N43A 4LHSA 3DCQA 3Q8FA 4AEDC 1PGL2 3UL2A 3VBOC 3NJXA 5AVAA 2P5BA 2GAUA 2DVDA 2D6OX 4CXXA 2DVBA 4FAGA 1Z7S2 1YQ8A 3OGGA 2Y6LA 1YQ6A 3HD8B 3ZFEA 3M3CA 5HCAA 1JU3A 5FZ7A 3KVAA 2MHFA 4KL1A 3SCFA 2VU9A 4A41A 3O1SA 4QDSA 3RFRA 4IW3A 4EN7B 3H50A 3J7NA 4TLFA 4C0HA 4JGZB 4QD2A 3HNMA 3BOPA 3D8CA 3WV6A 1B35C 5F2WA 1LULA 1CIWA 4OMCA 5IHRA 3Q9OA 3ABZA 4LQRA 2HWD1 2HWE2 3DYOA 3PVOA 2Q8CA 4LBQA 4QPGA 4QMAA 4A6SA 2XL7A 4MX3A 4XTPA 2EAKA 3MPBA 5C7GA 2C9KA 5IVCA 5H9QA 1S2EA 4LBLA 4XHXA 5FYYA 3WINE 3AK0A 1RMU1 3USSA 5IVEA 3WNLA 3AFKA 1ENXA 2Y33A 4JRLA 3VD5A 4XF9A 3NJVA 1YEWA 3WP6A 4CCJA 5FY1A 3WP4A 3VBUC 5FZ3A 2PHLA 3C2UA 2XHKA 2R16A 4HZFA 1ZZCA 4HBNA 2WNVB 2D3PA 1HN0A 3ZYJB 5CFDA 3R05A 1VBD1 1NCRA 4XMAA 3GXUA 1F4HA 1GYKA 4QKNA 4IEVA 2QCSB 4YGBA 2A1XA 4ES8A 3IMMA 4CCLA 3N35A 3FHAA 4M01A 4E9KA 5I91A 3FLRA 1OA3A 2D5HA 3O0VA 4QB2A 5A7OA 4IGPA 3IB3A 3P3NA 1J58A 4EWDA 2JDPA 1FV2A 4XBLA 4E4SA 2H6CA 4XQDA 3NSTA 1PGW1 3OD4A 3JB8A 3I4IA 2VMFA 1R092 2D6LX 3K48A 3ZKYA 4EWAA 5IVJA 1OQDA 3O1OA 4JHZA 5CU1A 5K7PA 3U1XA 3DPRC 2W9XA 1X7NA 1AXYA 1X82A 4OCTA 3ZVXA 1LESA 2DUOA 2ADEA 4N8MA 3WG4A 3PNAA 4JGYB 1WD3A 1W6NA 2E32A 2XBO1 4QQPA 2ZGSA 5FZBA 3KD4A 2VQAA 5GJ6A 1QJY2 2HH9A 2BGPA 2RS11 5CKMA 5DQ0A 1XSQA 4PIZA 2QQOA 4BQ5A 3LEMA 5GLZA 3PMEA 2VTFA 5C8WA 1AYN2 2HWD3 5A3TA 3OY8B 4CDQB 1PO21 4LULA 2IXKA 4XPVA 2LW8A 4DIQA 2JG9B 2FZ1A 1UMIA 4XXPA 4AVSA 4R52A 2G9ZA 3HEIA 5IFPA 4QXKA 4MADA 5JXJA 1RMU3 5FZ8A 2XQRA 2YFZA 1EAH3 2JDHA 3VZKA 1XRUA 2NPIA 2Z2SB 2WS91 1QKQA 1HKDA 1IG3A 3SKJE 1YQCA 3JXSA 4YZ1A 4FQ4A 1O8SA 1PZ8A 3DYMA 3FL7A 4KI5M 3RJRA 3I2DA 5FFOC 4I2OA 3AKTA 5GALA 1N1SA 1N3PA 4MZUA 3AYEA 4A45A 3O1PA 4XCAA 5I0SA 3WP5A 3O1VA 3B00A 2UWBA 3RI8A 1W6OA 1RXGA 5L73A 3PTRB 4FPOB 3S5QA 1YIPA 1DYKA 4OZOA 1AL21 3H9AA 4PDWB 5D8AA 4DRRA 1PHMA 4LO6B 1CONA 3I3MA 3WW1A 1QJX1 1XNAA 2RS51 5DAWA 5IWFA 2JG8B 1NXMA 3TN91 3WF2A 1C3HA 3GF6A 2O1QA 3LE0A 3OUJA 3QOPA 3I3QA 2QQWA 5HXMA 3WHTA 5HPOA 1PGL1 3M70A 2CDOA 1NOVA 1QOSA 2RS13 3IDEA 4YGCA 1W6MA 2VW1A 5CEHA 5KHGA 1X8EA 3RZHA 5F6KA 4I02A 3OGRA 4LKDA 3ZYBA 4BK4A 2EF6A 1VAKA 2RVAA 2VM9A 5BPXA 2PHTA 1G9AA 1PO23 4AWDA 2XLFA 4NPLA 4BH9A 4NN0A 1YQ2A 2Z79A 4ZXEA 4AG4A 5JXIA 3T09A 1HN1A 4AQ6A 1KQRA 3BVCA 4FPKA 1A6CA 1WWYA 1UY3A 2GALA 4AW7A 4D69A 1DGRA 5BNNB 2BJSA 2CGOA 2JXAA 3KWVA 2VVDA 4RQPA 4N53C 4H2AA 4HETA 1QH7A 3JD72 5KC5A 3KHCA 1VBB1 2QQKA 2R073 1PK6A 4WBBA 3GCXA 4WZFA 4DB5A 4UAPA 4YSFA 3PU3A 1OXCA 5E16A 2YC4A 2HWE1 2PHXA 1HX6A 2WS93 1KXGA 2WNUB 4UFMA 4M0HA 1YNAA 3KV4A 4TWTA 1OKQA 1NA1C 1IGOA 2VZOA 4PBOA 3ZFFB 3OBAA 3BTYA 1H4HA 1OVPA 1VIWB 1BBT2 3L2YA 3OG2A 4AOCA 5FMOS 3VZLA 1UU6A 1HXS2 3S57A 4XYXA 5FZMA 2F4LA 1RUF2 4QGNA 4FP2A 5A7SA 5CG8A 3Q8BA 1JUHA 3ON7A 1UX7A 2DF7A 3FJSA 3PDQA 3PUQA 4B29A 1OUXA 3IWZA 4CYDA 3KMHA 4CP0A 2WA4A 2DTWA 2WJSA 1MQTB 3TEWA 4CSWA 1QJX3 2RS53 2JDNA 1QEXA 2JENA 3ORJA 3VL8A 1HDKA 4CUBA 3OGJA 4XAAA 3ECQA 5CNAA 3SC7X 2W08A 1S1AA 4KWUA 5CFCA 1ND3B 1HJFA 2C26A 4AHXA 5FPXA 3EJKA 2WSVA 1QXJA 4O9GA 4WM7B 5BV6A 4AAXA 3FUQA 1LECA 2W39A 3AP5A 2P3YA 4G9SB 1MVEA 1R091 1Z7S3 4XF3A 4ZU5A 4XJZA 3RVHA 4GWJA 4OHXA 4FQZA 4CEWA 3S7IA 2E31A 5KHKA 1ZRFA 1JOJA 5FZKA 2WDBA 2XJPA 4XE9A 1OQ1A 2PYTA 2GDFA 3AVSA 4Z1VA 2PAEA 2FZ2A 1EPWA 2D97A 1BMV2 4ZU4A 2DU1A 4LOSA 4UFJA 1QJY1 4FFGA 4IDZA 3VBHB 4WV8A 5FZ0A 4XJWA 1QQP3 3CIHA 2V5YA 1CAWA 2GN7A 2NZ9A 5GZDA 1XQNA 3GNEA 2PHDA 5LA1A 1JI6A 4LA2A 5LB6A 1S0BA 1D4M2 1LCLA 1NLSA 2DTYA 2IXLA 4MHRA 4MGIE 1G7YA 1H8TB 2HWE3 3QD6A 2JD9A 4D7TA 2YU2A 1MS4A 3NQHA 5E89A 5I0TA 1ZBA2 3CQOA 3S0MA 1ULEA 3J4UH 4EYUA 1ODNA 1RTVA 3I59A 2EXKA 4AI3A 1NY72 2NMNA 2P6CA 2NQYA 1UAIA 4OHZA 2VBDA 4DEVA 4TXWA 4W6XA 1G9FA 2XWBB 2R061 3MZHA 1H9WA 3MW3A 3VDAA 2XB6C 1I5ZA 1KITA 4LPLA 2R0FA 3UK9A 5F3EA 1FNZA 5ACA1 2IVJA 4PF5A 5FO9B 3O7OA 5IATA 1N3QA 3WNOA 5JZGA 1QJU2 1YQ5A 3PUHA 1FX5A 2JDZA 2VW2A 4XDQA 2RR11 3GBGA 1ENQA 1PIV2 1AXKA 3POBA 1UY4A 1AZDA 1YXWA 3ACGA 3AP9A 4CE8A 1FMD2 1V9U2 3BTAA 4UFLA 2EIDA 1ZZ8A 1UPSA 3HQXA 2LM3A 2ZX3A 3I3BA 3OOXA 5JAXA 2BYVE 4LEJA 1PO12 3NAPC 3WVJA 4JCKA 3ZIWA 3NKTA 1FOD2 3AZYA 3LF7A 4P00B 1MS9A 2XHNA 1YLLA 4KG0A 4QB1A 3AXDA 2WLQA 3MBWA 4NHKA 4AEKA 5J37A 1GICA 4K1YA 3WG2A 3M3OA 1E5SA 1R093 2CGNA 2R1DA 2WZ8A 4GJZA 3PTYA 4HKOA 4EZ4A 2ARCA 3POWA 5A3UA 5CKNA 4UFIA 2FDHA 2PHUA 4UW5A 3FMGA 3SCGA 4KBBA 1WZXA 3H42B 1GP4A 1PX3A 4CDXA 2IZWA 3VBRA 4AQSA 4C91A 1DHKB 1UW8A 4CDWC 4NHYA 2FDFA 1QJY3 4W6WA 1NLQA 5FDBA 2PAMA 5IK8A 4AEDB 4YARA 3T3YA 3ZXKA 4Y20A 3VBOB 1CQ9A 3O5SA 4QHBA 5FZOA 1KS4A 3H0OA 4YVSA 5A80A 3ACIA 4URTA 4EWEA 2XLAA 1H6YA 3NNGA 4LE3A 4FO9A 1AYN3 1US3A 4OMDA 3I2HA 2ET1A 3FE5A 1F9KA 4Q29A 5CVRA 4NIDA 2BDRA 4CRQA 4EZHA 4NAOA 3ES1A 1W04A 1OOPC 3MPPG 5DAPA 5ERLA 1CAVA 4JKMA 4FOVA 5E6HA 3SH5A 5CBLA 3JD71 4QM8A 3VDDC 1GMMA 2E7QA 4NE9A 3KV5A 4FPHA 2VQTA 5ABJA 1O91A 2ZZQA 2C1FA 4IGOA 3ZDSA 3A4UA 3Q8EA 4JRAA 4V1PA 1JYVA 1QIQA 3BYWA 4JKKA 4C1WA 5C8CA 3LIHA 1IPJA 3HBKA 4H7MA 2JB4A 3VV1A 1YFYA 1BBT1 2GSYA 4IE4A 1S4CA 1GFF2 2J1SA 1H2LA 2OZ6A 3GHNA 2WNVC 1HXS1 3I7DA 4YGDA 5C3SA 1M06G 1YWKA 3T4VA 2VE1A 4CCOA 2O8QA 4RR3A 3P3PA 5FP9A 4GQ7A 4AFDA 3VBUB 4BPZA 3H3LA 2PHFA 3VB9A 5F2SA 4BMBA 3O1TA 3QACA 4NIHA 5A6ZA 4DEQA 4LHLA 1H1AA 2UYAA 2BVVA 4Y4YA 5A32A 1ZRRA 2JD4A 3ZN5A 3USUA 2ILMA 3SCHA 4V2VA 3ZDVA 4RS5A 4FOYA 2A7AA 4C90A 3TRSB 4ZHNA 4M4PA 1NQDA 3QCWA 2VZUA 4COWA 1UIKA 4ASKA 3I49A 4TYSA 1SPPA 1VR3A 2VUJA 4L8QA 4FFIA 1TNRA 4D0QA 5E88A 3ACHA 3HPNA 1ZRCA 3OEAA 1QDCA 4LE4A 2F4PA 1R1A2 2GN3A 2GH2A 3AFGA 4WM8A 4LHKA 2Y6HA 2IFRA 2W92A 3RWNA 1BMV1 5GZCA 1H1IA 5GLWA 3CKHA 3ZSEA 4D6RA 3ZIXA 2GC1A 3FX3A 2VG9A 3JD73 2Q1FA 3K75B 3BUCA 4E2GA 3I97A 1Q8SA 5JVVA 1D4M1 5EYXA 3BI3A 1UYYA 1Y43B 1WMDA 4RHV1 5FREA 1JUIA 2BFUS 1W9WA 3KSCA 1ZBA1 4LORA 4ITCA 5DZFA 2Z4FA 1YUDA 3VBFC 5L19A 4AF9A 2VAUA 3WG3A 3N9NA 2B4KA 4A3XA 4BA6A 3C7FA 3OF1A 5FUPA 4M4RA 4Q4Y2 1BBT3 3GM8A 3IKWA 3O12A 4XCBA 2FBEA 5T50A 4AI9A 4Z2AA 1UXZA 1HXS3 1RUF3 2WNOA 1GNHA 3LA3A 1GKBA 1K45A 1QJU1 2WWSA 4HLTA 4BQ2A 4YFZA 4MGTA 5EWSA 1PIV1 1GZWB 3BN6A 3M2MA 5FPUA 1GOGA 2HEVF 3PHMA 4K20A 1O7FA 2QVSB 1WCUA 1HRI2 3W58A 2LUWA 4QXBA 1W0OA 1XSRA 2NLRA 4BCUA 4ORFA 4QXHA 4BLJA 1RIRA 5T5LA 3IAQA 1LHUA 3ZX7A 2VMGA 5FMBA 5A7WA 4PDWC 1FOD1 4AFBA 4AHZA 1ND2A 3AP6A 4LO4B 3PLQA 4URAA 3N7JA 5CYYA 5A7PA 1XPWA 3I2FA 1G9CA 1A78A 1WW5A 1N1VA 2VZVA 2WSUA 1SFPA 4NRQA 2JG8C 1AL0G 4IV1A 4MGZE 3OPTA 1JYNA 2JECA 2AGSA 3GALA 1AUYA 2R7EB 3MFAA 4XIOA 2VY0A 2R042 3NV1A 3RI9A 5CG9A 4YM3A 5LRRA 4EROA 5A3NA 1LEDA 2VMDA 3PL0A 2ZCWA 2BUKA 5JR7B 1A34A 1RITA 2PQQA 1FT9A 1IS4A 1V6IA 3KF5A 4PLOA 2ZPXA 2CGPA 4OUSA 1D4M3 4YRDA 1XOYA 1TME1 3DUIA 4Y5SA 1WLWA 2H0VA 4BYYA 1O3QA 1ZBA3 4M3CB 2EALA 1WMFA 3SLIA 1LOCA 2O0OA 4PJYA 3UGGA 3SQOA 1REFA 3MI8A 1H2KA 4LO7A 1CPMA 1RYYA 4GA9A 4BM8A 4CXWA 5C4WC 3VKNA 2R49A 4BB3A 1MS3A 2WNUC 5T5JA 3WDYA 4L0PA 4GMP3 5H9RA 4JX0A 4JDNA 5KHIA 1QJU3 5C3QA 4BQYA 4CP9A 3L9JT 3BTXA 3C7GA 3P6BA 1PIV3 3C7OA 2J22A 1NZIA 2AREA 1UZYA 1W8TA 1XNKA 2EVXA 4NPRA 4UI9L 2ARAA 2I45A 4TTGA 1FMD3 1V9U3 3GCWA 2JE9A 4P9GA 2BGOA 1NA1B 4ISRA 5FZGA 5DG2A 5FK7A 2QKDA 4YPJA 1PO13 3OEBA 3OSDA 3H1MA 4AL9A 4ATFA 1L7QA 2WA3A 1FOD3 1UOFA 1ZNPA 2HBUA 3POEA 4AGGA 4CDUB 2CU5A 4OHYA 2D3SA 3AZZA 2VOWA 3K46A 3E6DA 4AAPA 2QDNA 3EO6A 4DNYA 4LBQB 1ST8A 1VBD2 4H55A 1L7LA 2ZHKA 4YYOA 4NOTA 2PA7A 5FUNA 1CD3G 1NT0A 2BERA 3C7EA 3LZZA 3MHZA 4OVEA 4XZPA 5D1IA 5ANNA 3PVBB 3ZXAC 1UXXX 2E26A 5F1RA 4MG2A 4WM7C 4XF4A 5GZEA 3J9SA 2E53A 3AB0A 1VRBA 4FOQA 3SNMA 2JKXA 1UMZA 4A7YA 2WAAA 2GMPA 2BWCA 3HNYM 1FAYA 1PGW2 2G1MA 2WN3A 2ZGRA 1DQ0A 1NCRB 4LBOA 3M3EA 4IERA 3S30A 4JKLA 1QY4A 1R1A1 2GC3A 4JHTA 2OUHA 5L7OB 5FYTA 2MPFA 1G9DA 1K5MB 2HLEA 3P1IA 1JZ8A 3DPRA 3JB4C 2XBO2 1YFXA 2ZX1A 1I9RA 1S0CA 5F5AA 4S2GA 5HCHA 1ASJ2 4IE7A 5IUQA 1H8TC 2FDIA 2ATFA 1XBFA 4YM1A 4L92A 1BKZA 5FRAA 5K0UB 4R4ZA 1C28A 1BLZA 2O14A 5FYMA 3WUCA 3CLPA 3AL5A 1H8VA 1VB2A 2XONA 2BVBA 1OVSA 1VP6A 2V73A 2WAOA 1JH5A 3E5XA 4R9BA 4AI8A 1ZZ7A 2Y0OA 4QXCA 4BU2A 4CCDA 4GIQA 4Q27A 1YO8A 4IEYA 3ALQA 4Q4Y1 1CAUB 2OVUA 5ANQA 2XJSA 1PVC2 5A3OA 4XDOA 1F2NA 1POV0 4MGQA 2E63A 2WFF2 5EQUA 3U4SA 2W1QA 1UKGA 1WUVA 3POGA 5FZEA 3UT0A 4CCNA 1LAJA 3T2TA 1KEXA 3FZ3A 1AVBA 5JXHA 3H3ZA 2E7AA 1J1TA 3I8TA 4XFCA 2F17A 2WO2A 4UYBA 4Q0QA 2Z5WA 5IVYA 1YJKA 2DFBA 1W6PB 3IIAA 5E8AA 2ZGTA 3O0WA 3N9OA 4EJRA 4K1ZA 4OFGA 4QGLA 4QX3A 5LW9A 3LDBA 3VD4A 1F8VA 2Q8OA 1MS1A 4S2FA 4Q26A 4XURA 4YM2A 3G6JB 1VJ2A 1W2OA 1AL22 2TEPA 4AFMA 3HBZA 4HVQA 1X9PA 3EYPA 4UW6A 1CVNA 4ZPIA 2XLGA 4GJYA 4Z07A 4NHLA 3LSDA 2RJLA 2GMMA 3VKLA 3AMPA 2PLV1 1LGBA 3TN92 1R1A3 1W99A 3O1UA 4XBQA 4HPKB 4QB6A 3ZYGA 1C1LA 1KFUL 2R041 4KWJA 4D3WA 1JZ2A 1T6BX 4A2UA 4Y1VA 3POFA 3UETA 3OBRA 3OYWB 1AJKA 4LBQD 4CUAA 3DGTA 1OSGA 4CVUA 1LJ7A 3NVCA 4CDWB 5EIYB 5FY0A 2B7YA 1JZ4A 4MOAA 4UF0A 4WVMA 1GV9A 2JX9A 3J7MA 4XUPA 5FBZA 3ZN6B 1PZ7A 3GJBA 4HFSA 3IBMA 5M0TA 5EHDA 4KWLA 1W8HA 2DCZA 5TSWA 1DGWX 2W68A 2BQPA 5JOZA 3ST7A 2JDYA 4BQ3A 1ULGA 3PIJA 1ACCA 2AC1A 5FZHA 2P6HA 1OOPB 2EXIA 2VCAA 4Q4Y3 1VBB2 2LROA 2ZMNA 2YFUA 3DECA 1QF3A 4XTMA 3VDDB 4N53A 3WZ1A 4Y1XA 4CEYB 2W87A 3SHRA 4XFBA 2OKXA 5IVBA 3CU7A 1BCXA 3WNPA 5ISLA 4N9IA 4CCKA 4L11A 3ASIA 3VBSC 4OZXA 1NX9A 2VOTA 1VALA 4QQLA 4BQ4A 1HRI3 2D98A 2BRTA 1QXPA 4IQPA 3VL9A 1AR82 1N1YA 1YFUA 2QQJA 1C5HA 3B9CA 1OPMA 2NMOA 3EQEA 4AVAA 3M7AA 5T54A 3KV9A 4HSLA 3THCA 1ULDA 1Z0HA 3ZYHA 1QHDA 2B9VA 4L99A 4LKEA 4QDQA 5FWJA 5J7MA 5LRSA 4XW3A 1HQLA 2VOVA 4BISA 3POIA 3WDUA 2QUOA 1U12A 4KH9A 2VXJA 1UOBA 4GZ9A 3M8LA 1KRIA 4Y22A 4GH4A 1CJDA 5F9TA 1JTZX 4X8PA 1I1EA 2JICA 5DPNA 1CX4A 3T1LA 2HWF1 2Y38A 2A3WA 4YVWA 1VMJA 1W2AX 3GZEA 3VGIA 1CR7A 1JHJA 1W2NA 1YJLA 2IVIB 3P5BA 5LEKA 1DP0A 3VZMA 1GSLA 1XE0A 4UT5A 2R043 1WLTA 1TMF1 2VVEA 3AMNA 3RZMA 1AR61 2CNAA 4XIKA 3K4AA 4Z92B 5EV7A 1OH4A 4DXRA 4AGRA 3THPA 1KFXL 3VHRA 4AZZA 1IS6A 5F6LB 4QPIA 4Y24A 5JWPA 4F8AA 3U78A 3EB7A 4BQXA 3B5LB 1E57A 5F5IA 5KC6A 4OLLA 4COYA 1SLAA 4K8FA 3BOWA 5D2AA 4BZ4A 1SCSA 2D7FA 2G9GA 2PMWB 1X36A 5G05L 4KU7A 4XVHA 5C9AC 2SLIA 4HMZA 5JLVA 3PUIA 4UW4A 1ASJ1 1JODA 1NCQA 1RUG1 2YXSA 2VULA 1JW6A 2WFPA 3B7MA 4OI4A 1WMEA 2D44A 3RPQA 1CZTA 4ASLA 1LHWA 2RJ2A 5KXBA 1V6NA 4DS0A 1MS0A 3JQWA 4MV2A 2G19A 4CXYA 1V70A 3H3UA 2W1UA 4P9YA 5J96B 1AX0A 3UGHA 3WDXA 2P17A 1BQPA 1HLCA 2VNVA 3IPVA 4FTBA 2R062 3MW2A 3VBFB 4Z2WA 3VHNA 3ENRA 1FPN2 1PVC1 2ZS6B 4YZ3A 1G86A 3AYAA 2WFF1 1LENA 2ZGLA 4UWDA 5ACA2 2QQIA 4ISQA 3MV01 4YW6A 1WBFA 3OD0A 4QGMA 3U4XA 2JB8A 5FIXA 1QWRA 3WQBA 5BNPA 2W46A 3VUOA 3ZPYA 1A8MA 2RR12 1VBD3 2VECA 2ZACA 4FXGB 5EJ1B 5CAZA 1DQ4A 2F6BA 2ZHMA 3KV6A 5GKAC 1W0NA 3WW4A 3ZM8A 5K9YA 3ZMNA 2BU9A 2R0HA 3I59B 3IDBB 1JZ6A 2PXJA 4Q0UA 3N3HA 4BXFA 3DKQA 2QTWB 2D43A 5FLJA 3OTFA 4IV3B 1B09A 4ARXA 2YGLA 4MXWA 3MLJA 2NM1A 3WY6A 2MNGA 4Y1ZA 5JZGB 3WCSA 2BW8A 3W5NA 3FC0A 3B02A 3H1WA 3E6CC 2KXLA 2XJQA 3POYA 4K7JA 1HIXA 4YG0A 3ZFGA 2NP0A 1OQEA 2DVAA 3R4UA 4Q8LA 5C3RA 3AYDA 4QX8A 4PQQA 2OPWA 3FFQA 5L9RA 2AACA 3GGLA 2XBO3 1E5RA 3IZOA 1MZ5A 4Z82A 2JDAA 2UWCA 3N4MA 1ASJ3 2IFWA 1H1MA 2Y64A 3B3QE 5EJ3A 4O65A 2B9UA 3UESA 2Q1MA 2EIBA 2X29A 4H7LA 4RD7A 5DDJ1 2GNMA 2ZX0A 4OUMA 2D6MA 1UO9A 5FYZA 5HCBA 1S55A 4PIXA 2ZGNA 4CA9A 1V6KA 2VPVA 4Q8KA 1Q8PA 4PT6A 4ZZ5A 4QHZA 4B4RA 4JGZA 5JIUA 1J3QA 1NE4A 2QQLA 2CWSA 1UWWA 2WZPP 5IVVA 3CO2A 1PVC3 3ZFEC 1WA6X 4NAMA 4Y33A 2VD7A 5C4WB 3PJYA 2DDUA 3LEKA 3UJOA 1LKNA 3KVBA 5KXCA 1R082 2EXHA 2QZ2A 3ZPOA 3RDIA 1YCIA 4S2HA 1MEC2 3IDAA 1WGPA 2JDUA 3GBFA 4FPJA 5FTTC 4ATEA 3B01A 1W8WA 3ZN4A 2PELA 2RDQA 4IEZA 1AR81 2CTVA 2ERFA 4FTEA 1O8PA 1LRHA 4OI1A 4CDUC 1CAVB 4UFKA 2XL9A 2D6NA 3N9PA 4BJ0A 4QPGC 1DZRA 1CESA 3DN7A 2N7GA 1ENRA 1UL9A 1UPIA 5IW0A 5C5UA 1OKOA 2W2IA 3EXUA 1AL23 4ZKTB 4AE2A 3LWCA 3T2QA 4FTSA 1AYM1 4QX2A 2CAVA 5F3IA 4DOUA 1O4YA 1GU3A 5JXGA 4I3GA 1LHOA 2J1TA 1BEV2 5FOBB 2P3JA 1P8JA 3WQ1A 2P4EA 1HB2A 3EHKA 3PUAA 5LBCA 3TN93 3WQ0A 4MUVA 3B9IA 1W9YA 3NMBA 4M0NA 4SBVA 1H0BA 2B45X 4FBFA 5FO7B 2WT0A 1NCRC 5FZLA 3H7JA 1MS5A 4IGQA 4LXLA 4CPBA 3JBG1 3AL6A 5FYBA 2LTNA 5DMYA 2XH6A 1OMIA 1L3JA 5CADA 5L7OC 2JIGA 2W3JA 1K5MC 1XNTA 4LIUA 2WBKA 3ZYPA 1UMHA 5I0DA 4LLOA 4NIIA 1SBEA 1GP5A 4MHUA 1JYXA 1NG0A 3NW4A 1LGNA 4JGYA 3JQXA 4C1XA 2QQPA 4AVBA 1F31A 1W8UA 1D0HA 2Y0IA 2C24A 5K0UC 4K21A 1U5ZA 1VBB3 4GMP0 1WA4A 1GWLA 1ZYBA 2VW0A 1O5UA 3AYCA 1BXHA 5J98B 3ZXDA 3FN9A 2DCTA 2ENRA 3LQCA 3OY8A 1DLLA 4CDQA 2RDNA 4RHV2 4OQ8A 2YU1A 3FLPA 5A7NA 2JG9A 1CGPA 1RUH2 1M4WA 2PHWA 1LR5A 1X50A 1RUC2 4LUKA 2X10A 3K4DA 4FPLA 4QQ2A 4WM8B 3LD8A 4YW7A 2FDKA 1AR83 3D0SA 1FPN1 1DBNA 1OA4A 2ORXA 5JSPA 4AHWA 4CZSA 4IEXA 3NJZA 3TAYA 5FP7A 4COUA 5C8CC 1Q43A 3OPWA 3J7LA 1RINA 5LK7B 3ZXLA 2CHHA 3RG0A 2Y6JA 1PMHX 1CZVA 1U0AA 1S0DA 1UYZA 3JU9A 3QLQA 3RWKX 1YFWA 3POJA 4ZONA 5FYCA 4XUOA 1UQXA 5DXDA 1QOTA 2WZEA 4B8EA 4BQ1A 4DZGA 1N47A 5AC92 4HK9A 5FP4A 2GU9A 3KCCA 2D6KA 4LBJA 4NRMA 1BHGA 4PDWA 4KNCA 3WNMA 3U14A 1C4RA 4YM0A 1RJ8A 2RE9A 1SHWB 2K0GA 1AX2A 1J84A 4XQWA 1YIFA 1OHFA 4YFWA 4AVCA 4BK5A 2J1VA 1IPKA 3W21A 4DRVA 4AHYA 1STMA 4XFHA 3DXTA 3WDWA 4DINB 3CJIB 4LIVA 2FCUA 4CU6A 1XU1A 1JU4A 5D8AC 3KGZA 1ODMA 4R9CA 4YW5A 3IIIA 2IC1A 1W9SA 4AI0A 4FXKB 3LFMA 1ZREA 3UKVA 3V0AB 1LOGA 1DQ2A 1T6GC 2BNNA 4BXSV 5A3WA 1TME2 3NO8A 3TYJA 5IAXA 1LU2A 2RMU1 3E5UA 2ZHNA 5BNNA 3T0AA 5I0UA 2WL1A 4FT8A 5A1AA 1N1TA 2R063 5FMDA 2Y6KA 5BNOB 4CEYC 1FPN3 3HT2A 5A3LA 2Y8KA 5FY7A 4R9DA 1UY1A 4W50A 5ACA3 3I2OA 2VOXA 4YZ2A 1R081 1FNYA 1WBLA 2X5IB 2WYSA 4BIFA 4KGQA 1C8M1 1QNWA 3J7HA 3MIDA 2RR13 1MEC1 4LHNA 4QU1A 4YW3A 5FZ1A 4Y3OA 1XC6A 4HKLA 4NVPA 1SLCA 2X09A 3VBSB 3ZFFA 4E8CA 1LOFC 1F35A 1ZRIA 2J1RA 5DN2A 4PHZA 2BZDA 4AR2A 2GNBA 2ZEZA 4UBHA 4RSUA 3SITA 4E4DX 5A70A 2ZGMA 4QWNA 1VAMA 1RL3A 1SCRA 4D6SA 5KXEA 2VC9A 3FHIB 3O14A 1BVP1 2YV8A 4QM9A 5LZ6A 2GC2A 3I2KA 1CIYA 1ZZ6A 5APAA 1E5IA 5F5QA 5IYYA 5J09A 2TBVA 2C5DA 1MQTA 5DUUA 3VD3A 3X29B 3LDKA 2TUNA 1BEV1 3AX4A 2KA3A 1KDMA 2ZA9A 1VAVA 1ND3A 1DGWA 5CISA 1HQNA 4XAEA 3IDCB 2YPDA 4Q0PA 2YC2A 4GXLA 1DFQA 4WM7A 3PVEA 3ZXEA 1VMHA 4A6OA 2IWGB 3K4ZA 1I6XA 3MEPA 4PLMA 5IFTA 4Q1PA 3H8XA 2B42B 1BYHA 4PLNA 4YW1A 4E8DA 3J8F2 5CFCC 3M3QA 4LITA 1AX1A 4XF0A 3WNNA 4A42A 2YBPA 4R4XA 4CU7A 3URFA 3HMYA 2YMZA 3IN9A 4Q4X1 2W1WA 4W6YA 5JPMB 1COV2 1KGYA 2VUDA 3VBHA 3ZR5A 5GLUA 3E6BA 4E4ZA 3BPZA 4ZY9A 4FPGA 3GZTB 5C9AB 1AF9A 5KWRA 4FOWA 1PNFA 1JYTA 4CEWC 5E1RA 2BWAA 1W6QB 2MEV1 3U07A 1S0EA 1D0GA 1GR3A 4D7YA 3DYPA 4NIAA 1H8TA 2QQNA 3WF1A 4CTEA 2PQSA 2QBXA 3TEZA 1GQPA 2XVKA 4Y5Z0 2ZGPA 1OURA 5GLVA 4LNVA 1JZ3A 1RUH1 3CNAA 2VZTA 4L9BA 4LBKA 1CPNA 1MEC3 1RUC1 3T0BA 1LU1A 3VD7A 1XYPA 3LCPA 1S2BA 1TG7A 2GP5A 2J1EA 2V5DA 1UZ0A 3MO4A 3BALA 1KD7A 1W8NA 3ZXFA 2JWPA 2VQUA 2Q8EA 1QMJA 1URXA 4HN0A 4QKFA 3TOJA 3MYXA 4QX1A 2XXZA 5FKBA 2RDSA 5FQ0B 3V0BB 3R6SA 1WCSA 2X53S 3KB5A 4Q1RA 3ZSKA 1BEV3 3H8UA 4Q4V2 4NJ4A 5FUIA 5AC91 4IV3C 2XJTA 3ZR6A 3V56A 3AJZA 1RB8G 2OXBA 2ZGKA 4B4QA 1VBE2 1NQJA 2GZWA 2WWJA 5FYSA 4I01A 5JZGC 4NROA 5JCTA 1AJOA 3KHBA 2W94A 4OULA 4B7EA 4DPNA 5A7QA 3MUZ1 1W03A 2DCYA 2BOIA 1C1FA 1KJRA 3LEIA 4JQTA 2NYYA 4LR4A 3AKPA 1QNYA 4INDA 4P5HA 1DGLA 5FYHA 2PLV2 3CF6E 3MIGA 1OPOA 2W91A 4LK7A 1WCQA 4LKFA 4MH0E 1MZ6A 3C8XA 1ZBE2 2VZPA 1JZ7A 3OBZA 1GZCA 3TWIA 4MGSA 5C6CA 2A5ZA 4AEDA 3RMXA 3RZLA 2WWUA 2L9LA 3A22A 5D21A 3VBOA 3WG1A 2G4IA 3RJ2X 2RHPA 5IVFA 3M4FA 1O59A 2BNOA 2XUEA 4RHV3 5CKQA 1V0AA 5B4NA 1C8NA 2ZABA 3NL1A 3MICA 2X05A 4M3CE 3VBRC 1RUH3 2VL4A 3PUSA 2DWRA 3ZLIA 2J1AA 1NXD1 1RUC3 4IE0A 5FCCA 3VN4A 5A33B 4XACA 4B1LA 4N43B 2PAKA 1ZZBA 1W39A 1Q5OA 3INAA 4K40A 3VZOA 5C3OA 3ME2A 4Y26A 3ELNA 2OT7A 1UIJA 4XJ9A 1B35A 1IS3A 1O3SA 5A6XA 3ZFEB 4WVMB 1OLQA 4YW4A 4XFIA 1HW5A 4M00A 5T5OA 2JE7A 2FHRA 4YLZA 1GOFA 1S0JA 1Y3TA 4V2WA 3ACLA 1LOAA 4RA0A 2JEMA 1YHFA 1R64A 5ABJC 1O4ZA 1ALYA 2AYHA 3NNLA 5AC93 3I2IA 4DUXA 4EN0A 4LT5A 5FO8B 5J48A 2VNRA 2WABA 1UY2A 4WZCA 1V6LA 5SV5A 2Y6FA 5IT6A 2I2SA 4YG6A 5DG1A 3C3VA 1VB4A 1HV1A 1WW4A 2BGCA 2OIIA 4QPGB 1UX6A 3AVRA 4XDPA 5FPVA 3VBUA 3KQ4B 4F7ZA 2EIGA 4J25A 4GB32 1SLLA 1DYOA 1SLTA 1Y9GA 2HWF2 4U36A 5FYIA 3S6PA 1CWPA 1Q56A 5T52A 3HN1A 4QPWA 4QQHA 2QNKA 3LKJA 1SEFA 3K77A 2VMIA 3HOBA 5I8YA 1TMF2 1KDKA 1XE7A 1JHNA 3O1RA 1AR62 2YBSA 5F5CA 3WUDA 5B4XA 4O9EA 3ZKUA 1TZOA 2LS6A 2VQ0A 2OPKA 4XEZA 1F4AA 2FQPA 5CFDB 4XJAA 3MUY1 2QQUA 4GH4B 1VBC1 2RV9A 3J8F1 1ZZ9A 4X6RB 1UOGA 1IG0A 2GNTA 2VCCA 2ZBJA 3FFZA 4RS5C 1Q8QA 5IK7A 1TME3 1JZ5A 3IM0A 3K2OA 3WF0A 1COV1 3CJXA 3M3IA 2FCTA 5LY1A 5DAVA 5LY2A 2WNEA 3FHQA 3ILNA 1AHSA 3NKGA 3WT3A 1RUG2 4YNIA 1IHMA 1O6UA 5GZFA 1QJFA 2PTMA 4DXTA 1TEIA 1ONAA 2QQMA 2UU8A 2ZZJA 3LPFA 4P14A 2XJUA 4QPIB 3KQRA 4WM8C 1IKQA 1LGCA 4ASMB 3KCXA 3LEGA 1PGSA 4MXVA 5FMOL 3U10A 4E27A 5IK5A 3RQ0A 1LODA 2XVLA 2OQ7A 1FV3A 1W6NB 2RM22 1TVGA 1JMUB 4FFHA 1GZ9A 4IEQA 1GOHA 2HWB2 3NV2A 1EP0A 4I30A 4EN8B 4NR1A 3KGLA 4DXSA 1O4TA 1NCQB 1WCKA 3ZYRA 2YPJA 2BV4A 4QDRA 3WLUA 1O3TA 5L9BA 4EQVA 3MF9A 1FATA 2KM2A 4P9XA 3U75A 4XF1A 5FZ4A 5K8SA 1PVXA 4TSVA 1D7PM 1GZWA 3PU8A 1U5IA 2VUAA 5FBJA 1S0FA 4Q4V1 3HAGA 4XMIA 2CV6A 4AQTA 2VMHA 2WRAA 1VBE1 5A3PA 3D5OA 1PMJX 5J36A 1DF0A 2ZOEB 4D6QA 1F5FA 1OLME 1MZEA 1PM4A 2A6WA 2ZMKA 4NPMA 4C0BA 1W3XA 2VXRA 2DCKA 5FZIA 5LASA 4AFCA 5FXZA 2YB7A 3SEPA 5J1XA 5HXVA 2GNDA 3BPSA 3AKRA 2JIJA 2WIIB 1UN1A 5F37A 1RVF2 2ZEWA 2PN5A 3CJIC 3J8F3 2ARXA 1PZ9A 3DEMA 2A6YA 1ND2C 3TNPB 3F2ZA 4FPFA 2Y6GA 3MFCA 3UV9A 3CDZB 5HBAA 1ZBE1 1WW6A 4O61A 2VR4A 2RG4A 5DABA 1W6OB 1COV3 1Z78A 2ZAHA 2OZJA 3KS7A 4J6GA 4MLOA 3CZUA 4ZZ8A 3LFIA 3S5AA 1H4GA 5D8AB 3VKFC 3OPZA 5SV8A 3MIHA 1OUSA 2VZRA 4K6BA 4PQ9A 5L9VA 4UFHA 5DDJ2 2J42A 1HRV2 5FY4A 2IXCA 1PM7A 1G8WA 4AVVA 3VDBA 2RJKA 4ZU7A 1TE1B 4RGGA 1JN2P 3ITQA 4IE5A 4M3CA 5BNOC 2RS32 1DZTA 2WT1A 3BCWA 4FFFA 5FY9A 2ZMLA 4RFRB 1W6MB 2VCBA 4GWIA 2X5IC 4FPEA 2ZGQA 4GWMA 3D4KA 2A6XA 2LALA 1OH3A 2VZSA 1ULFA 3HIFA 2K2SA 1QGLA 4Q2FA 2GC0A 2AENA 2XOMA 3ES4A 3N36A 1UYXA 3DKWA 3T08A 2DFCA 4Q4V3 4GAZA 1NA1A 1XE8A 4JAAA 4RQPB 2CYFA 4AVTA 5FZCA 2GH8A 1QQP2 1PK6B 2E6VA 1VBE3 3MF6A 4CDUA 1GWMA 3WF3A 5LEJA 3JUUA 3A23A 1I3HA 2XDVA 3H1YA 3U11A 1JYIA 4Y1YA 4CUGA 5I8TA 1AYM2 4HVOA 5I93A 3GZAA 4GB31 2W0XA 1CZSA 3QBQA 3W5MA 2XUMA 1D2QA 4JDMA 4A44A 1UOJA 2SBAA 4LBMA 2PLV3 4YZ4A 3W9AA 4CUCA 2QDRA 1GBGA 1FYUA 1S0GA 2UY9A 2J7MA 5LCWL 2VUCA 1EAH1 4QT6A 4P5YA 5AVPA 4BLIA 4F83A 2HEYF 4DUVA 3ZYIB 3A0NA 1ZBE3 3KCYA 4D8MA 4O7XA 4P08A 1J83A 1A8DA 1J3RA 1XYOA 3OUHA 3JBG2 3VHPA 5HV4A 2JDMA 4AI1A 3A0KA 4BE3A 1S2KA 1NKGA 1X8MA 4R8HA 3WD5A 3VKOA 2R32A 5JUVA 1ZA4A 2B5HA 5CFCB 5L7OA 2UWAA 2K9ZA 3WR0A 3B94A 1K5MA 3LPGA 5T5PA 4AXOA 1W90A 1MVQA 1DG6A 1OD3A 5FZFA 4HKWA 4KQ7A 5H9SA 2XQXA 4META 2E9QA 3N9QA 4OHWA 1CX1A 1W8OA 3BU7A 5K0UA 3OGSA 1WLDA 4CEWB 5AFBA 1SFYA 1ZRDA 2A3XA 3FBMA 3R4DB 3B69A 2ZGUA 3BU0A 4FAHA 2RM21 1DIWA 1H6XA 2DYCA 4LKSA 4A7ZA 1RUOA 2EIEA 1W9FA 5GM0A 2HWB1 1CAUA 1CN1A 1JXNA 3A7QA 1CAWB 3O0XA 3MIEA 4BQWA 3AZVA 4OYUA 1EUTA 3T30A 1C5IA 1LOEA 1W8ZA 1RUE2 3OJBA 2W95A 4FP3A 1ZM1A 4H14A 1HB1A 4JTNA 3SKVA 1IQDC 2ZKLA 5J3UA 2AR6A 4LMFA 2J1UA 4Q4W2 1SACA 3I54A 4UBGA 3ZSMA 2BEOA 5LBBA 5C70A 5LWBA 4GB33 1HV0A 2YDEA 3GZUC 2HWF3 4NHXA 4NIGA 3OBTA 3RMYA 1NLRA 1W6PA 2ORZA 2R071 3MV11 4K3UA 1TMF3 3BIWE 4H3WA 5CZKA 1AR63 1V6OA 2QZ3A 4FVVA 3AMQA 5JOWA 1OF4A 2DU0A 2JDKA 1LHNA 1OLMA 3NAPA 4XJ8A 2IXHA 4SLIA 2XMLA 2YBKA 3JZVA 2A6ZA 1YI7A 1RC6A 4XFAA 2ETEA 1RVF1 2HWC2 2XWJB 1QU0A 2XKOA 2YG0A 5FK8A 4HXCA 4QHOA 1SMVA 4HPKA 4W8JA 5IK4A 5JOYA 2VZ3A 4HT1T 4LBNA 3OCPA 5FWEA 1CAXA 5H9PA 4IEOA 3T4HB 4DMIA 4CCMA 1EPZA 4ES9A 3OYWA 3ATGA 1DGRN 5IJRA 1K12A 5FLHA 2BFUL 3IT8A 1POV1 1RUG3 4CDWA 1BK0A 3UGFA 5FZAA 2OX0A 3I3EA 2DCJA 3NJYA 3VZNA 2UURA 2WC2A 2Y26A 3ZN6A 3HVDA 4QKDA 3RYPA 1HRV1 5I8SA 2OQ6A 4N43C 4YGEA 4BWOA 4KG8A 2B8MA 2RMU2 2RS31 5DAXA 2RM23 4CDXB 3VBRB 4NWVA 1N3OA 4WVVA 1OOPA 5JOXA 2HWB3 1SQ4A 1UU5A 3GDBA 1RUD2 2WFF3 2WQ8A 4LA3A 1UZVA 3LGRA 1Z7S1 4MVTA 4Y20B 4YVSB 5FZOB 3VDDA 2XKPA 5FPLA 4QAWA 1VLNA 4CEYA 1MPXA 1C8M2 2P3IA 3K3NA 2VNOA 2W5FA 2A3YA 3TBDA 3UNPA 4PIYA 5FYVA 4HG6B 4HN1A 2FD8A 3O1MA 3G7DA 5DZGA 3LB9A 3RYKA 1HQWA 1W2UA 2CDPA 3AMMA 4G4FA 1XNBA 2PFWA 4Q5OA 4GWNA 3PURA 1GNYA 1HB3A 1QQP1 1XB9A 4UW3A 3OB8A 1GWKA 4CPBD 5ABJB 1ULCA 1UF2C 2QQVA 1LOFA 4AGVA 3RRDA 2YZ4A 2VBBA 3S7EA 4RN5A 2WNVA 3QH7A 4AEJA 5BUVA 2EAAA 5JIAA 4JQRA 3SMHA 3ZO0B 1JYWA 3K51A 1C57A 2WN2A 1J1LA 5FJKA 3ROUA 5C8CB 4ZS2A 2ZEYA 5B2GB 4FSJA 1SLBA 5FZ9A 1VRH2 2BTVC 1RVF3 2HYKA 4GALA 4QX0A 4EV0A 5C71A 2R6QA 5KR7A 4BMEA 1AXZA 4CCCA 2VZQA 1GUIA 4OQ9A 4Y4RA 4N9HA 4EN9B 5DUXA 2XGXA 1TNFA 3R0RA 2R30A 4X6QB 5CFDC 3NWKA 4GH4C 1K3IA 2UYBA 4RR3B 2FMYA 1E5HA 4B1MA 1BJQA 1US2A 2H0BA 2H6BA 3L2HA 4HONA 5L36A 1POV3 2VJXA 5FPZA 4DO0A 1OD5A 2VMEA 4YVWC 5FXVA 2D93A 3SH3A 1EV12 2P37A 4XQ4A 5DDJ3 3PJQA 3FWEA 3V64A 5FP3A 1HRV3 3LA2A 5A32B 3AZXA 3I3DA 3USUB 2Q1ZB 4Q4X2 2VCMA 4RS5B 3N9MA 2C0ZA 4XC9A 1OBNA 2RS33 3SISA 5KHJA 1Y7BA 2C9AA 1VMFA 2IXIA 1D2SA 1JOBA 3NNFA 4L2NA 3WF4A 3MIFA 1POQA 2WZR2 4QPIC 4AI2A 1SPPB 2W52A 3R4SA 4ONUA 5I0RA 3H8RA 2A75A 4PI0A 4XUNA 3QH6A 2MEV2 2ZTNA 3IAPA 1OFSA 5GLTA 3CHXA 5FPBA 3T1MA 4D94A 4BHPA 3BB6A 1WW7A 2WO3A 3KZ4C 5FLIA 2CY6A 2WLPA 4NO4A 1RHI2 1NCQC 1O5LA 2WYFA 4I0AA 5FXWA 4ET7A 1LNSA 4JVAA 1XXNA 1J3PA 2YGMA 4X8NA 3VBFA 3HWJA 1AR72 3CMGA 3LDRA 2P1BA 4KBZA 4LO8A 1RUE1 1APNA 2XJVA 1RUJ2 1AYN1 2I74A 4Q4W1 4GULA 5FY8A 3ZXJA 1AYM3 4LO5B 1UU4A 3AMHA 4Q0VA 5EYYA 2Z69A 2W47A 3FBYA 3FLTA 3PMSA 3U0ZA 1NZCA 1X9TA 3UKTA 1SDWA 3BGAA 5FP8A 2WUHA 3H7YA 3HN3A 3MGUA 4FPYA 1EUUA 2JKBA 4IESA 4LUMA 4NWWA 1I5PA 5BNPC 2XPJA 1DU3D 1RUI2 4IV3A 1IKPA 1Y9QA 2WO7A 4DFSA 1WCDJ 4E2SA 4JTOA 2Q30A 3KF3A 4KMQA 1UZWA 2QE3A 2AUYA 3JBG3 5K4LA 4J1WA 3BODA 1O3RA 5F39A 2HWC1 1LB2A 2VTXJ 2JG8A 5F3CA 5C33A 1DCSA 4GD4A 4TLGA 5A1FA 3THDA 2DVFA 1NYWA 4XUTA 1WMXA 5JPNB 3F95A 4GKXA 1UZZA 3NV4A 4KWKA 1Y9MA 5A7WB 4IEWA 3UJQA 1ND2B 1K5JA 1Y4WA 1SFNA 2WT2A 1A3KA 2BP6A 1FI2A 1OFNA 1OA2A 3ZXGA 3LSEA 4Y1UA 1QXRA 2WQ4A 3ZFGC 4CP1A 3WP3A 1GQHA 1JYCA 2OA2A 4IV1B 4RFT0 3ETPA 2WQZC 2VGDA 1H30A 3KT1A 3H8OA 1W2TA 1XNDA 3WX5A 2HKXA 2V72A 3CBNA 2ZX4A 3ACFA 1V6JA 3WW3A 1AR92 1F15A 4MSVA 3WW2A 2VBPA 5G04L 4B7KA 1G9BA 3T2OA 2CWMA 4B3NA 2ZJCA 2Q4SA 1RUD1 3KT4A 3RZKA 4PBPA 2DBIA 3A21A 4QX7A 3NNMA 5C4WA 1GZTA 1RUE3 4EN6B 2ZKNA 2LRPA 3EMRA 3DL3A 2WNUA 1U5YA 4F3JA 4Q4W3 2O8OA 1HB4A 4JGZC 4YW2A 4RQPC 1BZWA 2RDRA 2TNFA 3HNBM 3T2PA 1PK6C 4D7SA 1UYPA 5JR2A 2XVGA 1GQGA 1OF3A 2D5FA 3WDTA 1CJPA 1KS5A 3UYJA 4ARYA 2A6VA 4W4ZA 4A7KA 3WNKA 2Q8DA 5JMCA 2YYOA 3CZJA 1TQ5A 1ZX5A 3SEEA 4XJUA 1B35B 3RSJA 5JDBA 2CL2A 4AEMA 3U37A 4HL0A 3K3OA 2FDJA 5FPAA 4AFAA 4CP9B 4DY3A 5JI9A 3RZJA 4E4HA 4PCRA 3KLSA 1VRH1 2HWC3 3MLLA 3AP7A 3ZSLA 2XR4A 3NNJA 4ZS3A 3ZOIA 5KBFA 3VLBB 3Q8AA 2DUQA 2A70A 1Q8OA 4Z8BA 1LTEA 2W1SA 4IE6A 1WD4A 3WXPA 2GMEA 1RUF1 1GNZA 5CA6A 2VZ1A 3WNXA 1JBCA 1GLHA 4CU9A 4Q0SA 2ZEXA 3WSOA 3WCRA 1VBC2 1WLCA 4QPYA 1EV11 1UCXA 5FYUA 2IUWA 3ILRA 4CU8A 4NUBA 2VMCA 4JV4A 2XG3A 5DUWA 2RMU3 5A1LA 1VBA2 4PF1A 3AP4A 4AYUA 1PNGA 4C8DA 1QJEA 4IEUA 1H2NA 3W59A 1PMIA 2X8KA 2WZR1 1S0IA 2CAUA 5BNQA 1UY0A 5DZEA 1QOOA 1VPHA 2OUJA 3LAGA 3RYRA 4BOWA 3AKQA 4OUEA 1MR5A 1RUD3 4GKYA 5KHHA 2ID4A 1NE6A 2V09A 4DY5A 1LOBA 1R083 2E51A 2HBTA 1C8M3 1DQ5A 1UNBA 4JGYC 3AZWA 1RGSA 3AM2A 3TB0A 1NAEA 2DV9A 4QQOA 5A3MA 5FAXA 3DPRB 1RHI1 3ZMOA 3AKSA 3D3AA 3WDVA 4YWAA 1PX4A 5T55A 2ARBA 1AR71
chains in the Genus database with same CATH topology
2P3KA 4CDQC 2JJ6A 1OLRA 4HSJA 5GLVA 1MZFA 4HVRA 1MACA 1RUJ1 2JG9C 2VOKA 2ES3A 4OI0A 2DURA 1RJ7A 4AK3A 3TNQA 3E97A 2FMDA 4N7UA 1VRH3 5HCFA 1NY71 4COZA 1RUNA 4I0WB 2XJRA 4P9IA 3FUOA 4B4PA 4ZXKA 1RUI1 1QJZA 4QX5A 4GMP1 3N7LA 3UKNA 4I0BA 1DDLA 1Q3EA 3WQ7A 1BK1A 1FXZA 1IS5A 3NV3A 4E2QA 1EV13 5EFUA 2YY1A 5JSOA 1DYPA 1IOAA 1FMD1 1V9U1 2VVFA 3DF0A 2HJIA 3D82A 5EZWA 4Q4X3 3CJIA 5GZGA 1PO11 5BYNA 3RZZA 1EYBA 5DUVA 3E5QA 1UKRA 4MGYE 2WZR3 3ZSJA 3GYDA 4N7IA 2MEV3 3V0AA 4OI2A 3ETQA 3JCIA 4XBNA 1QH6A 3SH4A 4CDXC 2NN8A 1DZQA 4MGKE 2VH9A 1XNCA 1AR91 2OYZA 4L97A 3KT7A 4KU8A 1RHI3 4YVSC 3MLKA 5BNOA 2QJVA 5BY5A 1AR73 1EY2A 3IMNA 1Q8VA 3D0JA 2G9FA 1UD1A 1RUJ3 2IXJA 2X5IA 4IL7A 4XFGA 1YYNA 1SBDA 5BNNC 4M3CF 4HANA 3THTA 4RL7A 4I09A 3CL1A 3VBSA 2P34A 2YROA 1KJLA 3LA7A 5FOJB 5BXXA 2ZGOA 3V65A 2B39A 2Z42A 5AFEA 1U5XA 4U2AA 1IQAA 4RGAA 2Q5TA 3RS6A 4YG3A 1RUI3 4N53B 2HWD2 3EBRA 3DV8A 4I3PA 1SLIA 3ZFFC 1H9PA 4G3YC 1XU2A 2Q0AA 2QFEA 4BIOA 5LK5A 3HR9A 1RMU2 2BBVA 3AXEA 2YUEA 1EAH2 1W0PA 4RR3C 5HI0A 2EXJA 1G6NA 1SBFA 2ZHLA 3CEWA 3MIBA 2WKKA 5EXOA 3D6EA 3VZJA 1MQTC 1R1ZA 4Y22B 4NHMA 1V00A 4LLFA 4P9LA 3APBA 1ND3C 2UY8A 3POSA 4YVWB 2A71A 4UXAA 1H2MA 1YI9A 1VBA1 2I07B 4IXLA 4WVZA 4MYEA 3N7KA 5T3NA 1AR93 1ENSA 3WOGA 4YZ5A 4DXZA 5C9AA 1LEMA 3M1HA 4XXAA 4CP2A 2D6PA 2DVGA 4XFFA 5CB7A 4LTAA 5KXDA 1QDOA 1W6QA 1X33A 3LOBA 1DQ1A 3MDPA 2PHRA 4HK8A 2AZ5A 1V6MA 2OW4A 2ZX2A 2BNMA 2EA7A 4S2DA 4DQAA 1F5JA 1MS8A 3VBHC 4AQ2A 4QU2A 2RS12 4XOGA 4J1XA 2B46X 5CIRA 3VKMA 1ZVFA 3N7MA 2A73B 1PO22 3V0BA 5FQ0A 1D4VB 2D40A 3AJYA 3GHMA 3IPVB 4WVWA 4XILA 1GANA 3ILFA 1LHVA 2R072 2E7TA 3B93A 2DUPA 3LOIA 4R9AA 3VHOA 1XYNA 4FCAA 1YRZA 4P9JA 5BNPB 3RNSA 2WS92 3GBWA 2D3RA 3J26N 4IEPA 4JC1A 4COVA 2BPA2 4OHVA 1VBC3 4XHBA 4KGGA 4P9WA 1HRI1 3HT1A 2AH2A 4K9SA 4IETA 3PVNA 1VBA3 4W65A 1REDA 1OI6A 3SXWA 4MXWB 4IV1C 2WINB 3NAPB 2P2KA 4XETA 5JI7A 4FPCA 2ZAAA 1BVVA 1QJX2 2RS52 2YC0A 2YHJA 3MW4A 3ZFGB 4JDOA 1DQ6A 2VNGA 3KM5A 5JSRA 1J59A 2R1BA 1IZ3A 2HEWF 4N90A 5A33A 3WHUA 4TZDA 1REEA 1CAXB 2ET7A 4N43A 4AEDC 1PGL2 3UL2A 3VBOC 5AVAA 2GAUA 2DVDA 2D6OX 4FAGA 2DVBA 1Z7S2 3OGGA 3HD8B 3ZFEA 3M3CA 5HCAA 2MHFA 4KL1A 3SCFA 2VU9A 4EN7B 3H50A 4TLFA 4C0HA 4JGZB 4QD2A 3BOPA 3D8CA 3WV6A 1B35C 1LULA 1CIWA 3Q9OA 2HWD1 2HWE2 3PVOA 4LBQA 4QPGA 4QMAA 2XL7A 4MX3A 4XTPA 2EAKA 3MPBA 5H9QA 3WINE 4LBLA 4XHXA 3AK0A 1RMU1 3USSA 3AFKA 1ENXA 4JRLA 4XF9A 3WP6A 3WP4A 3VBUC 2PHLA 3C2UA 2XHKA 2R16A 4HZFA 1ZZCA 4HBNA 2WNVB 2D3PA 3ZYJB 5CFDA 3R05A 1VBD1 1NCRA 4XMAA 1GYKA 4IEVA 2QCSB 4YGBA 4ES8A 3N35A 4M01A 4E9KA 5I91A 3FLRA 1OA3A 2D5HA 3O0VA 3P3NA 1J58A 4EWDA 1FV2A 4XBLA 4E4SA 2H6CA 4XQDA 3NSTA 1PGW1 3OD4A 3JB8A 3I4IA 4EWAA 1R092 2D6LX 3K48A 1OQDA 5CU1A 5K7PA 3DPRC 3ZVXA 1X7NA 1AXYA 1X82A 1LESA 2DUOA 3WG4A 3PNAA 4JGYB 1WD3A 1W6NA 2XBO1 4QQPA 2ZGSA 5GJ6A 3KD4A 2VQAA 1QJY2 2RS11 4PIZA 5GLZA 3PMEA 5C8WA 1AYN2 2HWD3 3OY8B 4CDQB 1PO21 4LULA 2IXKA 4XPVA 2JG9B 2FZ1A 4XXPA 4AVSA 4R52A 4QXKA 1RMU3 1EAH3 3VZKA 1XRUA 2NPIA 2Z2SB 2WS91 1QKQA 1HKDA 4YZ1A 4FQ4A 1PZ8A 3RJRA 3I2DA 5FFOC 4I2OA 3AKTA 1N1SA 1N3PA 4MZUA 3AYEA 5I0SA 3WP5A 3B00A 2UWBA 3RI8A 1W6OA 5L73A 4FPOB 1YIPA 1DYKA 1AL21 3H9AA 4PDWB 5D8AA 4DRRA 1PHMA 4LO6B 1CONA 3WW1A 1QJX1 2RS51 2JG8B 1NXMA 3TN91 1C3HA 3GF6A 2O1QA 3QOPA 3WHTA 1PGL1 3M70A 1NOVA 1QOSA 2RS13 3IDEA 4YGCA 1W6MA 2VW1A 5KHGA 1X8EA 5F6KA 4I02A 2EF6A 1VAKA 5BPXA 2PHTA 1G9AA 1PO23 4AWDA 2XLFA 4BH9A 4NN0A 2Z79A 4AG4A 4AQ6A 1KQRA 4FPKA 1A6CA 2GALA 4AW7A 4D69A 1DGRA 5BNNB 2CGOA 2JXAA 2VVDA 4RQPA 4N53C 4HETA 1QH7A 3JD72 5KC5A 1VBB1 2R073 1PK6A 4WBBA 4WZFA 4DB5A 4YSFA 5E16A 2HWE1 2PHXA 1HX6A 2WS93 1KXGA 2WNUB 4M0HA 1YNAA 4TWTA 1OKQA 1NA1C 1IGOA 4PBOA 3ZFFB 1H4HA 1VIWB 1BBT2 3L2YA 5FMOS 3VZLA 1UU6A 1HXS2 4XYXA 4QGNA 1RUF2 5CG8A 4FP2A 1JUHA 3FJSA 2DF7A 4B29A 3IWZA 4CYDA 3KMHA 4CP0A 2WA4A 2DTWA 2WJSA 1MQTB 1QJX3 2RS53 2JENA 3VL8A 1HDKA 3OGJA 3ECQA 5CNAA 2W08A 1S1AA 5CFCA 1ND3B 4AHXA 5FPXA 3EJKA 2WSVA 1QXJA 4O9GA 4WM7B 5BV6A 3FUQA 1LECA 2W39A 3AP5A 4G9SB 4XF3A 1MVEA 1R091 1Z7S3 4ZU5A 4XJZA 4OHXA 4FQZA 4CEWA 3S7IA 5KHKA 1ZRFA 1JOJA 4XE9A 2XJPA 1OQ1A 2PYTA 2GDFA 4Z1VA 2PAEA 2FZ2A 1EPWA 2D97A 1BMV2 4ZU4A 2DU1A 1QJY1 3VBHB 4WV8A 4XJWA 1QQP3 2V5YA 1CAWA 2GN7A 2NZ9A 5GZDA 1XQNA 3GNEA 2PHDA 4LA2A 1S0BA 1D4M2 2IXLA 1LCLA 1NLSA 2DTYA 4D7TA 4MGIE 1G7YA 1H8TB 2HWE3 3QD6A 1MS4A 5E89A 5I0TA 1ZBA2 3S0MA 1ULEA 3J4UH 4AI3A 1RTVA 3I59A 2EXKA 1NY72 2NMNA 4OHZA 2NQYA 1UAIA 4D94A 4W6XA 1G9FA 2XWBB 2R061 3MZHA 1H9WA 3MW3A 2XB6C 1I5ZA 1KITA 2R0FA 3UK9A 5ACA1 1FNZA 4PF5A 5FO9B 3O7OA 1N3QA 5JZGA 1QJU2 1FX5A 2JDZA 2VW2A 4XDQA 2RR11 3GBGA 1ENQA 1PIV2 1AXKA 1AZDA 1YXWA 3AP9A 1FMD2 1V9U2 3BTAA 1ZZ8A 1UPSA 3HQXA 2LM3A 2ZX3A 5JAXA 2BYVE 4LEJA 1PO12 3NAPC 3WVJA 4JCKA 3ZIWA 3NKTA 1FOD2 3AZYA 1MS9A 1YLLA 4KG0A 3AXDA 2WLQA 4NHKA 4AEKA 5J37A 1GICA 4K1YA 3WG2A 3M3OA 1R093 2R1DA 2CGNA 4HKOA 3PTYA 3POWA 2PHUA 4UW5A 3FMGA 3SCGA 4KBBA 4CDXA 2IZWA 3VBRA 4AQSA 4C91A 1DHKB 1UW8A 4CDWC 1QJY3 4W6WA 5FDBA 2PAMA 5IK8A 4AEDB 4YARA 3ZXKA 4Y20A 3VBOB 1CQ9A 3O5SA 4QHBA 1KS4A 3H0OA 4YVSA 4EWEA 4URTA 2XLAA 4LE3A 4FO9A 1AYN3 4Q29A 5CVRA 2ET1A 3FE5A 1F9KA 4CRQA 3ES1A 1OOPC 3MPPG 1CAVA 4FOVA 3SH5A 5CBLA 3JD71 4QM8A 3VDDC 2E7QA 4FPHA 5ABJA 1O91A 2ZZQA 2C1FA 3ZDSA 3A4UA 4JRAA 4V1PA 4C1WA 5C8CA 1IPJA 4H7MA 3VV1A 1YFYA 1BBT1 2GSYA 1GFF2 1H2LA 2OZ6A 3GHNA 2WNVC 1HXS1 3I7DA 4YGDA 1M06G 1YWKA 2O8QA 4RR3A 3P3PA 4GQ7A 4AFDA 3VBUB 4BPZA 2PHFA 4BMBA 3QACA 4LHLA 1H1AA 2UYAA 2BVVA 4Y4YA 5A32A 1ZRRA 2JD4A 3ZN5A 3USUA 2ILMA 3SCHA 4RS5A 4FOYA 2A7AA 4C90A 3TRSB 1NQDA 3QCWA 4COWA 1UIKA 4TYSA 1VR3A 2VUJA 4L8QA 1TNRA 5E88A 1ZRCA 1QDCA 4LE4A 2F4PA 1R1A2 2GN3A 2GH2A 3AFGA 4WM8A 4LHKA 2IFRA 3RWNA 1BMV1 5GZCA 1H1IA 5GLWA 3ZSEA 3ZIXA 2GC1A 3FX3A 2VG9A 3JD73 4E2GA 5JVVA 1Q8SA 1D4M1 5EYXA 1Y43B 1WMDA 4RHV1 5FREA 1JUIA 2BFUS 3KSCA 5DZFA 1ZBA1 4ITCA 1YUDA 3VBFC 5L19A 4AF9A 3WG3A 4BA6A 4A3XA 3OF1A 4Q4Y2 1BBT3 3IKWA 3O12A 2FBEA 5T50A 1HXS3 1RUF3 1GNHA 3LA3A 1GKBA 1QJU1 2WWSA 4HLTA 4YFZA 5EWSA 1PIV1 1GZWB 3M2MA 2HEVF 3PHMA 4K20A 1O7FA 2QVSB 1HRI2 3W58A 2LUWA 1W0OA 4BCUA 2NLRA 4ORFA 4BLJA 1RIRA 5T5LA 1LHUA 3ZX7A 2VMGA 4AFBA 4PDWC 1FOD1 4AHZA 1ND2A 3AP6A 4LO4B 3PLQA 3N7JA 1G9CA 1A78A 1WW5A 1N1VA 2WSUA 2JG8C 1AL0G 4IV1A 4MGZE 2JECA 2AGSA 3GALA 1AUYA 3MFAA 4XIOA 2VY0A 2R042 3NV1A 3RI9A 5CG9A 4YM3A 5LRRA 4EROA 1LEDA 2ZCWA 2BUKA 5JR7B 1RITA 2PQQA 1FT9A 1IS4A 1V6IA 4PLOA 2ZPXA 2CGPA 4OUSA 1D4M3 4YRDA 1TME1 3DUIA 1WLWA 2H0VA 4BYYA 1O3QA 1ZBA3 4M3CB 2EALA 1WMFA 3SLIA 1LOCA 2O0OA 4PJYA 1REFA 3MI8A 1H2KA 4LO7A 1CPMA 4GA9A 4BM8A 5C4WC 3VKNA 2R49A 1MS3A 2WNUC 5T5JA 3WDYA 4GMP3 5H9RA 4JDNA 5KHIA 1QJU3 3L9JT 1PIV3 2AREA 2EVXA 1UZYA 1XNKA 4NPRA 2I45A 1FMD3 1V9U3 4P9GA 2JE9A 1NA1B 4ISRA 5DG2A 2QKDA 1PO13 3H1MA 4ATFA 2WA3A 1FOD3 1ZNPA 4AGGA 4CDUB 4OHYA 2D3SA 3AZZA 2VOWA 4DNYA 3E6DA 2QDNA 3EO6A 4LBQB 1VBD2 4H55A 4YYOA 2ZHKA 4NOTA 2PA7A 1CD3G 3LZZA 4OVEA 4XZPA 5D1IA 3ZXAC 3PVBB 5F1RA 4WM7C 4XF4A 5GZEA 3J9SA 2E53A 3AB0A 4FOQA 3SNMA 1UMZA 4A7YA 2GMPA 2BWCA 1FAYA 1PGW2 2ZGRA 1DQ0A 1NCRB 4LBOA 3M3EA 4IERA 3S30A 1QY4A 1R1A1 2GC3A 2OUHA 5L7OB 2MPFA 1G9DA 1K5MB 3DPRA 3JB4C 2XBO2 1YFXA 2ZX1A 1I9RA 1S0CA 4S2GA 1ASJ2 5IUQA 1H8TC 2ATFA 4YM1A 4L92A 1BKZA 5FRAA 5K0UB 4R4ZA 1C28A 3WUCA 3CLPA 1H8VA 1VB2A 2BVBA 2V73A 1VP6A 1JH5A 3E5XA 4R9BA 4AI8A 1ZZ7A 2Y0OA 4GIQA 4Q27A 1YO8A 4IEYA 3ALQA 4Q4Y1 1CAUB 2OVUA 2XJSA 1PVC2 1F2NA 1POV0 2E63A 2WFF2 1UKGA 1WUVA 3T2TA 3FZ3A 1AVBA 3H3ZA 2E7AA 1J1TA 3I8TA 4XFCA 4Q0QA 2Z5WA 1YJKA 2DFBA 1W6PB 3IIAA 5E8AA 2ZGTA 3O0WA 4EJRA 4K1ZA 4OFGA 4QGLA 1F8VA 2Q8OA 1MS1A 4S2FA 4Q26A 4YM2A 3G6JB 1VJ2A 1AL22 2TEPA 4AFMA 3HBZA 4HVQA 4UW6A 1CVNA 2XLGA 4Z07A 4NHLA 3LSDA 2RJLA 2GMMA 3VKLA 3AMPA