5EZBA

Chicken prestin stas domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
QYRILGQIPDTDIYCDVEEYEEVKEYPGIKIFQANTSLYFANSESYTSALKKKTGVDGSTNVHSLILDFAPVNFVDSVGAKTLKSVIKEYNEVGVCVCIASCSGPVMNELTRLNFFDNTVTRELLFHSIHDAVLACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chicken prestin STAS domain,Chicken prestin STAS domain
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 43
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5ezbA00
5EUXA 3AGEA 1AUZA 3LKLA 2KA5A 3IH9A 5EUSA 4XS5A 1SBOA 3ZTBA 3ZXNA 5EUWA 3IHAA 1TILB 4DGFA 4DGHA 1H4YA 4QTPA 3OIZA 1T6RA 5EUZA 4HYLA 1H4ZA 3OIRA 3T6OA 1TIDB 5EZBA 1BUZA 1TH8B 3LLOA 3MGLA 2VY9A 3NY7A 3AGDA 1THNB 1VC1A 3F43A 3IH8A 3IHBA 2KLNA 1H4XA 5EUUA 3IF5A
chains in the Genus database with same CATH superfamily
1BPLA 1N6DA 3VSEA 1AUZA 3MOGA 1WXXA 1FC9A 2CWWA 5EUWA 4QTPA 3OIZA 2ZOAA 1T6RA 3C0KA 2RRLA 3D03A 3GVKA 1V0FA 3OIRA 1TIDB 1BUZA 2VY9A 4DMGA 1THNB 2OASA 1K32A 3F43A 3IH8A 2DXNA 3IHBA 3AGEA 4AE2A 3IH9A 2B78A 3ZTBA 3IHAA 4DGHA 1FC7A 4L8KA 3V97A 5EUZA 3GMFA 1H4ZA 4HIZA 1N6FA 1TH8B 3LLOA 3MGLA 3DUPA 3AGDA 1VC1A 4AEJA 4L1CA 1J7XA 1WXWA 3IF5A 3LKLA 3V8VA 3GVJA 1SBOA 3ZXNA 4DGFA 4JC0A 4GHNA 4HYLA 3QDQA 5EZBA 1FC6A 3D3UA 3DJAA 1HF2A 2KLNA 1H4XA 2ZO9B 5EUXA 2KA5A 1V0EA 5EUSA 4XS5A 3GVLA 1TILB 3GHFA 1FCFA 1H4YA 3JU4A 2DXLA 3LDFA 3DORA 2AS0A 3T6OA 3EH7A 3NY7A 3K50A 3GK7A 1N6EA 5EUUA
chains in the Genus database with same CATH topology
5EUXA 3AGEA 1AUZA 3LKLA 2KA5A 3IH9A 5EUSA 4XS5A 1SBOA 3ZTBA 3ZXNA 5EUWA 3IHAA 1TILB 4DGFA 4DGHA 1H4YA 4QTPA 3OIZA 1T6RA 5EUZA 4HYLA 1H4ZA 3OIRA 3T6OA 1TIDB 5EZBA 1BUZA 1TH8B 3LLOA 3MGLA 2VY9A 3NY7A 3AGDA 1THNB 1VC1A 3F43A 3IH8A 3IHBA 2KLNA 1H4XA 5EUUA 3IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUX A;  3AGE A;  1AUZ A;  3LKL A;  2KA5 A;  3IH9 A;  5EUS A;  4XS5 A;  1SBO A;  3ZTB A;  3ZXN A;  5EUW A;  3IHA A;  1TIL B;  4DGF A;  4DGH A;  1H4Y A;  4QTP A;  3OIZ A;  1T6R A;  5EUZ A;  4HYL A;  1H4Z A;  3OIR A;  3T6O A;  1TID B;  5EZB A;  1BUZ A;  1TH8 B;  3LLO A;  3MGL A;  2VY9 A;  3NY7 A;  3AGD A;  1THN B;  1VC1 A;  3F43 A;  3IH8 A;  3IHB A;  2KLN A;  1H4X A;  5EUU A;  3IF5 A; 
#chains in the Genus database with same CATH topology
 1BPL A;  1N6D A;  3VSE A;  1AUZ A;  3MOG A;  1WXX A;  1FC9 A;  2CWW A;  5EUW A;  4QTP A;  3OIZ A;  2ZOA A;  1T6R A;  3C0K A;  2RRL A;  3D03 A;  3GVK A;  1V0F A;  3OIR A;  1TID B;  1BUZ A;  2VY9 A;  4DMG A;  1THN B;  2OAS A;  1K32 A;  3F43 A;  3IH8 A;  2DXN A;  3IHB A;  3AGE A;  4AE2 A;  3IH9 A;  2B78 A;  3ZTB A;  3IHA A;  4DGH A;  1FC7 A;  4L8K A;  3V97 A;  5EUZ A;  3GMF A;  1H4Z A;  4HIZ A;  1N6F A;  1TH8 B;  3LLO A;  3MGL A;  3DUP A;  3AGD A;  1VC1 A;  4AEJ A;  4L1C A;  1J7X A;  1WXW A;  3IF5 A;  3LKL A;  3V8V A;  3GVJ A;  1SBO A;  3ZXN A;  4DGF A;  4JC0 A;  4GHN A;  4HYL A;  3QDQ A;  5EZB A;  1FC6 A;  3D3U A;  3DJA A;  1HF2 A;  2KLN A;  1H4X A;  2ZO9 B;  5EUX A;  2KA5 A;  1V0E A;  5EUS A;  4XS5 A;  3GVL A;  1TIL B;  3GHF A;  1FCF A;  1H4Y A;  3JU4 A;  2DXL A;  3LDF A;  3DOR A;  2AS0 A;  3T6O A;  3EH7 A;  3NY7 A;  3K50 A;  3GK7 A;  1N6E A;  5EUU A; 
#chains in the Genus database with same CATH homology
 5EUX A;  3AGE A;  1AUZ A;  3LKL A;  2KA5 A;  3IH9 A;  5EUS A;  4XS5 A;  1SBO A;  3ZTB A;  3ZXN A;  5EUW A;  3IHA A;  1TIL B;  4DGF A;  4DGH A;  1H4Y A;  4QTP A;  3OIZ A;  1T6R A;  5EUZ A;  4HYL A;  1H4Z A;  3OIR A;  3T6O A;  1TID B;  5EZB A;  1BUZ A;  1TH8 B;  3LLO A;  3MGL A;  2VY9 A;  3NY7 A;  3AGD A;  1THN B;  1VC1 A;  3F43 A;  3IH8 A;  3IHB A;  2KLN A;  1H4X A;  5EUU A;  3IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...