5EZJB

Crystal structure of fab of parasite invasion inhibitory antibody c1 - orthorhombic form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
213
Chain Sequence
b'SIVMTQTPKFLLVSAGDRITITCKASQSVRNDVAWYQQKPGQSPKLLIYFASNRYTGVPDRFTGSGSGTDFTFTISTVQAEDLAVYFCQQGYTSPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab c12 heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
total genus 55
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezjB01
5E2WL 4JM4H 3L5IA 5TE7H 4Z7VB 3GIVA 4APQC 3LMJL 3DOSA 1KXTB 3MA9L 4TN9A 4LSPL 3VA6A 2RFXA 1Q9KA 1MFBL 4D0CB 3D39E 4TUKL 3EO0B 5BW7C 4YHYB 1JPFB 3IETB 5AAMA 5J6HB 5KVGH 1JPSH 4YHYC 4QTIH 3RNQA 3RUGF 1UZ8B 2Y7QA 4YK4B 1FL5B 4C56A 3ROLB 1P1ZB 3P9LB 5SX5K 3RX7A 5JW3H 3CSBA 4HK3J 2E7HA 2V2TA 2JJSC 2W60B 1R3KA 4TVPH 1OF2B 3ZTNL 1MFDH 3H9SE 4OCXL 5ECJE 3BAEL 1MCWW 4X6DA 4LP4A 3BDYL 2KZWA 1BZ9B 3LRSA 5IVNA 3K4ZA 2J8HA 2R0WH 5EC1A 1B90A 3S3PA 5C0CA 4Y5YC 3I9GL 5LQBH 3DXAD 3EOYG 3KG5A 4HIIB 2ITDA 2IC2A 3O2WH 1FH5H 3K81A 2EDWA 1CE1L 4AEIH 3ZSSA 3A67L 1FGVL 3DNKA 4RBPK 5CZKA 2OK0H 1J0KA 4PFEA 2BY3A 4H1LH 4J3OC 1ZLSL 4DCQB 2NQCA 4NO3B 2UZYB 3WFCH 1ZHLA 4WDIB 1JNNL 3MRQB 3QXVA 4MJIA 3U2SB 3L3KA 4ZSOA 5ACZA 3RWHB 4NQEE 1MCOH 4GBXD 5GJSL 1NEUA 4OLZL 4FQIL 4PJFB 1PSKL 4UOW0 2GK0B 1U8LA 1KPUB 2I26N 3QP3A 3JTTB 2FSEB 4XWOD 5CJQL 3P0YL 4X6CF 4DK6A 1M71A 3FRPA 4WTZA 3OAYK 4J1UB 2Z91A 4KUZL 3VA2C 3A6CH 2NY7L 4KKLC 4NRXB 4RIRA 5F3BB 4JKPL 4YXKH 2ZCKH 4ETYA 5IBLD 4XGZA 4XPBL 3VD7A 1I7ZA 5BZDA 2EYRA 4GAJL 3VGDA 4NN7C 4JFHE 4XPFL 5ICXA 3X3GH 3IS0X 3V5KA 3NZ8A 4K94L 1QSED 4DW2H 2BHYA 3M8OL 5JPMA 3HE7C 1TNNA 2YPLA 3D25A 3DSFL 1EHLH 3BWUC 3S37L 3DROB 4OAWB 3RPIA 2R4RL 4RMTA 2VDML 1BEYL 3WN5A 1JPSL 3MROB 4NQCA 4HS3A 4UIMB 4ZFOA 4YBHA 1U58B 3QQ4A 3TBWA 3C08L 3LEVL 3VXSB 2P5WD 3H0TA 3MRDB 2PW1A 4CMHB 1C1EL 1G7IA 5TDOB 1IAIL 4LPWA 2IGFH 4MZ2A 4ORZC 3CVHB 2BNUA 4OLVL 4QWWD 1CLZL 5DXWA 5EO9A 1JNLH 5DJAB 4UDTA 4ODHL 4MB4A 4RX4D 3LN4B 4PBVC 3P9MA 3S96B 1F97A 3GI8H 3VXMD 2LE9A 1W72L 4NNPH 4XC1L 3PJSA 1FBIH 5FHBL 1FL6A 4XBEL 3EO9H 4L8BB 2Q86B 4HIJB 4WW1B 1PJ9A 3U0WL 5F3HB 1EEQA 4QRTA 1OW0A 3H9ZA 4PGZA 3TBYB 4XP1L 5KANG 3VXUD 3O11B 1NFDE 4LKCA 1SJVA 4UT7L 5KSAD 1OD9A 3RPKA 5HHOA 2UYLB 2WW8A 3QEQE 4MLIA 5GZOD 5DEGA 1A9BB 2W9EL 3ARED 1GZPB 5IW1A 3D2UD 4QCIA 4G9FA 4I77L 4M6NL 4DN4H 4ZFGL 3DMMB 5ITFA 1EAPA 2PO6A 5ACMA 2AVGA 4QXUH 4GSDL 1CGYA 5EU6E 4PLKC 4QF1B 4H8WL 4FMFA 3JWDL 4F7EA 1EEZA 4M00A 3RHWF 1MI5A 1QFUL 3KPRB 1CL7I 4NWTH 5D2LF 3RQ3A 3WFBH 4MDJB 3IDXH 3O6KL 3A6OA 4LCYA 2DQTH 2R56H 1DANT 1E4XH 3RNQB 1WUNT 2NZIA 4KHXL 3SKUD 4D94A 3T0EC 1JF5A 2PXYA 4ODBD 5J6GA 4FQCH 3LH2H 3GBNL 4LEXL 5GGUB 1S8DA 3RU8L 1MNUL 4HX1A 1K85A 4YXHL 2O5ZH 2NXZB 1WT5C 2AGJH 1C5DA 1AP2B 3O81A 3TM6A 4LLQA 1EJOL 4P23A 1JGLL 3TN0D 4Y2DB 3BUYB 4Y1AE 4E41A 4CJ0A 4OT1H 3NCYP 2G5RA 1T2XA 2DMBA 2V5MA 3UTQB 2JJSA 4GW4B 2J8UA 4U3XA 1KC5L 4Z7VA 1T0MA 3V7MA 1FAKT 2C3XA 1K4DA 4G8GD 3KLHD 3HG1D 4J12A 5FGCB 1YPZE 3IS1X 5BV7L 4PJEE 1HHJA 2LVCA 5JOFA 4AH2A 4XVJH 3U4BL 4PJBE 4PJIF 1FL5A 5F9WB 4PB0H 4FFVC 1ZHLB 4YBLB 3EDFA 4HLZG 2R2EA 5DEZA 1XH3B 3QDGD 2BY1A 4L9LA 5JHDE 1KTKE 4JDVA 1JGVL 5ESVA 4WY7L 3LHPH 5IMOB 4AEHH 4BFEA 4EOWL 1K8DA 4BH8A 1MJJB 3EFFB 3WNLA 1T04B 4LSTL 1F00I 2IQ9L 2PR4H 1QRND 1QVOB 1CGWA 3LKNB 4KK6C 5DQ9A 1HI6B 1Q72L 3GMQA 3DHJA 1B0RB 2IAMA 3B3IA 1U8OB 2R4SH 1HH6A 1HDMB 5I9QB 4P2RB 3REVB 4OQTA 2JCCF 1PD6A 3WLWD 4S1QH 2CLRB 2YN3A 5K9KA 1GPOL 3UTSE 5ID1A 4YX2L 1BIIA 2CDGA 2D7QA 1HKLL 2QHRL 3T1FB 3RVUC 4DN3H 4QHNB 2X4TA 3BEVB 1RHHA 5SWZD 2QSCL 3C60B 4MA8L 1QG3A 3DX6A 3V5KB 2EDQA 1CFVH 2R1YB 1KG0B 2YBRA 3IFOA 2FL5B 5IG7B 3N1PC 4OZHB 2EYTA 3ZTJH 5LAXB 4DUWA 4E0RA 5FUOL 2YA2A 2CRIA 5T5FL 3QXTA 4I18C 1NCCL 2HJKB 1BFOA 1YMMB 4MNQE 5EOCL 4HDIA 1WSST 5ICZA 5J13B 1DLFL 5HYQA 4U4BA 5CS7A 2B0SL 4CW1A 5IQ9B 5FGCE 4JRYB 1HZHH 4W6YB 3BFOA 2MHAA 5JW5B 1I7ZB 1HZHL 1G7JA 3W81A 4UDTB 3ZLQC 4K3JL 4M3JA 5I19L 2N7BA 3S96A 4FN0A 5DDHA 1GC1C 2QQLH 5M94B 3RVXC 1N0XH 5EBMB 1A7PH 2NMSA 2X40A 1B4JH 4L8BA 4PV9B 4S0TD 2A6KB 3CLEH 3MJ6A 5DYOB 1KJ2B 4RMRA 3VFOA 3IAPA 1QYGL 4X6DE 3VMPA 3GBNH 3PDOA 4M5YH 2DQHH 3DLQR 1CFBA 4LOUD 1A6ZB 4JO1L 5L6YH 1KCLA 1VEMA 1INQA 4TPRL 3RBSA 1T2JA 3G6JB 1RUKH 3OAZK 5E8PA 3O3DA 1SYSA 3KPSA 4XNQB 1S3KH 2IBBA 5CZVL 2EEBA 5DTFB 5E1AA 2HKFL 1A3LH 1M7XA 4JFDA 5DJAA 5L8LB 3QRGL 5LGJB 3SE8L 3GSWB 4I77H 2R0LL 4DN4L 4PJGB 5CMAA 4YFDB 1IM9A 3QI9A 4PGCA 4IMKA 2A83B 4KJPD 4WW1A 3MLZH 1OB1A 4JREB 1DQDH 5D1QD 4LFHD 4RZCA 5C6TL 3T0EE 4IRSB 2IQ9H 2PR4L 1R3JB 3UX9B 5IEHB 5BOPA 1YJDC 4Q2ZB 5I6XB 3IRZA 3LIZH 4M1CC 2VR4A 1OT2A 2K3TA 4XHJC 4AEHL 4OF6A 3T4AA 5IHLB 1I7RA 2AEWA 5FV1L 4E41B 3T2NL 3QO0A 5FYLH 1JNLL 1VEOA 1AE6H 1IGFH 4GH7B 1OAXL 3IFPA 4M1DL 1OSPL 1KACB 5MP6L 1PGRB 2NXYB 4G8EA 3IU4H 4JHZA 4PRNA 4K7PX 3MLWH 1BD2D 5HYSB 3NFPB 4L8CB 3BPNB 1WBYA 3SDYL 2HFTA 2FHFA 2X44D 3SO3B 2HYMA 4YPGB 1NBZA 3P4NB 4X5WB 1IGCH 3PQYD 5DK3A 3K80A 4HFUH 4CN4A 3UPCA 1JN6B 5DSCA 4PJ5E 5FIEA 2PXYB 3WO3B 1A1OA 2EIZB 4MD4A 1ZGLA 2G60H 2DM2A 2CUIA 3T8XB 2Y23A 4L9LB 3UDWA 3GMNB 3DBXB 1QLEL 4LSQL 3D85A 2VQTA 3Q5YA 3QFJA 5ESVB 5IESH 4K94H 1V5JA 5C0BD 1L9NA 2DQJH 4IMKC 3VXUB 3WHXA 2DD8L 3U7YH 3AY4C 4LAQL 4WUKH 2AGJL 4NRYB 2JKXA 2O5ZL 5DJ6B 3IDJB 3QUKA 1MUJA 4PJ9D 5J1AA 1Q0YH 4NJ9L 1FN4A 4FFYL 4GQPH 2P5WA 1P69B 5IMKB 2NNAB 4FQXC 4MXVE 4OZGF 3T4YA 4ZNCD 1KJVA 2VAAA 4MA3A 5HJ3A 3WS6C 1W8OA 1YECH 3ETBF 4GOSA 3PIQB 5C8JB 1ZLUK 4P2QD 4JRYD 4ETQB 4HXAL 1CFQB 1IGYB 3SO5A 2GAZB 3CH8A 2C4FU 1Y6MR 5LG1A 1T83C 5CJQH 4M62L 1N5AA 2BVQB 4P4KA 1D5ZB 2IFFL 4R4BA 3S6CA 4NGHH 4LBEA 2GJ6A 4OV5B 4BZ2H 3TCXA 1L7TH 5E94A 3FTGB 1V05A 3PWUA 4NQVB 5GS1B 3HB3C 4WJ5B 3EYFB 3CFEB 5SWQB 1C7SA 5SWSA 3KNBA 4BH8B 3PGFL 2NXZD 3IXTB 1DL7L 2FX9H 3L3DB 4U1JB 5MERA 2P5WE 5DI8B 3UTOA 2VLMD 1AFVL 1RQ5A 5GGRY 3TN0B 4RWHA 4BKLB 4OZHF 1BLNB 3F7PC 3IKCB 4AIXA 1RUAH 4NPYA 3ZT5A 4TQEH 3EO9L 1MCWM 1EHXA 1D5IH 5ICZB 3S8WA 2B20A 2W0LA 3FT3A 2IH1A 4I3GA 3S36L 2W38A 4UTAH 1DBMH 4L8DB 3I9GH 5HI3D 1SMOA 2AAVA 4KJYB 3QUXB 2UZXB 1ZVHA 4EIZC 4L1HA 1KCRL 3O6ML 5C0GB 1AJ7L 4RAHA 3T1WA 3DX6B 2IAMD 5C0FB 5T3ZD 1KTLB 3JV5A 5E2UH 2Q3ZA 1JFQL 1ND0B 3ARBD 2R1YA 5E08H 3UPRA 1NGQH 1K6QL 1WQVT 3VFOB 4CBPA 4CMHC 4YIQA 4OZHA 2XT1B 1CZ8H 1U8KB 3DX8A 2IANE 2VDMH 3EO1A 4PRHB 1WBXB 3QCVL 2ZUTA 2QKIA 3KXFB 4HD9A 3F7QA 3GO1H 5I1DA 1QRNB 3B2UD 5F96H 4KMTL 3TO4B 3LOWA 1QTYT 3GSVB 4PD4J 1CD1A 4F8TA 4F7TA 4ELME 1PZUB 1QBMH 5L2KE 2DJSA 2GTZB 3MA9H 1RUML 4GAJH 3W2DH 3PWNA 2VDPH 2XZAL 3N1QC 2YEZB 1EHNA 1A5FL 3GSWA 4NN7B 2VZUA 3QDHA 3CFIC 4OZIE 1CQYA 4LVHC 3ZTJG 4WUKL 5JPNB 3DVNA 1HCVA 1J8HA 4Y7MA 1P84K 5HHVL 1SM3H 4QGYA 3NA9H 2YKLL 2FX8L 1FAIL 5EN2B 2DYPB 1Q8MA 2IG2H 2VNCA 4WW2A 5I8EB 3BXNA 5KVDL 1TXKA 1OTSC 3PWPE 7FABL 5IJVB 5BMFL 4HIEA 4ELMA 4OQTH 1I7RB 1X6NA 4G8GE 4BA8A 1NUFA 3MA7A 3TZVB 3FHAA 5AYUL 4KC3B 5MP6H 2VZOA 4L4VB 5ESQA 2WIIA 1K5NB 3RTQB 3PUCA 4NZRH 4YHOH 2VWEC 2ARJQ 2BOBA 3UBXG 1NUNB 1TDQA 3CSPA 4JFDE 2BHZA 3WCYA 4RGMB 2EDJA 4BSVA 4QHMA 2BNRE 3LS5H 2DIAA 1LEIB 1V3KA 3ILQD 4FQXA 4JAMA 5IIEA 3T8XA 4FFWC 1A64A 1PVHA 3B6SB 1S9VA 1P4IH 5IEHA 1VPOL 3D85B 1Q94B 4ELMF 3LEYH 1ETZB 1OAUH 5JW4Q 4XT1C 3S5LB 1CDBA 4Y5YB 1QSEE 3S36X 3F65A 3CNKA 3N1GC 4K07A 2GSIB 4Y19E 4K71B 3PGCB 1EK3A 4V1DA 2YUZA 1EBAA 2M1KA 1KIRB 1S9YB 1T03H 1NCNA 2ITDB 4Z7UE 4X6EA 2BHUA 1J88A 4JO3L 3WDJA 1M6OB 3KYMA 4OLYL 3TT3H 1CFQA 3TA3A 5AZEL 2VZTA 4NQCD 4D9LL 3BWAA 4JCMA 1YEKH 4TPRH 5TE7L 4PTUA 1MJ8L 5I18H 1FLRH 1INEH 1HIML 1XGYH 3HLAB 3GMNA 3U0PB 4ZSOB 1IARB 5ACZB 4JHBA 3FT4B 4ZFFB 3O3UN 2JJTA 5GGTL 3KNBB 1KXQE 1U3HB 4Y19A 4X4MA 2GK0A 4YDIH 4LPCA 1TVHB 4K3JH 4NSKB 3HR6A 1MOEA 1UEMA 1T3FB 4N0UA 4KKNA 2UUDK 4KQ4L 4MJ5B 3MBEB 1WTLA 5F1OB 3BZDA 4MAUH 5J3HC 5DS8B 1U8IB 1JGUH 3RWDB 5CUSH 5D7LE 4GG8A 1OAZH 4K9EL 1I3GH 2CKBH 1NCCH 3ZKXC 3ARTA 3GKWH 3LD8C 4IM8A 3ULVC 1HNGA 4UB0H 4QOKD 1EBPA 2CUHA 1GZQB 3VFGL 5E94B 4KHTH 8FABA 5AG9A 1YUHA 1CFVL 2BNQE 5HHXH 2FO4B 4OCLC 3GMRB 4NQUA 2QSCH 3QQNA 1MJUH 4G5ZL 1U8KA 3DX8B 4HS3B 4ZFOB 4J3VA 1LD9B 2PYEE 3EYOA 2QKIB 2OMBA 4EUPB 1Z0NA 4OFYA 5E9DD 1G9ML 3NCCB 5TDOA 2QR0A 2GTZA 3Q48A 2EDFA 1MY7A 3I6KB 4S1SL 4Y5XA 1RJZA 4FFWD 4J3UA 3JTSB 4MSWA 4U7SA 1WZ1H 4UOW1 2FEDC 3X14B 5HYJE 1QSFE 3RNKB 5DMKB 5MEQB 2UWEE 4QRRD 2XI9A 5C0RH 1JWMA 3ZKSD 4E9LA 1U2CA 4PGBA 1I1AA 5FFLA 1I9RH 1IGJB 4NOFA 5CLTA 3VI3E 2DWDB 3BRDA 4XCCH 5JW4M 2W91A 3T0ED 1YMME 1RIVL 3MYJB 3RIAF 5F9OH 1VACA 2CKBB 1TJHL 2DDQL 3HS0B 4W4NA 5FUZL 3AXLA 3D85D 5D7JA 4CNIB 3TBYA 2P1YA 4WI3A 1LEGB 3CFBB 1GC1H 3D1MC 3T3PF 5DF0A 1A6AA 4UQ2B 3HZVB 3IGAA 1N8ZA 5DEGB 3ME0A 4E42A 1XF3B 4OCNC 3TLRA 4HC1L 3F7YB 1HINH 3MLUH 2WIMA 4YHZH 1EAPB 3D3VD 2RB8A 4O58L 2F53D 3PWNB 1JK8A 1A6VH 3QULA 5F21B 3KPRA 1LO2L 2PCPA 4ENED 3DX9B 4EN3C 4KMLB 3EAKA 5J1TC 2UZIL 2C1PB 4BUHA 1LDPL 2K7PA 3OKLA 2P5ED 4ZUVB 4L3EE 4TTDD 4BSVB 4G6FB 3ZO0A 2MOVA 5FDWA 3G6JF 5E2TL 3G04A 4OF8A 3GGWB 1DVFC 3QEUB 5GHWL 4JAMB 1JGDB 1N59A 2A9NH 2VDOH 3TWCL 2L0DA 1S9VB 5EWIL 2OM5A 5DHYA 1HE7A 5DEFB 5JHDD 5SWZE 2EDRA 1S7QB 3O2DL 4HIEB 1ZHKA 3PHOB 4KK5C 4ZO6A 2HWZL 5DMYA 3BUYA 1FZJA 2P7TB 3PGCA 1WK0A 4URTB 4YWGH 3RWCB 1Z9SA 3GSQB 1G84A 2FR4B 1V8HA 4L4VA 1J1XL 3QWQB 3AS2A 3L95B 4GRWH 3RTQA 35C8H 4LCWA 4NUJB 2HG5B 3FQTA 4WHTA 3TVMD 2QSQA 5JNYA 1Z2KA 3MC0A 1RI8A 2F54A 4HK0A 3NAAL 4I0CC 2AEQH 3BWAB 4JEGB 5T1LD 4S1DD 2NYYC 5HDBE 3U6RB 3IJSB 3QJHB 3D39A 4CU6A 2B1AH 5JMOC 5D2NB 2J4WL 4NKIH 1HXYB 4NJAH 5JIIA 3GBML 1H3GA 3MLVH 5DUML 2X70A 2Q8AH 2OCFD 4AL8L 3LKPB 3FB5B 1LO3H 1LP9E 3ARXA 2DQGL 2DYPD 2MKWA 4XC1H 4JO4L 4OI7A 1QNZL 1FO0A 3CFCH 2GSIA 2NY4B 1U0QA 2V2XA 1MRDL 2P8MA 2P44B 4HW6A 4NUGH 4V1DB 3QCUH 3D2UB 1MIEH 1S5IH 2JB5L 2ESVE 1KIRA 1S9YA 2OTWA 4G8IB 3FN0L 4Q9CA 2VWEE 4XNMB 3SJVE 1EEYA 4ZS6D 2WWMD 5AUMA 4G3YH 4X83A 5DRZB 3L3IB 2WQ8A 3WNKA 5JA9A 4UT9H 2O93L 4JKLA 1ZEAL 3NBNA 5F1IA 5ID1B 4LNRA 1ITCA 1E27B 1EGJH 1JWUB 3MJ8A 3RP1A 3O3EA 2DBLH 3EOBB 4WHYG 3GSRB 1PDKA 1BP3B 1TZIB 4XBGB 3HNSH 3DGCR 5FM5M 1SEQH 1NCBL 4RISH 2YBRB 3IFOB 1IAII 3HMXA 1ZK9A 5DQJB 3V95A 4GBXA 1KJMA 5IHUL 3ARFD 5CSZB 2E27H 1B6UA 1UCTA 4GMSL 1Y18B 1MCPH 1P9MC 3FAWA 1KB5B 1FDLH 4ZAKA 3AVEA 3P4OA 4Y5XC 1BFOB 1JUFB 3CVIL 3UMTA 4JRXB 2CQVA 2PN5A 2MQCA 5TE4L 2NY7H 2Z35B 2V6HA 3T3MF 5F7EH 3UXFA 4PRBB 4JRYA 1IKNC 1C08A 4WEBH 1D5IL 2MHAB 4GS7C 1EIBA 1MAMH 2ICWJ 4HLJA 4UNTA 5I1CH 3SDXE 4XMPL 1WWWX 1XGTA 5I1HH 3HAEH 2HFGL 5DDHB 4XC3H 4PJEF 1NCAH 3Q6GL 1HKFA 4WENB 3L7FB 4K7FB 1YUHB 3O6FD 1RULL 3SDCD 5GJSH 5IM7A 4PLJD 3ES6B 4JPKH 5BRZE 2YA1A 5GRZA 3UEZA 5GRJL 4L29A 4CN1A 2O5XH 4P46B 3MRRB 5SWSD 1ZWIA 2DOCA 4HUVA 5IFAH 4KXZI 4LMQI 3U4AA 1A1NA 4UIKH 4I5BA 3V79C 5E99L 25C8L 4QHLA 4QKXB 1RU9H 4TSCH 1KCUH 4WEMB 3TBTA 2V9RA 3SDAA 1XCTB 4ZXBD 4ORGB 4HWUA 4YXLH 4Y5XB 1JE6A 1BQLL 3FKUS 1GGCL 4JFDD 4HXAH 2EO9A 2H41A 3TA3D 1AO7A 2FATL 1FZKB 1MWAB 5IB1A 4B7LA 2X4OB 4W70A 4R97C 1UA6H 2Q7YA 3GJFB 4PJ8B 2D0HA 3D0VB 5CMAB 3U9PH 3R1GH 5HYJA 4FFYH 2C1PA 3BDYH 1F58H 4ZUVA 1SY6A 4KRPD 4U05A 1A7OL 3G04B 1F2XK 4HEME 4R4FL 3UTPE 1MFDL 4OM0L 4RZCB 2HKHL 3ZTNH 3W9EB 1JGDA 1N59B 5C0EB 3SKJL 1YEGL 4ZS6C 2YHGA 3OKYA 4XP9L 5I2IB 4HWEH 3BZEA 1AD0A 2BSTA 2F5AH 4KRMB 4AIZB 3C5SB 2LABA 5EH1A 1KEGL 3ZKMC 1N8ZB 2J5LC 2CO6B 2EDNA 1DP0A 1SJEA 4LDEB 3FRUB 4YDJB 5KSAA 3T4AB 4QNPF 3I75A 4ODUB 2ZNXA 4CMMA 1F6LL 2WAHA 3G6DL 3HI5H 5D8JL 5ILTH 3F58L 3QEQA 5FYJL 3UJJH 2XYCA 4QXWA 4U1GB 2XQBH 3IU4L 4JM4L 2PTVA 3HMWL 4AM0B 1YYML 3MRGB 4N90D 4YHKH 2BVOB 4GFTB 1MHPH 1T7VA 4NHUA 2B7DT 2DAVA 4U1HB 4AYFA 1Q9LB 2EZ0D 2YPVH 3PWJA 1P1ZA 1EMTH 2I9LA 2OQJA 3P9LA 4DKEH 4KUCD 1AD9A 3GGWA 5BO1H 1P7HL 5GRVK 1NL0L 1A1OB 2NR6C 4Z7WF 1U6AH 3PE9A 2A6JA 2IH3B 3A6BH 1JCKA 3CDYA 5SX4H 5C2BH 1J86A 4HT1H 2ZG3A 2PXYD 2Y4SA 4FFZH 3QUYD 1FV1B 5TQ2L 3LPFA 3PHQA 5T3ZE 1EH9A 1FNEB 3GB7B 5DD3L 4BZYA 3X12B 1UGNA 4FABH 4S1RH 3KS0J 5L0QC 1UM5H 5E7BA 1FN4B 2YD1A 1CXKA 2NNAA 3T4YB 3SPVB 3STLA 2OTWB 2VQUA 4FNLH 3PIQA 2IMMA 2VLKB 2VDQH 3MV8E 5C8JA 3THMH 4LCWB 1YDPB 2NZ9C 3VGHA 1F11B 4DGYL 2B2XL 2ORBH 4I0PC 1OHQA 5DRZA 2YUWA 2FHBA 5J3HD 1CDCA 3CZFA 1PYWB 5F1IB 3D87B 2V9TA 1T66C 3IJSA 2YC1B 1D5ZA 3RX8A 3LKOB 4ZO7A 3SY0B 5D2NA 3CC5A 5LJYH 2GJ6B 3NACL 1N64L 3K7UA 2ZJSL 1PFCA 3FB6B 4OZIF 2X70B 4K9EC 3G9AB 1QBLH 2C4XA 1X5XA 3BHBA 2G2RB 3IXTA 4FOMA 2P8MB 4P99A 4PS4L 3VWJC 4PJHE 1WEJL 3HI1B 1MJ7H 3UBXI 1M71B 4G8IA 1CDIA 1M7IB 3ARDA 3OTTA 4U7KA 1KJ3L 2W9DH 4WW2C 4N0CD 4NPYB 1JPGA 1CICD 1JHLL 1M7DB 1NEZB 3MFFA 4GG6B 4YBQD 1IFHL 1ZKAA 2W0KA 5AZ2H 2OZ4A 2F8VA 4QLRA 3FB8B 2OL3A 5J89A 3I3EA 5HTSA 2NLJA 1ZXQA 5DUPL 2I07A 3H42L 3HR5A 1MRFL 5F7WC 2FIKB 2YRLA 4IRZL 1YEHH 4KDVA 1M05A 5D71H 4G7VH 1JI2A 4JPWH 4YHLH 5DD6A 3BKML 2WLYA 4ODXB 4FP8L 4P5MA 5IQ7H 5GZOC 2XQYK 1A21A 4JFEE 4LHUB 1T0PB 3ZDZF 1MCRA 4YIQB 3ULVH 1DQMH 4LLYA 1KJMB 3HNTH 2CPCA 3WIFA 2FCBA 4YFEA 2AK4A 1ZT4A 2HP4A 3F7VB 4JQIH 3PWPD 3TZVD 5CGMA 2B5IB 3O8XC 4PRHD 5JHLL 4X80H 5HYSG 2AERT 1VFUA 5EOQH 3WO4C 2CO7B 3BEWB 4JO2L 4X5XA 4JLRA 4P2OD 4XP6H 1ZAGA 2EC8A 5DURB 5C09B 4MQSB 4QRPB 3T2QA 3JUZA 1ADQH 4PJBF 2GITA 1AO7B 4YHIA 5GRYA 4EXKA 3MX0A 1LEKB 1FZKA 4TNVF 5CKGA 4EI6B 4PJ8A 1ED3B 1DQQA 3ULVD 2C26A 4GKZB 5I74C 2DLGA 1GJIA 4UTBL 3T0AA 1B6DA 3OPZL 5LVEA 5TDNA 1O5DT 4ZPTB 2W92A 3BP5A 5I30L 2DLFH 3MJ9A 4G6AD 2DM7A 5ERWA 5JIPA 5T33L 4XMLL 3FONB 5IJKA 2F19H 1EZVX 3ZT6A 4OKDA 4UAOB 3HNTL 2DYPA 3MRRA 4PJXF 4WCYH 3VI4F 5IW3A 3MLSH 1R5WA 1JHTB 4PPTA 5F1KC 2HJFA 4QHLB 3H7LA 3FRUA 4AQ1B 3O2VL 1G6RB 1TITA 4H26B 2CD0A 2VKWA 1CFSA 2D7MA 4F80A 5F7YC 2IPTL 4QF1A 1T22A 4WW2F 4OZFB 4DUXA 3CIQA 2JIXD 3MXWH 4XVTL 1P2CB 3E2HC 5ADOL 1ONQA 5HHPA 3DVGB 4GRWF 4UU9B 3QUXD 1ZA6B 1WFNA 1CT8A 4XNXH 2J12B 4KQ3L 5TF1L 2RFXB 4QHMB 1BREA 1J1PH 1NGYB 4YEEA 1Z5LA 4NZUH 3CSYA 1JBJA 4RWYL 4PJXA 3EJZC 2CDFA 1CG9A 4AQOA 5IT2H 4TYUA 1YN7B 3BZEB 1E4KA 5TPWL 1A9EA 1AP2A 4WI6A 1WZMA 2BP3A 3LH2L 1GHFH 2EYSB 1U8HA 2R2CA 5J8OA 2E8ZA 3SGKC 1D6EA 3X12A 1SMAA 5I73C 3U9UB 2R56L 3K8LA 1KT2A 1GL4B 2XA8H 4NYLB 2E7MA 4R90L 3O6KH 3QUML 4JFZH 3JVGC 3SE3C 4P2QE 4FG6D 1YEDA 4NDMA 5LGHL 2D7TH 3FQUB 4IS6A 4R8WL 3TA3B 5D7LD 4WGVB 1Q9LA 1RJCA 1BQUA 5IW6B 4AG4H 4Z0BL 4P48A 4X9FA 4GRMA 2W9EH 3LCYA 2NYYD 1RZIA 4NKOB 4YFLI 3F8UB 4X7FC 5E9DA 3T04D 1N4XH 1L7IL 1YJDH 4P0DA 4WDIA 4NQEA 5L7XH 3FT4A 3QIWB 2OTPA 3BHBB 4KH2A 1KTDB 3IU3B 3QDGB 2DBJA 3GIZL 3L3KB 1HH9A 4X4ZA 2G2RA 4NN6C 2UUDH 2AXGB 3T0DA 1CS6A 4U1IB 3OSKA 3RDTA 3LKQA 4NNPL 2XACC 1AKJB 3CUPA 1NANH 4MJ5A 1B0RA 1I8IA 2DLFL 2VLKA 2X9YA 2Y07L 2R29L 4MS8C 3VXRA 1JF1A 5E6ID 5MEPA 5D7JD 4LF3B 4UTBH 3MRIA 1D9KB 2MCG1 1AO7D 4FQJL 1DBJH 4M03A 3NCYS 2DI7A 2OL3B 4FQ2L 3CZFB 1Z9OA 1IC4H 1YNKL 1ADQL 1BIIB 1P4LB 2CDGB 5F3BA 1BBJB 4XCNA 5DHVA 1QLFA 4KJPC 4X6FB 4XTRC 5EUOE 4AZ8A 2Z31D 3GRWH 5IF0B 3SBWC 2BFVL 3QCTH 3CH1B 1J5OH 3BZ4B 1F4YL 4O02L 4ODXA 5CJBA 1MPAL 4FA8A 5IG7A 4X9GA 1P7KA 5I8CA 4K3DH 2YWZA 3D25B 5T3XD 1AHWC 2KH2B 2HKHH 4MB3A 1YNTA 4ZUSA 3DPBA 4Z7WE 4FP8H 3MGOB 5DLML 1ERNA 4J23A 3MCLL 4UILL 4WFGD 5H37H 5C7XH 1GGBL 4YDLB 3U9PL 4J4PD 3WXWL 4N8VG 3MV7B 3BESR 1QOKA 5HDLA 2DQIL 3DTXB 4M6OL 5HGHA 3ZHLA 4LCUB 5SX4I 1RHFA 4EI6A 1WCBB 2DL2A 4EBQH 4GKZA 2R15A 3BP7A 3QFDA 1OCWH 1KCUL 2X2YA 3ARDD 3SDXF 5DD6B 3P9MB 1JZ3A 3TO2B 3H9HB 3ZYIA 5D9SA 5GIRB 4HXBH 3OB0K 3L5XL 3RY4A 5ERWB 2EXWD 3V5HA 2O5XL 2R0KH 3VFRB 5F3HA 7CGTA 4EI5C 4C58B 4OI8A 4ZNEA 3GHEH 2HJFB 5I16A 3WIHH 3F7YA 1QBLL 1RK1A 4HUKB 1F42A 2UYLA 5L88L 3WFEH 5IVXE 1N64H 2CRZA 1TJIL 2VSCA 3DI2B 4ZSOE 4CVZB 4WUUD 4MS8D 4JLRB 5DJYB 3BJLA 2D9CA 2YA0A 2DQDL 4L3CB 3SDDB 5LXGL 2Y36H 4JZJB 4QHKI 5DFVC 4LAJH 1RZ7L 4DAGL 2E9WA 1LEKA 3O2WL 3AGVA 3WEXB 5HGAB 2PCPB 4XNYH 1ED3A 3TH3T 3AB0C 2J88H 1MVUA 1XT5A 1MCLA 4DGYH 4MQ7B 3VD5A 5DQDL 4FTVE 4H1LB 3IAQA 1KCVL 1UH4A 5GSRB 5FYKU 1ZGLM 3BAEH 4OCXH 4WHDA 2EZ0C 5DUBA 5KSVA 4Z7VF 3ZE0E 5DEFA 1CGUA 4WI8A 1A1MA 5DFTA 4MQTB 5CBAB 2DB8A 1DQTA 1MQ8A 5TH2A 1Q9WA 5FGRA 2Z8VC 3QH3B 5J9PB 2JELH 3QBTB 4G9DB 2QQKH 2YXMA 1H5BA 1TFHA 3BGAA 4JQXC 3DV6A 4ONFL 3L95A 1MFBH 2PYFB 3SJVD 4BQ6A 5IBUB 4WHYH 4ZMAT 3OKDA 3RIFF 2ICWB 3VG0L 4E5XA 4H0GA 5CEXB 1ZA6A 5INDA 3M07A 1NBZB 3P4NA 4X5WA 3D39D 1IT9L 5CJOL 4LDOB 4TVPD 4PRIA 3GNMH 4NUGL 1RIHH 3QDJD 3E6FB 5ANME 1A9EB 4KKCC 5E4EC 3KHQA 3FB5A 2OP4H 1KTDA 3MNZA 4MJIE 2JCCA 3CVHL 4GRLD 2NXZC 3GUTA 1CGSH 4WFED 3V6FB 5J1AB 1YNLL 2C1OA 3QXAA 3DUSB 4IJ3C 5CHNA 5IV2A 2CMRL 2VAAB 4JZNA 3V0WL 3EFFA 4HG4J 2GY5A 3MJGX 4XNMA 2KQMA 3FN9A 1J0HA 2XN9E 4LLMA 4MAYD 5E70A 5D7SL 1BOGA 4MWFA 3VGBA 1VDGA 4IS6B 5JO5B 3QIBA 3UTTD 4YEFA 4I2XA 1QFHA 1Z0MA 2CIIA 4P2QB 4KV5E 4FZ8L 3REVA 1J1XH 3N06B 3FN3A 5H37G 4PBXA 2OI9B 3MUHL 4LBEB 3BW9B 1RZFL 5IR1A 4OV5A 5K9KB 5ANMA 3FOLA 4R96B 5EIQA 3ZE0F 1MIMH 5L9DL 4Y4HD 3BD4A 3F6IA 3AB0B 4PGDA 5LBSL 4TSCL 3O2DH 1MH5A 3C9NB 25C8H 3FAXA 5SWSB 3V8CA 4HH8A 3VFWB 1ZT1B 4QYOB 2AXGA 3HUJE 1WIOA 2BC4A 4PRHE 5IOPB 4ZQKB 2EKJA 5B8CC 4KXZH 5ITBH 1TIUA 3LB6D 2GJ6E 5HHQB 4L4JA 2Z31C 3D69B 5MEPB 4D9QE 1NMAL 4GS7B 5K9OA 4ZTOH 1TZGL 2P8PA 6FABH 3FT3B 5LCVH 4IOIA 1DDHA 1QHPA 3WFZA 4NCC1 4QRRE 4J6RH 1MAML 3QA3B 4ODSL 5FYJU 1CK0H 3ZZ1A 4PD4K 4HPOL 5CINH 2HLFC 2XZQH 1CIUA 3TFKD 3CH1A 5KANI 4EZMA 5BS0E 5I1EL 4D9RD 1MAJA 4IIQB 1INDL 4U1MB 3ZDXE 5KS9B 5GIRA 2X9WA 4KGJA 3R0MA 1QSEB 4BZ1H 4PJEA 3O6FB 4U0RC 4XXDA 5ETUB 4HUVB 1PKQB 1U8PA 3PDOB 1U2HA 1M1SA 3CFKA 2HH0H 3N85H 4XH2B 4ODWA 4KZDH 4CDHA 2XZCL 3HE7B 4PIRF 3LZFL 1EXUB 1MVFA 2ATKA 3EDEA 3MUGA 2F8XC 5IVOA 4BFGA 4DGIL 5A2KH 5CCKH 3SDDA 5F9DC 2AJXH 1WZ1L 1Y6NR 2YEZA 1QSVA 1FORH 1LWRA 1WCBA 3QG7H 2IBZY 1R3IL 3D0VA 4AMKL 4JFDB 3WYRA 5HYJB 4R0LB 5JPNA 1EA9C 1NCDH 5LGJA 1B2WH 4LLAA 2Z31B 2ZG1A 3QB7C 3RGVC 1IM9B 3WDIA 4PGCB 1U8MB 4WI4A 2IMNA 3EYVB 4U1KB 1P7QA 2R23B 3QZWB 1FRGH 4AIZA 4QXTA 4FQ1L 5DMGC 1QQDB 3RVVD 1DVFD 4KROC 1FO0H 1KENH 3AS0A 3ARGD 3TZVA 4M8QA 5CIPH 5DJYA 4HJ0C 3MRMB 3J7HA 2WUBH 2GY7B 2VH5H 1UT9A 4R6UA 2BX5A 1OAZL 2F53A 3WEXA 1QPPA 2BOBB 2H8PA 4NC1E 4HCRL 5EOCJ 2J8UE 3GIVB 2VXUL 4C54A 1HEZA 4KK8D 1R0AH 1RZJH 4IMLA 2EXWC 3NFPA 4L8CA 1CN4A 2UVEA 4JY6A 1LEIA 1YC7A 1G6RL 2P49B 5GSRA 4ZUWB 5F6IC 1BMGA 4IJ3B 4MCYB 2J3SA 4LCIL 4LASH 2Y7QB 4C56B 4JFFB 4BFIB 4HV8B 3QEHA 2OX5A 1CLYH 1ETZA 1HHKB 2Y1VA 3KXFE 4Z7NF 5JQ6H 3GJEA 2W65A 1BBDH 4Z77B 1MSPA 3MLYH 5E8DL 4X6DB 1OPGH 5I18L 2PW2B 4OSUH 5CHNB 4GAGL 3RIAK 4RAUB 4HIHB 4RGNB 1RFDL 4X6EB 4JGMA 4K2UH 3VD4A 2MMXA 2VLJD 3MRFB 1FVEB 1F11A 3KYMB 5GGRA 2LAGB 2ICWA 1KIQB 2DIJA 4DVRH 4Y2DC 5IP4A 1A0QL 4RFOH 3BPCB 1UWEH 3S35H 3TVMA 1X5YA 4DCQA 4DVRL 4XCFL 3I6GB 3KPSE 5HBBA 1ZANL 1UM6H 2NY0D 5ANMB 3HLAA 4O58H 3AS3A 3VRLE 1L9MA 3FB6A 1OGAB 4PGDB 5CP3H 3BN9C 5MHSE 5I75C 4M1GL 2V17L 3B5TA 3C9NA 1V3LA 2RCSL 5T3XE 1VGEL 1C12A 2V5RA 3BT2L 4KV5F 1LNUA 3U2SA 4QY8A 4D0DA 4Y19B 4AIOA 2X42A 4LKXA 1F4HA 1BBDL 1E6JH 1ORQA 3NIGF 4HS8L 4JB9H 3UP1A 4XPAL 1S7WA 1F3DH 1BAFL 3EDJA 4JZNB 1CU4L 4JG0L 4LHJB 4U1JA 4PRID 3W0WB 1JPGB 4H8WC 4KAQH 3S34L 2FSEA 2D03L 2FBOJ 5GISL 3E8UL 1BLNA 5C9JB 2DS4A 1F6AA 2ZUYA 1DSFH 1CWVA 1XFPA 4ACPA 3FB8A 3RZCD 1KEML 2BCKB 3QYCA 5AYUH 1JYXA 3IJYB 2IBGA 4MVBC 4UINH 3NN8A 3BW9A 1GZQA 1ACYL 3MRPB 5IWLC 5BZDB 1M05B 32C2B 3M17A 5HHOD 2M8XA 4R7NB 4MAYA 1H3TA 5KS9A 2MQ0A 4GMTL 2I60L 4EI5B 4NM4L 4NNXA 1F4AA 4U6HB 4S0SD 1FAIH 1ND0A 2X6MA 3UBXA 1S7RA 2OL3L 2XZZA 5C86A 3EKCA 4KVNH 1QLRA 1OY3B 2AK4B 1U93B 1HWHB 1ZHBB 2NY3B 4PRHA 5HI5D 5JXAL 3NCJL 2DM4A 1IKNA 3QQ4B 1RIUH 4S2SA 1H8OA 3BEWA 4X5XB 3R8QA 5IBTL 3TO4A 3LAFA 1I1RA 5F7MC 1RVFH 4XI5C 4MCZB 1MEXH 2PW1B 2I9TB 2KUTA 4D0BA 1RUMH 1DQQB 4NKDB 4ONHB 3RWIB 1BFVL 3MJ9H 5ISZE 1C16A 3KJ4C 4IIQA 2Z31A 1A3RL 4PJCF 4OJFL 5EC2A 1XIWB 3VG9C 3O6FA 2B1HH 3MRJA 2M2DA 4I18A 2YR3A 4ZPVA 4Z18A 3GM8A 1R5WB 4X7SL 5I76B 5E08L 1PZ5A 3CFKB 2Q8BL 3O11A 3GM0A 1T80A 3FO1B 5BRZA 4LFHG 3U7WL 4D3CL 3HE7A 1Q0XH 2MPAH 5EU7C 2AJVL 2C3VB 5D6DA 4JJ5B 1GZPA 5IW1B 4OZFA 2QSTA 1MJ8H 3OQ3B 3E0GA 5JUEH 1I3UA 3H6JA 3Q6FB 1DBML 5B38B 3P11L 2X1XR 1CE6A 4K7PY 4I0PA 3MV9B 4Q9RL 1MI5B 3FQXA 4BSWB 5E8OA 4ZDHA 3VXME 3VMNA 2J6EH 1HOCA 3TF7C 4PJXB 3MV9E 5LCVL 2WLZA 2NW2B 1N6UA 1YN7A 3IFLH 4PJIE 5E6IA 1G7PB 2VOTA 5C08B 1UH3A 1D6VH 3U82B 5GQBA 1AGCA 4Y4HC 5BVPH 5KSUB 3QWOB 4JN1H 5FOJA 1OOAA 1AGEA 1GOHA 3PP4H 3QIWC 3GI9L 3FO0L 2XXCB 4MXQD 3QUZB 1OTTD 1YYLH 1VPOH 3NPZB 2EXYD 5E8NB 3NGBC 1FNSH 4M8QB 5D70H 2XY2A 1YEEH 3EOTH 1YN6A 3EZJB 1MFEH 2AP2A 3FO2A 2FB4L 5DJ0A 3NIFF 2ZSVB 1JGEB 1IC7L 2AKRA 5D93C 3RTQC 5DFVD 2AXJA 4APQA 5CJ5A 1WWAX 3BSZH 3I50H 4TRPL 5C07B 1X7QA 3QDAA 1PW3A 3TVMB 1A4JB 5HDBF 3OR7B 4PJDE 3SGKA 3L3HA 5H2BB 2DQFA 3T0XA 2P43B 1Q0YL 4M4PA 4O2FA 4XAWH 3PQYE 2FEEI 4TOYH 2VN4A 2D0FA 1MQKL 4NM8L 3P4MA 4X8JA 4KKAC 1LNUB 3OKMB 2A6IB 3GJEB 1CVRA 4N5UA 3HPJB 3NVQA 5IMOA 3CVHH 5I71B 1RK0B 2FX8H 2Q1EA 1U3HA 5D2LA 2OP4L 2A38A 2J2ZA 1XF4A 3EOAB 1EEYB 3PQYB 1UKTA 1OM3H 3SE9L 2A77H 2XPGB 3VFSB 2IALA 3CDGA 4NM8H 4QEGA 3V9FA 1JTOA 4NQDB 1HDMA 5DS8A 4ERSL 2PTTB 5IMMA 3SO3C 2VDPL 2G75B 3DXAE 5HY9A 2GEEA 4RNRB 5H94A 5FYLL 3UYRL 3NN8B 3LN5B 1DZBA 4TUJA 1A7QH 2VXSL 3LEXA 3LKRA 1KCKA 1C12B 1P7QD 4A6YB 3WSQL 4N1EA 3DUUB 4GBXB 4N0RA 5FKPB 3EOTL 4LKXB 5IUSA 1J87A 5C0DB 2E3VA 1RJYA 4Q6IC 5EU7E 1ZSDB 5C6TH 1XF2A 4LRIC 2BDNH 4XVSH 4ZUSB 4WRLA 2HTLD 4LPUA 3WUWB 4LVOB 4JRXA 1FL3B 3UTZB 3W9DB 4JJHA 2R0ZH 4H5SA 2Z35A 2D3VA 3MRKA 4X4XB 1MF2H 2DN7A 5BVJA 2P48B 1DBBL 1BGXH 3MR9B 4ZXBC 4O5LH 3H7BA 1C08B 4RMVA 3VFMA 4BQCA 2QR0B 4P5TD 3HMXL 5IB5A 5EUOF 2R2HB 4CW1B 2YXFA 1LGVA 1NMCC 4Q9RH 3PP3K 2X4PB 1RZ8B 32C2A 3M17B 2CJUL 4K3HA 3DYMA 3L7FA 3P11H 4K7FA 5DRNB 3BPOB 2ZNWA 5DJ8B 5EZLB 3VFPB 5D9SB 3LB6C 4MNHB 1A7RH 5JUEL 1A47A 4R0LC 1FNHA 1AHWA 3QHZL 1XGUA 5L88H 3SKMA 1VACB 3SQBA 1HN1A 4U6HA 3E6HA 4L29B 4M5YL 5DYOA 3UYPA 3ALWA 2VL4A 1PZ5B 5SX5H 3HZKB 1RK1B 3GHBL 1A7PL 4OV6F 2AJ3B 1ZVSA 5EU3A 4L3EB 1T0NA 3EBAA 3VXTB 4UBDC 4MNQD 5IMLA 5T3XH 3V52H 4L3CA 4NWUH 3KS0H 2OJZL 1QFWL 1MCKA 4DKFH 4G6JH 4J2XA 3VXNB 4FG6C 1ROWA 3RWIA 5JZ7D 3HC3H 1OSZB 4QRSB 4GRLA 1WZKA 4MXWH 3QULB 4GJTB 2FO1A 4M6ML 4MQ7A 2HN7A 1PX3A 1UACL 4WU5B 2R9HC 4Q97A 5EA0H 3B2VL 4C4KT 3KXFD 1WV7T 4BQ8A 4NO0D 4I18B 4J8RA 4ZAKC 3OF6D 1AGCB 5DJCA 3UTTA 3L3OB 3QWOA 4I4WA 2FBJL 5D7IF 2DD8H 5DHYB 1RURL 1SJEB 5KSAB 1Q9WB 4Z6AT 2NY2B 5FYKL 3V5DA 1XCQB 4MA8H 1QD0A 3FMGL 3KJ6H 4CMMB 5C92A 1H5BB 2VABB 1I9EA 2G60L 1G7MB 1AH1A 4EUPH 1GPOH 1FZJB 2P7TA 1BM3L 2I60H 2GSGB 4XHJD 3GSQA 3MRGA 4MXVF 4D8PA 3HCVB 2VZ3A 4JN2B 1JZ8A 1CE6B 1TTUA 2F54E 3NCEB 1RUPL 3DECA 1O0VA 4U1HA 4WGWB 1Q9KB 5C0AE 1X7QB 4X7CC 1FSKB 4ZDHB 1NFKA 2Y5TA 1JPFA 3QWRD 1NSNL 3RY6C 3OR7A 4ZFOL 3T0BA 4M93B 2AEPH 5BJTA 5FM4A 5F6HJ 4P23D 3ZE1E 5DHVH 2ED9A 5GJTL 5I6XC 3QPQC 5TQ0L 5D5MF 1NUGA 1HXYA 4HKZB 4RQQA 1BF2A 5TQ0H 4FRWA 3MNZB 1G9NH 1X4ZA 3QUZA 3P73A 1ORSA 1UQSB 5GJTH 3BKCL 3GSUA 5I1JL 3GUTB 1FSKC 4FHBD 1I8LA 3VXUA 5EUKA 2V5YA 5DJ0B 1A7BA 3O4OB 5E4IA 1U42A 2DJUA 4JHAL 1CR9L 4KTDH 4P2CG 1WITA 3QIBB 2ZUVA 2Y6SC 3FOMB 1UM6L 5CILL 3IFNH 2CIIB 4P2QA 4NNYB 2GJZA 4NOBA 3ZKQD 2EH8L 1MI5D 3L3HB 3O0RH 5F88B 5B3NA 1FFOA 3VW3H 4PJ7E 1UB6A 4RGNE 3SKNA 1IKFL 3MJ8B 5BS0D 4X8JB 4MVBD 1A8JH 4TNVK 3O3EB 2EXYC 3S4SG 2A6IA 4ZFZB 3VU2A 3FTGA 4YXHH 4GAGH 3MXVL 3KDMA 3EYFA 4XTRD 3HI1A 4RMSA 1XR9B 5DRWB 4HWBL 1I7UB 3STZA 4BQ9A 3CLEL 5EG6C 1T4KA 5FO9A 4CVXB 1NFDF 3HKFA 1ZVYA 1KB5A 1F6FB 4MXWL 3RL2B 5CLWA 3WFBL 3MOQA 4WNQB 3WNPA 3K1DA 4X4XA 4NP4L 5C71A 4JRYE 1QRNE 3PGDB 1TVBA 4F7MA 2E9BA 4LCIH 2VXTH 5D1QB 1OW0C 4X6BA 3VW3L 1IMHC 4KQ3H 2IH1B 4NRXA 2G75A 4H20L 5EZJB 2R2HA 4H8WH 1D5MB 4PY7B 3HNVH 4L8DA 2FIKA 1NGWB 3PG2A 1LO0H 1XGTB 1NMBH 2HA1A 5EZLA 4P5MB 3CLFL 3RWJB 3X3FL 3VFTA 4RGOH 3BVNB 2DLHA 2CDEA 5D96B 1GOGA 3G6JE 4Y1AB 3W11D 1ZSDA 1PKQA 4RFNC 3QEGL 3KHOA 4U2ZA 1HCFX 5HI3C 3WN5B 5A3IC 4PJ5B 3IXAB 4JDZB 4N0FA 1T0NB 5T33H 5I1LB 1QRNA 3EW3B 4HGMA 5IFHH 5GGVH 5HHMD 5DJ2B 2GITB 5IB5B 1XCTA 3HFMH 4O5LL 4J4PA 1G7QA 4ZOAA 4KDTC 4XP4L 3Q2CA 1H3WM 4YH6A 4U6YB 2NY5C 2R0ZL 1VFMA 2RGSA 5C0BB 4LEOA 3PL6A 4FTVD 5TDNB 5HYFA 1YMHB 1RUPH 1JMXA 3MLXL 4A2MA 1Z3GL 4XZUA 5T3ZH 2F58H 4OFKA 1NDMA 2VDNL 5JXEA 4JKMA 3CPLB 5EOQL 3FL7A 2BY2A 5EU6B 4X80L 1YMMD 4HAGA 3UJTL 2HTLC 3EYVA 3KPSD 5F6HI 3U1SL 4NRZA 1CBVH 1J12A 1KUMA 2BJMH 1U92B 2OZ4L 5MHSD 1A7NL 5DMJB 4NKMB 4YBLC 4H26A 5D4QA 3MO1A 4MHHG 3BIAX 1BQHA 2R1XA 1XGPB 1UM4H 3RI5K 4LARL 4HQQL 1TZHB 4JGUA 2AV1B 5B3JF 3RVVC 1TQCB 2F53B 2FRGP 3VH8A 4AEFA 3VXNA 4JKPH 2BVUA 1B0WA 1MRFH 4JY5H 5F7LB 4HMDA 1EHAA 4M6MH 3C2SA 5GGVY 4LSVH 4XNUL 4Z76A 4AM0A 4HC1A 5HYIA 2VDKH 3FZUC 5CWSB 4RDQF 5D6CB 1ZS8A 4U49A 4JHWH 1QFWH 2OJZH 5TDPA 4MNQA 4NC0B 4LIQL 2MCPL 4D2NA 4KZEL 1ZGLP 3NFNA 2OR8A 4P3DB 3KLDA 3GRWA 3H3BC 1OL0A 4OZGE 1AGBA 4Y5VB 1Q94A 2ZWLT 1JF6A 3EJJX 4LCCC 4Z77A 1ORSB 1UQSA 1P4BL 3V6OE 3H8NA 3W0WD 3UYOD 2SEBA 5FM8A 5I17A 2AXHA 4PJIB 4RAUA 4P2RE 2RIKA 3OAUH 4G6MH 4GW4A 1T1YB 2DQTL 4M8VA 2DWEA 4KPHH 1MIML 2V7HA 5E5RB 3CGTA 3C8DA 1WWBX 2IANB 3RGHA 3MRLA 1NLDH 4V2CB 3O2DA 1FCGA 2AQ1A 3QIUC 3GMLA 4KTEH 4GRMB 2ORBL 2BNRD 1FNSL 4GSDH 2N56A 2R0WL 2EE2A 2VO5A 1E4KC 1WZLA 2VDQL 4GXVL 4PTUB 5I15H 3FO0H 5HHOE 3BOVA 4XAKD 3KLHC 5CZXD 1B0GA 1YEFH 4Z78A 3TBSB 1HNFA 1MFAL 5HPMB 4PJHA 3KDMB 3RDTB 1ZMYA 2JJUA 1MWAL 3QWRA 3R0NA 4OZIB 5DRWA 1AKJA 3CUPB 1A4KA 4Y19D 3SGEI 2X4UA 2BVTA 1R24B 4PLNC 3OKNB 1AXIB 4PRPB 2DTSA 3UO1L 1CL7L 2ADGA 5KVGL 1FYHB 3EJZD 5H35A 1FZOB 3MBEA 3B3IB 1RZKC 2VXSH 4LRNL 4B5EA 1M7DA 1BWMA 2ERJB 5CD5C 1DBAH 4PYGA 1R3LA 3MREB 3JV0A 4JFXA 2DI9A 1AXTH 1CXFA 4JFYA 1IAIH 4RRPG 3MRPA 2FX7L 1H8SA 5JR1H 5F7NC 3AREB 1JP5A 5DR5H 1BOYA 4IOFD 43C9B 4KVCL 4D3CH 3IDYC 2Y6SD 5F70A 3VFTB 3HI5L 1RUQH 3DMMD 1I1FA 3OZ9H 3RVXD 2HVJB 4UZGA 4ZUTA 5GRVL 3STBA 8FABB 4OIIL 4Y1AA 1FZMA 2RHEA 5AG8A 4X9HA 3S37H 2NTFA 1YNTB 1A3RH 4DW2L 1LD9A 1GXEA 1AGDB 3JUYA 4JDZA 2DKMA 1ZLUH 3MV7A 4KDTA 3FT2A 3WJJC 4O00A 4XWGL 4Z7QE 4D0BB 1V3JA 4UAOC 3B2UC 4YXKL 1PG7H 4IDJH 5FA4B 3CMOH 2FATH 2NY5L 3QFDB 4POYA 1NGWA 5HGDA 3QQ3A 2VC2H 5AWNH 4KUZH 4HZAA 3JWOH 4LL9A 1I1AC 3QXDB 4PP1C 5EORH 1A6UH 2JB6A 4KKCD 4YXLL 1PEWA 1N7ML 1CDJA 5EU6A 4KPHL 4GG6F 2WK2A 4K3EL 5DMIL 1TLKA 2Q87A 3ULUC 2EC9U 3QUZD 1TMCB 4NM4H 3FONA 1CXIA 5GZND 5BRZD 1U8NB 1OAYL 1BD2A 1A6ZA 4BELD 3HI6H 2X4NB 5BVPL 4M7LL 4FZEH 5KAQG 1SYSB 3P4LA 1N0LA 4K8RC 5DJ2A 1UYWH 1TZHA 1W2KT 1J8HD 5J4MA 1YY8A 1T22B 2XNAB 1WAAE 2IAMC 5GS1C 5I1HL 3QFJD 5IVZB 1F4WL 1C5CL 4RDQG 5IK3A 2MKLC 3IVKA 4LU5H 1HOCB 4H1LA 5D6CA 1KNOA 1JYVA 4S11A 4P4RA 2IQAB 3ZT7A 4P2YA 3G6AB 5KSUA 4DFIA 1L6XA 1KB9K 3FQWA 4LRIA 3WFDH 1SEQL 2AJYH 4K7PL 1BQHB 1U8HB 3PHOA 4OD1H 1YN6B 4O51B 1WFTA 4JGJA 3QAZB 2PYFA 3OV6A 3H3PL 1CBVL 1JGEA 3U46B 4Q58C 3VH8B 3ULSB 1T1YA 2DQCH 3MOAL 4APQB 3OB0H 1UCBH 3OJVC 2ZZUT 2V7HB 4L9LC 2VXVH 4H88L 2IANA 2OBGA 1N6QL 3EO0A 2HT2D 4LSPH 3GMLB 4XXCA 4C57C 4QRPE 2VJXA 4O4YH 5TJWK 1KPVA 1JN6A 5DSCB 4B53A 1RZIB 2BMKB 1X5IA 2W60A 1PKQE 1AGBB 3DBXA 4XNZC 2HT4C 4P5TA 5C0AB 1T20A 1YPZF 3C5ZD 2A6DA 1PBYA 4QT5B 4HUXA 4JG1L 1QNZH 1RV6X 3WHXB 2VDLL 4BSJA 2C1OB 3H9SB 3QXAB 3UTSA 4DWHA 1HH9B 1ZA3A 2BRQA 1G6RH 1TVDA 3BJ91 2VERN 4P23C 3HE6C 5JDSA 1R0AL 3TYGH 1G9NC 3PWVB 2DWEB 4GMTH 5L7XL 2YMXL 4XPGH 1AC0A 3RI5F 4IRSC 1IGMH 4UV7H 1R5IA 1XGRB 4LF3A 1LO0L 3S97C 3OXSA 4RNRA 5H94B 5T5NG 3WL9B 4GRWE 3FOLB 1WLHA 4R96A 4UOJA 4MA7L 1N5AB 2BVQA 2D7TL 4R8WH 3QDMA 2XN9A 4YHML 4Y5VC 3MRQA 4HMCA 1YPZA 4WI9A 43C9A 1J11A 4NQCE 4U1SA 1N6VA 2VDLH 1J1OH 3Q1SH 3D18A 4L9DA 1JMZA 5CP7A 4H25B 3IDIB 1CFTB 4OI9A 4JDTL 4R90H 1H5BC 5DRXB 4PJFA 3EDKA 6CGTA 2CRYA 1FZMB 4PTTA 4M43H 4OTXH 2AK1H 5GRWA 1R24A 3OKNA 5CSZA 4BH7A 4HWBH 1H0DA 4PJXE 4P59H 3MNVA 2A9NL 5K9OB 5K9QI 5GHWH 5H35B 1NFIB 4ZAKB 4AMKH 3MRKB 4QOKA 4IOIB 3U79A 3QG7L 4XPHL 1S7TA 4ZUUA 3MR9A 5FEBA 1HILB 2YPKA 2ZP0T 1I3RB 3QI9C 2YD7A 1C8PA 2UZIH 4DGIH 1SJXA 3RZCA 4F58L 3DV4B 1SYVA 3VWKD 4P9HH 1EV2E 4OCMC 4PJFF 1ZTXH 2QLVB 3GMMB 1NFDB 5D7KD 5C0FA 4XPHH 4YHZL 4PJ8C 1QR1B 2DJ4A 3E6HB 4IIQC 4OB5L 5HYEA 1TENA 1TCRB 5ETUA 1T7XA 3UPRB 4JHAH 2VXQL 3CXHJ 4BUGA 1JJUA 3SKOA 2E5EA 1GGUA 3VFRA 4ODWB 3LSOB 3ARVA 1ZWIB 2KPNA 3QNXB 2ATKB 5DA4A 3VXTA 1I1AD 4JDTH 3D9AL 4PRPD 1H3VA 2EH7L 2LV4A 4J7RA 2E8YA 5FUZH 1TJHH 4F7TB 5IWLA 4M9OA 2PYED 5HPOA 4K8RL 1A02N 3M1BA 2YPLE 5JXEC 5CGYC 4YHPA 2I24N 4PRAB 3BGMB 3QISA 3KPNA 5B39G 3MODL 2F54D 1UWGL 5IK3B 3ARFA 3QQ3B 1N5YL 5DWUL 1D5BB 3QG6A 3O6LH 5HVHB 2AV7B 4OD2A 4KKLD 5E95B 4XVUC 5HYJD 3DVNB 2DQUL 5KN5A 4V1DD 1N3NB 1WAAF 3DJ9A 1P7QB 2R23A 4X0KA 5SV4A 3TYGL 4I4WB 3JV6A 3QRFM 5I9QC 5MENA 3NABL 3SCMD 4K3EH 5DMIH 1T7WA 2DLTA 2X4NA 5ALCH 3ARSA 4RAVA 4LHQB 3OBAA 2OSLB 1EEUA 4DQOH 5IGXH 3I75B 5AAWA 2NY2D 5D7IA 4PG9B 2GHWB 4WI5A 2VLRA 2VZVA 3VFGH 3MA7B 5I1GH 3V8OA 4OFYD 2IJ0C 3QEQB 1LO5B 1G7HA 1K5NA 1E4WH 3WUWG 1IGIH 3BZFA 4S10A 1MLBB 3IVKB 1UZ6E 5JHDA 1QO3B 1WAAA 3F6LA 4QRQA 3ARWA 5GGTA 4XAKE 3K3QA 2IQAA 3EYQD 4P57A 4ODTL 4OCRL 3PWJB 1YQVL 1UCBL 4MAUL 2X4RA 3G6AA 3C6LC 4UUJA 1VHPA 2QL1A 1OAKH 4DZ8B 3CD4A 5GGUA 1IZKA 4NWUL 3TIEA 1HQ4B 1UZ6F 1FIEA 3OX8B 4OIIH 5M7QA 4K7PH 2AJYL 3RJQB 5CZXC 1WEJH 1FV1A 1KELL 3FCTA 2PXYC 5AD0A 1PG7W 5A16A 3BIKB 2J8UB 3C09B 3SPVA 3TJEL 1INDH 2ADJA 1KIUA 1K2DA 3BPCA 3FOMA 3ARBB 1CTOA 5EZOH 4N90E 1R5IB 4F9LC 1WT5A 1XMWA 4LRNH 4AH2B 3TVMC 3ZE1F 5GGSY 3UO1H 2XY1A 3LKOA 3GJFH 1FE8L 3FQRB 4E41D 3VXSD 3CC5B 3RWFB 6FABL 4Z8FH 1MWAH 5FO7A 1UYWL 4QY8B 3P0VH 4JR9L 4JDVB 1J0YA 2EDYA 2DLEA 1MH5B 3OJDA 5ALBL 2AW2A 1K8DB 3UTSB 1XR9A 4KI5D 3DMMC 5CSGA 1ZA3B 3RWEA 4HCRA 1OAYH 1VESA 5JIHA 5DFWH 3ARGC 5I0ZA 4OM1L 4CVXA 1KYOK 1HI6A 5DJZA 5CD3B 5C9JA 4NBXB 4PJAE 2C3WA 2OTUA 4Z7WA 4P9MH 1HILA 2YPKB 2P8PB 1BZQK 3OXSB 3Q5TA 5BZWA 3RZCB 2ZOLB 2NLJB 3WFEL 1A22B 1U41A 2E6QA 2XN9B 3T1FA 4LLVA 1RHHB 3HR5B 2VMFA 3WIHL 1N2RB 3BGFB 4U1SB 4ERSH 1DE4A 4XWGH 3D3VA 1HHHA 3RAJH 1T1XB 4X8XA 4KJWC 5FYJH 3UJJL 2A1WL 2B4CL 1SQ2N 3G5VB 2E6PA 2L7UA 2WNGA 4XB7A 1QLRB 1QRKA 1YNLH 5F7KC 3L3GB 4F33B 2BSSA 3U36B 8CGTA 1H0DB 1AY1H 4PJEB 4XXDB 2VR9A 5D6DC 1KEGH 5KW9L 5B38G 4YHNA 1FNLA 2E7BA 4EUPA 4XH2A 1J05A 4HDIB 4ODTH 3DRQB 1RUQL 2I9TA 5HYQB 4MD5B 2XV6B 4WFGE 5ENWA 3V0VA 4JFPA 2K1MA 1KN2L 2DI8A 1RJZB 3RX5A 4PRAA 5FA3A 3SDCA 1EVUA 4MSWB 1U91B 4QRPA 4U6YA 5T1MB 4YHIB 1JWMB 4P2OC 4Z7NE 4TTDC 4N0CC 1DBAL 2AV7A 4OD2B 3GMMA 3WD5H 4Q9BA 4Z7UB 5EC2B 2XRAH 4PV9A 2CKBA 3HS0A 5A3ID 1XIWA 5C0NC 1TCRA 2OZ4H 3OMZA 3RBGA 3WNOA 4HUUA 2NPLX 4TUOA 3SGDH 5MENB 4NQTA 4JANB 1KN4L 3BPOC 4QXGL 1ZLVK 4OM1H 1BZ7B 2CK0L 2C3VA 4RAVB 1NGQL 3O3DB 1XGPA 3ULUH 4ZAKD 3HRZB 2VLRB 1CXHA 2AABH 2AV1A 3DX7A 4YHPB 3ISWA 4UMGA 3ARYA 4U1LA 1DBJL 4X6CE 3KPNB 3WNMA 1BJMA 1P2CA 4Z8FL 4OCWL 3FQXB 1NCAL 1ONQB 3Q6GH 1FE8H 4KWUA 4Q7DA 3T08A 1MLBA 2FGWL 1D5BA 3Q5OA 3QDME 4XNYL 5J12B 4K8RH 1CT8B 3TC9A 2NW2A 1HYSC 4OQ1A 5C08A 2XFXA 1FG9C 4WTXA 5EZOL 5D1ZC 1EVTC 2NCMA 1AGEB 4BFIA 5GPRA 4Y5VA 3TJEH 4PB9L 3DRTA 1HQ4A 3OX8A 4EQ2A 3KPMA 1DL7H 3RUGA 1MHEA 1RY7B 1BJ1H 1ZHKB 3TA3C 1FG2B 3MBEC 3INUH 2O61B 2R0KL 5I8OH 1LK3H 1ZTXL 2ZSVA 4BZ2L 4HHAA 1HXMB 4HXBL 4H0HB 4F9LA 1A14L 3BPLB 4NC1C 2PO6D 1NBVH 1HYRC 2MCPH 4B7IA 2CIKB 3UJIH 1YEDB 1QO3A 3AAZB 3MQIA 3FQUA 4HK0B 1JV5B 1F4XH 3BISA 3ZSTA 3R06B 4LSVL 2XA8L 3TIDA 2WINB 3L5WA 3TJHD 1ZGLB 1P6FA 3O41A 1E4WL 3CDCA 3RWFA 2GCYA 5C7XL 2EC9T 3ZKND 3TIEB 4Y4KB 1PX4A 1G0XA 5F44A 3VXPB 2WSKA 4TSBH 1OGAA 2IWGA 3FN0H 3OJMB 3TBSA 5HPMA 2VDRH 4XP5L 5JXAH 4LAQH 3SCMB 4JVWA 1ZLWK 4D0DB 5B22A 4OZ4B 1K4CA 1A4KB 4HBCL 3V6OC 3IDJA 3QUKB 4RWYH 1J1OL 3P0GB 3PQYA 4PRPA 4WFEE 2LFGA 4OGYH 3VXUE 5TF1H 4NCC2 4YHMH 5JTWA 1I8IB 2ZPKL 3WS3A 1PAMA 5IB3A 5D5ME 4YC2C 5D93B 5FAAA 4Z7WB 4M5ZH 3QEQD 3C5ZC 3T0WA 5AUMB 1DR9A 1IGCL 2H26A 4C83A 2DTMH 3JWDC 3L3IA 2DQUH 5C6PB 1ACYH 1QUNA 4JFYB 3NTCH 4LNRB 4P4KB 4FQ2H 4QHUB 5DHVB 3IDGA 5F8RC 3IJYA 1OAXH 2EKSA 1MY5A 4KROD 3D3VB 1NC2B 5GGVL 3T2NH 2R29H 1T1XA 1G9NL 1TZIA 4XBGA 4WUUA 2D03H 3KLAA 2EH7H 4L4VE 1MCHA 2EDOA 3GSNL 4PRPE 2GK2A 1BJ1J 1Z6JT 3AU1A 3GIZH 3UTZA 3W9DA 4YHNB 3MACH 1U93A 3CXDH 4NZTL 1QA9B 2GYSA 4G6FD 2VXQH 1IQWH 1JUFA 2X1QA 2L7JA 3DETD 4WU7B 3UZEA 3NTCL 3HC0B 1KFAL 4D9QD 4IRSD 1NC4B 4CKVX 1J8HE 1F2QA 4Y16C 2MNUA 1ZANH 4F57H 4M5ZL 3QUXA 2VSDA 2WP3O 1RZ8A 3BE1H 3QRGH 3O8XA 4P9HL 3DSNA 1L0XA 5DJ8A 5FUCC 3VFPA 1CD9B 3QXDA 1H8NA 4JQIL 4NKDA 4ONHA 2HKFH 3H3PH 4NIKB 2NY1D 2R9HD 1A0QH 4UNUA 1UXSA 1VKXB 1T1ZA 3PWPA 3VFUA 5A1AA 3QUMH 3H9HA 1SY6H 3QO1A 1RURH 4D9RE 1KIPA 2ADIA 2AJUH 3SDAC 4Y2DD 3MV11 4HUUB 3WFDL 4XP5H 3NIGE 2BSSB 3RWGB 4AT6A 5CJXA 1BD2B 3KJ4B 4GUPB 4P2OA 4OSUL 1Z9MA 3VWKC 4JFED 2AJ3A 1GHFL 3KVQA 3OL2A 2ZG2A 1T5XA 5E8DH 3HC4H 3O6FC 4U0RB 5I16B 5BRZB 5TPWH 4NC2B 1GSMA 4OTXL 4M43L 2YRPA 4M7JH 4YPJA 5ENWB 4JFPB 3HC3L 3QSKB 1YY8B 1IKFH 4HIXH 4AEEA 5FCUL 1J1PL 4G6JL 2ERJC 4DKFL 1JIBA 3T3PE 2H32B 1AQKH 1Q9OA 3BIBX 5B38A 3D5OF 2A0LC 5T3XL 2B0SH 3L3JA 3MV9A 1OP5H 4ISVA 4BSWA 1MJ7L 2AXFB 5ADOH 1N26A 5EPMB 1MHCB 4KY1L 1AGFB 1HHGB 3EFDH 4PS4H 3QUXC 5E2VH 4M48H 2C4FT 4CDGC 3RZCC 1E28A 5FUOH 4JANA 3H9SD 3O2VH 1AD0B 2BSTB 3I3DA 5I8EA 3MCG1 2UWEF 1IAKB 4GW1A 3FQWB 3V5DB 1XCQA 3W0WE 1MHEB 2Z9TA 4FQQA 5IJVA 1S7SA 1LILA 1G7MA 1I8KA 4P2RD 5I1IL 1YQ2A 3DO7A 3G08B 1A6UL 5EORL 2FECL 3SDXA 4I9WE 2HFEB 2FGWH 2FH8A 2NY5H 5JLZB 3CMOL 2NY6D 5EBGA 1FP5A 3Q3GB 3P77A 2Y5TB 4MHHI 4E5XB 5CEXA 4DOHB 1QPXA 4A6YH 3SN6N 5C07A 3IDNA 3B83A 3CAFA 1A4JA 3TEUA 2WINA 5H2BA 1ZHNB 4HKJA 4PYHA 1XZ0A 2BDNL 4JO2H 3S35X 3CK0L 2IH3A 4BK5A 2JIXB 3BQUC 2JE8A 2YUVA 3E6FA 2DQCL 3P9WB 4OLWL 5IBUG 2P24A 3WBDA 5C0AA 1MRCH 3P73B 5C6WH 3KPMB 3N9GH 3RUGB 3SCMC 4ELKB 4NQDE 5KOMC 4G6KL 3BDBA 3F12A 4Y5YA 3VWJD 3PHQB 4X7TA 1S7VB 3VGFA 4MDIB 2LTQB 3GB7A 3HPJA 2WQRA 3OXRB 5JOPE 1RK0A 4HHAB 3KYOA 5E7FA 1HXMA 5DR5L 5IV2B 3W5NA 1VERA 3JVGA 3SE3A 2BVPB 3BKMH 3EIFA 1S7XB 4YHKL 4NT6A 3X11A 1M6OA 1J0IA 4LQFH 4NNYA 1BVLB 2IALB 2VLJE 3K2MC 4XVJL 4JQXA 1UACH 1FVCA 1FFOB 2D9QB 1SJHA 5CINL 5DJDA 2YPLD 4F15B 4LCCA 3N1FC 2EE6A 1YPZB 2DMKA 1LDSA 4J6RL 1CL7H 1CIDA 1UJ3A 2GCYB 1J8KA 4JO3H 2EKSB 5ICYB 5CP7B 2FJHB 3V52L 4XRCA 1KJ3H 2W9DL 3NIDF 3SQOL 4DTGL 4HZLA 3RKDC 5F6IB 2NXYC 2AJZA 4FZEL 3UC0L 5B4MC 2BC4B 1RJYB 3LQMA 4PJ9C 5FO9B 5D1ZB 2YN5A 4OZGB 3DO3A 4GXVH 5I15L 4KK6D 3KPLA 1P4IL 4KHXH 3D69A 1WIUA 5D1QA 1U3ZA 3I50L 4DVBA 1W0WA 4M7ZB 5BVJB 4W68A 4JFFE 4HKBB 1IAOA 1NJ9A 3VFNB 2I07B 2VC2L 4QHUA 5EDXA 2VUYA 5C08E 4P46C 5EBWB 5A43C 5T1KA 1F13A 4JKKA 2B2XH 2X10A 5FO8B 4MX7A 1NFDA 3GMOA 3ECBA 3CMGA 1P84J 4LHUA 4EI5D 1DN0B 3RGVB 1UM5L 1XGUB 1F90H 2BNQB 3SKOB 4ZD3H 3WIFB 4UT7H 4WTZG 4XVSL 3P0VL 2GJJA 4JR9H 3KPPA 2ARJA 1KBGL 5DT1H 4N0FB 3K1KC 1RZKH 3F7VA 1QA9A 4KZEH 3U0WH 4OIAA 3RVUD 1EAJA 1K9TA 4CGTA 1ZVSB 4JHWL 3ZMRA 1U6AL 2NY6B 2WWMC 43CAB 5IROA 4OLUL 4KKAD 2D4DA 3VXMB 5DVMA 5JOEA 4FQHA 2FYYA 1BJ8A 5C0BA 4KVCH 2H32A 2I5YH 1Q9OB 4JY5L 4UT6L 1EFXD 2ICEA 2UWEB 2RAMA 3L3JB 1YA5A 5KAQF 4GRLB 4R0LA 3ARZA 1UM4L 4ISVB 2Z92B 4OCSL 4ZOCA 5DD5L 5KN5B 2AXFA 2H2SD 3NFSL 4XMKH 2I5YL 1FFNA 3MNWA 4NRZB 4YDLC 4RISL 3ULUF 1NCBH 4G8GB 1LEGA 3CFBA 4GUPA 5JMRA 4E41E 3VXSE 5JQHC 1A6AB 1VADB 3PDDA 3U1SH 2Y5EA 1JHTA 4TSAH 4OLWH 1RZKL 2WANA 2CR3A 4GKOA 1YQVH 4GLRI 4XP9H 3FZUD 3LN9A 3BGFC 1JFQH 1YEFL 2VABA 1OP3K 3ARDC 5E8EA 4LPTA 3T2OA 3HG1E 4A6YL 1AJ7H 5IVXF 5HHPB 2GSGA 1RJLA 4Z76B 4GG6E 3DX9A 2R2BB 3HCVA 1V7NH 4JN2A 3B8YA 4QRQB 1PY4A 1UFUA 1CDGA 1RIUL 3O4LA 4PJGE 1IEHA 3CDFA 5IFHL 1MHCA 3VRJA 4WFFD 1Z5LB 1HHGA 4JY6B 2X4RB 5F1NB 4ZUWA 4HUMB 3O3AA 4ZXBB 5B39A 1SEBA 5DZNA 2HTKC 1LK2A 1IAKA 2A73B 5EOTA 3SJVA 2W0FB 2ZOKA 4JY4B 2OI9C 4HKZA 1KTRL 5IFAL 3F12B 4M7ZC 4H0IA 5I66B 2YD3A 1T6WA 4P5TC 5AD0B 3GI9H 3LQAC 4OLZH 3DO7B 3GSUB 3QIUD 4M48L 3U9UA 2APVA 5A16B 1P4BH 3BIKA 3RWCA 1SBBA 2HFEA 4YQXL 4JPVL 4C4KO 1MCQA 2NX5B 5DK2A 2RJMA 4NQXB 1UVQB 4UDUA 4PREA 3MRLB 5SWZA 5GGRB 3WE6A 5HGGS 1MFNA 1OAQL 2F54B 2J6EL 3WJLC 1FVCB 3ARBC 1IAMA 4YWGL 3CX5J 3D39B 3QJHA 1PQZB 3GSOB 3PABA 3VDBA 3D9AH 4EJ1C 1UENA 4NKOA 5F9WC 4D0CA 1UJ3B 5TE4H 1S7UA 5E9DB 4R3SB 2YUXA 5ICYA 1B0GB 2YD2A 1NAML 3SKNB 1YECL 3RTQD 4FQXD 3ROOB 2E6JA 3RHWK 3WJLA 1T5WA 2CK2A 3MGAA 4QGTA 4ZFZA 4GMSH 2RCSH 4MDIA 3VJ6A 4QO1A 2X4UB 2AJUL 3K74B 1IILE 1OF2A 3OKEB 4YUEL 5D1ZA 5BV7B 2B8OT 3BQUD 2BJML 3LPGA 4DFHA 3VXRB 4OF7A 1OTUD 1UB5A 3AC0A 3L5HA 1W0WB 4HFUL 5BZWB 2ATPB 4M1CD 1TVBB 3C60D 3P30H 3MGTA 4HKBA 5HVGB 1NJ9B 4X6BB 1RZGB 3ARRA 3U83A 2GT9B 3RVWC 3SDYH 3MOBH 5FCSH 4X6FA 1N2RA 1JPTH 3S98A 2APFA 5IF0A 1IQWL 4MX7B 1RVFL 3WMSA 1FFQA 1AE6L 1IGFL 4J3SA 3OWEA 1MCDA 3D0LB 3HHRB 1FIGH 2AJZB 5A2LH 5C3LD 3L3GA 1P7KB 5EO1B 1JL8A 1PLGH 5F9OL 3TH4T 4EDXB 3KPPB 1QBBA 4PJFE 4OZGA 2Q76A 4XCCL 4PRIE 1J05B 2CLZB 4AL8H 4TVSa 3MGOA 3FT2B 1WJ3A 4Y4HB 1U8LB 4Z7QF 1XF5A 43CAA 1L7IH 1N4XL 1YJDL 2HT3D 3I6LE 3LV3B 5KVMC 2M26A 5FA4A 3CLFH 4FQHB 3X3FH 1FNAA 4G80B 5HGHB 1ACZA 3EFDL 3BH8B 4KY1H 4YNYA 2ICEB 3L5JA 1HYSD 2IF7A 4W4OA 3HNVL 1JRHL 3PL6B 1C16B 4H20H 4WO4C 3GDBA 5CGYD 3ESVF 5B4MD 2LU3A 4YJZL 1FHGA 5DD1H 4HIXL 5IB2B 4JFZL 2B5IC 1U8NA 4PLKD 3ULVF 3MRJB 4M7JL 1IEBA 2FBJH 2GFBB 2OYPA 5I76A 1SVCP 3FO1A 5L8KB 4NKMA 4UV4H 3HRZA 3BT2H 3AMLA 3MROA 2NY0B 4M7KH 1XIWC 1R3IH 5EBLA 3MOBL 3QDJA 1H15B 3VCLA 1OGAD 5E8EB 5IVZA 4JZJA 3BO8B 1BD2E 3X17A 5C0ND 2P4AB 5HGAA 2E9JA 1KJ2L 5E56A 1JPST 5JORA 4XNXL 3T09A 5E5MB 5C2UB 1YEIL 2EH8H 3RZWA 1MCJA 1FFNB 3EYUL 3WIIL 4OD1L 4F57L 4POUB 4YUEH 4MA1B 5CILH 1LK3L 5I8OL 4XVTH 3OGOE 4MNQB 4JE4B 3HAEA 1RFDH 3MXWL 3VGEA 4B41A 4Y4FD 4BZ1L 3PJSB 4CJ1A 5CBAA 2Q86A 2W0FA 3G5XA 5FUCE 4PB9H 3CXDL 4NZTH 5TFSH 3VD3A 1OWRM 3MACL 2CKNA 4K23H 2GI7A 4HULB 4ODUA 5I1EH 4MJ4A 2O61A 1LMKA 2XA3A 4G9DA 4PY8I 1ITBB 2PUQT 2VRAA 4Z95L 1X5LA 1UJTA 1KPRB 4FXKB 4OLYH 4PY8J 3TT3L 3HRPA 2AKRB 5E00A 1J10A 4G9FB 3HMXH 1I9RL 4YX2H 1E0OB 3O4LB 1T83A 5E0QA 4J3TA 3R06A 1CGVA 4UBDD 4S1QL 3VRJB 2I9LB 2OQJB 1DEEA 1EEZB 1WF5A 2AABL 5ELIA 4IHOB 3O41B 4F37K 2A6JB 4MMXC 1BPVA 1S7UB 1WCQA 2DTML 3O45B 4Y4KA 2WUBL 1BVKB 3ULUD 2HLAA 3AROA 1T20B 4X5LA 5K9QG 2YD8A 3SE4A 5F7FA 2H2SC 3OKMA 5I66A 1QZ1A 4QXGH 4PG2C 1K4CB 1VENA 3QXWA 1O7VA 5J6GB 4AY0A 3C5ZB 3WSQH 3UAJC 4ZO8A 3ZYZA 5D2LB 5DVOA 3STLB 2XRAL 1JGVH 2EDXA 3MRBA 3TP4A 4NFDA 5HXMA 1YDPA 4JFFD 4GKNB 1XEDA 1XGRA 1BOGB 4MWFB 5FYKE 3J8F7 2DICA 1YEHL 4PB0L 1PYWA 4XCYB 5CP3A 3TH2T 1T0MB 4K9EH 2NY1B 5HY9B 3QIUA 3BYTA 3IDGB 4OLEA 1MCFA 1FORL 2A77L 3GZKA 5IR1B 1OM3L 3SE9H 2EIBA 5GXBB 4R3SA 1G6VK 1Y6KR 2AK4E 5JOFB 2Q6WB 4X6CB 3MV01 3IDMB 2F15A 2P5EE 4G43A 1T5WB 1NBVL 2RQ8A 3LZFH 3DGGA 4HJGB 4R4NC 1I1FB 3VJ6B 1ZT1A 2R2EB 3NIDE 2W59A 1XH3A 5J11C 3OZ9L 2FDBP 3GHBH 1H3UA 4ZQKA 1XF2B 5HGBB 1QFPA 3OHXB 1MQKH 1NFIA 2D2OA 2Q76B 5FB8A 5HHQA 4IRJA 2FEEL 3X13A 2DRUA 2P47B 3MFFB 4GG6A 3U4EB 4KJQD 1DDHB 3LV3A 1QVOA 5FM5O 3U48A 1VGKA 2P8LA 3QZWG 1E4XL 3MGTB 3H7BB 3VFMB 3QA3A 1OGTA 5FXCH 1SYVB 2IAMB 5D72L 3RKDD 3TT1H 1CCZA 4L8SA 5F93C 4X7DC 1LQSR 1VEPA 2APBA 2VYRE 1W0YT 4P2RA 2X4PA 1KB5L 2JCCE 5CD5D 4GAFB 4CRPA 5KVFL 3V0AC 3B43A 5ADPH 3QO1B 2YWYA 1KBGH 5DT1L 2VN7A 3U30C 3OAYH 2WZPD 1D9KD 5DC9B 4QHNA 4ZD3L 1IGTA 4Z7OF 3QNYB 3C60A 2X7LB 1T89A 1LO4L 1TJGL 3TFKC 4B0MM 3ULUL 5EU4B 3QNXA 2EE9A 5C07D 2WBWB 5DD3H 3TPUA 1JYNA 4N68A 3O6MH 4Z0XB 2HMID 3MUZ1 4YZFF 2FL5A 5ADPL 3M1BB 4GW5B 5T1LB 5C9KA 2Z0BA 3BGMA 3QDJB 3LS5L 5C09A 1LP9A 4DAGH 4X4YB 3TN0C 1T2QL 1NL0H 2ESVD 2VE6B 2ID5A 2HJKA 3ARFB 5HHME 5KSBF 2F5BH 4TNWF 5ID0B 2VUOA 5D1XA 2X9XA 2Q3AA 3OAUL 4G6ML 3C2AL 3BRFA 3O9WD 1N3NA 1IAIM 1KNOB 5IVXB 4I3SL 1G7JB 1EFQA 4P4RB 1RZJC 1KN2H 1E28B 1Q0XL 3W5MA 3R4DA 5F71A 4C59B 1KELH 4TNWK 4X7SH 1X5GA 5DJCB 5DZLA 1KB9J 3UTTB 4NQSB 5HI4D 3NMEA 5EO0A 1VB9A 5KZCB 5HDQH 2YZ8A 1T7YA 5I75B 1S7SB 2HFFA 4PR5B 4U2YA 3TNMB 4L5FH 4LIQH 4MGXA 4PLJC 5C3TA 1CFSB 4F7PA 4G9FE 4DKAA 5JOPD 3LKSB 2H2PD 5EBLB 3GSXB 5KSBA 3CX2A 1EUTA 2BK8A 3OKOA 3MRMA 3VCLB 4O51A 3MJ9L 3QI9D 3B9KA 1NC4D 5FF6A 4XPFH 3U46A 5BS0A 3BZFB 4ZS7H 4CADB 1SHMA 4WO4D 1B3JA 4D8PB 4XAWL 5JORB 3HAEG 3S3JA 2V7NA 4XPBH 3IDNB 2ICES 3I2CL 4P57B 4HQQH 3R1GL 2XZAH 4LPYA 4RGNC 3CSYB 3EJYC 4UUJB 4IHOA 1CG9B 3BN3B 4RMWA 4MCYA 1KPVB 2FLRT 3IKKA 5GS0C 1CQKA 4DQOL 5IGXL 2DQJL 5DHXB 5C08D 3KWWB 2JIXA 5TGBB 3TNNA 2IPUG 1WFUA 1BVKA 3UDWC 4ELKA 3MV8B 2VLKE 2HTKD 3L6FA 2OL3H 2W65B 1MRCL 3QIBC 1QFOA 5E99H 3OKKB 3UJTH 4UIKL 1D6EB 4QT5A 4U3HA 3QJFB 5DZOA 4NYLA 3KYNB 4WVRA 2VDNH 4ZOEA 4CL7A 1AIFA 3PP4L 1NLBL 5E2UL 3MRBB 3MLWL 4N5ED 4GKNA 1FVEA 5E00B 5D2NC 4K3GA 1OQXA 3VRLF 1JNNH 4XCEA 1SBSL 1DEEB 1DSFL 4YR6A 3E3QC 4JM2C 4X99B 2Z8SA 1ODAA 3I3BA 2IEPA 1FCCA 3E8UH 3I6GA 3WL9A 2Z8RA 4PRNB 1CLCA 2ITCB 1FH5L 1UWXK 3CU7A 3DYPA 2HLAB 3QDMB 3QIWA 4YPGA 2Q6WA 1U8QA 1QFWI 2BNQD 3AM8C 3QNZB 4G43B 3CVIH 1E6JL 4OUOA 4YDKH 3RWEB 3LY6A 2V5SA 4LP5A 3IDIA 1FDLL 1ORQB 3GHEL 4U1IA 1MCPL 3LKQB 1S7WB 5E2VL 1KGCE 5E03A 3BP6A 5EFIA 3HTLX 4R26L 4XCFH 4HKXB 1RMFH 3LRSB 1EPFA 5KSAC 3T0EA 4QWWC 1IQDA 1A2YA 3PGDA 2C5DC 4F7MB 2VAJA 4M62H 3IJHB 5D5MA 1KJVB 4MA3B 2BCKA 5HJ3B 1P4LA 4HIIA 1T66D 3VFNA 5HDOA 1BF8A 1QLFB 1JYWA 1CYGA 5FO8A 4PJAA 2VL5B