5EZJB

Crystal structure of fab of parasite invasion inhibitory antibody c1 - orthorhombic form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
213
Chain Sequence
b'SIVMTQTPKFLLVSAGDRITITCKASQSVRNDVAWYQQKPGQSPKLLIYFASNRYTGVPDRFTGSGSGTDFTFTISTVQAEDLAVYFCQQGYTSPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab c12 heavy chain
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezjB01
4GFTB 3DMMB 5IVXE 2OL3B 1JBJA 4PV9A 5IJVB 4R0LB 3GJFH 1QHPA 3RBSA 4Y89A 3CLFL 1KULA 2DWEA 4LKXB 1MCIA 2GAZB 1U8OA 1Q9KA 3C5ZA 3RY5A 4LCYB 4W6YB 1KCSH 3O2WH 1BGXH 3T1FA 1S5IL 4Z8FL 4PGBA 3H2WA 3S36L 5JHDB 4WCYL 4HKJB 2NY1D 5C8JA 5EU6A 3GGWA 2BVOB 1R3HA 3MRMA 2XY1A 1L9NA 1H5BC 4WGVB 1DLFL 1WFUA 2Q8AL 1WSST 4L9LA 5KSVB 2X4SB 4C56B 3B6SB 3RTQB 3Q1SH 3ULVD 2B5IC 4XCEA 1F11B 1NGWA 3PWPE 3SDCB 1WT5A 4FQIL 3O4OC 4XAWL 1KGCD 3CH1B 2OJEA 4YO0A 4UQ3B 5KZCD 4PJGB 3QHZH 5T3ZE 3FJTA 3H0TA 4RMVA 3AC0A 3ZKMD 3BW9B 5C07D 4M6NL 2K7QA 3AU1B 1A1OB 4QXTB 4XWOC 4FS0A 4LU5L 4WENB 3FFCE 1KF9B 3EJZC 4FFZH 1L7TL 1AGCA 1I3VA 5IB4A 1MRDL 4N90E 5L9DL 3KDMA 3BT2H 2XPGA 3RZCC 3RA7H 3MACH 1E27A 5FO8B 5EORH 4PJCA 3AM8C 3REWB 3O6ML 3MRIA 1YYLL 3CFDA 3BDYH 3O3BA 4CW1A 3ALWA 3BQUC 5KOMC 3TESA 1FN4B 4ZXBA 4NO2B 1UCBL 2HVKB 1P7QD 4PD4J 1JCKA 2FSEA 2VH5L 3MA9L 1AKJA 2R4RH 2IAMA 3BPNB 3QIUC 1RIUL 2O61A 4IOFD 2PTTA 5B8CA 1I8KB 1PEZA 3KJ6L 3L5WA 3MRKB 1B2WL 2F53A 2Q8BH 2NR6C 3RL2B 3UO1H 3BH8A 3DVGB 3HNTH 5AWNH 1YMME 3VI3F 5K9KA 3THML 4BM7A 2X1OA 3BGFC 4JFDB 4PRHA 2P8PA 3SKNA 5DTFA 2M26A 2KPNA 3QXUA 1OSPH 4XRCB 5JXEA 1IKNA 5D7JA 5MP6L 4OT1L 1OHQA 2V9QA 3OB0K 4TVPD 3P0VH 4JPWH 4X5WA 2GCYB 2X4OB 3DMMA 5GS1C 1T83C 2XG4A 1WITA 3I84A 5F1IB 4R0LA 3EDDA 2J12B 4QT5B 4LCWD 4LKXA 4V1DE 1WC7B 4LCYA 3OJDB 4KQ3L 5KSUB 1WGOA 3EYFB 1H8NA 1QTYT 5SWZD 1OQXA 1RMFH 3RKDC 3RGVA 1OAQL 4PLJC 4C83A 3SGEI 2OTUB 4F33A 3L5XL 5JHDA 1EHLL 2NX5E 1X5FA 4JPVH 5K59F 5MEOA 2NY3D 4EDWL 2BVOA 5HHVL 3DBXB 5D2NC 5E7BA 1ZS8A 5BQ7B 2DDQL 4UNTA 4BSVB 5D1QB 4DFHA 1KEGL 4C56A 4IMKC 1OCWH 3MOBL 3TZVC 3DXAD 3ULUL 4S1DC 1U8KA 3F7RA 5DJXA 5FDYA 2VR9A 3CH1A 4RGOL 4AL8L 1Z9OA 1T66C 1LE5A 3OKMA 4Z7VF 4UQ3A 3CLEL 3C60B 4MS8C 4PJGA 1DLHB 3NCEB 1GZPB 2KBGA 5HD8D 2W0PA 5DMYA 3BW9A 5IBTL 4DJMA 3MRGB 4RDQG 3REVB 4XVTL 1I8MB 4D94A 3BVNB 3AU1A 1U3HD 4QXTA 1QD0A 5HSFA 2XXCB 4IBLT 3TBSB 1SVCP 2EEAA 2GY7B 3QUXA 5GZOD 4ZDHB 1AO7A 2LU3A 4NQSB 5FO8A 3LEYH 4P2QD 3REWA 3SKUD 5KSBF 1CXFA 2A1WH 3GHBL 2DMKA 5DVMA 3RJDA 3O9WB 4PJFB 2ZCLL 2HYMA 1FN4A 2APTA 3MRBB 1KJVB 2X4TB 3SE8H 1AI1L 1QYGL 1AHWC 4LSQH 4PJDF 4PRPB 4M5YH 1CLOL 3GEWB 2BVTA 3RL2A 5ID1A 1LD9B 5IB1B 2CDFB 4JPKH 1A3RH 3ZKXC 4LHUD 2VDML 2UWEE 1NH6A 2Z31A 4OCSL 2NY4C 4ZFGL 3RGHA 2OI9B 2VXVH 1ROWA 5ID0B 1FQ9C 1I1AD 1ZSDB 4PY8I 5B22A 1RURL 3ARGC 1MFBL 4IIQC 3I50L 3SY0A 4O9HH 1CL7H 1CYGA 5F7KC 4RAVB 2GCYA 2X4OA 4YHYB 3T0DA 3SQOH 5D7IF 2GEEA 2F15A 1CICB 5ISZE 5F7MC 2UUDH 5AAWA 3VXNB 5F1IA 5M95B 2OYPA 4QT5A 3MLZL 3V5HB 4OFYD 1J0ZA 1WC7A 3LQAH 1UKSA 1FVCB 3C08L 4AJ0A 1WEJH 3OJDA 5CD3B 2P43B 5KSUA 3OKOB 4J3TA 4WI2A 2FCBA 2ZG1A 2IPUK 5GGVL 5TPWH 2EXWD 3CDCA 3IFNH 3SJVB 2OTUA 5D1ZC 1I7UA 3QXAA 1KACB 1ZVHA 1W72A 3DBXA 5SWSE 4U7KA 3MLXL 4PJBF 5BQ7A 5ERWB 4IJ3C 4NC0B 3LHPH 2HJLB 4XPFL 5D1QA 4BSVA 1HZHH 1I9RL 2JTDA 4KTDL 4DAGL 3AS1A 3F8UB 4JFHD 2BOCB 12E8H 5FHAH 3D3VE 3INUH 5M94B 3KYMB 1FDLH 3C60A 3OGCB 3PWPD 1D5IH 3C87A 1GZPA 3MRGA 1F90H 1I8MA 4M7LL 5T1LD 5T3ZD 3PXHA 1KTLB 1JGEA 1OT1A 2NTFA 3RX5A 2ZJSL 4Z77B 1ZV5A 1YEDB 3TBSA 3V0VB 4XC3L 3MLYL 3IFPB 5IVNA 4ZAKC 3GSUB 2VC2L 4LSRL 3T0EB 4NQSA 5HGAB 5INDA 1Y6MR 5F89B 3C5SB 1CDIA 1GOHA 5KSAB 3MV8A 4PJFA 3CMOL 3A67L 4NUGL 4K8RL 1ZHKB 1UH3A 2HLFC 4FOMA 4JGJA 3TV3H 1GCFA 4ZO9A 2ZZUT 1KJVA 3WSQH 1IL1B 4ZUUB 1BOGB 4KK9C 3FQWB 4KVCH 3V6OA 5BVJA 3EOYG 4PRPA 4PP1D 3G6DH 4P3WA 1YN6B 2CSPA 4S0SD 1X5AA 2BMKB 1JI1A 1LD9A 5IB1A 2CDFA 2QKIB 4I0KA 4LDOB 3E8UH 1NDMB 3IU4H 3ZDYE 5FGBA 1RAMA 4GXUN 1RUML 5ID0A 2X05A 4AYFA 3TVMC 4PJIF 1ZSDA 5IBUG 5E8NB 5ICZB 3FHAA 3CDYA 4H0IA 4CDHA 4K3EL 3BP5A 1GPOH 5L2KB 1X6LA 1S5IH 5ESAB 2DYPD 1EX0A 4XBEL 3VXNA 3S36H 4WCYH 3V5HA 5DT1L 2BK8A 2YXMA 2LV4A 3TF7C 3RNKA 2GUOB 5CD3A 5C71A 5I73C 1DLFH 2Q8AH 4ENEC 4JHZA 4LARL 3SJVA 2ORBL 4HGWA 1L0XA 4FQIH 5MENB 5IVZB 2BY3A 4GRLB 1EJ6A 2A6KB 1OWRM 1J0YA 1CE1L 5ERWA 5BJTB 3LMJL 4M6NH 2B20A 4I18C 5DHXB 2N7AA 4LU5H 3VFGL 5I17B 4G42B 4PLKD 3VG9B 2BOCA 4IRSB 5E00B 5EBGA 2P7TB 1CE6A 5EBMA 1WUNT 5KVEL 1MRDH 3OGCA 4R2GB 5L9DH 2CRYA 2EYRA 2C3XA 2VWEC 5DJAB 3O6MH 4HLZG 1YYLH 3ET9F 2B2XH 4JB9L 1KTLA 3CAFA 3VFRB 1NL0L 2B1AL 2HFTA 4CJ1A 1UCBH 5GGQL 1YEDA 2DL9A 2WQ8A 3V0VA 5KN5A 4NZDA 3DX7A 3IFPA 2VH5H 3MA9H 4QF1A 3SGKC 1RIUH 5E4EB 1W72L 3KJ6H 4HD9A 1FJ1B 4KU1A 3ZHDA 1B2WH 1A47A 3QNZA 4AM0A 5I19L 1JWUB 3IJSB 3THMH 1ZHKA 4X4MA 5T3XE 3OX8B 3OKDB 4BELD 4Z7VE 3CXHJ 3KPSE 2W38A 3FQWA 3GIZL 1MCLA 1V7ML 5DGQA 5FYKL 4EIGB 2PN5A 4XHJC 3BKML 3NZ8A 2AV1B 2E9BA 5MP6H 2AKRA 2BMKA 3PWUB 2QKIA 1CDJA 4X9GA 1NDMA 1SYVB 3MOAL 5CLWA 2DKUA 4JKKA 1OWWA 1D5XB 1MELA 2H32B 3Q5YA 5HDLA 5GRWA 3U6RB 4PBWD 1T03L 3EOAA 2C1OA 1VGEL 4NZRL 4KQ3H 1B4JL 2KUTA 4HT1L 2YD2A 4G8EA 5L2KA 5BRZB 1OAQH 4MXQD 3U4AA 4NC2B 5ESAA 3L5XH 1EHLH 1AQDA 4PJDE 5I1IL 1MFAL 1BIIB 4EDWH 3G6JF 5A2LH 1KYOK 2GUOA 3L3IB 2DDQH 4FQJL 1BF8A 3BGAA 4U1SB 5C2BH 2HAZA 2MPAL 1KEGH 3VFNB 3MV11 4P46D 3MOBH 2CKBB 4OZIB 3ULUH 2DM2A 4PJ9B 2JLLA 2B1HL 5F93C 1KOAA 5MENA 4RGOH 4AL8H 4Z7UE 4ZXBC 3CLEH 4MA3B 3FCTA 4GRLA 2A6KA 1I7TB 2PTUA 5DD5L 3VXMA 2Z9TA 5D7IE 5IBTH 2N1KA 1MFDL 5LXGL 1J8KA 4XVTH 5BJTA 3T2PA 5B8CC 4KHTL 5I17A 4P2CG 3VI4E 3DYOA 1RJCA 4IRSA 1TTFA 3BN9C 1LDPL 2P7TA 2EDJA 3OB8A 4O2FB 3X12B 1VSCA 2XA3A 5BO1L 4X6EB 1N64H 5DUML 2AXGB 1QO3B 2DICA 4BZYA 5AUMB 5DK2B 2DS4A 3D3VD 2ICEA 4QGYA 3GDBA 4PGZA 4NQEE 1U58B 3GHBH 5I16B 3O6KL 2ZCLH 4QWWD 1U91A 5FK9B 3VFRA 5JXEC 2VLJE 4WWKD 5D7JC 4D0BB 5EU4A 2QADC 3FRUB 1IGFL 4G6AC 1R3JB 1MHHB 4YBQD 3DMMC 4GSDL 1AI1H 1NUGA 1QYGH 4I8DA 1FJ1A 4R0LC 1CLOH 5IFAL 5IQ9B 4M6AA 1RU9L 2A77L 1JWUA 3IJSA 4OCSH 3M1BA 3OX8A 3QEHA 4ZFGH 2VR4A 3OKDA 3CPLB 5HHME 1BJMA 1HXYB 4YHZH 3Q48A 4JJ5B 3ZL4L 1RURH 1ZHNA 1MFBH 3KS0J 4WUKL 3I50H 4TUKL 4PRNA 1MFEL 1MI5A 2WINA 3PWUA 2CK2A 4RZCB 1X5KA 4U0RB 5FA3B 1SYVA 1OD9A 1OGTB 1F4WL 4UTAL 2EKSA 5EOCL 3GUTB 3MLZH 4RFEA 4MYWB 4PP2B 3RTQC 4JANB 3LPWA 1HEZA 2BHZA 1NC4A 2PUQT 3C08H 1WFTA 4XP6L 3DUHA 3SDCC 1NMAH 3PWVB 4JR9L 5BRZA 1T1XA 5EWIL 3H7BA 1JPFA 3QDJE 2C26A 2F5AL 3SHSA 1IZJA 3T2NL 4H25B 3TA3D 1H8SA 5BCAA 3QDMD 5I0DA 2WQRA 2XQYG 3OJVC 4H8WL 4KZDL 5DYOA 4TTGA 3L3IA 3MLXH 4IMLB 2JCCE 4XPFH 3VXUE 1I9RH 3VFNA 3MLVL 1OF2B 4KTDH 5F70A 2CKBA 1P7HL 4PJ9A 1UWGL 4L4VB 5IW1B 3TCLB 2C3GA 3L3DB 5ESVB 3OAYH 5F7DB 4MA3A 4XI5D 4D3CL 1I7TA 4V1DB 4N0CC 3Q6FB 5KAQG 3BZFB 3BPNC 4M7LH 4PGDB 4M7KL 3DYPA 4XPBL 4AZ8A 2ZJSH 5I1LB 2V5RA 4XC3H 3MLYH 3QIWD 3UPCA 2CIKB 1R24B 2VC2H 4LSRH 4X6EA 2AXGA 1QO3A 5AUMA 3SCMD 3GJFK 4MVBC 4XXDB 4ZTPH 5I16A 3HE6D 5J0BA 4G9FD 4MGXA 3CMOH 3A67H 4NUGH 1NEZG 4K8RH 5CFHA 5GZNC 2J8HA 4NBYB 1R3JA 3GBNL 3QSKB 1MHHA 3P77B 4JFQA 5D2LB 4UDTB 1P6FA 2X9YA 3FB5B 5IQ9A 4PRBB 3LEVL 2O5ZL 1CDCA 2H6PB 3UDWA 4MQXC 3CPLA 4JE4B 3C9NB 4NZJA 1RUMH 3STZA 4DTGL 2EYSB 1HXYA 3RBGA 3OV6A 5CEZE 4JJ5A 3KPSD 5TQ2H 3VU2A 4FQCL 1B90A 1UJ3B 3WS3B 4K3EH 1O0VA 4RZCA 5GGSB 4QHKJ 1ACZA 1OGTA 4YGAB 3AY4C 2J8OA 1VFOA 4XBEH 1EH9A 4TPRL 5CP3H 5D1QC 2DQFB 2K9UA 5DT1H 4PP2A 3GSOB 5ITFB 4LHUG 2WW8A 1EEUA 1UFUA 5HDOA 3F62A 4QY8A 1NUDA 3CFKA 4KRPD 3C60C 1EUTA 5DVNA 1CT8B 5LGJA 4IS6B 1FIGH 4DZ8A 4HUXB 2ORBH 3W5MA 3RL1B 2WIIA 4H25A 4PTTB 5HI5D 2NW3B 4MD4B 3QDGB 4D9LL 3N50A 1CE1H 2FBOJ 4IMLA 3MO1A 3PG2A 3CU7A 4GW4B 5D7LE 3VFGH 1A6ZA 1DE4B 1KCKA 4FQXA 1CIUA 1LEKB 4QRTB 5ISZB 3TCLA 1TPXB 3O9WC 3L3DA 1GHFL 5ESVA 1MHPL 3IXTA 5F7DA 3FO9A 2BNRE 3L3GA 4PBXA 2O5YL 1R0AL 4F7EB 3BZFA 2XV6B 4PGDA 4GW5A 1I8LA 2N56A 4ODTL 3MTRA 4Z7WE 1NL0H 2JJSA 2B1AH 5I1LA 5GGQH 4RFNB 2CIKA 1R24A 4OLVL 5TDOA 1CVRA 1PDKA 1OAKH 1KB5L 3GMNB 3U82B 2OI9C 4OQ1A 2YMXL 3NABL 3ULUF 3OF6D 2BRRL 1J05B 3QFJE 1PVHA 2FX8L 2IH1A 1H3UA 3ES6A 1ORQB 4JQXA 2H2PC 4NQED 2YEZB 5F6HJ 3BI9X 4YHYC 2IQ9H 1A0QL 1NGZB 2VLJD 4NQVB 4OF8A 4MX7B 3GIZH 1CICC 4OGXL 1V7MH 5FYKH 5D2LA 4UDTA 3BKMH 2Y72A 3BD5A 4KK6C 1RSFA 4PRBA 4PS4L 1C7TA 2APVA 2X4RB 5CEXB 3MOAH 4KI5C 2H6PA 4GAYB 2F8XC 2ESVE 5IKCA 2EYSA 2CPCA 1L7IL 1T03H 5HHMD 4O58L 3VGFA 1EV2E 1UJ3A 1VGEH 3HI1A 4DW2L 4NZRH 1B4JH 3WS3A 3WIHA 5A2FA 4HT1H 2Z4QB 5C0AA 3TJHC 3B3IB 2HTLD 4H5SA 2NY7L 2DQFA 1NCBL 5ITFA 5I1IH 1MFAH 3W11C 5IESL 4P59H 4X6CF 3B5GA 4U2ZA 1F42A 4FQJH 4XVUD 4GMSL 3GSQB 4HG4K 4Y0GA 4I0PD 1X6NA 5EC2B 1CT8A 1PX4A 4IS6A 5IHLB 3P4LA 4PGJA 5E5RB 3RL1A 2B1HH 3TBTA 3B83A 1Q9OB 5IV2B 5B4MD 4RRPA 3QDJD 2NW3A 4MD4A 1RUQL 1PBYA 2R8SL 3M8OL 2WWKO 2XRAH 5LXGH 3T0EC 4GW4A 2Z35B 4KHTH 4YHOL 5JUEH 3NPSB 4Y16A 1KBGL 4LDEB 4KJQC 3ABZA 4TTDD 4U3XA 4NDMB 5TF1H 1LDPH 5KSAC 3QXVA 4UV4L 2NNAB 3BP6B 5DUMH 4PJXE 1I8IB 4W70A 4R6UA 3T0WA 4F7EA 5J9PA 3QPQC 1CR9L 4CMHB 3O6KH 3DLQR 5HVWA 1BJ1J 3FT4A 1IGFH 3O41B 1JNLL 1OQOA 2UUDK 5DXWA 3SEPA 2XZQL 4GSDH 2A6IA 1P1ZB 4BQBA 4EUPG 3G5YB 2J8UA 1I3UA 4B5EA 1CGUA 5IFAH 1J05A 1W0VB 1RU9H 2OSLA 3F7VB 1X7QB 5FYJE 3ULSA 3MUZ1 4EVNA 1SYSA 4NO3B 2E7CA 2YEZA 4IOIB 2JELH 2NZ9D 1NGZA 1JFQH 4BSJA 4NQVA 2MHAB 1UZ6F 4MX7A 4OFPA 3P0YL 3JVGC 3ZL4H 3HMXA 1YQ2A 4KXZH 4WUKH 4B50A 2EDFA 4TUKH 3BRFA 1MFEH 3KR3H 4YGVB 2Y06L 1MRCL 5LVEA 2YPLD 4GAYA 4UTAH 1HQ4B 1CDYA 3DSFL 5EOCH 3WDHA 3BJ91 3DWTA 2YSSA 5B39B 2YWYA 4XP6H 1CFQB 4KMLB 2CDGA 3FQNB 4JR9H 2R15A 4GRLC 5EWIH 4FP8L 5JIKA 3B3IA 4EI5A 4OKVA 2F5AH 2GK2A 3T2NH 1AH1A 1S9YB 4U31A 4H8WH 4KZDH 3VG9C 1OP5H 1Z3GL 4IRSC 4R4ND 3DSNA 1CD1B 5HHXL 2VSCA 1HQRB 1T3FB 4R2GC 3MLVH 4ZSOE 3QI9B 4FTVA 2R29H 4LRIA 1UWGH 1XT5A 5DJYB 4ELKB 5IV2A 2OK0L 1FNEB 2C3HA 1BF2A 2AI0H 4JM2B 5I75B 4D3CH 3NTCL 2PF6A 1OSZB 4J3SA 2Z35A 5E4EC 4XPBH 4JCMA 3PQYE 4BA8A 1IILE 2D7MA 2W9LA 4NDMA 2BJMH 4BZ1L 1CXLA 3GIVB 3MRDB 2NNAA 4OKDA 1T7VA 4U1IB 2H8PB 1BBJB 1NGXB 3EGSB 4W4NA 2IMMA 2ZUVA 4LEOB 5D1XB 1OTUD 2FYYB 1MQKL 1ES0B 4Y19B 4YXHL 2FIKB 2SEBB 3O41A 3GMOB 3UJTL 3ZDZE 5DS8B 5B38B 3BESR 1P1ZA 3G5YA 2NXYD 5KOVC 4Z7UB 1CWVA 43C9B 4L1DA 4PJ8A 3BDBA 1JF5A 1W0VA 4MCYB 3LEVH 1X7QA 1FE8L 4NO3A 4BSWB 4LK4A 1TFHA 3QFJD 5EZIL 5E9DE 4NQCE 4DTGH 4CRPA 3ZHKA 2MHAA 1CDUA 2YKLL 1AGBB 3BZDA 5CJ8A 3VD4A 1WBYB 3QEQB 4FQCH 4ORZC 5JOPD 4KZEL 3L3KB 2OTWA 2HA1A 1J8HA 3QCUL 1KTDA 1HQ4A 1U8NA 3FL7A 4TPRH 2XT1B 3DOSA 1GC1L 4GOSA 5CSGA 3BPLB 4UUJB 4EBQL 9CGTA 5B39A 3V0WL 1MIML 1EA9C 3O6FD 2DBLL 4TOYL 4ZFOL 1IARB 3FQNA 2Q76B 3MV7E 5HPMB 1RZJL 1WISA 4G9DB 5T1MB 3FT3B 1YUHA 1S9YA 2FX7H 2IBZX 4IRJD 1M7IB 4D9LH 3FZUD 4LPCA 1YPZA 3FQUA 1YNLL 1HQRA 2LE9A 2VL5A 3MLUH 1T3FA 3EYSL 2X4PA 3QIBD 3QI9A 3QO1B 4QRRD 4X9HA 1YEFL 4Y4HD 5DJYA 3UTSE 4ELKA 1GHFH 5IMLA 1FNEA 3P11L 5JNYB 1JVKA 2P47B 3LQZB 2UYLB 1R0AH 4ZD3L 3UAJC 2PO6B 1WBZA 3B2UC 4ODTH 4BK5A 4BFIA 5C2UB 3MRDA 4OLVH 3HB3C 4U1IA 1KB5H 2H41A 1NGXA 2YMXH 3NABH 4LEOA 2BRRH 3T77B 2FX8H 5EOQL 1GOFA 4GRWE 4YBLB 1ES0A 1QBML 4QHMA 1MCBA 3D0VA 2FIKA 4YNYB 5GJTH 5K9OB 4NFCA 1UA6L 4QXUL 4RQQB 1A0QH 1QSFB 4U0RC 2Z8VC 4ISVB 4OGXH 5C6PB 4JQIL 3HC4H 3HAEG 4OCXL 1HDMB 5EZOL 3N85L 5EU7E 4H26A 4PRID 4PS4H 1WCQA 4DWHA 1FIEA 4YXLH 3QUZD 4QRQB 15C8L 4PY8J 2A2QT 2GT9B 2Y07L 4CADA 1L7IH 1KSRA 1AGBA 2V7NB 2NYYD 1WAAF 3QEQA 4O58H 3P9WB 4HC1A 2YHGA 4GT7A 4IHOB 1U6AL 1NAML 4ODXA 3D6GA 5CBAA 3BGMA 2V2XB 1WQVT 3G04B 3L3KA 4F58L 1R5VB 4R7DB 2AP2A 2DLIA 4MAYD 2NY7H 5JZ7C 2BVEA 4X99A 2PETA 1LP9B 3MRFB 5DJ2A 2XNAB 3U83A 3AXLB 3BKJL 5E99L 5IESH 4Z78A 5DEGB 1AGFA 1RZ7L 4GMSH 5DFTA 2OLDA 1IEAA 2Q76A 3D69A 2FO1A 1BD2B 1MY7A 1DFBL 3UJJL 1F3JB 1N6QH 1R5IB 4G6FD 3WBDA 1U8JB 1YMHB 4YPGA 1RV6X 5HPMA 5MEQA 2EECA 4G9DA 3FT3A 4HIIB 1I8LC 3UTTE 3QEUB 1UB5B 2QSVA 3BYYA 3WJLC 1RUQH 1EBPA 1JRHI 2R8SH 3QPXH 4PGEB 2VMFA 3WUWG 3PGCB 3M8OH 4AK1A 4N0FB 4WUUE 1NFDB 1OVZA 4YHOH 2XN9B 1EFXA 1KBGH 4DVRL 1UJTA 2IFFL 1UXSA 4RMSA 3QDAA 3V95A 2DWDB 3LQZA 1MCCA 3AREA 2UYLA 3O4LD 4HK3J 1CR9H 1AR1D 5ICXB 4M6OL 4X7TB 4X4ZA 4RMRA 5FB8B 2PO6A 3FTGB 3SGEH 3PL6D 3B8YA 1CFVL 3U0TB 1JNLH 4JFOB 5HYQB 2VLKE 2XZQH 4K94C 3D5OF 3MZTA 2ITDA 1NDGA 2H9GB 4Y5XB 1UZ8B 3T77A 3MCLL 3C2SA 2WM0A 3KWWA 4Y1AB 4TSAL 2BOBA 1UJ3C 2X1WL 5DC4B 3ZE0F 5DZOA 1QRKA 2EIZA 5K9OA 4RQQA 1QSFA 3EO0B 2EEBA 4J6RL 4Z0BL 4ISVA 3P0YH 2YRZA 1HDMA 4FFVD 1I7ZA 2BNRB 5EBWB 3NPZB 3SDDB 4I48A 5F96L 1D9KB 5HHNB 4UIMA 5I74B 4E41B 4QRQA 1IAOB 1ZT7A 3DSFH 2F19H 5BS0A 3WNKA 4HEME 3DVNB 3NIDE 2V7NA 3TO4A 3OAYK 4U6VL 1AFVH 2V2XA 1JNHA 3G04A 5L6YL 5DJCA 4FP8H 4I1NB 5JO5B 3H9SA 1KNOB 3D1MC 1LP9A 3MRFA 1JNNL 2XNAA 1NPUA 1J18A 2VIRB 3FN9A 1Z3GH 1G7PB 1TPXC 5HHXH 4YR6B 3ULUD 1IJ9A 2ZOKB 4OLUL 4WHYG 2JIXB 1MCKA 3QAZB 1F3JA 4Y5YB 1JZ5A 1R5IA 1U8JA 1YMHA 1SY6L 1I9JL 3U30B 4HIIA 3ZT5A 2OK0H 2ESVB 1UB5A 4MA8L 2NY2B 1TCRB 5GRUH 3HPJB 3NTCH 4HC1L 1LO3H 4PJHF 4RFNC 4PGEA 3PGCA 5C08B 2A9NL 1NFDA 1QFOA 4Q0XL 1UWEL 4MNGB 2XN9A 3KGRA 1U9KA 1FYTB 5ECJE 4L8SC 5MI0B 4BZ1H 2VERN 1VACA 2UZXB 2DWDA 3N1PC 1BVLA 1WIUA 2GHWB 1AXTL 4U1KA 1DEEB 4NRZA 4ODUB 4JRXA 4AEHL 1G9NC 4X7TA 3BAEL 5FB8A 2LTQB 3FTGA 2AK4E 1V5JA 4NIKB 1MQKH 4YXHH 1XR9B 4JY4A 2FZ3A 3UJTH 5HYQA 4RGMB 3FT2B 2JJVA 3T3MF 4PJ5E 5JDSA 3T65B 4YFLI 2UY6A 4UT9H 3B9VA 3FQRB 3H42L 3WDIA 1FE8H 4Y1AA 3IRZA 4KJPC 1P5UA 5E6ZA 5EZIH 3V4PH 2G60H 3EO0A 1Q9WB 1NFIB 2YKLH 1ZHBB 2NY1B 3MJ8B 4O2EB 5KANG 4PJXB 2FJGB 1SBSH 4FMKA 5EBWA 3WFBL 4OBSA 1D9KA 1FZKA 5HHNA 1N5AB 3SKMB 4KZEH 3SDAB 2HP4A 4KRNA 3QCUH 1KB9J 3O3AB 5F1OB 4S1QL 1MHCA 3WFEL 1GC1H 3O3DB 3DVNA 4CU7A 3FOLB 3TFKC 2P8MA 3V0WH 1MIMH 3OHXB 2DBLH 4CKVX 1S8DB 3C6LC 4TOYH 1FH5L 2VXQL 5A40E 5JO5A 1RZJH 3G5VB 1B3JA 3I75A 1TJGH 1U8IB 3LCYA 2P5EE 3NPSC 1WTLA 1CXIA 3DETC 1S78D 4YR6A 3VGGA 1YNLH 4O5LL 1T0MB 5F1NB 1HNGA 3EYSH 4KRLB 1MAKA 2ARJQ 3ARXA 4RFOL 4YPJA 5LGKA 4CMHC 4HJGB 3D39E 3QWQB 1WAAE 3GSNB 2BDNH 3P11H 2VZUA 1RZGB 1TCRA 3HPJA 4PJAB 5HYJA 3KNBA 1XGTB 1PFCA 4HHAB 5ESQB 4MNGA 4HK3N 2VZ3A 1JTPA 1IAMA 1FYTA 2VLRA 2A6JB 3T4AB 1DQML 1YJDL 4K8RD 4JFFA 4ODUA 4Z18A 2FATL 5LBSL 5L88L 1A2YB 2J4WL 1X9QA 5EOQH 1RZIB 1E4XI 3LKNA 1EAJA 1QBMH 4HIJA 1FLTX 4NCC1 4KPHL 1XR9A 2COQA 2YN5A 4Q9RL 4QXUH 4LLMB 4TRPL 4JQIH 2X41A 4OCXH 3AGVA 4PRAB 1TVBB 3FT2A 5TDPA 5EZOH 3T65A 2VLKD 3MRCB 1F4HA 4P2OD 2E6PA 3FQRA 4DKEL 5DRZA 2GK0A 5SWZB 3I6GA 1K5NB 5DMKB 4OGAD 15C8H 2Y07H 1Q9WA 3CSBA 1S7TA 1ZHBA 4O2EA 2GIYA 2NY3B 4ZUSA 5CINL 1E0OB 1NAMH 3SKMA 5K9JL 4F58H 1B88A 2WUBL 3O3AA 1TVHB 5I2IA 2CIIA 5FO9B 3RQ3A 2G9HB 2HMID 3R0MA 2EZ0C 3O3DA 5F88B 4WW1A 3BKJH 4HMEA 3OR7A 4OQTL 3ZYZA 5E99H 3OHXA 1JIBA 5CUSL 1RZ7H 3MV01 5C07A 4MNQE 4TVSa 4YDVB 4JM2C 1DFBH 1Q72L 2VAAB 3BD3A 5I75C 3D25B 5J56B 4WFEE 4P3CH 1T89A 1U8IA 2D7OA 2VQTA 3SOBL 2DQIL 4QHUA 5T1KB 5E24E 3RUGF 4L8BB 2NW2B 2EH8L 1S7XA 4P2QB 5DLMH 1PKQE 3C09B 2V17L 3TPKA 3B4NA 5D1XC 2V5MA 3CSGA 2E7LC 2IFFH 1N3NA 1P7QA 5DJ8B 2H2SD 3GSNA 1NLBL 3U4BL 4NYLB 4M4PA 4PJAA 4L4TD 1XGTA 5E2TL 3WIIH 2OCFD 3VFSA 3BWAB 5ESQA 4NC1E 1INQA 3IS1X 4PJ7A 1HH6B 1JYVA 2AQ3A 3GSXB 3GMPA 3T4AA 5FYJU 1DBBL 1CFVH 3C8DA 5E8EB 2YD6A 3BPCB 1I1AB 2AW2A 1LO2L 2D0GA 4KDWA 4ZUWB 5HHOE 1A2YA 4YX2L 1E6OH 1WWAX 3PIQB 4JFYA 4PJEB 2ICWB 1B9ZA 5FYKD 4TSAH 1IGTB 3ARYA 5TDNB 4HUKB 3CH8A 4DUWA 5C9JB 4X8JB 4LLMA 3ESVF 4WIQA 3MGAA 4Z0BH 4P5TD 1YEEL 3RVWC 4LCWA 5JDJA 1HXMB 2XTJE 4OV5A 4PRAA 2XWJB 1PZ5B 2BC4A 3MRCA 5DD3L 2B8OT 5F96H 3BPLC 4HWEH 4PREB 5SWZA 4PJ5D 3W82A 1K5NA 2PYFB 5DMKA 4S10A 4J1UB 5CHNB 4OIAA 3V6FB 4RGNE 4J7RA 3DV4A 4U6VH 1AGDB 5DQDL 2GKIA 3K8LA 5GS0L 2FD6H 3KPMB 3PHOA 5FO9A 3DXAA 4OM1L 4WDIB 1JNNH 1ZWIB 3K8MA 3PWJA 4J4PC 4MNHA 4OZFB 4WV1B 5F7EH 1T5WB 4I4WA 5E7FA 4YDVA 4OLUH 2VAAA 4WO4B 5T1LB 1U3HA 3D25A 5MEPB 2XKNB 3G5XB 5LKNA 2YUVA 1SY6H 2DKMA 1I9JH 4HPYL 3QISA 1Z0MA 2Y6SD 1JGUL 1MHEB 2PO6C 4Z6AT 1C16A 4MA8H 2IAND 5H94B 3WN5B 1P5VA 1QSEB 2DLTA 5CGYC 1T22B 5D5MF 3VXPB 4P2QA 2HG5B 1J1PL 5ACLA 4Q0XH 1UWEH 1BWWA 5CEYB 3ULVL 4L3CB 2HH0L 3SDXF 4YBLC 4P49A 3DGGA 3VXSD 4JQVC 1AXTH 3MUHL 5JIHA 1JMZA 4AEHH 3MRQA 3BAEH 4LHUA 5HGHA 1HH6A 5D9SB 4LSPL 4K7FB 3W81A 3IVKB 4WW2B 3BPCA 1I1AA 3CFIC 1J0KA 4XNZB 2IH3B 1FVDA 5TE4L 1CFNB 5F3BB 2YA0A 4G8GE 5EUKA 3V79C 4BQCA 3UPAA 3H42H 3F6LA 1J88A 1MRFL 1LE9B 1IGTA 2VZVA 5TDNA 3MROB 4UAOC 1LO4L 1CN4A 5C9JA 4X8JA 2O5XH 1FLRH 4NJAL 4FG6C 4OFYA 1WZMA 1HXMA 4PR5B 3K1DA 3T0XA 1U42A 4KJWD 2XWJA 3LV3B 1PZ5A 3UROR 3C6SB 3LN9A 2NPLX 5E94A 5EFIB 1H3VA 4XT1C 2EO1A 4S1QH 3RDTB 3WFEH 5JW5B 4GQ9L 3RVVC 2YPVL 4JZJB 2X70B 3TH3T 1X5YA 3LD8B 4TVPL 1CK0L 1FH5H 1NBZB 5A16A 3MXWL 1A7NL 1NLDH 2ZP0T 2VXQH 3TWCL 3MC0A 3KPMA 3DIFB 3QJFA 3OWEA 3UYRL 1HI6B 1C5CH 3DROB 4OZFA 3PWPA 2DI7A 4WV1A 2X4QB 5JQHC 5EG6C 3G5ZA 5J6HB 4O5LH 1BQHB 1PSKL 2RFXB 1GOGA 4WJ5B 5T1LA 1GRWA 2EDOA 5C0EB 5MEPA 2XKNA 4RFOH 5EZLB 2YZ1A 3QCTL 1Y0LA 2E7HA 4YHLL 3RX7A 4FA8A 1WIPA 4YEFA 4ZODA 3WN5A 3W2DL 3W39B 3JWOC 3TN0B 2HG5A 3BP7B 3U7WL 1EMTH 5CEYA 1A8JH 4Y5XC 1QFWL 3OKEB 4L3CA 1DQQB 5TE7L 5C0RL 1NJ9A 5I66A 1DQMH 1YJDH 4XC1L 2AJSL 2DJUA 2FATH 1K85A 4LVHB 5LBSH 5L88H 3ARFB 2WP3O 2J4WH 2OP4L 1BPVA 1KFAL 5F8RC 1KUMA 1M1SA 3SDDC 2NY6B 2HTKC 2GFBB 1D9KC 4K7FA 4KPHH 4Q9RH 3QUYD 3FB7B 4TRPH 3LN5B 2IG2L 4OJFL 5I74C 3IVKA 4WW2A 2X44D 5CD5D 1BBDL 5J13B 1UKQA 3VD5A 3EO1A 4RIRA 2IH3A 2ARWA 2GSGB 3HC0B 1OLZA 5IT2L 4NN5B 3QUKB 3KXFE 4MCZA 4X7SL 3HUJF 1FNGB 1LE9A 3S3SA 1D5BB 4YAQA 4U1GB 3MROA 1XZ0A 2IBBA 2AAVA 3K3QA 4PR5A 1KJMB 3SKOB 3LV3A 1JPSL 4FQ1L 5CINH 4MQ7A 3I6LD 2RJMA 2XTJD 5KVMC 4KV5F 5K9JH 1P69B 2VZ1A 2WUBH 4P46B 2CH8A 2AK4B 1NANI 2HT4D 1IT9H 1ZKAA 3QNYA 4Y5YC 3QAZC 3GMMB 2OJZL 3PHSA 4R26L 3U30C 4OQTH 4ELMF 1S7QB 4F37F 5CUSH 5ITBH 1Q72H 4LMQE 1OD7A 1IC1A 4EUPA 1MCNA 4K71B 4YHPB 3SOBH 2DQIH 2ID5A 3MJ9H 5IB5B 5DQJB 4H1LB 1DVFD 3P30L 1G7IB 1LO5A 3GBLA 4L3EE 5MI0C 1A6VL 4HKZB 2V5YA 2EH8H 2LQRA 4OZGE 4QRPD 5J6HA 1TIUA 4WWID 4WJ5A 3BZ4A 4YHIB 1XGQB 2Z93B 3IDIA 5EZLA 2V17H 2WBJD 4YZFE 2DQDL 4YEEA 3DO3A 2DLFL 2LTQC 1NLBH 5I18L 4JDTL 3U4BH 4ZTOH 1AGEB 1QBBA 4KJYB 3W39A 1ZEAL 1CTOA 5E2TH 3MRLB 4TUOB 4KHXL 4R7NB 4WFFD 4RGMC 1S7UB 1QFPA 3BD4A 3OKEA 3L3JB 1DQQA 1DBBH 4LSDA 5JQ6H 1T21B 1VENA 1Q94B 2FB4L 1D5ZA 1GIGH 1LO2H 1G0XA 2P5EB 3P4MA 5F8QC 4X6BB 1TETL 4RDQF 2NY1C 3ARFA 3MA7B 5T3ZL 4YX2H 1I7RA 3H8NA 1C12B 3F7QA 3PV7A 4XP4L 5KW9L 4D8PA 3QXTA 4NP4L 2GFBA 4TQEL 4OSUL 3FB7A 1SQ2N 3O3EB 3SDAC 1YEEH 3MJ7A 4LSVL 2QJDA 3RWGA 1TJHH 3L5HA 2GSGA 3HC0A 3OGOE 1VA9A 3KPRE 1FG2B 3MGTB 1OGAD 3QUKA 5DD3H 3VXRD 3U9PH 1QRNB 1FNGA 2VLMD 3GB7A 1D5BA 3ZKMC 2XWTB 5C70A 2RB8A 1CGVA 1PYWB 3TA3B 5C92A 3QDMB 1KJMA 4WHTB 3SKOA 4HFUL 4TSBL 2OMBA 4QKXB 5DQDH 5GS0H 2BNUA 4P46A 1A6WL 4OM1H 4NN6C 3FRPA 3GMMA 3ZYIA 1A3LH 1S9VB 4BH7B 1UT9A 4IDJL 5DC9B 3PNWA 4GBXC 3ARBD 3MLWL 5C0CB 3SE4C 1P9MA 1B4RA 5IMMA 4K7PL 2VXUL 2AK1L 4HPYH 4FQ2L 3NIGE 5FO7A 4XP1L 3RP1A 5L0QB 5IB5A 1JGUH 3DV6B 1SJHB 1UEMA 3RI5F 1A1NA 3VFTA 3D3VA 2HN7B 1NFKA 2J2ZA 3K4AA 5J06A 1XGQA 2Z93A 3DNKA 3AFLA 3HE6B 4G9FB 3ZZ1A 3ULVH 3RNQA 3OG4B 1P6AB 4WWKA 2R2EB 2R56L 4XWOD 1K6QL 3CVIL 1N59B 5FV2A 2HH0H 5F9OH 3RWFB 1AGEA 2DJSA 3D48R 4EN3B 1KT2B 3S98A 4WI8A 3TBWB 1Q0YL 4P2RE 3MRLA 4TUOA 2IBZY 3HZVB 4BKLB 4ZG1A 2XZAL 1EGJL 2E7MA 1OPGL 3MBXL 1G1YA 4N9GA 4POZC 3MV9D 5DHVB 1Q94A 5IBLD 5TE4H 5IQ7L 2KL6A 1J86A 3MA7A 4GKSA 1C12A 2NR6D 1AD0B 5IMKB 3BX7C 4G8IB 8FABB 32C2A 5ANME 4XX1E 1LO4H 3U36B 2J88L 4NJAH 3NCYS 3GI8H 3I2CL 3RVUC 4PTUA 2GJ6D 1X5XA 1QFWM 2FH6A 5AYUL 3GMLA 1QRNA 5KSBB 1QPPA 1MIEL 4M7LT 2LABA 3KXFD 5CSZB 1RJLA 4AG4L 4H20L 4ZFZB 4GXVL 1CLCA 4GQ9H 2ZSVB 1PYWA 2YPVH 4U05A 3TA3A 3QDMA 5EU3A 1FGNL 4JGMA 4MLIA 5GZOC 2YC1B 4LGPB 1JP5A 2FHCA 4L8DB 3MXWH 1A7NH 5J1AB 3W0WE 3GBML 4B7LA 2EC9U 5HHOB 1T04A 1IGIL 3VW3L 2C7UB 1ZA3B 2E9JA 1RUPL 4NOBA 5GRJH 3C09C 4PLJD 3ZHLA 1V3LA 3UYRH 4HCRA 1A7BA 2XOTA 4CL7A 2CUHA 2NY0B 5HDBF 5I0ZA 2W0LA 3E1F1 5DA0B 1PSKH 3GMQA 1XIWB 5KJRL 5SX4H 3JWDL 1MJ7H 1ZT1B 4NZTH 5J1TC 3LSOB 2MKWA 2VKXA 4HFWB 4YHLH 5C0BE 3QIWA 3TZVD 3DV6A 4S1DD 2AXHA 2Y5EA 5J12C 5HJ3B 4TN9A 1SJHA 3CD4A 3SCMA 3W2DH 2E8ZA 2HN7A 2VWEE 4MS8D 4HKBB 3TBYB 2BVQA 3WCYA 5JPNA 5F72S 5HGBB 1I1AC 5FUCC 3HE6A 4G9FA 3ROOB 5BVPL 5CJQL 4QNPF 3RVTD 4YFEA 2R2EA 4Q9BA 1G7HB 1P84J 2FEEI 4LP4A 1HWHB 3BFOA 5TE7H 2WUCL 1D5MB 5C0RH 3EDJA 4EN3A 1DANU 3TBWA 2DTSA 4XC1H 3VCLB 2AJSH 3TCXA 3TNMA 4PJBB 4BKLA 1MCPL 3GJFB 2OP4H 1KFAH 3R06B 4R9HA 5C0DA 3WIFB 2R1YB 5I1AA 1IGJA 3IFOB 3NH7L 3IDJA 3KLHC 1KJ2A 2PW1B 1RFDL 2IG2H 35C8L 4M9PA 4OJFH 5DHVA 1A1MB 4F9PA 5ICYB 1BBDH 5CSBA 4Z7VA 1G9NL 3KPSA 3VH8G 5IT2H 2W0KA 3BUTA 4XCFL 3MRRB 1H3WM 2NXZB 4P3DA 5EU6E 4ZNEA 3L7EB 4X7SH 1AIFA 1AD0A 8FABA 3T04D 3H3PH 5HPOA 5AEAA 3WUWA 1MH5B 2H32H 3ZT7A 3JSSA 1QG3A 2MCPH 5EIIA 1JPSH 1JNJA 5EPMB 3WNLA 4OF6A 2YUWA 4HIEB 4I0PB 5KSBA 1EIBA 3M45A 2BVPB 2VRAA 3KPRD 4WV1C 2FNBA 5IF0A 4HXAL 5EU7C 4WO4C 2ZSVA 3QFDB 3JV4A 2OJZH 5AG9A 4R26H 3SE9L 2I07A 4PJDA 2PXYB 2YC1A 3EYOB 2DOCA 4L8DA 3WDJA 4N8CL 5J1AA 4KI1A 3WN5C 4G8GB 4PJCE 1I9IL 4LFHG 2ICWI 1T1YB 2C7UA 1ZA3A 3ZSSA 4FXGB 4F15B 4AMKL 4QTHA 1U93B 3P30H 4FXKB 4JDZB 2VAJA 4PJIB 5EC1B 4MLSA 1A6VH 2FL5B 4OV6F 1TMCB 1BEYH 4WTZA 1A7PL 3IGAB 4N68A 5D7IA 2XA8L 2MQCA 2VO5A 2F53E 4JFED 2DQDH 3LSOA 2ATPA 4KI5F 2DLFH 1H8OA 1BZ7A 4KROC 6FABL 5FYLE 4JDTH 4JKMA 4PG2A 5I18H 1GSMA 5HJ3A 4PRHE 1T4KA 4X6DF 3MODH 2OM5A 3OF6A 4KHXH 4XNUL 4WW2C 1UH4A 4PGCA 4XNZC 1EXUB 4NQEA 1G7HA 1XCQB 2ADFH 2VLJA 4HCRL 4M62L 2FB4H 4JLRA 5KG9B 5I1HL 4ZAKD 4K3GA 1DQJB 4OBRA 1TETH 1U8PA 4PJBA 3IXAB 4RMUA 1OAUL 3LN4B 4P2RD 3R06A 3WIFA 4XP4H 2R1YA 3KPLA 3IFOA 4NP4H 4JHAL 4TQEH 4OSUH 2EDRA 4NBXB 4RMTA 4APQB 5ICYA 4LSVH 2DM4A 4KK9D 5JHDE 3RDTC 4X7CC 2XY2A 3K46A 4YHKL 1A4JB 2YPKB 4JZJC 5D71L 3L7EA 2VZSA 4KKAC 3GI9L 5DJ0A 1XGPB 3LD8C 5FECB 2LVCA 3ALPA 3WYRA 4C56E 1IC7L 1B0GB 4FXLA 4MXVE 4PLKC 3V7AE 3TVMD 1BX2B 2C3VB 1VFAB 2BNQD 4HFUH 5DMIL 2BVYA 4TSBH 4PJGE 4I0PA 4RMQA 1QSVA 1IMHC 4L8CB 3AAZB 1L4IA 4G6JL 1KJ2L 1A6WH 1D6VL 4ETQB 5K9QI 5T3XL 4R8WL 3QDJA 1GVIA 4PLNC 4ZNCD 4IDJH 4JRYD 3UZEA 3MLWH 5DD0L 4G80B 4NWUL 5JLZB 2HFGL 5B3NA 2A9ML 1T1YA 4K7PH 3TN0C 1NCDL 4A6YB 2AK1H 5I8CB 4FQ2H 3W0WD 4XP1H 4ENED 4JPIB 5HYSG 4FXGA 3PDGA 3ILPB 5KS9B 2CJUL 4FQPA 4FXKA 2XACC 4I13B 4PJIA 3SE3C 5EUOB 1K2DB 1GH7A 4M1DL 1MUJB 3DRQA 2R1WA 1RJZA 2P44B 3CU1A 4LCCB 4Z0XB 3CJJA 4LVHC 2XG5A 1K6QH 3CVIH 3ARFC 4V2BA 5IFHL 3SGDH 5ALCL 3TO2B 2YBRA 1HH9B 2FJHB 4YFDB 5I6XB 4X5XB 5DDHB 2NY6C 3VMNA 1UGNA 4JFDE 3IS0X 1YEHL 4ZUTA 3SBWA 3DVIA 1O5DT 3G6JB 2EIBA 4DEPB 1MSPA 3CIQA 5EDXA 5J13C 3JV6B 2XZAH 1EGJH 5E2WH 3P4NB 5EOTB 1ONQA 1OPGH 1EXUA 3MBXH 1DN0B 4NN5C 5IHUL 1XCQA 3RI5K 3PV6B 1HOCA 5HDBE 1MWAL 2ZG2A 4U1GC 4QOKB 4J12A 4MXQC 5KG9A 3QWOA 4U1MB 1BFVH 4U1JA 5IQ7H 1CD0A 5KAQF 4C54A 2CO6B 2F8OA 3LN4A 2QSCL 4I9WE 1CLYL 3OKKA 3T09A 2YPLA 4JGUA 2F54B 1QVOB 4K94H 1J0IA 3GM8A 1LEGB 5DQ9B 3VXOB 4APQA 3I2CH 4D0DA 4P46C 1EVUA 4GG6B 4MD5A 3O6FB 4HF5L 4U1NB 3WKML 3MSPA 4XHJD 5EO1A 5AYUH 1MIEH 1XGPA 2IPKA 4K3DL 3G6AB 4MJID 2R23B 5EB9A 5FECA 4AG4H 4M03A 1YEJL 5DD6B 4F7TB 1N5YL 4BK4A 3LKPB 5CKGA 4LVOB 4IRJB 3TP4A 4K71C 5C0IB 3UBXB 1BX2A 4UNUA 3QZWB 3PWNB 4X9FA 3CZFB 4KKBC 4PLOB 5GS3A 1C1EL 4J23A 3T0BA 1G9MC 3AAZA 3GBMH 4OM0H 1IGIH 3VW3H 3QIBB 4QRRB 1Y18B 4J3XA 1RUPH 3H3KA 4M48L 4QWWC 2APWA 4NQXB 1J87A 4OD2B 2X1QA 2BXZA 2X4NA 3EBAA 3DECA 4OLYH 3I02A 4YBQC 4FQQA 2Q3AA 3BH9A 4P9HC 5JLZA 5KJRH 3JWDH 3S8WA 4MHHI 5CCKL 1H15A 3IJYB 4OZHF 5GGUA 1F4AA 2Z8RA 3MV8E 4PJFE 4S11A 5FFLA 1KJ3L 3QNXB 5EUOA 1GJIA 3VA2C 1EK3A 1VB9A 1K2DA 2JJUA 2ZUWA 3IDUA 4XNYL 3KYOB 3MYJB 4ZXBD 3RWIB 4I5BB 1HHIA 2C1PB 4PRPE 5BVPH 5CJQH 4LCCA 2B0SH 3NFSL 4M8QB 4BZ2L 3TO2A 3VWJD 2WUCH 5E4IA 2FJHA 2MKLC 5DDHA 4N8VB 4OD3L 3HCVA 2V2WA 4G5ZH 3G6JA 4OZIF 4PRIB 5IVXF 1K4DA 1MCPH 5BV7B 3JV6A 7FABH 3P4NA 2Q86B 3QUZB 3BYTA 1DN0A 3KLAB 4TSCL 1D6EA 2XICA 1RFDH 5CAYB 5DJ6B 3PV6A 1IQWL 5JOFA 35C8H 3U2SB 2BHUA 2QADD 4C57C 3VWKB 4G6AD 2X2YA 1G9NH 4U1MA 3QULB 3TA3C 1VDGA 4XCFH 1J11A 5FF6B 4A2LA 4MJ2A 1QVOA 3NFNB 2X6MA 4MAYB 1Q0XL 3WLWD 4FABL 1XMWA 5DQ9A 1B6UA 3SJVE 5IW3A 1KN2L 4JAMB 3QXDB 3OSKA 3O6FA 1BWMA 1YEIL 4DZBA 3MLSL 3IDMA 1H3TA 5DD6A 4HXAH 3T8XB 2AV7A 2X9WA 1UM5L 2AJ3B 4IRJA 3UBXA 3GSRA 4CBPA 3RTQD 1UXWB 1LHZA 3PWNA 5HI3D 1NCNA 4J8RB 2WLZA 3CZFA 2FEDC 5HI4D 5HY9B 4N8CH 2GTZB 2WBKA 3SDCD 1I9IH 3QIBA 5D7KD 4QRRA 5DSCB 4LHJB 1L0QA 4K3HA 2ZUUA 1ZXQA 4Y4HA 3HE6C 3IETB 4AMKH 4LVNB 4R3SB 2DLEA 4IOSD 1LK2B 5CEZL 3ZDXE 3O8XD 3O4LB 5D96B 3T0EE 1A7PH 2G5RA 3LB6D 1OTSC 4EN3C 1SBBA 2XA8H 4HW6A 4QO1A 3IJYA 2P5WD 5GGTH 3PL6B 1F3RB 1F13A 1IM3A 3VRLE 5GGRB 4R4BB 3RFZC 3QNXA 3K2MC 4Y2DD 4G6ML 4GAJL 4Q9QH 3KYOA 3MYJA 2FJFB 4BJLA 4XNUH 2D7TL 3H9HB 4I5BA 2C1PA 5D6DC 3WO4B 3ZYJA 4XVJL 1FYHB 1R3KB 2A6DB 2AEWA 1X5LA 3JWOL 4M62H 5I1HH 5IEHB 4N8VA 5CJXA 3DX6B 2VTFA 3F7YA 5F1SA 4PRIA 4JFDD 1TENA 3I3BA 1TITA 1Z6JT 5B21A 3HAEH 3QUZA 3KLAA 3KPPB 4M3JA 2KQMA 1JK8A 3LEYL 4LEXL 5L2JA 1XFPA 2XXMB 5L2KE 5GZND 3U2SA 3QJHB 4M6ML 5C3TA 2X89D 3VXTB 4YHKH 2OR8A 5K93A 5HI5C 5FF6A 1E6JL 3GI9H 4DKAA 5H35A 4O2CB 4M5YL 3QT2A 2QHLA 4MAYA 1RK0B 2J3SA 4URTB 1IC7H 2AEPL 4MQXD 1TJIL 1DR9A 4JAMA 3C5JB 3QXDA 5MENE 2VXVL 5DMIH 4ZUVA 2WZPD 4N9OB 2JJWA 3WXWL 3HRPA 2NY0C 3PWLB 4WTXA 1Q9KB 3C5ZB 4G6JH 1G0DA 1D6VH 1XIWC 5T3XH 4JZOB 1HE7A 4GJTB 4R8WH 3T1FB 3HR5B 2AJ3A 1MPAH 4KVNL 4J8RA 4BUHA 4PGBB 3QEGH 5E5MB 4HJJL 3IDGA 2EDWA 4PG2C 5DD0H 1G6RL 2GTZA 5C0ND 4NWUH 5C8JB 5EU6B 4TNWF 2HFGH 2DIAA 2A9MH 3EFDL 5DSCA 5F7HA 2PYED 3CX5K 4N8PA 1A6AA 4ZSOA 3IETA 4L9LB 4R3SA 1H3PL 1LK2A 4M9OA 4HUWA 3WD5L 3O4LA 4XCEB 4M1DH 2L7JA 2BCKB 3F12B 4YO0B 43CAB 4NM8L 1SMAA 1W8OA 1Y6KR 4LIQE 5ELIA 1RI8A 3PL6A 5IFHH 5ALCH 3ZT6A 1YNKL 1HZHL 5DUBA 4R4BA 3O9WD 1RHHA 1DCLA 4S1SL 1YEHH 5CWSA 4HUMB 5JTWA 4X6CB 2UWEF 3H9HA 2WWMC 4OF0A 2XYCA 4OGZA 1FDLL 2K1MA 3SO3B 3HA0A 5L8KB 2A6DA 2NXZC 4N1HB 4YFLF 3RWHA 2LAGB 3LEXB 4KK5D 1F90L 3MRIB 3OTTA 1MWAH 2BXYA 2KH2B 4JO4H 2RR3A 3DX6A 3FQTB 4QXGL 5JA9A 5IJKC 1AKJB 5DK0B 2IAMB 2Q87A 1KG0B 2QSCH 5AAMA 1CLYH 3SO5A 4F9LC 2FECI 3HE7D 3L5WB 2XQYK 4I0PC 3IYLW 5BRZE 3BH8B 4QHNB 1WICA 2P1YA 4UDUB 5C09D 1CICD 5DZNA 3VXTA 4HF5H 4U6TA 3WKMH 3JZ7A 5B4MC 1XCTA 2HVJB 4JN2A 4KVCL 1AY1L 3HG1D 4HGMA 4KK6D 2CKNA 4O2CA 2PXYC 4HEPG 1UACH 1YEJH 3KLDA 4KI5D 3NMEA 4X5WB 1WF5A 2ENSA 2W9DL 3IU4L 2VE6B 5GS0D 3C5JA 2Z0BA 3UTPE 4YK4B 4KKNA 3SJVD 4F15C 4K9EL 3VXQB 1C1EH 1KPVB 3PWLA 2ZSWB 3V5KB 1KTKE 5FYJL 5F6IB 1ZT4B 4M48H 3QH3B 3RWJB 1GPOL 4JZOA 4WHYH 4NQDD 4HK0B 3HR5A 4KQ4L 1RD6A 3RGVB 4XPHL 4C83B 1QKZL 4F33B 5E5MA 3QRGL 5MEOB 4XX1G 3MOQA 5CCKH 1MNUL 1ZS8B 3Q5OA 2EE9A 3EJYC 1KJ3H 4OGYL 2PNDA 4F2MA 1KTRL 1AXSA 5HYIA 4XNYH 1U8KB 3P9LA 3TNNA 1FP5A 5DJXB 4XXCA 2BCKA 3F12A 43CAA 2NY5L 4LPWA 1LE5B 3OKMB 4X98B 3T0ED 5DI8B 3MFFB 3NFSH 4BZ2H 3UPRB 4KJQD 5KSAD 3B9AA 4OD3H 3E3QC 4W6XB 5FA4A 1FBIL 4X6CA 4PRDA 3MRHB 3ZDYF 4APQC 3ILQC 3QUXB 2OX5A 1U8LB 4HJ0C 4P2OB 1J5OL 1AO7B 3QPQD 4ONHA 4TSCH 1QQDA 3LEXA 2QL1A 1IQWH 2B2XL 2EH7L 5FM4A 4I2XB 1KCVL 3ME0A 3B9EA 1EEQA 3B2VL 1TQCB 3FQTA 5DK0A 3WE6A 1KG0A 4LSUL 4R4NC 1J0HA 4UILL 1Q0XH 4FABH 4XCNA 5ID1B 4QHNA 1Z5LB 1NBYB 4UDUA 2Z31B 1KN2H 3KHQA 3CFCL 1YEIH 4ZO8A 2HVJA 3D2UD 3MLSH 4QXWA 1PAMA 4DFIA 4UMGA 1U92A 1JL8A 3SY0B 3NACL 1ZVYA 2R2CA 4DUXA 2VE6A 1UM5H 4L4VE 1GYAA 1CU4H 3VXQA 1KPVA 3CNKA 3QUML 2ZSWA 2FO4A 3V5KA 1CFTA 1ZT4A 5HHPB 1XR8B 3QH3A 3P3YA 2W07A 3RWJA 4HK0A 4LCCC 5E1AB 5I1JL 3VGEA 1F5WA 5CEZH 4L4TB 1I3RA 5I6XC 1I7UB 2APFA 5CIPH 4CAGA 3LPGA 3QXAB 2P4AB 3FB6A 4R2GD 1W72B 4DEPC 3PJSB 5C2BL 5EA0H 5DK3A 1QZ1A 4G6MH 4GAJH 4XAKD 1NGPL 2J1KA 1A9EA 2D7TH 3VFUA 4ZFFB 5D2LE 4X98A 4XVJH 1DQLL 1PGRB 3MXVL 3PP4L 3MFFA 5DI8A 1NANH 1NBQA 4M1GL 3QA3B 1N6UA 3JWOH 3UPRA 2EDLA 1KENL 4P5TB 1JGEB 3LQAC 3MX0A 2NTFB 4PPTA 1P84K 3MRHA 4CN4A 2VLKA 1HKLH 4P2OA 1U8LA 1K8IA 1VFBB 1N64L 1E4KC 3Q2CA 4JM2F 3O6FC 3K2UH 3S4SG 2V6HA 3G9VA 4M61B 4HH9A 4LEXH 2XFXB 5INDB 4KK8D 5C0AE 4M6MH 3MV8B 4I2XA 4HWBL 3RY6A 2IJ0C 5CBEB 5CP3A 4P0DA 1E6JH 4IRJC 4LVOC 3BHBB 5BVJB 1CDBA 3FZUC 1CXEA 1ZHLB 3MFGB 2VQUA 1Z5LA 1DEDA 2AEPH 1NBYA 3NBNA 3QIBC 1TJIH 3EFFA 1UC6A 2I25N 3TEUA 1HCVA 3L5IA 1GGTA 4J3WA 3WXWH 3QDGE 1F4XL 4YHZL 1JGDB 5DURD 1IC4L 4Z7UF 4LMQI 3OJMB 3V6ZB 2YWZA 4WU5B 3BP5B 1CL7I 1K3ZA 4Z76A 2IANB 2FDBP 4KVNH 4NPYB 1CQYA 4HJJH 4HWUA 3VI4F 5DF0A 1G6RH 1N4XL 1EO5A 5GPRA 3EKCA 3RNKB 2HT3D 3EFDH 2HKHH 5HHPA 3AROA 1XR8A 1NMAL 3CMGA 5E1AA 1EAPB 1H3PH 3VXSB 4BYHA 3WD5H 4L4TA 4OLXL 4HGWB 2VISB 4N0UB 3AB0B 4EOWL 2F74B 4NM8H 2FRGP 5CJXC 1RY7B 3SDYL 1X5HA 3BIKA 3TGXA 3L5JA 3PJSA 4UINL 5ADPH 3V7AG 5BV7C 1YNKH 1P7KA 3QUZC 4CDGC 3MNZA 1EO8L 5J8OA 4S1SH 1FORL 4M7JL 1I1FA 3UBXI 2GITB 4TNWK 4ZFFA 1CE6B 5EBMB 3VWKC 1XGYH 1YYML 2EYRB 3QA3A 1BQLL 4P5TA 3VRJA 2H3NA 4MAYC 3HB3D 1U0QA 2WBWB 5KN5B 1J9CT 3DX7B 3QQ9D 4QXGH 1IQDB 3ZKND 3FFCD 1VFBA 4M7ZB 2DM3A 4QF1B 4PJ5A 4HUUB 1A9BA 4Q6IB 4M61A 2XFXA 4ZTPL 1P4LA 4N90D 3QNZB 5ACZA 2AXFB 4AM0B 4LLDA 3VD7A 1GGBH 3MUGA 5CBEA 3EJJX 1L6ZA 1KCRH 4W4OA 4HXBL 3OZ9L 1C7SA 2Y36L 1FCGA 1AY1H 2AGJL 4JZNB 1C5DA 3BHBA 1BAFH 3Q3GB 1QLRA 4M5ZL 1ZHLA 3NZ8B 2AKRB 3BE1L 1EEZA 4LAJH 1QEWB 4OUOA 5FUOL 2W9DH 2JCCF 4OF3A 1EUUA 3V0AC 1D7FA 1YMMD 4GKNB 3T4YA 4K9EH 4LVNC 3T0VA 3ZE2E 3O0RH 3IAPA 3CDFA 1JGDA 3EOAB 5TQ2L 2C1OB 5D96C 5FYJH 4AIZA 2UY7A 3EYUL 1AR1C 1A6TB 3IB4A 4WU5A 1HHHB 3JV5A 3V6ZA 4G8EB 3KPNB 5JZ7D 2IANA 4KQ4H 2EXYD 4NN7B 4NPYA 4XPHH 3PL6C 1QKZH 2K3TA 4YBHA 5DZLA 3L6FA 5FHBL 1AQDB 3QRGH 2ICWJ 4L4VD 2ZUSA 1HHJA 2WANA 1FNSL 1XF1A 3VH8A 1MNUH 4V1DD 5FCUL 3LKRA 4P5KB 1BECA 2V2TB 4OGYH 3O2DL 1NAKL 2ED7A 1EAPA 1A64A 3VXSA 3JXAA 1WAAA 1FIGL 2EO9A 2P46B 1YEKL 2VISA 4N0UA 4N1CA 2F74A 3PF2A 2NY5H 5K33A 1F02I 2YD9A 4FFVC 3FCTB 2NX5D 1SJXA 3VXMB 5GIRB 4YC2B 3QUYB 3WS6C 4G8FA 5F44A 5CKAA 2CDEA 1FBIH 1GXEA 1N8ZA 2GITA 1J5OH 3PDDA 3A0OA 4W6WB 5EBLB 4YHML 2ICEB 3HZYA 2ZG3A 4HS3B 2DD8L 4MJ5A 2EH7H 3ARDD 1U91B 1KCVH 4MXWH 1ND0B 5EU4B 4PJHB 3B2VH 4NRXB 1IQDA 3RHWF 5JW4N 1OAKL 4LSUH 1G7MA 1YY8B 4HUUA 2ICCA 2DIJA 4Q6IA 1TZIA 4UILH 3ULUC 4HIHB 2AXFA 3C5ZC 3U9UB 3M1BB 2C3WA 2W91A 3QEHB 1ZLSL 3VFPA 3CFCH 1G84A 4K2UL 2IQ9L 1OAYH 4JZNA 1ZHNB 4BFGA 3Q3GA 3K7UA 4MAUL 3MRJA 4PRNB 4P4KD 1MI5B 2WINB 1QEWA 2NMSA 3NACH 5ETUA 1FZMA 4BH8B 5I1EL 1DVFB 2MQ0A 5E6YA 1RJYA 3NCYP 4GKNA 2E8YA 4HKXB 2EKSB 4L9LC 4QRPB 4RFEB 3QUMH 2I9TA 1HEZB 1NC4B 2WBJB 3QDGD 3ECBA 1WT5C 1A6TA 4XXCC 1HHHA 1MLBA 5H2BB 4XPAL 3KPNA 4Q74A 1T1XB 3H7BB 2AEQL 1JPFB 5I1JH 3CFEA 4NHUA 2DTML 4Z7WF 5ISZD 1JN6A 3ZE1F 2WAHA 4NNPL 2BY2A 5DYOB 1KB5B 1CD9B 2VKWA 3BEWA 4P59L 4NQUA 2N7BA 2IBGA 3X17A 2JB6B 4P5KA 1FRGL 3EW3B 2V2TA 2HJFB 3P4OB 4LNRA 4GLRH 3SO3C 4Y19E 2PCPA 4DN4L 4JY5H 4P9HL 1NGPH 3S37X 4X7FC 4D9QE 3LRGA 2BSSB 1DQLH 1JHLL 3TC9A 3MXVH 3PP4H 2XIDA 2EE3A 4PB9L 5GIRA 4M1GH 4LQFL 2IAMC 3QUYA 2XRAL 1ORSA 3CVHL 1KENH 5SWSD 5JUEL 1Y6NR 1F4YH 4XZUB 5TF1L 1A4KB 3U46B 3HRZB 2OBGA 3VXRB 1OGAB 2AERT 3E2HB 3QEQE 5DA4A 1R3IL 5EBLA 1U95B 4HS3A 2AVGA 4V2CB 2VUOA 1GGIL 1IKNC 4HWBH 1ND0A 25C8L 4PJHA 4NRXA 3EUUA 3KPQB 4JFQB 4DUVA 4HX1A 1YY8A 1BZ9A 4YK4C 2OXHA 1S78C 1ZGLP 1IAIL 4HGKC 4HIHA 4KJPD 1LVEA 3VG0H 1A7OH 5AZEL 4EEEA 1SEQL 5EIQA 3U9UA 1FSKB 5F6IC 5A2KH 1JZ4A 2JELL 3STZB 3ARBB 1JFQL 2JKXA 1F4XH 3RGVC 5IROA 2V5SA 5IB2B 5F7NC 1IC4H 4GRWH 3FAXA 3KR3L 1F2XK 2J5LB 3L3OB 4BH8A 2FH8A 3VFWA 1DVFA 1G0YR 1QBLH 2LU4A 3TT1L 4HKXA 3UX9B 4QRPA 3QHTC 3C6LD 1N4XH 4LBEA 1CGSL 4K8RC 3KJ4B 2H26A 2WBJA 4PJXF 4QY8B 2IADA 5H2BA 1SJEB 3CFKB 3EHBC 5LGJB 1R6VA 4CVWA 4OF5A 4OLXH 4DZ8B 2VABB 2FWOB 2ADGA 1LGVA 2WIIB 1Z9MA 5C0JB 4X9IA 3DETD 4EOWH 3RPKA 5DEFA 2FLRT 2QR0B 3NVQA 3SDYH 1KB5A 4TUJB 4UINH 3RVXC 3QUXC 2CLZA 2JB6A 3MV9B 3MO1B 2CGRL 2HJFA 3P4OA 4KMTL 4NO0D 1EO8H 1A6ZB 4OGAC 2R29L 1FORH 4M7JH 1QSFE 4FQXB 5F1KC 1QLFB 2B4CC 2Z91B 3IXTB 4XBPA 1EHAA 2AI0L 3RY6C 2BSSA 3FO9B 1NGQH 1YYMH 3L3GB 1TQCC 4WFGE 4LCUB 1ACYL 1BQLH 4GW5B 5E2UH 3S5LB 4EQ2A 4NKIL 3RUGB 4XZUA 5BS0E 2GJ6B 1T2XA 1A4KA 2BJML 3HRZA 4HZAA 3U46A 2X09A 1OGAA 3VXRA 4OTXL 1E28A 2ITCB 5TDOB 1MCOL 1X4ZA 2Z31C 4OFKA 1U95A 4PJAF 1FZJB 4CVXA 3VD3A 3QYCA 2QHRL 5GRZA 4MZ2A 2IH1B 1MJUL 3ES6B 2A73A 3HFMH 4ODWB 4Q2ZB 1LP9E 3KPQA 2XKUA 1BIHA 4HXBH 3OZ9H 2ZKHL 2Y36H 2GSIA 2AGJH 5FV1L 1RUAL 4M5ZH 1W0YT 1BD2E 4DGVL 3BE1H 4E5XA 5FUOH 2X42A 3E6FA 3KPOB 2BERA 3N0PB 3ARBA 5IKCB 5T3XD 3WLBB 5D2NB 3EDKA 3NA9L 5IB2A 5A2JH 2ILLA 2Q7NA 4TULH 3NCCB 1NFDE 2OMNA 3EYUH 3HI1B 1MVUA 2XN9E 3L3OA 3QWRD 4N5EC 5C0AB 3S34L 5FCSH 2EZ0D 1F3DJ 4OAWA 4H5SB 3MCKA 5FHBH 4Z7NE 4JM2D 1FNSH 5FOBB 5FCUH 1JUFA 1SJEA 2A74A 1NAKH 2AQ2A 3O2DH 2C4FU 4K7PX 4X80L 5HYEA 2VABA 2FWOA 2XQBH 1YEKH 1XF4B 3TBTB 4P5TC 5C0JA 2FX7L 3OXRA 1N0LA 3BSZL 4O51A 2QR0A 1DQTA 1FHGA 1PJ9A 4TUJA 3ZDZF 2DLHA 1V7NL 4KY1L 2H1PL 1Z9LA 3MLUL 3KS0H 3MV9A 4HZLB 4Y1AE 2DBJA 5D1XD 4JO1L 3U1SH 5DVKA 3DPBA 4Y16B 3X3GL 3GK8L 5C7XL 1QLFA 4Y19D 1BVKB 2Z91A 3HNVL 4ERSL 1OP9A 4YHMH 2DD8H 4W4OC 2DQCH 5J9PB 4LCUA 4WEBL 3V6OC 4E41E 3S5LA 4U3CA 3RUGA 3LRHA 2MCG1 2GJ6A 3FT4B 3PGDB 5FKAA 3ZE1E 5D5MB 1ODAA 2ITCA 4JVWA 5FGBC 2A6IB 3KXFA 3LH2H 2J8UB 2LAAA 1FZJA 4Y88A 3MBED 4ZFOB 2OSLB 2PR4L 3ULSB 4EVNB 4OLWL 1SYSB 2VITB 4ODWA 3RVWD 3MPCA 4Q2ZA 1ZLSH 1O7SA 2HFEA 5GJTL 4K2UH 1F97A 1ADQL 1KC5L 3HC4L 3HS0B 4CNIB 3W9DA 3HLAB 4NUJB 4MAUH 3VFOB 4X83A 1VKXA 3ALXA 5I1GL 3L3HA 5I1EH 3GSVB 4YXLL 4PJEF 1KXTB 1BOYA 3IDXL 3KPOA 3RHWK 3WLBA 5D2NA 5C08E 3GJEA 2YSSB 4NFBA 4C4KO 1DQDL 3BZEA 4MNGE 3AB0C 3J7HA 2CDGB 1TTUA 4XPAH 1FYTE 2FX9L 4H1LH 4MDIB 4GO6B 2AEQH 1G9MH 1FFNA 3DI3B 2DTMH 4U49A 4EI5B 4J4PD 4OKVB 5D93B 1IAIM 1W2KT 5FM5O 5HGDA 2CRIA 5TFSL 4JFFE 4NNPH 4ZOCA 5FOBA 2VDQH 1F6AA 4A2MA 1FRGH 4JY6B 2R0WL 1N6QL 2OQJA 4FTVB 4P23D 4ZAKB 2P8LB 4DN4H 4GRWF 4P9HH 5ADOL 1UCTA 1XF4A 5CGYD 3E6HB 1JHLH 4KJWC 2LU7A 3QPXL 3TPUA 1QPXA 4PB9H 3KYNB 1N6VA 4LQFH 3HC3L 4M7ZC 2WWKT 4AIXA 4HZLA 3CVHH 4LLWB 3UEZA 3B8SA 4Q6IC 3VXUD 1KCLA 1NCTA 4DKDC 3ARPA 1NCWH 1G9EA 2FHBA 1BVKA 1N7ML 2VUYA 4MD0A 4RAUA 2BY0A 5IOPB 1R3IH 3J8F7 4ZQKB 2Q20A 1NCAL 3BP4A 3RWEA 1NAMB 5C3LD 4H8WC 2A38A 3UXFA 1GGIH 5LWYL 25C8H 3BOVA 3GNML 1AXIB 3PGDA 5D5MA 1KGCE 2IMNA 4IIQA 5TE6L 2R0ZL 3DO7B 2WNGA 1V8HA 1U3YA 1IAIH 4PD4K 4PJ8B 4ZFOA 1FO0L 4QTIL 5AZEH 1SEQH 3SDXA 2VITA 4JRYB 4FG6D 1GAFL 5EZJA 4WY7H 3AMLA 2Y1VA 3HS0A 4NN7C 4ZS7L 4CNIA 3HLAA 4NUJA 3CFBB 3VFOA 3WFZA 3D18A 3T3PE 1FFRA 4HV8A 1BD2D 3GSVA 2OTWB 1J8HB 3RVVD 3QG7L 2WIMA 3TT1H 4HUVA 3U0PB 1KTDB 1U8NB 2F19L 5FIEA 4PJAE 1RHFA 1CGSH 3HUJB 1KCUL 3HMWL 4JFEA 2YK1H 2CK0L 5CEZD 4I3GA 4ODSL 2R4SL 3ORJA 1AFVL 1MQ8A 4NGHL 4MDIA 4FFWD 5IFJB 4YC2C 3QUYC 1IZKA 1YUHB 4MJ6A 3LS4L 1Q1JH 5CD5C 1UH2A 4Y8DC 1ZE3C 3S97C 1WZKA 1YPZB 3FQUB 3BO8A 2VL5B 1LDSA 2CGRH 4JY6A 4KMTH 5GRVK 2X4PB 4P9ML 4ZAKA 2P8LA 3MQIA 3IF1B 4XGZB 4ELMB 4XNMB 5IMLB 3E6HA 2W1NA 5ENWB 3AUVA 4P2RA 5GRUL 1LO3L 2R69L 4PY7A 5H37G 1J0JA 3KYNA 3LKOA 2EDDA 5SWZE 5KVFL 1M05A 2P42B 1Q9LB 1ACYH 1A5FL 4LLWA 1WBZB 2FLBT 4NKIH 5D7LD 4BFIB 2HRPL 4L1HA 3TYFB 1EFQA 4OTXH 2W0FB 1MCOH 5IOPA 1H3GA 3KG5A 2UZIL 4MJIB 4ZQKA 4F3FA 4MMZC 1X4YA 3NIDF 3VMOA 3UP1A 2VB5A 2BNRD 2V7HB 3L9RA 1NAMA 2QHRH 3SDDD 5ANMA 1MCEA 1MJUH 4HWNA 2IPTL 5JXAL 3FKUS 4OUUB 4QHMB 3TVMA 4E41D 3D0VB 2BNQA 3UTQA 5J89A 4OB5L 1DVFC 2ZKHH 1DP0A 4LNVA 3DO7A 1OTTC 1RUAH 1JF1B 2I27N 4PUBH 4DGVH 1EBAA 4H26B 1MEXL 4UT9L 3H9YA 2WBJC 4LRNL 2CR6A 4JRYA 1IEBB 1C8PA 4BQ8A 2P45B 3V4PL 2G60L 4CADB 4U6HA 3NA9H 3BIAX 2L7UA 1G7LB 3L7FB 4P2QE 3CFBA 1SBSL 3W0WA 2NQCA 4ODXB 5CBAB 3BGMB 1E4WL 2E27H 2VZTA 3S34H 2JIXD 4KC3B 2J6EH 3U0PA 5SV3A 3BWUC 4QHLB 4X99B 1BJ1H 5DJ2B 4XP9L 4DKFL 3HUJA 2ESVD 2CD0A 1P2CB 4PJ9C 4Z78B 1AGFB 5C08D 2W60A 1IEAB 3D69B 3F5WA 3VWJB 3DARA 3BJLA 2G2RA 5IM7A 4X80H 4EXKA 5MEQB 4YPGB 5IFJA 5FUCE 1TJGL 2I24N 4XHQA 4P57B 4E9LA 3BSZH 5ILTL 4JKLA 4HBCH 4M1CC 1V7NH 4KY1H 2H1PH 3E2HC 2GYSA 4PJEE 1T1WA 3NFPA 1REIA 4Z7QE 1S7SA 4JO1H 1H0DA 4WI7A 1EFXB 3X3GH 3GK8H 5C7XH 3IF1A 3SGKA 2OR7A 4XGZA 4ELMA 5A3IC 3Q6GL 1UXSB 4XNMA 3HNVH 2BDNL 5ENWA 4ERSH 5DRWB 5BV7L 4MA1B 3OL2A 2AJXL 3AREB 2W65B 5CMAA 3CK0L 2AJUL 4U1HA 4WEBH 3RWCA 1Q9LA 3TBVA 4PB0H 5HBBA 5I9QB 3VD9A 5KVDL 3MCG1 1ZOXA 1JTOA 4KDVA 2YD8A 3TYFA 2W0FA 3LKSA 1FSKC 1MCHA 4HG4J 4Q58C 4MJIA 3UDWC 2ITDB 1NDGB 5E6ID 5DFVD 1BFOA 5E2JA 3ARBC 5DUPL 2V7HA 5FEBA 2PR4H 2HJKB 3KWWB 4OLWH 4JFHE 2BOBB 1INDL 3SDAD 4OUUA 5J3HD 1NBVH 2EIZB 1HIML 2D31A 2J5LC 4KTEL 4HUNB 1ADQH 1KC5H 2HWZL 1XF2A 1UVQA 1JF1A 1I7ZB 1PX3A 5J6GB 2ATKA 5I1GH 4I48B 3DUUA 1AD9B 4UIMB 3KJ4C 1S9XB 1WWWX 1IEBA 1J1XL 1PG7W 3CSYA 1VADA 1SJVA 3IDXH 2BZDA 4NCDA 3MNVA 1SY6A 5F21B 5FYJD 3O8XB 1ZT7B 1ZLUH 5BS0B 1QSEE 4X7EC 1G7LA 3L7FA 3TO4B 4LF3B 1DQDH 4PYGA 1AQKL 3VFMB 2P5WB 1PQZA 1JNHB 2FX9H 4JM4L 5DJCB 5B39G 3H9SB 4Y2DB 3S4SA 5CZXD 4XWGL 4QHLA 1KIRA 1X44A 3MUY1 4K07A 5IBLC 5TFSH 4GBXD 5B3JF 3HKFA 4FQXC 1P2CA 5JMOC 4NRYB 3KYKL 1U8QA 4FQHB 1AP2B 3VWJA 1RVFL 2R0WH 4HS6B 5DRXB 5FKPA 4P3CL 1HN1A 3SKJL 1HYSC 5ADOH 5L8JB 4PBVC 3NOIA 4P57A 2FR4A 5D7SL 3QCVH 2JJSC 2ZOLA 4FMFA 3O45A 4UU9B 4JCLA 4PV8A 4OIBA 3EOTH 1QR1A 3HC3H 4K55A 3W9EB 3MR9A 5DLML 2A0LC 4P5MB 4X6FA 4XNXH 5IBUB 3NAAL 2OL3A 1N7MH 3GHEL 5IJVA 1VACB 4JQXC 1G7JB 5DRWA 3NIFE 3TLRA 1BVLB 1NCAH 2GAZA 2W65A 4UQ2B 4U1KB 3WIIL 4NRZB 1U3JA 4YUEL 4JRXB 1MCRA 1PY4A 2QTEA 4POZD 5LWYH 3VA6A 4UBDC 2MNUA 3GNMH 4JY4B 2FZ3B 3PQYD 2PTVA 2FGZA 4ZS6D 5TE6H 4HKJA 2R0ZH 3EIFA 5JDSB 1FO0H 4QTIH 3FO2B 1E6OL 5TF0A 2HJKA 5KSVA 5B38G 3S7GA 4OF7A 2X4SA 3B6SA 3RTQA 1RQ5A 1GAFH 3RVUD 1F00I 3S96B 4GW1B 1F11A 3OG6B 1B0WA 3SDCA 4ZS7H 5M7QA 4Z95L 2DQJL 2ZNWA 2CUMA 3FO0L 2QQLL 1WWCA 5J6GA 2PYEB 1ZVSB 3CXHK 4HWEL 1FZKB 3B9KD 1AD9A 2NTSP 1JV5B 3RVTC 1S9XA 1A1OA 3QG7H 3O8XA 3B5TA 4U33A 1CGWA 4OI8A 1MHCB 5J11B 5JOEA 4NKQB 5T1KD 5E9DD 1KCUH 3HMWH 5DJZB 4LF3A 4NQCD 2P8MB 2CK0H 4A6YH 1BLNB 3VFMA 2P5WA 4LOUD 1DTUA 4DN3L 4ODSH 2R4SH 1QBAA 1UG9A 4NGHH 2FD6L 4P48A 4Y2DA 3N06B 3WFDL 4JO3H 4NO2A 3I75B 2HVKA 5HVFB 3BRDA 2ZNXA 5HXMA 3LS4H 4Y16C 1IKFL 1K9TA 5F7EL 4NRYA 1I8KA 2CXKA 2XTLA 4FQHA 1AP2A 4ZYKB 3MRKA 5DO2C 1EPFA 3DVGA 4P9MH 3LOWA 4HS6A 5J57B 3S88L 4YH6A 5DRXA 1NCCL 5CILL 3MV7D 5DR5H 2I5YL 4JFDA 1TZGL 1RUKL 4UU9A 3RZWA 1UADC 2R69H 4KGLA 5HYJB 3KNBB 3HE7B 5I1KL 4XRCA 4K23H 1EZVX 5KVFH 3W9EA 1GC1C 1A5FH 3HI5H 4P5MA 4M00A 5C09B 2FHFA 1VERA 2VLRB 2X89A 4LLQB 2R0KL 2HRPH 3BISA 1IE5A 1G7JA 5AZ2L 3TH2T 2UZIH 3HG1B 4JFPB 3UTSD 1RZJC 1KIUA 4UQ2A 4JFFB 5I71B 2VN7A 1CS6A 2E6QA 3EYFA 3IDYB 2ADJB 3KLHD 2IPTH 3S9DB 3LKNB 5JXAH 5FYLL 4HIJB 4X6DB 4OB5H 1T1ZB 4OIIL 2PW2B 2O26U 4OQTA 4XPTL 5TDPB 1MEXH 3FO2A 3AY4A 3H9ZA 4HIXL 5DRZB 4I0CC 3I6KB 2GK0B 4NQDB 2EIDA 1CGTA 3I6GB 4LRNH 1JZ6A 5AD0B 2OL3L 3V52H 2HKFL 3S96A 2O5XL 4GW1A 1FLRL 3QP3A 3MJ9A 4X0KB 1S7TB 3BEVB 5JORB 4EI5C 4OCNC 4ZUSB 5T5NG 5D93C 1WCBB 1DLHA 3ARVA 2PYEA 1ZVSA 1H9VA 2E9IA 4LPXA 1E4WH 1JV5A 1QFUL 3REVA 3BVNA 1GGUA 4WO4D 4FQLL 5I2IB 2CIIB 2DQUL 4M4RA 4XP9H 4DKFH 4WW1B 4LRIC 4ZDHA 5DJZA 3OR7B 1S3KL 5KZCB 1QSED 1BLNA 3WEXB 3S35X 5HHQB 5C07B 3ZTNL 4AY0A 1NLDL 1N0XL 3HTLX 3O9WA 4MDJB 1F8TL 3E0GA 3MRBA 4QHUB 1C5CL 2X4TA 2EDTA 1C08B 5ILTH 1JTTA 4XTRD 4H88L 1S7XB 4ZYKA 4MWFB 3UTZB 1YNTB 1I1CA 4WGWB 4KROD 5EU5B 1N3NB 1P7QB 3PE9A 3Q6GH 4XB8A 5LG1A 4ZOEA 2ARJB 5DMJB 4MA7L 1MCWW 5BV7H 1CFBA 3CLFH 4M02A 2AJXH 3UTTD 2V9RA 3HE7A 1QRNE 3CK0H 2AJUH 3P40A 5TGBB 3VFSB 4UOW1 1CBVL 2B4CL 1EMTL 4RAVA 4WUUD 1INQB 5KVDH 3WXVL 4PJ7B 5C09A 4PJ8C 3ZKSD 1FAKT 1CICA 2M8XA 4LLQA 3GMPB 3ARZA 3QDME 5B3JE 4Z8FH 2AJYL 1TXKA 4RA3A 3D2UB 3HG1A 1XH3B 4JFPA 1NMCB 1FVCA 5DUPH 1MJ8L 3VI3E 3OKOA 2CRMA 2ADJA 4JFYB 2AJVL 5EO9B 1INDH 2RBLA 2ERJB 3ZTJG 1HIMH 1T7ZA 4LLVB 4X6DA 3V9FA 4KTEH 1T1ZA 3RDTD 1EVTC 2HWZH 4LCWB 4XAWH 4OV5B 2PW2A 4XB7A 1IGYB 4XMKL 4KKAD 5C0CE 2BC4B 5E5UB 4YDIL 3I6KA 2HJLA 4NQDA 5FGRA 1J1XH 1B6DA 5AD0A 3NCJL 1F45A 5D70L 4S1RL 2AJZB 5JA8B 1L7TH 4X0KA 3NA4A 3BEVA 5JORA 3KYMA 4HS8L 1AQKH 1WCBA 4G9FE 4JEGB 3DV4B 1YA5A 4JM4H 3AS0A 2E5EA 4KGJA 3PHOB 3ETBF 3GKZA 4WTWA 5BZDB 3DXAB 4Z77A 1WVZA 1IT9L 4XWGH 5K59E 5E2VL 3QI9C 3GSUA 1U2HA 3PWJB 1ZGLM 4MNHB 3T0EA 1NEZB 3WEXA 3KYKH 4I4WB 5HGAA 5HHQA 3UYPA 3TN0D 3PP3H 3UTOA 5ITBL 5F89A 1RVFH 3C5SA 1U3HB 1T5XB 3QBTB 1FVEB 5KSAA 3ZYOA 4MDJA 1FL6B 1MAML 1MLCB 3SKJH 3A6BL 1BM3L 2X9XA 5CJOL 3MJ9L 1BVZA 5D7SH 3CCHB 1C16B 1IL1A 1AE6L 1C08A 2BP3A 4PYHA 1BOGA 4ZUUA 3BKCL 4EJ1C 1ZMYA 1V05A 5BMFL 4ZNEE 3MJ6A 1LEIB 1UYWL 1YN6A 3U0WL 4MWFA 3LZFL 3UTZA 1YNTA 4OT1H 1RIHL 1TVDA 3ARFD 4EI6B 3STLB 5EU5A 3NAAH 1SHMA 2NY6D 3MYZA 3GHEH 5L8LB 2ARJA 3SQBA 4ZTOL 2VDLL 4BQ9A 5KS9F 3DGGB 3RJQB 4UZGA 5E8NA 5EUOF 2Q3ZA 5ICZA 4R4FL 5KSBE 5TGBA 4OZHB 5DMGC 4YUEH 4LPVA 1S9KC 2RHEA 2Z8SA 3MRQB 3IKKA 4LHUB 4WNQB 5HGHB 1JWMB 2Q1EA 2QQQA 2EDNA 3JVGA 5JQ6L 1VEMA 3D2UA 4Y4KD 1XH3A 1GIGL 1HHGB 5DURB 2DI9A 4Y4FD 1JZ7A 1FVDB 2AXJA 5F3HB 5F7LB 5HHVH