5EZJB

Crystal structure of fab of parasite invasion inhibitory antibody c1 - orthorhombic form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
213
Chain Sequence
SIVMTQTPKFLLVSAGDRITITCKASQSVRNDVAWYQQKPGQSPKLLIYFASNRYTGVPDRFTGSGSGTDFTFTISTVQAEDLAVYFCQQGYTSPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab c12 heavy chain
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezjB01
4D3CH 3MCLH 2IQAB 4XNZB 4LLYA 3S4SA 1IT9H 4U3XA 3H9HA 1KCVL 1KELH 1IC4H 4XPTH 4E41A 3W9DA 3WSQL 4FFZH 5F7YC 4OZFG 1NCWL 3V6FA 5CJ5A 1A1OA 4GLRH 1BJ1J 5HXMA 1BJ1H 1M7IA 5AZEH 2VLRE 2XTJD 3DXAB 1T03H 2P42B 3QHFL 2A9ML 1T5XB 2EC9T 1UVQB 2HTLC 4Y5YA 5FYJL 3GM0A 5CEXA 1HHIA 1MFAL 4WI7A 5D7IB 3DX9B 5C0BD 1J8HA 5CEZE 1DE4B 5T3XE 5E1AB 1FGVH 4PJCE 4QHNA 1IGYA 4Q9QL 2CIIA 4KKBC 2OR9L 4IDJL 4RMVA 4DVRH 4GRMA 4YGVA 2AKRA 3AXLB 2J2ZA 1U95B 2AGJH 2ITCB 3RIAF 3VH8G 3DRTA 2ITDB 3GSNL 5I76A 4L8SC 2GYSA 1G84A 3GI8H 4OZGF 3DHMA 1LGVA 3IU3B 5E8OA 1CFNB 3KPLA 3IAQA 4U2ZA 1XGUB 1V3JA 3GSQA 5SX5H 2APFA 3IRPX 1ZLUH 4OZIE 1S5IH 1JRHL 1HXYB 4R9HA 4TNWK 3T2QA 5L8LB 1VFAA 4RRPG 4XNUH 4IOIB 3RVWC 1I9IL 1PKOA 4OLYH 4KGJA 3AVEA 5INCB 4K3GA 1NBYB 1GYAA 3DSFH 3NACL 3TYFB 1BF8A 4HF5L 2EKSB 4LMQI 5DUBB 1MRCL 4XH2A 3V0WH 4WU5B 2EIZA 5KSBE 3SHSA 2HVKA 5EZLB 4KY1L 1CDHA 4MAYA 3CVIH 5EO9A 3HPLB 3KYKH 4K3JH 3BDBA 2HJFA 1QLEL 5EC1B 4X5LA 5GS1C 2FX9H 4OGXL 3H3PL 4JLRB 1U8IB 1DFBH 1OHQA 2FEEL 4LSSH 5A16B 2IFFL 3LRSB 1OWWA 4JFFE 1RUQH 3P77A 4GW5A 1D5XB 5DJZA 2VDLL 3F5WA 3CH1B 4OLXL 25C8H 1ZT4A 3V0VA 1M4KA 5J6HA 4U6XA 4LHQB 3DETD 2WNGA 3ARBA 2X7LB 4XPBH 2NXZC 2A6DB 4L3EA 4NCDA 1A6WL 1MFCH 2BNRA 2FX7H 3RVXC 3TIDA 4PJDA 2MTPA 4ENEC 4XAKD 1UACH 2Y5TA 2VN7A 1BBJA 4M1DH 3X14A 1ZA6B 1X5LA 4KZDL 3SOBL 1J1XH 1P4BL 1XF2A 4WUUB 3LS4H 4KUZH 1QEWA 2CDFB 3IDIA 3TN0D 4TULL 1MQKH 4AENA 1PQZA 3EDEA 3L6FA 5IHZB 1T0PB 5I1CL 5LQBH 4MMZC 5B39G 2F8OA 2D7OA 4KK6C 5KVMC 1FDLL 4WWID 5ESVA 2KZWA 5CGMA 3EDJA 3QIWA 4ZTOL 5HVFB 3V7MA 3O9WC 4OV6F 4WFFD 1PAMA 1UG9A 1UH4A 3IFPA 1BD2B 1T22B 3R1GL 4MNGB 3QRGL 2SEBB 5IKCA 5F7WC 3QG7L 1NAKH 1OGAD 2FJFB 1DQJB 2CLVA 3FHQA 4JFPB 4OZHF 5SWZD 4JM2D 5D2NA 4M4PA 1E6JL 5CLWA 5FKPB 4K23L 1TVDA 3WN5C 3JTSA 4C58B 2EIEA 1U3ZA 2FB4H 5I1GH 4GJTB 4G6FB 2DQHH 2J8UF 3F62A 1Q9WB 1CL7H 3I3EA 4MXQC 2E27H 5F72S 2EDHA 5AUMA 3C5ZA 3DUUB 3OJDB 4DJMA 4HV8A 4G6JL 1AGDA 1UB6B 3MRQA 2R2HA 2VLKD 5EBMA 3WFBL 4KJWC 1RY7B 3H9SB 5EC2A 1WBZB 1BVLB 2H26B 1FIEA 3BUYA 3TBSA 1GC1L 2X1QA 1AGBA 2GJJA 4KDWA 1QSVA 1KJ2L 5E03A 3BI9X 3WNPA 3B9KD 1F4WL 4WEBL 2VLRA 5EOQL 3W9EA 5IVXB 2YPLE 3D1MC 1PX4A 5FV1L 4TSBL 3MNVA 5MP6L 1E4XI 5ABDE 4UIKL 1K8DB 4GAGH 4NQTA 5CHNB 4FABH 2FRGP 3X13B 2RCSL 4HK0B 3PL6D 1U8HA 5DQ9B 1X6NA 4QXGL 1Y0LA 4RGNB 4PJCA 1XAUA 2XZAL 2NR6D 4S1SH 3RDTA 4E42B 1R24B 2AXFA 4N0FB 3DIFB 3O6MH 3D0VB 6FABL 1JGVL 3R06B 1XGTA 3ZYIA 2DQGH 1QLRA 3X3FL 3VXNA 1WBXA 3SE4A 3VXPB 5DMJB 3V52H 2E6PA 4V1DE 4GG6E 3VFVA 4ZQKB 4J3VA 5DJ2B 2YUXA 2H32A 3OKMB 1HHHA 2UZYB 4PY8I 3L1OH 4P2OB 5F7DB 2CO6B 1JN6A 2XG4A 4DEPC 2PYED 1AGEB 1W0WA 3CFJA 4P3WA 1EZVY 1KEGH 3WUWG 4K7FB 5IK3B 3NIDF 1HWHB 4KQ3L 3FB5B 2WBJD 4KRMB 1NCBH 3DI2B 4OZIA 3VWKC 2YK1H 4YHKH 5IJKC 4WWKB 2DL9A 3RVUC 3CFBB 3BRFA 2W0LA 4R2GD 3RWDB 5JO5B 1G9NL 4ELMB 2IAMD 3IF1B 4ALAH 2ZOKA 3CAFA 3OKKA 5BO1H 2D9CA 3HC3H 1YDPB 3QDME 2OM5A 3DO3A 3TVMD 3CZFB 3LMJH 5HHNB 2VAAB 3HMXA 2VITB 4LSPH 5KSBA 1YMME 4IMLB 3S6CA 1EA9C 4KI5E 2PTUA 3O6FC 3SDYH 4K7PX 2YBRA 2GAZB 2YUWA 4LCYB 4XTRD 5M95B 2C1PA 3OR7B 1JGUH 4WENB 4DKFH 1YN7A 5IEKA 4K9EC 4OAWB 5AYUH 4D0CA 5I9QC 5HYSB 4MDJB 3I6GB 3V5DB 1RD6A 4NIKB 1EAJA 2X5PA 4RX4A 3ARDA 4IRSC 1T89A 3REVA 3TBVB 3IDUA 5SX4I 3OAYH 4PJGF 2EE2A 5CGYD 4I0PD 4F7PB 3RVTD 5GGSA 5I15H 1T5WB 3QXAA 4HJ0D 3VFTB 4KRPD 4TUJB 4GKZA 3TPUA 4HULB 1SY6L 1DVFC 4I77L 4NHUB 3X11B 1R3LA 4QRQB 3IXTA 1HSAB 4WO4C 3SDCD 5FO7A 4ZUTA 3VG0H 1M7DA 3U30B 2R56H 4HIJA 3TH3T 3MRMA 5F1IA 3CVHH 5DMIH 2DRUA 1RU9H 5AAMA 4QT5B 2VXVH 2DD8H 5F9JA 1IJ9A 4LVOC 2F19H 3BN9D 4M02A 4G43B 4S1DD 4BYHA 4CVXB 3HRPA 5ADPL 1GGUA 1IGFL 2ZUYA 1AHWA 1FORH 1W2KT 1OP5K 4YK4C 2JKXA 4P5MA 2GEEA 3VU2A 2F54E 3QCUL 1JUFA 1XCTB 4PB0L 5JA8B 3ZE0E 4YHOH 5TE7L 1FNEB 3FRPG 2GSGA 1WZ1H 5IMLB 3IDNB 1P1ZA 3FQWA 3PP3H 2GJZA 4DN4H 3TGXA 1J11A 2IAND 4PIRF 5DD6B 3DMMD 2H2PD 2F74A 3ME0A 4NQXA 5C0GB 2YUVA 1JTTA 5E0QA 3BSZL 3AM8A 4RZCB 4UDTA 3IDXL 1CICC 4FTVE 4UV7H 5I71B 1S7SA 3EO9H 3LN4A 2DLHA 5EN2B 2RB8A 5T1DL 1INEH 3DUSA 1HILB 3MZGB 4Y5XC 3JXAA 1QO3B 1IVLA 5DHYA 3GGWA 2ARJQ 4BQ8A 1CI5A 2EKJA 5A2IH 3FRUA 5I30L 1MIEL 4AIXA 3RX8A 2Z8SA 1NMAL 3OV6A 1NSNH 2OP4L 3TBYA 3FB7A 4X0KB 3A6BL 1N0LA 2X10A 3IJSA 3X12B 2YPLA 5J56B 1NEUA 2IQ9L 3O6LL 1HXMB 3PXJA 5A2JH 1WWBX 3ARTA 1GOHA 3I84A 4IRJD 2F53B 4D2NA 4YUEL 4YDLB 2FEDD 4CVUA 2BXYA 3BW9A 3G08A 2C3XA 3U82B 1I8KB 2H1PH 4OCMC 5I17A 4JPKH 2MWCA 3RL2A 4YDVB 1IGIL 4YHNA 4C59B 3G6DL 2RAMA 3HMXL 1MY7A 4G6MH 3BZFA 4JY6A 3ZKSD 4RFEB 4B0MM 1FNLA 2YEZB 4K8RC 5DD1L 3GMQB 2GITB 4EI6A 4FQCL 4GG6A 4IBLT 4V1DA 1RMFL 1RUPL 3JTTA 3SCMA 2ZWLT 1T1XB 1L0YA 3EYVB 5KSAB 5MEQA 1HDMB 1YY8B 3QDGD 1R0AH 3CNKA 3U7YH 2B0SL 4LHUG 4PLKD 4GRWF 3R8BB 4N8VB 2CDEA 3TLRA 3BQUA 5GZOD 2ZUUA 2DQCL 5L6YH 3QIBB 4MA7L 3UTQB 3Q2CA 4FZEL 1IM9D 2D7TL 1QSEB 5LGJB 5E2TH 3GBMH 1E6OH 2CKBH 1YEFH 5EBGA 5AEAA 4OCLC 4X83A 2MCPL 4ZUSA 2VZUA 2DIAA 3GIZH 2OTUB 3QDMA 2FO4A 2UZIH 2HH0L 3D48R 1YMMA 1AY1H 1HEZA 3S97C 5I1EH 1ERNA 4IDLA 4F7MB 2P5ED 5FF6A 1FFNB 3CFCH 5EORL 3RPIB 3ROLB 1UWXK 2Y06L 1J0KA 3MA9L 2QL1A 4QYOA 2ADJB 3WFHA 3S98A 2FIKB 1U36A 1G0DA 4GG8A 2VZOA 2CO7B 2IH3A 4Y5VA 2YHGA 4NT6A 5E6ZA 1FAKT 1H15B 1TJHH 3EOBB 4Y19E 3KPRB 5CAYB 5BVPL 3RUGB 3D2UA 1GOFA 5HVHC 1DSFL 5F3HB 3GI9L 3ZKQD 5FUZH 1PLGH 4MQTB 4ZD3L 3P11L 1JHLL 2DOCA 3NIGF 4MA3A 5E4EB 2H6PB 5KS9E 3W11D 2DQDL 2UY7A 4JPIB 5DRXA 1E4KC 2EDQA 4DUVA 1P7KA 4JREB 4NUGL 2YD6A 3SGEI 3P3YA 5T1MA 5D6DA 4Z7VB 2P8LB 2BMKB 4XMKL 1S7WB 1G7LB 1ZKAA 1L4IA 2DQTL 3IFOB 5KOVC 4ELKA 1LMKA 4ODUA 4XP5H 5DMGC 4G8IA 2C5DC 2VOTA 1IAOB 4APQD 2F54A 1AR1C 4KV5F 5GJSL 3AMKA 5E00B 1BGXH 4KKLD 4WTZG 3CU1A 3HR5B 3NZHL 4LLVA 5K59E 1DQDH 4YFLF 4R90L 4QRSA 1X3DA 5E95B 4XCEB 3NA9L 3EZJB 3ULUE 1XZ0A 2C1OA 2YPKB 3EYOA 2R0ZH 3T3MF 1LHZA 4FQXB 4R7NA 2J12B 4XPAH 2BVQA 2IQAA 4GLRI 2OL3H 3H9SE 4X6DB 1RZFH 3QQ9C 4GXVL 4EN3D 1DQQA 3RAJH 1RVFL 5CP3A 1EXUB 4YHZL 2E7BA 4X8JB 1BQLL 1RJLA 1H8NA 2VL5A 3WKML 3MBEC 1TZIA 3BD5A 5EPMB 5HGGS 1NBVH 4F7TB 3U7WH 5DD0H 1KN2L 5IVXE 3FTGB 4OKVB 4U1LA 2LV4A 5BS0B 1N4XL 1SMAA 5I73B 1GGCL 3QJHB 1T1ZB 4HKBB 4A6YH 3DX9A 4IHOB 4ISVB 2AXGA 4OT1H 5HD8D 2WMPA 3RPKA 2BX5A 2ZCLH 4QHUA 4EUPH 3D0LA 3LSOB 4NQDB 3QWRD 3F8UB 4NBZB 5J4MA 1U95A 3C5SA 1MAKA 3DURB 1HHGA 2W9DL 2V2XB 4LLDB 4MCZB 4LEXH 4QRUA 4WV1C 1DBJH 3SN6N 1C1EH 5EZJB 2ITDA 1N6QH 4ZTPH 1W72H 1NCDL 4ZFZB 2WP3O 4YDKL 4NO2B 2AJSL 1XF4B 5CJ8A 3IU3A 1CFNA 1A4KA 1ZVSB 3V6ZB 1Z9SA 4M7KL 4Y4FA 4ZFGH 3C6LD 5IBLD 3EIFA 3K46A 4PJ5E 4RFOL 5MEPA 3OF6D 3GJEB 1MJJB 4H1LH 4L3AA 1CDGA 4O02H 4J2XA 1HXYA 4X7EC 4LLWA 1MI5D 3ARFD 4IOIA 4M5ZH 1YJDH 1NKRA 2Z31D 3CDGB 1FO0H 1TCMA 1XR9B 1NBYA 1YNLH 1G9MC 2H9GB 1N59B 3DV4B 2EKSA 3IB4A 5DUBA 5JR1L 5CWSB 1QKZL 2GTZB 1A6UL 2QQLL 4P5KB 1F00I 1CGVA 4E0RB 4OCYL 3BH9B 2QADC 2DIJA 5I1JL 4P2RD 1U3HD 5EC1A 4LQFL 5I0ZA 2DQEH 5L2JA 4K3DL 3QUKB 4Y16B 1NGQH 3PQYB 1OPGH 3T0AA 2WZPD 1U8IA 3HI6H 1A7NL 3MV8B 2QSVA 1YYLH 3X17A 3HI5H 4Z77B 5I1KH 4GQ9H 3HI1A 4YX2H 4PRPD 1D5XA 2X4PB 4OZFB 2W60A 3BEWB 3CH1A 1ZS8B 1QOKA 4AMKH 3LD8C 1DLFL 5DUPH 1EERB 3VA2C 3WXVL 4RMRA 2A38A 2A6DA 3BZEB 3PIQB 3OTTA 4R26L 2QQNH 1B88A 1KB9J 2APVA 4TTGA 4Y19A 5MI0C 4X4ZA 5EU7C 4GAJH 4HMCA 4YXHL 1MCWM 1LD9B 4KVCL 4OLVL 3QISA 4WUUA 1QBML 3U7AA 1NAMB 1FFRA 4Z7NF 5C0JB 3IS1X 2ZSVB 3T0EE 2AEPL 4PRIE 1W8OA 2ZCKH 4TVSa 4ZNEE 3ZE1F 3VH8B 5KS9A 2B2XH 5SWSB 5GZND 2X4SA 4YDIL 5E6ID 3CK0L 1KCSL 2ESVE 2ZG1A 1IILE 5F3BB 1MUJA 4ETYA 4Z5RA 4N5EC 4PV8B 3OZ9H 4QTIH 3FQXB 1T22A 2XA3A 2Y25A 5MHSE 2XTJC 5E5MB 5IIEB 4CW1B 4LGRB 3QNXB 2FJFA 1A0QH 1KIQB 3PG2A 4JFPA 1CL7I 3GMRA 2XTLA 4UDUB 5FKPA 2IPKB 1VGEH 2VXSL 3GMOB 2VR4A 4MMXC 1Q9WA 5IHBA 3U0WH 2WUBL 3DUUA 1KGCD 3OJDA 3LN5B 3B2UC 4KQ4H 2UWEB 3SKNB 2VZVA 1LO0H 2X4RB 4NO0D 3EFDL 3ES6B 5BV7H 4P23D 5JPNA 4N68A 3WKNA 3H9SA 3PHQB 1WBZA 1BVLA 2H26A 3NGBB 5E2VL 4EUPG 5JA9A 4BM7A 3ARUA 3PJSB 3OSKA 4ZPVA 2BY2A 1JFQL 3D39D 3U46B 4LSTL 4Q6IB 2DWEA 5EU4A 1MJ8H 5IVXA 2VWEC 1QFHA 5GRUL 4MD4B 1D6EB 4X4XA 4GT7A 5CHNA 2F53E 1PBYA 5L9DH 1GPOH 2DKMA 1KACB 4LRNH 4OCWL 5DK3A 3MLXL 2ICWJ 2R2BA 4PRNB 2XZQH 4E42A 3IAGC 1KSRA 3DIFA 4PRAB 4PJHF 5D2LE 1UKQA 3VRIB 1BZ7B 2DYPD 4OTXH 1MFBL 2PKDA 3VXPA 3G5ZB 1QBLH 5IBUG 4QXWA 2EEAA 4ZQKA 3TT3H 1INDH 3AFLA 1OAQL 5F7DA 5B39B 1LEIB 2ZSWB 3O2WL 5HYIA 4JVWA 4P3CL 4XNYL 1T6VN 2PETA 4PJ5A 5FO9B 4K7FA 4G8EB 1QUNA 5IK3A 1YYML 2R4SH 5B3NA 1FZOA 2X4UA 3L95B 2APBA 3NN8A 4BH8B 1G7PB 2YZ1A 5D7LB 3VXUE 4M1GL 3CFBA 3RI5K 3GUTB 4I3RL 5JO5A 3QH3B 4HXBL 4ELMA 2XZCH 4L8SB 4I48B 4D9QE 3HS0A 4H25B 1GAFH 4OLWL 5HHOD 3ARWA 5C0RH 3RY4A 5HHNA 5E56A 2VITA 1HIMH 4K7PY 4QCIB 1HINL 3TN0C 4AH2B 4D9RE 3MJ9A 5C07D 3QUYA 1AJ7H 4LCYA 4OKDA 1HWGB 3F7YA 3VFGL 2M26A 4WJ5A 4WU7B 4PG2A 4NUJB 4OAWA 2QJDA 1XMWA 3QEUB 2HJLB 2D0FA 3I6GA 3V5DA 2EYTA 1YEDB 4WI4A 1LO4H 3C2SA 4U6VH 1NLBL 2GSIB 4YHIA 1NMBL 4YO0A 1MHPL 3PWJA 4NBXB 4KVNL 5EA0H 4H88H 1KC5L 4JCMA 1NMCB 1TVHB 1CN4A 3RUGE 5TF1H 1XGRA 3U1SH 4LVHB 3IYLW 4TUJA 4Q58C 4XCYB 3MRNB 1SVZA 1CU4L 4WFGE 4Z76B 4JM2C 4ZOBA 3QCVH 5IHUL 1QRKA 3A6CL 3AS1A 5BOPA 3MXVL 4QRQA 1HSAA 5BXFB 1GIGL 1KENL 3ULUL 4JM4L 1U8PB 3B9EA 5IVZB 3OKEA 4KAQH 1CBVL 2DQUL 1JPST 1S7RB 3HZVA 3T0EA 4PRIA 2OJEB 3VRLF 5DQJB 4QT5A 4ZNEA 3GJFH 4Z7VE 2XWBA 4LARL 4CGTA 1CD1B 4G43A 4NM4H 4KZEH 2PR4L 1JNLL 5CSZB 1P5VA 2ESVA 4ZAKA 2VDOH 3ESVF 5ERWB 1YNKL 4X6CF 2R2CA 1XR8B 4L9LC 4OD1L 5C6TL 3RIFF 4ZOAA 3UAJD 4UU9A 4MB3A 4ZPTA 4GUPA 4XBPA 5IM7B 3QULB 3WUWB 3MV9B 3B9KC 1XCTA 4LP4A 1Y18B 2B1HL 1KV3A 2A83B 2AJXH 1OAKL 1MWAA 3P4LA 4NNPH 5EULV 4YHPB 3GKWL 3IDNA 4I3GA 3PL6C 1A1MA 1G7IB 2EDBA 2NY5H 2H45A 4ODWB 5EB9A 1K6QH 2NR6C 2VIRB 1T04B 5C6PB 4RZCA 3KJ6L 3LDBC 4WVRA 2YN3A 5EN2A 3ZTJG 2ZNXA 1CE1H 5AWNL 4NJ9L 2EECA 5F9OH 3LZFL 1GGIL 1Y6MR 2R8SH 2HT4D 1DBKL 4F9LC 5KVDH 2N4IA 4JJHA 3L5HA 3N1PC 4PP1D 3T77B 1P84K 3QWQB 2FD6L 3IFNL 3TA3B 3VGHA 3SKOB 3V9FA 4LGSB 1A9EB 1B0RB 1A7PH 2GW5A 5FUOL 5DVLA 1SBBA 4TSAH 4DFIA 2Q8AL 4AEIL 2YRPA 2VDPH 1SMOA 3SEPA 4GH7B 4JE4B 4YFDB 3DVFA 5DJCA 4KMTL 3X12A 4G8GB 2WBJC 3FZUC 1HXMA 5GHWL 4NQDE 1L7IL 1D5IH 4U7MA 2F53A 4HZAA 2IAMC 4DGIL 4G3YH 1ORSB 1I8KA 2ARJA 3MFFB 4JHZA 4YLQT 2UV3A 1DDHA 3TVMC 4YDVA 2YR3A 5F89B 4MD0B 5TDNA 5C0FB 3BPLC 4HG4J 1DUYB 1BFOB 4LSVH 3KPPB 5BMFL 2YEZA 1MRDH 5MENE 4XNXH 3GMQA 2G60L 4XTRC 5I6XB 2KQMA 1X4ZA 2EEBA 1IC7L 1T1XA 5FHBH 1ZT1B 1AE6H 1HDMA 4NRYB 2OI9B 4MAUL 1IM3A 2VDML 2WBWB 2NZ9D 1A9BB 5CIPB 3QIUA 5CZKA 4N8VA 1PGRB 5CGYC 5KW9L 3KR3H 5D4QA 2WLYA 5TE4H 4I0PC 4DN3H 1R5IA 2XN9E 1JJUA 3RVTC 3UTQA 4DAGH 1MCPL 1FFQA 3BH8A 4HJ0C 3WEXA 2NY3D 1Q72L 5LGJA 1EGJH 4D0DB 3S3JA 1ZE3C 3KPQA 1I9EA 5ANMB 1DANT 5BRZB 4HJGB 1GVIA 4DEPB 1WZLA 3SDCC 4G9FB 2OTUA 3O4LB 3B8YA 4YWGL 1CXKA 3LKPB 1IQWL 3UP1A 4UV4L 1PSKL 1IC5L 2G2RA 3MV8E 1A22B 4G7VH 3U4EA 1SYVA 1UWEL 3B3IB 3WHXA 3GO1H 5KG9A 3N06B 5DLMH 4EBQL 5DHVA 3VXRB 1IZKA 3DXAD 2GK0B 3OGCB 3BN9C 1NCNA 1N64H 4X9GA 3CJJA 4S1DC 1A4JA 3P0YL 3P30H 3B83A 4PJ8C 1P4LA 2IC2A 4MNQD 1N3NA 2D31B 5C08B 5T5NG 1ZHBA 4LASL 3RNQB 1JK8B 1H15A 1WJ3A 2CGRL 3EOBA 4WY7L 5I1DB 3MRHB 3O6FB 3RUGA 1MWAL 5IB3B 1UM5L 2BHYA 4OFVA 3O2DA 5I9QB 4JY4A 3FN3A 4PRDA 1FZKB 4FG6D 5DEGB 2D7MA 1CGYA 4IRSB 3DMMC 2H2PC 1LO2L 4R8WL 2H6PA 3I2CL 5SWSE 4JPIA 3BKJH 4YXLL 1S7TB 3AROA 3OG6B 3RWEB 2FJHB 1MIMH 3WFEH 1TZHB 1MCKA 1CLOL 1OT2A 2NY0C 3KYNB 4Z7VA 1PX3A 1S7WA 4AEEA 4L8DA 4NQCB 1RURH 2NY2D 4WO4B 4LCIL 5JQ6L 5J12B 1WAAE 1AXIB 4LHUB 1N8ZB 2BNUB 3CSBA 4GMTH 2C9AA 3QJFB 1IKFL 1TJIL 5E00A 2L7JA 4JN1L 4FQPA 3HR5A 3LEVL 3MRLA 4MXVF 1QPPA 3OAUL 4NFCA 4LVOB 5FM5M 1EBPA 4IRJC 4XCEA 4HWBA 2NY7H 5D1ZB 2N7AA 3MRIB 2DMBA 5F21B 5GRJH 1YEIL 4YK4B 2B8OT 2ZJSL 3ILPB 4MS8C 3DHJA 1Q38A 1GZQB 3MLYL 1ZA3A 4X6DA 1NDGB 5KSVB 4JFEB 1MCOH 1CXEA 4LIQL 1K8IA 5C09D 4HIXH 4M62H 4U4BA 3DYOA 2BY3A 1EXUA 4X6EA 4X8JA 1HKFA 3G5YB 4NP4L 2EDYA 4J3UA 3FTGA 4OKVA 1F3JB 1DQMH 1MPAL 32C2A 3MLUH 4HWZB 4OFIA 2VLJD 5DS8A 2ZG3A 4PLKC 3QJHA 4HCRH 2J4WL 3CVHB 3I6KB 4HKBA 1EO8L 4N0RA 1Z3GH 4H5SB 4F15B 5GZOC 4WUUD 4Z95H 1AH1A 2W9EL 5CCKH 1MHHB 1EEYA 1AP2B 4IMKC 2BSTB 4NQDA 4R7DB 2G5BB 1JTOA 3I02B 2FX8L 3RTQB 5CUSH 3V5KB 1KCUH 3TEUA 1AQDA 5BCAA 3DURA 1DBML 1MAMH 4IIQB 2Z35A 4R4BA 5CD3B 4O51B 4LLDA 5ESQB 3UBXG 3QXDB 1F2QA 2CIKB 4JHBA 2DF3A 1MJUL 4MXWH 4P99A 2A1WL 5DUML 4PB9L 1WIPA 2HKFL 1PW3A 5FA3B 5HDBF 3O4OC 4LSQL 5MENA 3NCEB 1NFIB 4POZC 1BD2D 4CMHC 3G5VA 1JZ6A 4HT1L 3GJEA 1JWMB 1S7VB 1YEHH 1MJJA 1KXQE 1E4XL 1VGKA 5LWYL 3SY0A 1A64A 5D7LE 1ZGLP 2GT9B 3P0VL 3RWCB 1FL5A 4JQIH 1WWAX 5F7EL 3V4UL 1SEQL 4DOHB 5MEOB 3CDGA 5IGXL 4YR6A 4G6FD 1UM4L 3JVGA 4FMFA 3MMEB 1A6VL 1LP9E 3BAEH 1N59A 3DV4A 4DQOL 2HTKD 2GTZA 4P5KA 3O2DL 1MCSA 4E0RA 4MQ7B 5D9SB 4Z7WE 4Z7QE 3RWGA 3TZVD 2KL6A 3BH9A 5GGVH 5EH1A 3NIFF 1RK1A 1ZOXA 4Y4KD 1QBBA 3WIFB 3MGTA 2AK1L 3FAXA 5F1OB 1F58L 3QUKA 4XP4H 1RZ7L 2ATPB 3MV8A 4OJFL 2A0LD 3ARRA 4Z77A 1KYOJ 1ONQB 1FRGL 2M8XA 3EDKA 4OZFA 3BEWA 4IOSD 1ZS8A 1PG7X 3MJ8B 3QEQE 1JPGA 4LSUH 4X4ME 3MJGX 1LILA 3ZE2F 2CK0H 3S36H 2M1KA 5DWUL 3VXMB 4RGND 3RBSA 3BZEA 4XC1H 5GPRA 5ID0A 1P4IL 1QRND 4APQC 3MODL 5C0AD 5C2BH 4I9WE 3N50A 5DTFB 4RIRB 1QQDA 1FAIL 1LD9A 2EE6A 1S7UB 1HH9B 1HI6B 4B53A 5IJVB 1BFTA 4HWBL 2AK4B 3ARSA 1C5BH 4LU5H 2Z8RA 3ZL4H 5C0JA 1KCKA 3FCTB 5EUKB 2HLAB 3UEZA 4I2XB 2FR4B 1T4KB 4P2OD 3VH8A 3UYRL 5SWSA 2C3VA 1LE5B 3GRWA 1BVZA 3T0XA 3VFOB 3K2MC 5HHXH 5HVHB 2A6IB 3GZKA 5F3BA 1WTGT 2CKBB 4ONGL 5FUCE 4M7LH 1QFPA 4WWKD 4RWHA 2VISB 3V5HB 4LPUA 5IIEA 3QNXA 5ILTH 1RZKC 4RRPA 2YC1A 4JZJB 1WAAA 1UA6H 5FO8B 5J11C 4UDUA 4Y1AB 4FQHA 4U1HB 3J7HA 2O5YH 4JPWL 3TT1H 5IFAL 1NLDH 4I4WB 4ZSOB 5D7SL 4HMDA 3RY6C 4KKNA 5HDQL 3LN5A 3I6LE 4RBPH 3FQRB 4FZ8L 3MNZB 2UYLB 4AG4L 2X4RA 4YBHA 3W2DH 2KPNA 5DMYA 1CXIA 1NJ9B 2C3WA 3LKRA 4P9HH 4U0QB 3DUHA 5FGBC 2OYPA 3QDJE 4X6FB 1CQYA 3KXFB 2Z91B 1C5CH 3D85D 3L7EB 4ZOEA 2X4NB 5IBLC 3C6LC 1QR1B 1NUGA 3FONA 4R4FL 4TYUA 5LKNA 3KVQA 1Q0XL 2GJ6B 2PW1B 4F7EB 4P4RB 5T1KA 3VXTA 4MJIB 3WO3B 4L8CB 4MD4A 1BIIA 2VTFA 3ARFC 4OLZL 4N1HB 2ICWI 1U3JA 5D70L 3MLPA 1VACA 4ZUUB 4BH7B 4PS4H 1F3DJ 4JZNA 3MYJA 3EYSL 1ADQH 1F3DH 3ZKMC 4DZBA 1A47A 1YEKL 2HT3D 5C6WH 2DWDB 3MRJB 2VDKH 5A2KH 2Z93B 4YHML 3VRIA 4NJAL 1KIRB 3PP4L 3G5ZA 4MWFB 1U3HC 4P9HC 3MOQA 4XMLH 3AS0A 3LKSB 5B39A 1SEBB 1FG9C 3ZKNC 1BBDL 1K2DB 5LGHH 5KSBF 3ZYOA 3WJLA 1OCWH 1JPFA 2G75B 2VZ3A 3DVNA 1RZ8B 1OP3H 3L95A 4NN7C 2EYSB 3CXHK 3ECBA 5D7LA 4WV1B 1CCZA 4PJIE 3WFDL 3QH3A 1AXTH 4L8SA 4Z78A 4KROC 4UINH 1Z0MA 3NCJL 3B4NA 4OFYD 5FGRA 1YEEL 4H25A 3THMH 1ES0B 4G9FE 5I1AA 4TUKH 5K9JL 3G04B 2LVEA 4Z7WA 5ALBL 4M43L 4QCIA 2XIDA 3NFSH 4ODXB 4AH2A 3EHBD 3VGAC 4A6YB 4GS7C 4PJXB 3I75A 5I8CB 4UI2A 4XCFH 5GZNC 3GRWL 2HJLA 5E6IC 2V5YA 3V79C 5CJOH 3LKNB 4Z7UB 4N0UE 4EUPB 1D5BB 3ZMRA 2GSIA 5FYLE 2IJ0C 5E94A 3NTCH 4OSUH 1SJEB 1UEMA 3S35H 5L2KD 2QADB 3ZDXE 1TVHA 4JG0L 1FIGL 3EYFA 4X4MA 4XPFH 3QPQD 4NCC1 4QRPD 1SHMA 4XCYA 5GS1A 1V3LA 1W72B 4Z76A 4UT7L 4EIZC 4HZLB 4JKKA 3O8XB 2XKNA 4YNYB 1ZGLM 2EH7L 4HHAB 3HG1B 4NKOB 1SJHA 1JF1B 4NN5B 5IVZA 4GRWH 2GY7B 4HJJL 4PRHD 3UPRB 3NABH 1JWUA 3MV7B 4BSVB 3QO0A 1S7XB 3GK8H 4HQQL 3D6GA 2OJEA 3CXDH 3INUH 3D3VD 5KSAD 1E4WH 1FO0B 2VL4A 4QHMA 4P23C 4CN4A 1GGTA 3ELAT 5IBUB 1JNNL 3MLZL 4QGYA 2DIBA 1AXSB 5CSZA 3E8UL 1DTUA 1J9CT 3VFMB 1XR8A 3QIBD 4K3EL 3B6SB 4KKCC 2X09A 3F6IA 1D3CA 3GBLA 3KLDA 1QSED 2FLRT 2RIKA 4KTDH 4U3CA 3EJZD 1K85A 4JAMB 15C8L 3P73B 1FZJB 2IG2L 4Z0XA 5IEHB 1G7IA 2V7HB 4Q0XL 1S3KH 4MCYB 3BIBX 5I8KL 2VIRA 2JELH 3UJTL 5DJYA 4OCRL 2HMID 1G7QB 3O9WA 1F4AA 3UZVB 3CLFH 1B0WA 3K4DA 3SE8L 4NDMB 1X5AA 2R9HD 4CRPA 3DGGA 2FGZA 4XP9L 4YXKL 1T20B 5CZVL 2ZCHL 5C0BB 3WNMA 5CJXC 3T77A 3PGDB 3O3BA 3R8QA 1CFQB 3WN5A 2IFGA 1WC7B 2DQIH 3KPOA 3QDJA 4H8WH 4D0BA 2R0LH 5H37H 2EH8L 3D18B 3FO1B 1A21A 2CMRL 2X1OA 3KPMB 3VFSB 3KPRD 1I7RB 4J3XA 4Q2ZA 2VLLA 1R3HB 1T7WA 4CAGA 5IFHH 3MCLL 1S9WB 3OXSA 3LQAC 4GG6F 4JHAH 1IT9L 3RWFB 1KELL 4XPTL 1TQBC 2K1MA 3HFMH 2NNAA 4F57H 4DGVL 3CPLB 3MFFA 4J7RA 1AKJA 1WCBB 5F89A 4RWYL 1FG2B 5AZEL 2VNCA 4YBLC 1BFOA 3C2AH 3MRDA 5F6IB 4LF3B 2FBJH 4PJBE 5HDLA 3KNBB 3MSPA 4XBGA 3FO0H 3RWJB 4NNXB 3MJ6A 4L8BA 1BZQK 3UBXI 1KLGB 3JWDH 5HDOA 4DVRL 5CIPA 4Y2DC 3KDMB 2HKHH 5CEYB 4YBQD 1I7ZA 1VADB 4NYLB 4DOHE 2HWZH 2O5XH 4JDVA 3VWJD 5A3ID 2AGJL 1U91B 4R6UA 4QEGA 4JANB 4W4OC 3FQUB 1KB5H 1I1FA 4OF8A 1AGFA 3KYOA 5BV7B 1HHKB 3GSUB 4O5LH 3JSSA 4PJIA 3GI8L 1Q8MA 2QSCH 4FP8H 4HIIB 3FRPA 1TNNA 3STLB 3ZTNH 4FQXD 1TTFA 1OLLA 4KKAD 4MHHG 4HJGA 4G9FA 4OI7A 1NGPH 3O4LA 4FFYH 4L29B 5DEFB 4WGWB 1HH6A 3UJJH 1L7TL 3LB6C 5K9KB 1QLFA 1AC6A 2F9BT 4OB5H 1U2CA 1S5IL 1X44A 1IAKB 3VWKA 5IJKA 1BWWA 4OLYL 1X5KA 3B3IA 4PTUB 2HG5A 4O2FB 2EZ0D 4HWEH 1OAZH 2GK0A 5FYKD 3AAZB 2X6MA 3DSFL 5BS0D 5IF0A 3OGCA 5HGHA 2VDQL 2YMXL 3V0WL 2ICWB 2R0WH 3PWVB 4N0UA 3HAEH 4HUXA 5IESL 2D31A 3RNQA 3UAJC 3CVIL 5I8EB 5E9DB 3BP5B 3TN0B 1OF2B 1JP5A 3KYKL 3MRHA 3O6FA 4K3JL 4ZFOB 2ATKA 1BM3H 4CMMA 5JW3H 2FX9L 2YKLL 3FB8B 1BAFH 2AEWA 1ZGLB 5LBSH 4LSSL 4MZ3A 1FZKA 3TV3H 5I66A 4I18C 3SKUD 5DEGA 4I2XE 5D72H 3L5WB 1RUQL 4IRSA 3ULVE 25C8L 2JJUA 1X5XA 3GMNB 3AGVA 4L4VD 4LCWE 2YD5A 1J1PH 3W0WD 4DW2L 4JRYE 4K94C 4P0DA 1S7TA 3ZE0F 4ZUVB 4XPBL 1ZHNB 4G5ZH 5HJ3B 3KPNB 1KT2B 1TZHA 1DVFA 1MFCL 2FX7L 1VFMA 3LKQA 4W81A 2A6KB 4FFVD 4PP1C 3CSYA 3V4VH 3H3BC 4M1DL 3QFJD 1FN4A 3MOBL 5SV4A 3LS4L 4KUZL 2NYYD 1INQB 1BVKB 3NOIA 4LHUA 5DT1H 1N8ZA 3HZMB 5JTWA 2BC4B 3RL1A 2FIRT 3RNKA 3QXTA 4CN1A 5TJWK 4X80H 5LQBL 3IAPA 2XQYG 3B5TA 3WL9B 2VRAA 5TDOB 4U05A 1T7XA 3HZKB 3UTTE 4MJ6B 3PWPD 1I7UA 4Y16D 3PQYD 4DVBB 1FVCB 4AIZB 4GRLB 1WIUA 3T1FB 4NHCL 2V5RA 1G7JA 5KSVA 4ZO6A 5ESAB 3W5NA 3TBTB 1A3LL 2PO6A 1K9TA 1PYWB 3IDJA 4YAQA 4HLZH 1F11B 3G6AB 3PF2A 4LSDA 1DL7H 3PHOA 3PL6B 5JOEA 2FB4L 4J12A 2DLIA 1CL7L 1BQHB 3U9UB 4OFKA 4KPHH 2NZ9C 4KK5D 3VJ6B 3I6KA 1CICA 4L3CB 3MUGA 2NX5E 3F12A 4Y5XA 3I3BA 1MHHA 3GJFB 4OD2A 2BSTA 4Y4HD 5C1MB 1ZT7B 1T21B 3I02A 4UMGA 1CE6B 2ZKHH 5I8OH 4F3FB 4M6OL 4NFDA 3MXWH 4XNZC 4OCNC 1WEJL 4O51A 1LEGB 5ESQA 5I19H 5D7KE 3SDXF 1K3ZA 3Q0HA 1EEUA 3VI3F 5FGCE 3U2SA 3RQ3A 2W0FB 4BUHA 4PJBA 2WBJB 1R6VA 2DJ4A 4GAGL 4FABL 4KRNA 4DUWA 1R3KB 1LEKB 3MGAA 2B1AH 3TCLA 5FHAH 1W0VB 1JI1A 4XHQA 1LDSA 1I1RA 4KRLB 4S1SL 3O6ML 5JHDB 1V8HA 1UKTA 2VUOA 3OB0H 4J1UA 3BPLB 4PGBB 5MEOA 4BQ9A 3WFCL 2DQGL 3ZHDA 2X4OB 2YSSB 3N0PB 4U1IB 3V52L 5FAAA 4PD4J 4IOFD 2JIXD 2VUYA 3OQ3B 5D9SA 1MREL 3L1OL 5E08H 3B9AA 3HAEG 3FT2B 5GQBA 4FG6C 1KEGL 1P7QB 5F8QC 2Y5EA 1UZ8B 2R1YB 3WIFA 1O7SA 2VXTH 4I0PB 4YHYC 2J88H 2YK1L 4LPTA 1T1YB 3Q48A 4Z7UE 4RNRB 4DGYL 1OY3B 1E28B 1OB1B 1Q9KB 5BO1L 1C12A 2ED9A 1K4DB 4EOWL 3HC3L 1ZLWH 3BO8B 1LQSR 2DTSA 1I8LC 2NY2C 3LMJL 3SDCB 1QYGH 2Q3AA 5GIRB 1G6RA 1CGWA 4GXUN 1J1OL 5KS9F 3UTSE 4JFDE 5E8NB 1UC6A 4OZ4B 2V2TB 5DTFA 2WUCH 1A2YA 4DKFL 1X5HA 4CDHA 4F2MA 1S7UA 4CNIB 5AYUL 1WFOA 2AJYH 1FNGB 1RULH 2D03L 4DKEL 1MRFH 1NFDE 1HKLH 4PJ8B 2HP4A 3JWOH 3MV7E 3ZSTA 1MCNA 1Q9OB 3P2TA 3FCTA 2HLAA 3T8XB 4I2XA 4Y89A 3FO9B 2O5ZL 2FR4A 1N5YH 3QCTH 3BDXA 5IMMB 5BZDB 1KXTB 1A1NA 1XCQB 3H7BA 3UBXB 4J23A 4LCWA 5I15L 3UJIL 5J1TC 5EU7E 4JRYA 4WI9A 5KVEL 1T2QH 3K80A 3T1WA 5K59F 4JY5H 2GIYA 5T3ZE 3KPSE 1DN0B 5E8EA 1MVUB 2EO9A 3BVNB 4N1EA 2IANB 3PWNB 3L3KA 2YD7A 2R56L 2XNAB 3DMMB 2L7UA 3K1KC 3CVHL 5DMIL 4EVNB 5ACZA 2VJXA 1V7MH 2AJVL 4LDOB 5FO8A 1RU9L 5IFJA 4LPWA 4HLZG 1E4KA 3WNLA 2VXVL 2DD8L 2F19L 2NY0B 4QWWD 5FM8A 2V2WA 5INDB 2NW3B 2FH8A 2BRRL 3JWOC 4UUJA 3S3PA 2XTJE 1FORL 4X5XB 5DZLA 3UTTA 5JLZB 3MNZA 2UYLA 3VFUB 4MGXA 5C0BE 1NJ9A 5HI4C 4KMQA 4YHOL 4PJ7F 2MJWA 2Z91A 7FABH 4OZGB 1WZ1L 2C4FT 4N0YH 3L7EA 1QNZH 4DN4L 1QR1A 1DBBL 2ZP0T 1MHCB 5EBWB 4JFZH 1R3JA 2YD9A 3BGMA 4P4RA 4MJIA 4L8CA 2B4CH 4UV7L 1N7ML 4M6ML 4HIHA 3P40A 3DBXB 1INEL 3OKOA 4JFHD 4BH7A 3BKYH 2NX5A 1F2XK 5C0EB 3HE7D 1I9JH 1QVOB 3MBEA 3GFUA 2DM7A 2HFGH 1IAIH 3MRJA 3ZYJA 3TZVC 2Z93A 4TVPH 1HCVA 5F1NB 3QDGB 1KIRA 1NSNL 3VFNB 1F8TH 2FATL 4Y4KC 2DI8A 3MRBB 4R0LB 1IFHH 3IT8D 1FE8H 3CLEL 4YC2C 1FFPB 5E70A 3RGVB 3RVVD 2W59A 4OF6A 3MV9D 5DO2C 5FB8A 4LGPB 2MHAB 1NQBA 1JMXA 2G75A 1IC1A 2DQFB 4QXTB 4JPKL 2CR3A 1RZ8A 2XY1A 4HKJB 1FBIH 1S9YB 2AQ1A 1VESA 4OIIH 2P1YA 4WV1A 3VXOA 1FJ1B 4U0RB 4RGNC 1F6LL 1G6VK 2BVEA 4RAVA 5IOPA 3O4OB 1RJYA 2XZZA 3V6OC 3L3GA 4CMHB 4JKPL 4NSKB 4LDEB 1EBAA 5FECB 3G04A 3MFGB 3WD5H 2X40A 5EU5B 2XA8L 3T0DA 4HFUH 2I07B 3EYUL 3TA3D 4HUVB 1CT8A 3WSQH 5L6YL 5C9JA 2AVGA 5I8CA 1H3PH 3JV6B 5IW6B 4NRXA 3EKCA 1FFOA 5E2TL 3GBML 3HNTL 1E6OL 3LKNA 4Z7UA 2CKBL 3EO1A 1YEFL 3PNWB 3UTZA 2J7LA 2FWOB 4G8GD 2YWYA 1T0NB 5FYJH 1MFAH 3GIZL 1UJTA 8FABB 3QI9D 4HUWB 4M9PA 4OZHB 3BWUC 5AD0B 4Q9QH 1IKNC 1VA9A 3UTSA 4JFDA 3BJ91 5KTEH 1CG9B 5I1LB 4HZLA 1ED3B 1WTLA 2J8UB 4U33A 3O3UN 2QTEA 4QF1A 4WFFE 1I8MB 3SDDB 3T4AB 1NFDA 4JRWA 3MV7A 2YXMA 1OGAE 1XIWB 2DLFL 4WGVB 1PFCA 5DRZB 5TFSL 1YPZE 2EYRA 1FO0A 5SWZE 1TJHL 4OF3A 5TPWH 4APQB 5DQDL 4I1NB 1MNUH 2X89A 1AXSA 1XGYH 1EEZB 4P59L 1U6AL 1JRHH 3KPSA 2VE6B 5FUZL 5FYKU 4CN6A 1ZANH 4NO3B 3C60A 4W6WB 4KMLB 4OUUB 1U8KB 1IL1B 1ULVA 1S5HB 3ZKXB 3NACH 4FFWD 2VLKE 5GRXG 4JAMA 3L3OB 5BRZD 1MRCH 1UXSB 4HKXA 3TC9A 2E8YA 3O4LD 5IEHA 3U30C 4XP1H 5HGBB 2NY6D 1X7QB 1QSFB 4J8RB 1YNTB 5F96L 4WFED 1U8LB 3VXRD 2DKUA 4NDMA 4O58H 4OGXH 3GMMA 1JE6A 2ICES 2OZ4A 2Y9RT 1T20A 2IFFH 3S5LG 5C0BA 5M7QA 1BGXL 5J11B 4PPTA 2VDLH 3NFNA 1DQDL 1MH5A 1N2RA 4ZXBB 1JBJA 5C08D 1KLUB 1N26A 1ACZA 3D18A 4FQLH 5EUOE 4DKDC 3VFSA 3RA7H 3EOAB 3O3EB 1ZHKA 3N9GH 5EBLB 1CGSH 5D2LF 5D1QC 2D0HA 5LVEA 4XPGH 2JK5A 2FECI 3SPVA 1S9WA 4PGEA 4XRCB 4U1GB 1FVDA 4JRXD 1RZFL 4OBSA 4KZDH 1A7QH 3RWFA 3EJYC 4LKXA 3QNYB 4GMSH 3DYMA 3ZHLA 3CPLA 4C56B 2O93L 2FGWH 4JDZB 5DVKA 4LKCB 2PYEE 3VA6A 3TNNA 5I71C 5EIIB 2ZOLB 3C6LB 3P0GB 1FG2A 4YFLI 1KPRB 4LF3A 1EAPA 3KNBA 3LAFA 5BZWB 4OF5A 4A6YL 1FDLH 1I3UA 1MI5B 3RWJA 1JWSB 3ARFB 4NQCD 1DR9A 2QLVB 3WIHA 4WO4D 4N9GA 4OT1L 3G5XB 2Y7QA 3B5GA 1KLGA 3HC0A 3BHBB 3OAZH 3ZZ1A 2OXGA 3QRGH 2DBJA 1NDMB 5CEYA 4D94A 3PGFH 1VADA 4NYLA 2LABA 4PJGB 4RMSA 3CU7A 1KPUB 1QFOA 1G7MB 2W9LA 4K23H 1II4E 1DBJL 3PHSA 3QPQC 4YDLC 4P2RB 4BA8A 5D1ZD 1U3HB 2C26A 4ZTPL 1S8DB 1W72L 2IALB 1YN6B 4WW2F 5CP7B 5JPMB 3IJYA 5LJYH 4UIMA 3PUCA 4ZFGL 4JFED 4N90D 2GTWA 1UCBL 5EZIH 1CFSA 5KJRH 3BYTA 3LKOA 5HGDA 2A2QT 2JJWA 3PE9A 2UUDH 1LK2B 4R4ND 4M5ZL 3KYMB 4PTUA 1FO0L 4O2FA 4WDIB 5DK2B 2R39A 1WGOA 2Q1EA 5FV2A 4KROB 4FXGA 3O3AB 3QHTC 2HVJA 1F4WH 4WEBH 4XX1E 5EOQH 3SE3C 3PWVA 5T3ZL 3UO1L 5MP6H 3QIBC 3WS6C 3BEVA 5I8EA 3TN0A 3BP5A 3QQ3A 1OF2A 1SYSA 4ZFOA 2GCYB 5C2UB 2DQEL 4QXGH 1OSZB 3RTQD 2HFEA 4K7PL 5LCVH 1NGQL 3PDGA 1OPGL 2XG5A 5D93B 2WINA 3FB8A 4AL8H 3RWIB 3HI6L 4S10A 3RKDD 3WFZA 1JGVH 5I1KL 2FYYA 4CKVX 2GUOB 4GQ9L 4YX2L 1H0DB 3L5WA 4MNHB 1EZVX 1R5WB 3GMNA 2HMIC 2WBKA 4HGWB 3BE1H 5DUPL 3GSVA 2ED7A 3CUPA 4X7SH 1V7NH 4G6AD 4WEMB 4OCSH 4JGMA 3WNKA 2R9HC 2VXUL 4ZUVA 1OGAA 1ZHNA 3KPNA 2CUIA 1KT2A 1YPZA 1WICA 3X3GL 3TO2A 2QQNL 2X70B 3Q5TA 1Z5LA 5SWZA 1CFVL 4JM2A 3VRJB 2P43B 4I3SH 2VQ1B 4GAJL 4UT6L 1HQ4A 2IANE 3VFWB 4KQ3H 5IMKA 5HYFA 2MQ0A 4HUMB 1INQA 1SQ2N 5DI8B 1BVKA 5ISZB 1Z2KA 2EXWD 3HZMA 3LVEA 3ARED 5L8KB 2B2XL 2VLKA 4EDXB 4P23B 1P69B 5TDOA 3L3IB 1B4RA 3HZKA 3HNSH 1U58B 5E4EC 4MAYC 3OZ9L 4L9LA 4DVBA 1FVCA 3D39B 4AIZA 3AU1A 2R2EB 3B9KA 1A0QL 1PYWA 2I9TA 4UQ2B 4BK5A 4MVBD 3QUXB 3G6AA 4PV9B 3VE0B 2JCCE 3WIHL 1B3JA 4HIEB 3U0TA 3PL6A 3WDHA 5HPMB 3VXMD 5JNYB 3SQOH 1I3RA 3S4SG 4GRWB 5A3IC 3VWJC 1C08A 4I77H 4NGHL 3TWCH 2WWMD 2DYPB 4JO1L 5BV7L 2AK4D 1TMCB 4F9LA 1ZLVH 4MA1C 3OKYA 1T21A 2AEQL 1AQKH 2APWA 3DX6A 1LVEA 4YDJB 2CXGA 2E8ZA 4F3FA 3QDGE 3VDBA 3WXWH 1VFBB 3QHZH 5J1SC 4Y88A 2PYEA 4C4KT 1RFDL 5KN5B 1MJ8L 3GIVA 4UBDC 2WBJA 1TJGH 1CGXA 1R3KA 1MCFA 5ADPH 4C55A 5AYQA 5L9DL 3MUY1 1GPOL 2EZ0C 3KLAB 2VH5H 2AQ3A 2IAMA 2J6EA 1FNAA 2VSCA 2OR8A 4L4TB 2XZQL 2W0KA 4XB8A 5HHOB 3K2UH 1CF8H 2OBGA 2BFVH 3TVMA 5HYJD 5EOCL 1KIPB 4RISH 4Y1AD 1XF5B 5GGUB 4YBLB 4LAQH 3S37H 4E41E 3QAZB 4X7DC 2X4OA 2V7NB 4OTXL 5CEZH 4ZFOL 2P5EE 5GRVL 4J6RH 3PGCA 5T3XH 2IF7A 1IGJA 4PP2B 4U1MA 3TT3L 2I60H 1INDL 2WQ8A 1EPFA 3N1FC 4IS6A 1MAJA 4ZYKB 4MA8L 2GFBA 3FT2A 3CZJA 4FOMA 3NPSB 5H2BA 2XRAH 3TJEL 5T1DH 4Y2DB 1SJVA 1UZ8A 2R1YA 2UZXB 2D3VA 3KXFD 1CD0A 5ITBL 4NKIL 4C83B 3U0PA 2GQHA 4I0PA 2I5YH 5DZOA 2H32H 1T1YA 4JG1H 2XOTA 1HE7A 4RNRA 1M05A 3OHXB 4NZUL 1CFTB 2ENSA 5ICYA 2ADIB 1WBYA 2GJ6D 1OB1A 4XC3H 2WW8A 1K4DA 4GW4B 2OP4H 3U36B 4MJID 3BO8A 2EIDA 2X4QB 4FFVC 2XXMB 5C0RL 1GGBH 3NCFB 3SDCA 1AD9B 4MYWB 5CZXD 1O0VA 4PRBB 1HIML 5GIRA 2NYYC 4OZHE 4LBEB 3O6LH 1E27A 5C8JB 5E8NA 4TTDD 4OZ4A 4YUEH 1AJ7L 2PCPA 2V2TA 2FZ3B 5J3HC 3QNZA 4HXAH 5BQ7B 3IJHB 1FNGA 4WCYH 1IGIH 3G6DH 1EHLH 1U8NB 5IWLC 3FO9A 3SJVD 1J18A 3CMOL 2P44B 5EA0L 5DD1H 3OX8B 5BZDA 1JPSH 1KB5B 1WAAF 4UTBL 4FQCH 4ZFFA 1RMFH 1ZMYA 5TF1L 2V5TA 2VR9A 4BELD 3U1SL 4EJ1C 3HLAA 5DURD 4PJ9D 2CSPA 4QY8B 1U9KA 3OMZA 4LCCB 2OMNA 4N8CH 5F9WB 3QCVL 4X9IA 3UPAA 3PWUB 3LN9A 3BVNA 5C0ND 4D8PB 3WHE0 2XWTB 2IANA 3PWNA 2DQCH 2XNAA 3DMMA 4JFYB 1KJVB 4KK5C 4OIAA 4EVNA 2BOCA 4KAQL 5JOFB 3EUUA 3CCHB 4KJQD 4M3JA 1X9QA 1X6LA 4LNRA 5DK0B 1Z0NA 4P2YA 5I18H 5TQ2L 4BSWB 1P2CA 4Y4HC 2X4TB 1TIUA 3K0WA 5INDA 1P7HL 4KZEL 1TNMA 5MERB 1OWRM 2Z9TA 1FL3A 1GL4B 4TN9A 12E8H 3VD7A 3HAEB 3GHBL 1JPTL 4X4YA 3VFUA 2VB5A 1F6AB 2Y06H 2AJXL 3MA9H 4NNPL 4BUGA 1EJOL 2K3TA 4DKAA 2QADD 2FSEA 1MY5A 2ADFL 5JOPD 3V4PL 2JCCA 1QHPA 4IRJA 5JORB 4JDTL 1RI8A 3NIDE 4CDGC 1M1SA 1K6QL 2G5RA 2P4AB 5ALCH 5IR1A 4FS0A 1MLCB 3O8XD 1KOAA 2ICEA 1CE1L 4HAGA 4JQXC 4OGYH 5F9OL 3DBXA 4WHYH 1L0XA 1XF1A 1FV1A 3S7GA 3HG1D 2R8SL 3GI9H 5JIIA 2FL5B 5KVDL 3P11H 1UWGH 1QVOA 1HHJA 3BXNA 2JF1A 1OSPL 3MRKA 1CR9H 3D69A 4OCXH 5F1NA 1S9XA 3KWWB 3QDGA 1A7PL 5ECJE 3VFNA 1MI5E 1JVKA 1WT5C 2B5IC 3JV5A 5E4IA 5J13C 1TLKA 5DGQA 5I16A 2VDPL 4MJ5B 2EDWA 3O0RH 4IRZL 1FFPA 4B50A 1A6TA 3MR9B 1JF6A 1LP9F 2DQTH 1D5IL 4Q6IC 1IM9A 4IMKA 4GKSA 2XQBL 5ENWB 4PJGE 3LEXA 1JV5B 4Z7WF 4Z7QF 4GKOA 3LCYA 4QXTA 3HPJB 4HS3B 4HKJA 3W5MA 5I2IA 4P2RE 2JB6A 3NZHH 3Q6GL 1AIFB 4LSVL 3VMPA 1MRDL 4XNXL 4N5ED 4U6HA 2P5EA 1BWMA 3MA7A 1K3IA 1NBQA 3CFKB 2AABH 5C7XH 4JZOB 3RZCB 4NSKA 4FN0A 4PRPE 2AS5M 5FECA 4NOBA 5FHBL 1PDKA 5EU5A 1AE6L 1NL0H 4CL7A 1MELA 3MUZ1 4MNQB 3KR3L 4HUVA 1NGXA 4EQ3A 3CDCA 5TE4L 4I8DA 4P2QB 2DDQH 4KU1A 4DAGL 5CBAB 4Y8AA 4KUCD 1KG0B 1KN2H 4A2LA 1EGJL 1JYWA 2X1WL 4GKNA 4JFOB 3B2UD 5TE6H 2FWOA 4I13B 4KC3B 3MCKA 2E7CA 8FABA 2LQRA 1RJZA 4OZHA 4FXKB 35C8L 2IMMA 5FIEA 4UTAH 4YHYB 4X98B 4OUOA 1BOGA 2BNQB 3I85A 1CG9A 4G7VL 5I1LA 3O11B 1G7HB 3GSWA 1S9VA 5F44A 5DLML 1NEZA 4RQQA 5GISH 2A6JA 1KJ2A 5ACLA 1MHEB 4QWWC 3ALWA 3P30L 1I8MA 5TDPB 3FQNB 3T4AA 2L4OA 2NY2B 3DTXB 2PW2A 4YDKH 3ZO0A 1JRHI 1QG3A 2BSRB 1ZVYA 4APQA 1IGMH 2R23B 3B2VL 4RFOH 4TRPL 3VD5A 1D9KB 2AI0H 1JZ7A 3GHEH 5IG7B 1GSMA 1J7VR 1NMCC 5CS7A 4NO3A 1KGCE 4RMUA 4LVHC 4OUUA 1U8KA 4U1KA 3NCYP 1JYXA 1S5HA 1T66C 3STZA 3FMGL 2XQYK 2YOCA 3QUZB 3BKJL 1UXSA 3L9RB 2VZTA 5M94B 1A6UH 2QQLH 2MKWA 2QSTA 4EN3A 1FLRL 3DWTA 1JZ5A 3IXAA 1MIML 3WFEL 1JGEB 3BKCL 5C09B 4WW1A 2RBLA 3HE7C 3TJHD 1M6OB 1X5GA 5GJTH 3AUVA 3D39E 5D7JD 4J8RA 4JO3H 3MLSH 5JW4M 1YNTA 5GRZA 1RURL 3QA3B 3L3JB 4LQFH 4PJHB 1U8LA 1NANH 4XBEH 4WHYG 2VLJB 3GBNL 1HQRA 1MEXH 1OD9A 4GMTL 2DI9A 3EFFB 3RJDA 1DUZA 4XP6H 2E7LC 4BQBA 1WZKA 2Q8BH 3RRQA 1EK3A 3E6HB 3PV6B 3DI3B 1J5OL 1SJXA 3OJMB 4U3HA 5E9DD 3RVVC 3T2NL 43CAB 2NY7L 3RY6A 4U1SB 1YQVL 3QWRA 1VSCA 5FDWB 5C86A 5GRJL 2XN9D 4R26H 1B4JL 1ZWIB 2HJKA 4OIBA 3BIKB 4YXHH 4O2CB 3BZDA 5LXGH 4WHCA 4YFEA 1MCOL 5SWQB 3LEYH 5FGBA 1KJ3L 4UZGA 4M62L 5F88A 2BOBA 5FCUH 1N0XH 2NTSP 3TNMB 4LKCA 4PGZA 3C6LA 1G0XA 4N9OB 3OF6A 4FQ2H 1DQML 2PTTA 3MLUL 1SY6A 5EFIB 3CK0H 1KCSH 2WK2A 2CLRA 5CP3H 1MI5A 1T2XA 3ARFA 2NQCA 3TA3C 2E5EA 2NTFA 4PJIF 1OAXH 5D6DC 2Z31A 2G9HB 4Z95L 5HHOE 4O2EA 1CLZH 4XWOD 4U6YA 2P7TB 4S2SB 4PJAF 5DJ0B 3ARGD 4PJGA 5EWIL 1KCUL 3BDYL 3TZVB 1KLFA 1RZIB 5FDYA 1MFEH 5C07E 4BKLB 4Y4KB 5IROA 2VKWA 4MXWL 4P2RA 3QI9C 4RCAA 1U3HA 3TH2T 4AT6B 4MDIB 1QFUL 4YC2B 5JPMA 4AJ0A 1XH3B 3TPKA 3NIGE 5GS2H 1KBGL 1NCCH 3VD3A 4GRLD 1HOCB 4F58L 1A14L 1YEHL 5CSBA 5BVJB 2RJMA 3EDDA 4P4KD 4PRPA 5ETUB 3L5JA 4P5TB 4PG9A 3EFDH 4Y0GA 3RWHA 3VFPB 5I6XC 4MX7B 2Q3ZA 5B38G 3ARXA 3ZDXF 3VMNA 4JQIL 3EGSB 4JB9L 2Y72A 4F8TA 3FOLB 1H3TA 3D9AH 4WDIA 2PYFB 4QOKB 2WWKT 1CDUA 1ETZB 5TH2A 4V2BA 1JZ4A 1JFQH 1QRNB 2OI9C 5HPOA 4Q6YA 4WHTA 3S5LB 5C0AB 3MNWB 4LSTH 3O3AA 3ARQA 2MNUA 3C09C 4GW1B 4ZG1A 4X6CB 4NQVB 2F8XC 3FQTB 4HUNB 1C5DB 3OBAA 1OP5H 5E2UH 4H0HB 4GBXB 3FFDA 5HY9B 1I1AB 4OCWH 1OSZA 4PTTA 4FFWC 3IGAB 1KTLA 3MLXH 1F4YL 2BHUA 1GHFL 3GSXB 2F58L 5E6IA 2D7PA 1DQLH 3AC0A 5K9OA 1H0DA 2K7QA 2NY6C 2EDEA 5HHQB 1RHHB 3QXWA 2ENYA 4HGWA 1MFBH 3FZUD 1PG7W 3NFPA 4LSUL 5F7NC 2VC2H 3S36L 1RZKL 2CDGA 1JYNA 2VABA 3OB8A 4XC1L 5EOTB 2HN7B 2X70A 3QFDA 4WI8A 4Y4FC 3O2WH 5C2BL 4P3CH 4XNYH 5JHDD 1W8NA 4NQSB 3VFWA 5DRWA 3QUMH 1FGNH 5DYOB 4EI5D 1I9RH 2EDTA 1A7RL 2R29H 3FT4A 5J1AB 2AJZB 3L5XH 5EU3A 5DI8A 5ISZA 3ZL4L 1KJMB 4I3RH 4NPYA 4HXBH 4J3TA 4RAUA 1BX2A 3HZYB 4NO0A 1H3VA 3D25B 3LOWA 4P23A 3HCVB 3OR6B 4RDQG 4K3HA 1P7QD 1UQSB 5JW4R 1U58A 3IDMB 4NZTH 5IVOA 4N5UA 3ROOA 1HSBB 1T7YA 4M7LL 3D85B 3D39A 3FT3B 3VFGH 1RK0A 1G9EA 2OSLB 1J8KA 4AY0A 5ILTL 3ALXA 5ID1B 4TUOB 3BFOA 3SKMA 3SGDH 4ETQB 2IBGA 2LU3A 4PV9A 3VE0A 1U93B 1C16A 4XCNA 4K07A 5L0QB 2O5YL 2L0DA 3TT1L 5HPMA 1NLDL 5FK9B 1KC5H 1PKQB 5J12C 5JXAH 3JZ7A 5C0CB 3OG4B 1FYTB 1P9MC 3P4NA 4PJBF 3HTLX 4Z0BH 4EEEA 2DYPA 3W2DL 3MXVH 1D5ZB 4NQEB 5HHVH 1YMHB 4PJ8D 5D1ZC 4P9HL 1CTNA 4GAYB 5CJXA 4OM1H 4YDJA 1GOGA 4NRZB 4LLMB 3ULUH 4HX1B 2QQQA 3M1BB 4HPOL 5HGAB 1CBVH 2DQUH 4JJ5B 5C0DB 1YUHA 4YQXH 4P3DB 4P9MH 3OKNB 1NCAH 4LARH 5LAXB 5D1QB 4Y2OA 4E9LA 1VKXA 4PJFE 4R4NC 2PR4H 4XWGH 4MSWA 1ACYL 5JDSA 3KLAA 4PS4L 2Q7YB 1LO5A 1UWXH 5BJTA 1FNHA 5IW1A 1ADQL 5HHOA 2DBLH 2XWJB 2B1HH 2RR3A 5IB2B 1XF5A 4F15C 3OXRB 5GGUA 2N1KA 4ZNCD 4Q74A 2V7NA 2NY0D 3GKWH 4WUKH 5C07A 4I5BB 1PVHA 1WF5A 3LIZH 1AGCB 3QQ4B 4PREB 4PP2A 3DXAE 3RTQC 1UZ6E 1F3RB 2MCG1 4XMLL 3LPFA 4IIQC 4Z7NE 1IEBB 3NZ8B 5DJXA 3RKDC 5D1XD 1A6PA 2FJGB 5D7IE 5H35B 4P46C 3EO0B 5LGHL 4Y2DA 4MNQE 3LZFH 4B7IA 3ZE1E 2NW2B 2NY4C 4C83A 1I4FB 3C9NB 4W4OA 1TZGL 2HRPH 1YQ2A 4XT1C 5L2KB 4G7YH 1B0GB 3U4BH 4G6AC 4GSDH 3GSOB 5E8PB 1CFTA 4QRPB 1AXTL 4RMWA 2ADIA 4UNTA 3MLWH 5DD5L 1RZGB 3U36A 5FUOH 3VMOA 3THML 2P8PA 4MS8D 2Q8AH 4AEIH 3MLVH 4TUKL 4ERSL 3ULVF 5DR5H 3TYGH 3F7RA 3NFSL 2EXWC 3S4SB 4X99A 2OJZH 4PRHB 1UGNA 1NPUA 3ZDZE 2FZ3A 2AV1B 3AREC 2W07A 4XCFL 2A9NL 3D3VB 2J5LB 5CINL 4ZO8A 2NMSA 2QEJA 2HAZA 1KNOA 5CJOL 5GGQH 4CU8A 1U8NA 4AM0B 2XKSA 1J88A 3WJJC 3MJ9H 5FEBA 3NTCL 5BMFH 3S35L 5CEXB 1HHIB 4GXUM 2G60H 5ELIA 1J8HB 3LV3A 3RGVD 4XPFL 5D71H 4PR5B 4NWUH 4QHNB 1CXLA 3NA4A 4OV5A 4N1CA 4MVBC 4X6BA 2VO5A 3PWUA 4YGVB 2AKRB 4I18A 1JYVA 3AY4C 4D8PA 1RV6X 4PGJA 4JFYA 1KJVA 2EIBA 3IETB 2IGFH 3NABL 5JOFA 5A1AA 5I76B 4POZD 3GK8L 3CXDL 2Q76A 1A7OH 3INUL 3MUHL 4XZUA 5DDHA 2WWMC 5C09E 1E4WL 4BSWA 2X4TA 3QEGH 3DVGA 1A3RH 3GSQB 5CGTA 1AI1L 1HYRC 4U2YA 4W6XB 1IQWH 3HAEA 1PSKH 3SDAD 1AD0A 1F6AA 5FKAA 1UWEH 1T7VA 3BPCA 3T08A 4KTDL 4WUUE 3ARPA 5TQ0H 3P0YH 3LQAL 3ZDYE 5EO0A 2EIZB 3W82A 5JORA 2HVKB 2IH1A 1IMHC 1S3KL 4MAYB 2JELL 4JZJC 3FB6A 3CLFL 1MWAH 3FOMB 3BRGC 2BP3A 3VCLB 2R69H 5EO1A 1BD2E 3SDDD 4MNGE 4JFQB 2R1WB 1QFWH 3P77B 2ZUWA 4UQ3A 3NH7H 3F5WB 2DQIL 2IPTH 1XIWD 1ZT4B 2QKIB 4PGCA 5J6HB 4M00A 5E8DL 2HRLA 2BJMH 2R0KL 3KWWA 4LK4A 4HUKB 2OTWB 4XGZB 2DQJL 1ZSDB 2BRQA 3VFRB 3VWJB 4L3EB 1KEMH 1CLOH 3BX7C 3TIDB 5IFHL 1P6FA 3L3DB 1QACA 4PJFA 2Y5TB 4ODBD 1Z9MA 4JHAL 5C92A 2FO1A 4MA1B 1N5AA 5ENWA 5JIPA 5TGBB 5FYLD 3HFML 3UDWC 4JR9H 4F57L 3IDIB 2FECL 3HPJA 4CJ0A 4BFBD 1V3MA 4ODTL 4U7SA 4JN1H 5CZXC 3C2AL 1R3IH 1UCTA 3E1F1 5DC0A 5GRYA 2EICA 2FBJL 3OGOE 3OAUH 1U8OB 1QSFD 4TTDC 3FFCD 5ESVB 3A67H 3CFKA 3V0AC 4JZOA 1ROWA 3ET9F 3DXAA 4JO2L 2ZJSH 3S9DB 1T5XA 1Z6JT 4HDIB 1UVQA 3MLYH 3QXUA 1RUAH 2C7UB 2HKHL 5D7IA 3VRLE 3VXSD 1DE4A 2FBOJ 2HWZL 2O5XL 4RMQA 4MNQA 5HHMB 2CLVB 2KDGA 4RGNE 5E1AA 1KB5L 4ZXBD 4HS6B 1QRNE 5D2NB 5IQ9B 1FH5L 2F5BH 1TFHA 1JF5A 3JTSB 4PJ9C 3V6OE 3AXLA 1MPAH 5GS0H 4FP8L 2QSCL 3K1DA 5CMAB 2ITCA 3D5OF 4LVNC 3QB7C 5AUMB 3ZTNL 4CUCA 1NFDF 2J4WH 4LVEA 5C0NC 1NGPL 4HV8B 4OQTH 4FFYL 3UJJL 3E2HB 1OOAA 2W9EH 3MRQB 5E1HB 5EBMB 1LO3L 4JVUA 4FXKA 4L4VB 4C56D 4H0GA 4XVJH 3W0WB 4K94L 4KJQC 1G7HA 3P4OB 1CK0L 1XGUA 3BUYB 2FX8H 3TBSB 1AGBB 1OAZL 4FQQB 3Q5OA 5TDPA 1MCRA 2APTA 5EU6D 1I1CA 1VEOA 4U6TA 3QFJB 5DUMH 1XFPA 1I8LA 3WLBB 1PG7L 3G9VA 4ELME 1YECL 4EIGB 1C8PA 5INCA 4LSQH 3TYFA 2BSRA 3H0TB 5DHVH 3ZKMD 1U8HB 1LWRA 2R23A 1BM3L 4WU5A 5JUEH 2YWZA 5J6GB 1E4XH 5IUSA 1F02I 5GS0C 5EZLA 2XT1B 4XNMB 3RDTB 5IG7A 3B43A 2AXFB 5LBSL 3TV3L 3P0VH 1UH3A 3KLSA 3BMWA 3HPLA 5D72L 5F7EH 3V4UH 3PWPB 3OJVC 1QLRB 3VXNB 1A6VH 1WBXB 1WVZA 2Z0BA 4JLRA 1ZTXL 2D7NA 1J1PL 3VFVB 4J4PD 3O8XC 2H32B 5A16A 3LRSA 3O2DH 3ZKND 5DVNA 1HHHB 4G5ZL 5C71A 1JGEA 1NANI 4M8VA 5F97E 5C09A 1JN6B 4NN5C 5F7UA 3HMWL 1W0WB 3CFJB 3LPGA 2Y23A 3DVIA 2DM2A 3QA3A 3L3JA 1YJDC 2X7LA 1MVFA 4KROD 2VLJA 3UTPD 1YY9D 5F1SA 1DN2A 1L6ZA 3EFFA 1FRGH 2QR0B 4WW2C 4Z9KB 1ZA6A 3OKKB 4WEUD 4X80L 2CDFA 3PV6A 4Y4HB 3QSKB 4S1QH 4DTGH 4QNPE 5KSBB 1J0IA 3V8OA 5FDWA 1OT1A 5IHZA 1OTUD 2F5AL 4PYGA 1P4IH 3MACH 2YD2A 1KTDB 2Q6WB 1ZWIA 4HPYH 2JB5H 2QHRL 3G6JF 3BIKA 2C1PB 1FAIH 4O2CA 5IEKB 3V95A 4RGOL 5SWQA 2VR5A 1EFXD 1YZZA 4HWBH 3GM8A 1T80A 3TNMA 1DL7L 3ARDB 3MBXL 1BD2A 4LMQE 4MNGA 3A0OA 3REVB 2NPLX 4JFFB 2SEBA 3F7QA 4CADB 4GOSA 5F93C 1DQJA 3BJLA 3CMGA 5DJDB 4KPHL 5GGSB 3QXAB 4GKZB 3TPUB 3TM6A 4LRIC 4ONGH 1PEZA 1R3LB 4R3SB 5ISZD 4ZMAT 5FO7B 4ZUTB 5C9KA 3EOTL 1M7DB 2JIXB 4KHXH 4S2SA 3MV11 2ZKHL 4HIJB 5I8OL 2CUHA 2UUDK 3TZVA 1UB6A 1RZIA 2CD0A 3C8KB 4HBCL 4Y4KA 2B5IB 5I19L 5J13B 2V6HA 5F9JB 4AT6A 4U1NB 3DECA 4KTEH 1QBAA 4PFEA 1HNGA 1XH3A 4KKCD 1UB5B 5B4MC 2B1AL 5DA0B 5HDQH 1HOCA 3M8OH 5F6IC 1MCBA 2CJUH 3N1GC 4BZYA 4P5MB 2YD3A 4ODSH 4Z18A 5E24E 5L2KE 1K8DA 3QUXD 3GNML 4MX7A 5JXED 4M5YH 3X13A 1P6AB 4HK0A 4QRPE 3CX5K 5DQ9A 2Q7NA 2GSGB 1ETZA 1QRNA 5J06A 1IE5A 3S5LA 5C0AA 3MNWA 1R24A 4N0FA 4H1LG 1BEYH 3D0VA 4R4FH 1IEHA 3R06A 3V6OA 4GW1A 4NQXB 4HAFA 4NC2B 5ITFB 4LIQE 3E0GA 3O45B 4M7JH 2YA1A 4OLZH 4PRHE 4C57C 4HWUA 3QR2A 5BV7C 1C7SA 3DUSB 3NAAL 5DJ2A 1A02N 5HY9A 3OKMA 5DHXB 2VXTL 3D3VE 1QTYT 1YPZF 3GGWB 4P2OA 3EYSH 4JM2F 1AGEA 1YEKH 3SKJH 4NZDA 1EIBA 2DB8A 2Y36H 3TJHC 3FB7B 5HHQA 1RHHA 3FB5A 5D7JC 5E6YA 5EZOL 4WWKA 1QSEE 1QYGL 1VHPA 3RWDA 3BWAB 2YPLB 3IF1A 4NOFA 1GJIA 2OCFD 5AAWA 4BZ2H 2HN7A 1Q0YL 4L4TD 1YDPA 1VB9A 4XXCA 3R0MA 5CILH 3HUJF 1CD9B 3CZFA 3G08B 5L7XL 1OAYL 1P84J 2VAAA 2AJYL 5DYOA 5I17B 1PEWA 1RULL 1ZXQA 3O2VL 4FQJH 4IMLA 1ZLSL 3RL2B 3V7AE 3O6KL 1OD7A 4YHNB 4AK1A 4HH9B 4GAFB 4XCCH 5KVGH 3CX2A 3JWOL 4LOUD 4JY6B 3UZEA 2GAZA 2KKQA 3OR7A 2BK8A 1YEEH 3OPZL 4EI6B 3HZYA 5HYSA 2J3SA 4MDJA 4GG6B 4V1DB 4UNVA 4H26B 4QRRD 3JTTB 3FAWA 4U31A 4Y2DD 3ISWA 3TBVA 3QZWG 2BVPB 5J8OA 1HSBA 4LPXA 4F7PA 1J10A 3S36X 3D85A 5EUOF 3SGDI 3KPRE 4W6YB 1T5WA 3MUJA 2CDEB 3VFTA 3BQUB 1G1YA 2W38A 3KG5A 4PLNC 3V8CA 1RUMH 3GRWH 4TUOA 4NHUA 4ETQA 5B38B 3X11A 1V7ML 1VFOA 1UEYA 1Y6NR 2IPUK 1UM6H 1OTTD 2HT2D 1MOEA 3LB6D 2JE8A 1YEGH 3HE7B 5HTSA 4XWOC 4JG0H 4IJ3B 3ARGC 3FO2B 5FFLA 1H5BC 4UT7H 1D5ZA 4NQEA 4CVXA 5EIVA 2VMFA 4GAYA 3KAAA 1MFDL 3NIFE 4XXDB 5TF0A 4LLMA 3M1BA 4GG8B 5D5MF 5HGAA 4YPGB 4GRLC 1QNZL 4JJ5A 4NT6B 5C0DA 4HQQH 2DICA 2D7QA 3L5IA 2E7HA 5I0DA 4P4KC 5I1HL 3P4MB 4MQSB 5JZ7D 3OKNA 2LE9A 5D1QA 1FNEA 1MCIA 3MLZH 3D2UB 5IMLA 1JHTB 2X9XA 5DD6A 4LFHD 4K3EH 2Q7YA 2P46B 5C0GA 4OFYA 4MA3B 2XWJA 1J05B 4X6DE 4PJEB 1LE9B 5B21A 3OXRA 1U8MB 3EW3B 4LSRH 5HVWA 3M45A 1HILA 4YE4H 1QO3A 5HBBA 5DRXB 5E7FA 3NMEA 1IFHL 1XGQB 4I5BA 3CFIC 5FYKE 5BS0E 5DZNA 2EE9A 3UJTH 3WUZA 4L5FL 4XAWH 5CJQL 4X0KA 4ELKB 2GI7A 3EO0A 5FXCH 2NW2A 3Q6FB 1I4FA 2F54B 4MQXD 5CZVH 5L2KA 2ZCHH 1FBIL 4OIIL 2I27N 4LP5A 2A77H 3I9GH 2NY5C 3QI9B 4QRPA 3HNVH 1NC4D 4QRSB 2EH8H 2CMRH 1QD0A 3VGEA 2C1OB 3EYOB 3GMLB 4WI5A 3WE6B 1GRWA 3RU8H 4EI5C 3CD4A 3WD5L 4RFEA 4I0KA 4R7NB 4L4VE 4YZFE 4HFUL 4KHTH 2BVQB 2MQ3A 4FTVB 4JKMA 2GITA 4XMPL 4PRHA 3W0WE 5F1KC 5L88H 1DQQB 2EDDA 4LLQB 2QV2A 4MZ2A 2AV1A 4DGVH 1H3PL 1RJLB 1CDJA 3D3VA 3EYVA 5JDJA 2VL5B 5KSAA 2W0PA 1TZIB 1YY8A 3BKMH 4AEHH 4NM8H 2VLME 4RWYH 5GRWA 5J0BA 3QFJE 4U1LB 2BSSB 2YA0A 3C09B 3DYPA 4AM0A 3SE3A 3OKDB 4YEEA 1AO7D 3QIBA 3WS6A 1EHAA 4CVZB 4BFGA 2AXGB 1QSEA 4PR5A 2NY1B 3UXFA 1T83A 4XVSH 3T0BA 5B8CC 4QHUB 1GH7A 3D0LB 5KTEL 1ND0B 2ID5A 3WJLC 1MCEA 2OR7A 3C5SB 3PWPE 2BZDA 5GXBB 2PNDA 4LHJB 1HHGB 2NY6B 4X7FC 3PQYE 4QRUB 3IETA 4F7MA 1NGYB 1W0YT 4WHDA 4UAOC 1FFNA 3RPIA 3RZCD 1I7TB 3ROLA 3MLTB 1IEAB 5TPWL 1A4KB 1CLYL 2ADJA 1BQHG 1MNUL 4Y4FB 2FIKA 2JCCF 5MEPB 1TITA 1DZBA 3S35X 1XGYL 1L7TH 2ZUXA 4P2QD 2DS4A 3MZTA 2V9QA 3AB0C 4LLWB 1ZANL 3KPRA 3SDXB 2LFGA 4NC1E 4XVUD 2B20A 5E99H 2IMNA 5F3HA 2PXYD 2VDQH 1FVEB 2YMXH 3MROB 2ZUQB 4GFTB 3SGJA 4JRXB 3BP6B 2WIIB 4XP1L 4QHLB 5IESH 4HC1H 2VDNL 3B9VA 5DRNB 4EZMA 4Q9RL 4RA3A 5EDXA 1KXVC 1X5JA 2BNQD 3S88H 3SE9H 1XT5A 1QFWI 3CH8A 3FOMA 5D8JH 5L2JB 2YKLH 5E2JA 2WSKA 4O58L 2ZZUT 3F7PC 3C8DA 3VCLA 2P8LA 5HYEA 2BMKA 1FNSL 3BD4A 1G7LA 2P5WD 4JFQA 2R1WA 3HI1B 3IFOA 1I85C 1IGCH 2W60B 2QKIA 3QUMB 3OWEA 5GSVB 1HZHL 5D1XC 4FQLL 1IAOA 4DW2H 2OTWA 4XGZA 2EEDA 1ZSDA 3RA7L 3VFRA 1OM3H 3N9GL 4PUBH 1CGSL 1D9KD 5IB1B 3VWJA 4XPGL 4Y19B 3L3DA 1CTOA 3MRRB 1OAUL 3ULSB 4NKMB 3MOBH 2KH2B 1A7QL 2CRYA 2YPKA 4DK6A 4FXLA 5TGBA 4GMSL 5FUCC 2UWEE 3R4DA 2FGWL 3BISA 4FQXA 3QUZD 1NC2D 2YRZA 1FCCA 4QXUH 3VXQB 3HRZB 3R0NA 5KS9B 9CGTA 4WI2A 1U8OA 1JIBA 2X1XR 4LEOB 4CJ1A 2X4SB 2CRZA 3H8NA 5EPMA 4F7TA 1JZ3A 1MUJB 4Z5RB 4ZS6C 5BS0A 1BQSA 3Q1SH 4HDIA 4NHCH 4R0LC 1SM3L 1T1ZA 2C7UA 3PGFL 4IHOA 4ISVA 1A3LH 3T65B 3GMRB 4HS6A 5T33H 5IQ9A 5SX5K 3RGVC 3C8HA 1H3GA 1CIDA 3LSOA 1A5FH 5DA4A 1ZLUK 2OK0H 3WLWD 4PLOB 5CMAA 3HN3A 5CIPH 5FA4B 2V2XA 4TNVK 4MCZA 1QFWM 5KVFH 1D5MB 5HI5D 4P46B 2IBZY 3LS5L 5EZJA 4U0RC 5EZIL 4UOW0 3GMPB 5HI4D 4ZFZA 4ZO7A 5KJRL 2NY4B 5JPNB 4L4VA 4NO2A 3M07A 1XF4A 4OQ1A 3U48A 3W0WA 1ZVSA 2KBGA 3V6ZA 1YEJH 3P4OA 4M6OH 4HS8H 4FQQA 4ZPVB 4P57B 1WEJH 1FPTH 2DWEB 5EU4B 1L6XA 3QFJA 1A3QA 3WLBA 4DZ8B 4LDLB 4G9DB 43C9B 4Z8FL 1XR9A 2XPGB 3SDAC 4X4XB 4TPRH 2H9GA 1MCWW 2W92A 3H0TA 5E5RB 5CWSA 1EMTH 2V5MA 3BGFC 4ODHH 4PJ7B 3ZYZA 5J6GA 5LCVL 3AREB 2R2BB 4XNMA 3BMVA 4AL8L 5FYLH 4M48H 2IBBA 5IWLA 3WFCH 3PWPA 4F80A 1CVRA 3SQBA 4Y16A 3PQYA 4PJDF 3BE1L 3KYAA 1MF2L 2VZSA 2UVEA 3TF7C 4X7SL 1V7NL 2O26U 4K9EH 4OCSL 1JGLL 5DO2D 3JUYA 5CKGA 1MREH 5AZ2L 1CLCA 2X4PA 4P5TD 3SDDC 4I3SL 4RSVA 1HCFX 2HFFB 3DX7B 4PJ5B 4NO5B 2AW2A 1MSPA 2YN5A 1XIWC 5HI3D 3UPCA 1FZOB 2X4UB 3NN8B 4QOKD 3PIQA 4XPHL 4DGYH 1VPOH 5T1LD 2LAGB 2QR0A 2ZNWA 3VI4E 4JFHE 3HS0B 1CGUA 4EOWH 1WWWX 3HHRB 2KZ1B 1EHXA 4TVPD 1UXWB 1NAMA 4Y4HA 1U3YA 4GBXD 3HNSL 1C7TA 2K9UA 2ZSVA 4O4YH 4F37F 1SVCP 1I1AD 3ZKXC 1J1OH 2EDKA 1KTDA 2Q6WA 2QBWA 3TP4A 3QUYB 3F7YB 4WJ5B 2R4RH 1F5WA 3CXHJ 3CDYA 2D03H 4DKEH 4PV8A 5T5FL 2EYTB 4Z7OE 3FQXA 5IVNA 3MV9E 3MLRL 1ITBB 4JFFA 2OXHA 4YHIB 5E5MA 2O5ZH 5FYKL 4YO0B 3WNOA 3PWJB 4CW1A 1QHOA 4CADA 2BDNL 1KIQA 3TBWB 3SQOL 5DJDA 5GGTA 2ICCA 3UJIH 5F70A 2EC9U 5KAQF 1OVZA 1XGRB 4EQ2A 4XVTL 5HYJB 1KCLA 2UY6A 5KVEH 3WV0A 2IPKA 4JQXA 1F4XL 1REIA 4ZXBC 3TWCL 3GMOA 4BZ1L 3C08H 2DLGA 4R3SA 4PJEE 1F6FB 1AQKL 1X5YA 2JIXA 3EYQD 3MREB 5ADOH 2V17L 5DD3H 2CRMA 3K8MA 2UWEA 3SKNA 3WXWL 3QHZL 3OKEB 2AJVH 1KCRH 3ES6A 4U1GC 3C8KA 1J0JA 3HZVB 3MOAH 3T0EB 3QPXL 4PRIB 1WT5A 3RGHA 3PHQA 4U1NA 5DFWH 2ZUTA 2XWBB 3LRGA 4PJCF 1TJGL 1JZ2A 1U41A 3PJSA 1AFVL 3U46A 2BRRH 1UB5A 5FYJD 3DSNA 2XXCB 2ESVB 1CDIA 4Q6IA 4ZAKB 2VH5L 5I74B 4G8GE 1BOYA 4TOYH 4PBWD 4UU9B 1E4JA 4ZPTB 1UYWL 4GUPB 4XBPB 3K2UL 3CFDB 1CF8L 1D6EA 2BFVL 4RISL 1VEPA 2PO6C 1MWAB 4LAQL 3S37L 4M4RA 1Q1JH 1MCQA 2D0GA 5I1IL 5E2WH 1M71B 5CEZL 4J6RL 5T3XL 4PRNA 1A1MB 2YZ8A 1DBBH 1ZEAH 2JJSC 2WM0A 4PRAA 2I60L 1QPXA 5C0CD 1RPQA 1FYTD 5ITFA 2CUMA 1JZ8A 5IT2H 3O45A 1BZ7A 4OZIF 1N7MH 4NQED 1WIOA 1NBZB 4M6MH 2XRAL 5J7CC 4FA8A 4LCUB 3SJVB 4K8RH 5IHLB 2NZIA 2I5YL 4J4PC 1LEIA 2ZSWA 4JG1L 4LL9A 1O5DT 5DURB 4PJ9B 4WFHD 4XI5D 5FO9A 4G8EA 3IFLH 4XC3L 5D1QD 5IW3A 3VGFA 4LVNB 2FATH 4BH8A 1G7PA 4TSCL 3S34L 1GGBL 4RA0C 3GUTA 3DARA 3BP4B 5DJCB 1KN4L 4H0IA 2OL3B 3BWAA 3CLEH 3EJYD 4I48A 5GGVY 5AG8A 1YY9C 3DPBA 5ANME 5BRZE 3OAYK 1EJ6A 3O4LE 3H42H 3JUZA 2W65B 2ARJB 2BVOB 1BFSA 4HXAL 4WCYL 1NAML 1DDHB 3HE6D