5EZLB

Crystal structure of fab of parasite invasion inhibitory antibody c1 - monoclinic form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
SIVMTQTPKFLLVSAGDRITITCKASQSVRNDVAWYQQKPGQSPKLLIYFASNRYTGVPDRFTGSGSGTDFTFTISTVQAEDLAVYFCQQGYTSPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab c12
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezlB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezlB01
4EUPG 5JIPA 1E28B 1EGJH 4HWEL 2LU4A 5HY9B 1I8MB 2C1OB 5BVJA 5C0CE 1MVFA 4UZGA 2DLEA 4YHKL 4LCUB 1J0JA 3HRPA 4HK0A 4HIXH 1TVDA 2BVUA 5FKAB 1F45A 5FUCE 4Z0BH 2GW5A 3ECBA 3UO1L 5L2KA 1A6VL 1JVKA 4JO2L 5J7CC 1AXTL 1S7VA 5DUBA 4MB3A 1I8LC 1S8DA 4G8GE 4XCCL 4PJBB 3BP6A 3FN9A 5DD3L 5L6YL 5D1QD 4EBQH 3VCLA 3NACL 3BH9B 3LQAH 4LEOB 4HULB 5I66B 3IVKA 5DJXA 4F57L 2VERN 4NZRL 4RMUA 1U2CA 3BX7C 3SDDD 3X13A 1PLGL 1PZ5B 1CICD 2NZIA 4QRPD 5T3XL 4M1CC 1KPUB 2EO1A 3T4YB 4PB9H 1MCLA 4TNWK 4ODSL 1S7WA 1TZHB 4NNYB 5HDQH 4M6ML 3MBED 5IEHA 2VN4A 4HEPG 3FQNB 5IR1A 3HZVB 4XBEH 1H3PL 2VXSL 1TJIH 4OQTL 1NCBH 5HYIA 2H2SC 3OTTA 2Q8AH 1F4YH 2VC2L 1T80A 3MLWL 1E28A 4XMKL 2OI9C 2FR4B 2EC9U 3UTQB 2X1PA 2J6EL 5F9WC 3U1SH 1NBVL 2AEPH 2DWDB 3TPUA 3P9LA 3IFNL 4HUVB 4QRPE 4UQ3A 4ELMF 3A6CL 5IB2A 2W0PA 3MUGA 3H0TB 1YPZF 4CADA 1QHPA 2R29L 1CE6A 2BY0A 1QVOA 2X6MA 3S37H 2KDGA 1W0VA 1S7XA 3CVIH 4BM7A 1LO4L 4X6BB 1D5XA 4ZO9A 5BZDB 3BJ91 4LLAA 1QRNA 3OKYA 5D1XA 4M8VA 4OM1H 1GCFA 1JFQH 4YIQB 4ZUVA 1OAYH 1NKRA 4H1LB 2CR6A 3BQUC 3EJJX 5C2BL 4TVSa 4GXUN 1U8QA 1YQVL 2P24A 3SE9L 3G08A 3O2DA 2HFFA 2IMNA 1T20A 3TA3D 5J13B 3FQNA 1S9YB 4TSAH 1MFAH 5ISZB 1KB5L 3SKMB 4IIQC 1AQKH 5E6IB 5FK9B 3W0WA 1T1WA 2XG5A 2MQ0A 5L8LB 4ORZC 4R0LB 5LGJB 1I85A 1FG2A 3PE9A 3UTOA 3OGOE 5EU6D 3VXOB 4PRIB 5HVFB 5E2UH 1NLDL 5C08B 1KXTB 2HKHL 3DVFA 5DK0B 5HJ3A 1QP1A 3QFJA 4XCNB 1RULH 4I9WD 5DHVB 4NC1C 5GZOD 3MODH 2B0SL 2QLVB 3DSFH 5FOBA 2EEBA 4MZ3A 4Y7MA 5HHOB 4XHQA 2NLJB 3DVNB 5T5NG 4L3EB 4RFOH 1K5NA 3RWJA 3K4DA 2LU3A 2XFXB 3QO0A 5EU6E 3LRSB 1UCTA 4H1LA 4HUUA 5CEYB 4W6YB 2EDWA 5SWZA 3T8XA 5C0CA 3FB7A 4I9WE 1J8HB 1B3JA 4PJDE 1NMCB 5ISZA 3ZDXF 4HKZB 1NPUA 5CSGA 3O9WD 2DQUH 4MA8H 4PRAA 1RU9L 3T0EA 2IPUG 3U9PH 5I16B 2EH8H 2OJZH 4LDLB 4LSQH 1RJZA 2OK0L 3C2SA 3KYKL 1KACB 3VXMA 2C3XA 1R3KA 3VXOA 3C8KA 2ICEA 3MCLL 2DMKA 2C3VB 2X4NB 3I50L 5DK0A 3MRGB 3ZKMC 3QCTL 2R8SH 4O51A 4MAYD 2EIBA 1L7TH 4ONGH 3N85H 3KJ4B 4RZCB 1V3JA 3QDJA 4NN5C 2BNQB 1JTTA 2BNRB 3BGMB 4YUEH 3MUJA 5F88B 5GGVY 4G9FD 3VH8B 4DEPC 1EFQA 4NUJA 4NKIH 1K2DA 1A7OL 1MCPH 4F37F 3QXWA 1B6UA 3V6BR 4OV5B 1DQLH 5B3JF 5FO8B 3QT2A 5ITFB 4Y16B 1MUJA 3SDAD 2KH2B 3D6GA 1U3HA 1CLZL 3R4DA 1JHLL 1HEZA 4GW5B 3SDDA 4N0FB 2AJZB 5FDWA 5AZEL 1A7BA 2ATKB 2FD6L 4P9HC 4S1RL 4R96A 1R5VA 4ZTPL 1MHCB 3T1FB 1QR4A 5ENWA 5IB4A 4G9FE 4J3SA 3AGVA 1QLRB 5FGSA 4JFDB 5EORH 4J6RH 4FMFA 4PJCA 1WFUA 3FT4B 3K81A 3RWFB 3WNOA 3O8XB 2NY6B 4GKNB 4E42B 1UA6H 4NN6C 3Q6FA 4FA8A 4EUPA 4PJHF 2GIYA 1RJYA 4PUBL 2XN9A 4LSPH 1EPFA 7CGTA 4CDHA 4UILL 5FUOH 4ZFZA 1LO3H 2ZUTA 3LKSA 2XQBL 1ZXQA 1LE9A 2AV7A 4GUPB 5F88A 1OP3H 1XGYH 2KUTA 5D7JC 3B9DA 1MCHA 3QUYC 4JFEB 1J1XH 4CUCA 3WFEH 3GMOB 3EJZD 1JK8B 3MX0A 2L0DA 4B5EA 5A2IH 3UJTH 2GITB 5JQ6H 4Z7OE 1OVZA 4LNRA 1ZMYA 3A6BH 2D3VA 1U91B 5F1SA 5J6GB 2AQ3A 3QHTC 1HKLL 5L8JB 3WO4C 4M7LT 1KLFA 1F4WH 2NX5A 2G60L 2VQTA 5FYJH 3RX5A 1B0GB 4JQVC 4AL8H 5MERA 1PJ9A 3CGTA 4LRIC 4MCZB 4K3JH 4MJ5B 5T1DL 1BOYA 2XTJD 5BXFB 1MFCL 5DTFB 5GRWA 2A73A 5JPNA 1G7QB 1TCMA 2QKIB 4IOIA 3VE0B 5C6WH 4JJ5A 1YNTB 4GKNA 3DRTA 4HXAL 1GOGA 3TC9A 1IAIL 2GJ6D 1I1RA 3ARFC 1JL8A 4MZ2A 4HMEA 1DBBL 5SWQB 1G9ML 4KMTH 5T1LA 5AYUH 1AR1D 2HJLB 2Y6SC 3BIBX 1RIUH 5GRZA 4PJ8D 4HQQH 1KIQB 3RI5F 3MJGX 3NAAH 4Z95H 3NA4A 2XTJE 1FBIH 2VZ1A 1H5BC 4UB0L 1JK8A 5F9OL 4ONFL 1JN6B 4PLOB 2XZAL 2XZQH 2VR4A 2WP3O 4OI8A 1BZ7B 4BFGA 5IOPA 1MQKL 5JR1H 2GJ6E 4RNRA 1U91A 1IGTB 5F7NC 4DVRH 4YBQC 3RKDD 1LP9B 4ZNCD 3EHBC 4Z7UE 5H8DA 2LTQC 2DF3A 4P23A 1KCUH 4PJ5D 2BY2A 4NJ9H 3UMTA 4Y4HB 2QKIA 5IROC 5KANG 4U3CA 3BPCB 3ARQA 1QA9A 5B4MC 1MWAB 1MHPH 1MI5A 1SBBA 2AEQL 2CDEB 3MGAA 2VQUA 1A6ZA 4HXBL 3O0RL 3TV3H 4X98A 4O9HH 5T1KD 1G84A 3C09B 1DZBA 1UCBH 5C86A 1A3QA 1CFNB 4HKBA 4I18B 5E4IA 5EOCJ 5E99L 5D2LB 4Z77B 4J8RA 1N4XL 1AD9B 2VUOA 3FO9B 4ZUSB 3I6GB 2YSSB 3VFUA 4PJ5E 4TULH 4ZXBB 3UJIH 4RIRB 1G6RA 1KPVA 4BFEA 2ADIB 3GSVB 5L0QB 4DKAA 5C9KA 3P30H 3INUL 3L3IB 2MQ3A 1KT2B 4ODVH 5CJXC 1VFAB 1FZKB 1MFDH 2CQVA 3G5XA 4LAQL 1UM4L 1CR9H 3PGDB 1F6AA 1ODAA 1AXSB 5DRWA 2IGFH 4JR9H 3N50A 2VLJB 2UWEA 2HMID 5I71B 2IAMA 3C6LD 5AAWA 1I9IH 1MLCA 4EEEA 1LHZA 3HE7D 3V0WH 2D4FA 5GS1A 5IW1B 2AW2A 4KROD 4KMLB 1ZA3A 2CRIA 1UJ3B 3BPCA 1NBYB 4H88L 3IDMA 1SY6H 3EOTH 3IETA 3BRDA 1ZLVK 1RZKC 1KENH 1UQSA 1D9KC 5FXCH 4PJ7B 3MBXL 3KLHD 4A6YH 3PHOB 1I8KB 2BVOA 4PP1C 1BPVA 2WSKA 4I18A 1T22A 4GXVH 2XNAB 4HKJA 4MVBD 4S1DD 1J12A 1IQDA 4DZBB 1C08B 3BH8B 4U1HB 3I6GA 1XF5B 4CNIB 4PREA 4H8WC 3DX6A 4U1LB 2ADIA 1A4JA 2YA1A 1CVRA 5E5UB 5IKCA 4MMXC 4QRRD 4F7TA 1I9RL 3TCLA 4PJCF 1S9XB 1CT8A 4P5TD 3UPRB 3BDYH 3TT3L 4NHUB 5GZND 1T1YA 1Q9KA 2X4RB 3KNBB 4XNYL 2BSSB 3HRZB 4MAUL 4U6VL 3VRLF 3Q6GH 1OTTC 2R1YA 4YXKH 1FFNB 1XGQA 1I3GL 5ICZB 1HSBB 5D8JL 5IMLB 3ZE2E 5J0BA 2NY5L 4NWTL 4FABL 3BMWA 4QGTA 4WNQB 5EZLA 1G7IB 2G75B 1AD0A 2N4IA 2NYYD 3EOAA 5C0AD 4P2QA 4XT1C 3SE8H 3IYLW 1AO7D 5ACZA 4QRRE 1JGUL 1FCGA 2AJUL 3EO9L 3HUJA 4G8EB 1JNNH 1ORSA 4X5XA 2DKSA 4FNLL 2KZ1B 4TNVF 4OLZL 3MRCA 4LLWA 4PJ7A 3RIAF 1CG9B 1JMXA 3C5ZA 4KKLC 3DX8A 2P7TA 1M7IB 5EUKB 5JMRA 4WO4B 2D7TH 2GK0B 3NZ8A 5EA0H 4DZBA 4U1HA 3G04A 5F3HB 4F33A 4R4BB 3UTSD 1MPAL 1OAQL 1UM6L 1S7RB 3QWOB 2VYRE 1ITCA 4HIEA 4OZIA 3RPKA 3ALWA 5FGBA 1G0YR 3WJJC 5C0AE 2NY1D 3FT3A 1AO7E 1XH3A 4JDTL 3NFSH 4ZTOH 3L1OL 4K7PY 4HG4K 3KNBA 1U8MA 4U2ZA 5I8CA 1F11B 3NGBB 1KNOA 3L3OB 2JCCA 3MYJB 1H0DA 3NIDE 4HIHB 4KXZH 1B90A 1ZVYA 1M7DB 1FFNA 1JWSA 1IC1A 5LXGH 1A9BB 2ED9A 3UTSE 3DXAA 4QRSB 1IBGL 1DVFD 5I1DA 5KAQG 3EYSH 4AYFA 1RIVL 4AZ8A 1P6AB 4UQ2B 15C8L 3ZL4H 3D25B 3WNMA 2K1MA 1OP5H 5E6IC 3F7RA 5CZVH 3VXSD 2AQ2A 3PWPA 4HH9B 4DGYL 2QSTA 4LCIL 2GSIA 3BKJH 3HMXL 3OKOB 1T83A 4MHHI 2VLKB 4YGVB 3ZE0F 4GBXB 1XGUA 2IALA 1FYTD 2ZP0T 4F9LC 2I07A 4LCCB 3SDXB 3I02B 1K3IA 1MJ7L 1QEWA 2ID5A 4K3HA 4I0CC 3EDFA 3QWOA 2Q76B 5GSRB 2H41A 4TVPD 3RTQB 3L3HB 2AJXL 4NZUH 1KXQE 4X8JB 3L9RB 4ZUTA 3CLEH 1KJMB 3WJLC 1FO0H 3QNYA 2F9BT 2W0LA 5I1LB 1YYMH 3VXSE 1QLEH 4NJAL 3RA7H 3R1GL 2R4RH 2V2XA 2CGRH 4BH8B 1O0VA 2YXMA 3MLPA 1KN2L 3LQMA 1ORQB 3BKYH 1FYTE 4HMCA 3U7YH 5KSBB 2EKSA 1AGDB 4DUXA 5C70A 1P7QB 3VDAA 4IDLA 4Y89A 4TUJB 2PTVA 2RBLA 3SE3A 1BBDL 4TVPE 2AKRA 2X89A 3CX5K 4XCFL 3VI4E 5HHQA 1BFSA 2ITCB 4WFHD 1GHFH 1I1FB 2VLLB 3C6LA 2Z0BA 4OLXH 5DFTA 1BFVL 1ZTXL 3V0VA 1XGTA 3G9AB 4FXLA 3ULUC 5T5NF 3OXRA 3U48A 4AEEA 4YX2H 3U7AA 2DLTA 3BXNB 4I5BA 1XR9B 4DW2L 1H8NA 4XPBH 3FO0L 1E4WL 3ZHDA 3HE6A 1Q0YH 4HDIA 1LO0L 4P3DB 2I26N 4Q2ZA 1J5OL 3WO3B 2Q20A 1M05B 5GRJL 5FAAA 4X6CB 2HFGH 2OZ4H 4ZSOE 1RK0B 2RCSL 3P73A 4WFHE 3D2UD 2VXQL 1VFMA 3IU3A 3QRFM 1X5GA 3FT2A 1HCFX 4JVUA 1JMZA 1AY1H 1ZHBA 4LBEA 3SCMA 1DTUA 4XXDB 3VRIB 4M7KL 1FL5A 5HI4D 3O2VL 3MV9A 1AGDA 4R4NC 1P7QA 1TIUA 5HYJD 5JHLH 1JGVH 3QWQB 5EH1A 3G5VB 1DN0A 4OFDA 1BD2A 3ET9F 1WTLA 4HKXA 1JRHI 5CFHA 4OIAA 1RUQL 4XGZB 1XCTB 3IDGB 1A3LH 3FQWB 3GRWH 1Q9OB 5JXED 3QHZL 4NQCB 2WMPA 1IGYB 3CUPA 3QDMA 3WHE0 4ZNEE 1G7JA 3OB0H 1W72H 1JWMA 1MAKA 4L29A 4XVJH 3GUTB 1X5IA 1LO2L 5CP3H 4WEBH 2H3NB 3EYUL 4G7YL 1VCAA 5AWNH 3T65B 2VDLH 5D6CA 2A74A 5ETUB 4J3XA 3EDKA 5ALBH 5HYJE 5E9DA 1U8HB 1T4KA 2H2PD 2R2HA 4Q7DA 1RZ7H 1GZQB 1FZMB 5B39B 4MD5A 4FXGB 4MMZC 4PBWD 3KWWB 4KXZI 4NQXA 3MV8B 1ADQA 2ARJB 1N6VA 2CIIB 3MSPA 1X5FA 4QRTA 1IGJA 4V1DD 1EZVX 2YC1A 5BRZD 3HUJF 2DJUA 4PJXE 3TBSA 3QULB 3RVXC 3FQXA 3M17A 3SY0B 4Z7WE 1YEKL 4JKLA 3GHEH 3CMOL 3O6ML 3WLBB 1CTOA 5E8OB 3UDWC 1KCKA 5DEGB 1FPTH 2PKDA 4Y2DB 2W59A 2FECI 5TQ2L 4Z7UF 3U4EB 1UWEH 1PBYA 2A0LD 1D6EB 5H37H 3GJFK 1KJ2H 4AEIH 4JRWA 4V1DE 1EH9A 3AY4A 4RGOH 3VWKC 3GMNB 1KTLB 5BRZE 1G1YA 1YDPB 2VR5A 3TO4C 2HTLC 3H3KA 5AG8A 2G9HA 3LKRB 3DV4A 3QWRD 4YE4H 1KCRL 5E2WL 3L7FB 3TYGL 2AK4D 1JPGA 1FLTX 1CU4H 4L9LC 3BHBB 5EIQA 5JTWA 2Z31A 4HF5L 3EKCA 4Z6AT 1ITBB 4FXGA 2LVEA 4JPWH 4HGWB 3U36B 3OAYH 2DLGA 1CK0L 2LVCA 3HNVL 1RIHH 4ZQKA 1BLNA 3DYMA 4C56B 5TF0A 5IW3A 2DOCA 1SJXA 1R5WA 4M48L 3FO1B 3FFDB 5JIHA 5ITBL 2BRQA 5GJTL 5IJVA 3TBTA 2AK4E 2J88H 1ZSDA 2A6IB 4N0YH 4U1JB 3U6RA 5D93C 1T0NB 2E7BA 3IJHB 2UYLB 4NQEB 4KHTL 1CF8L 4KJWD 2P8PA 4X7TB 3NZHH 4XI5D 4OCRL 3SDYH 1U6AL 1SM3H 1P5UA 3UTTA 1JTOA 4FQHB 1IAKB 4HIIB 3HZYB 3OJVC 2YK1H 1E6OL 3UTZA 3LKRA 5GGTL 1MLBB 4YXHH 5DMKB 3C09C 1WIOA 5TE4L 5DXWA 4FQIH 5CUSL 3R8QA 2UZIL 5K33A 3BDBA 4H20H 4Z8FH 1QFWH 1OQOA 5HXMA 1FDLH 1ED3A 1KELH 1RURH 2Y23A 1C8PA 2LV4A 3FB5B 3U0WL 3VXUA 3CFCH 1VPOH 5GGUB 2RIKA 5ECJE 4WDIA 3GO1L 5AEAA 3EGSB 5KSVA 3TZVD 1R6VA 3LZFH 4IJ3B 4NP4L 4MNGA 5DVNA 3NN8A 1ZT4A 3FN0L 3RWHA 4KK8D 2AABH 1IEAB 1U3ZA 2MTPA 3V4PL 4RFEB 3BWAB 3QI9D 4GKOA 4BFBD 3C60A 4HBQA 1ZHLA 3DUSA 1QUNA 5DO2D 4QXUH 5GRVK 1P4IL 3QXVA 1DSFL 4EZMA 2QQKH 1TZGH 3QUXD 5GISH 1WBYA 1DEDA 3K1DA 3KYMB 4I0PC 1QACA 5DRNB 3ZE2F 1Z0NA 5IMMB 2CKNA 3AREA 2C3HA 2CLRA 1AFVH 3MYZA 4QF1B 4G6MH 3UZVB 4XPHH 1Z3GH 3UZQA 4IMLB 4DAGL 3C5SA 1KB5B 2QQLL 3HLAB 2OR9H 2QQQA 1X6NA 1VEMA 1B88A 3VDCA 4O5LL 3CDGA 2J6EA 2CXGA 4LMQI 1BQHG 1YEEH 3MRJB 2YEZB 1U8KB 2YPKA 5GPRA 4YNYA 5C0BB 1IKNA 1YEHH 3VGAC 4JFPB 4FQCH 5CKGA 5F1IB 1IAOA 4G8IA 5TQ0H 3MCKB 1A6AA 4YPGB 4PJAA 1MCOL 2CPCA 3RGVC 4JHWH 1CDJA 4KRPC 4BZ1L 2Y06H 2W65A 5GHWH 2AAVA 3RZWA 3UYRH 3ULVC 4CVWA 1GGTA 2NY3C 3NIDF 5E24E 3GIZL 4ACPA 5FUZH 2FWOA 4MXQC 5C9JA 5L9DL 4OLVL 5I19L 4KAQH 4JVPA 3GSNA 5IMMA 2HJFA 1X4ZA 5GS0C 5CGYC 4G6JL 4CMMA 3RJDA 1PG7X 3DURB 4TVPL 1R3IH 4FQXD 1FL3A 3D0LA 4G6KL 4K23L 4L8SB 4W68A 1ZS8A 1A5FH 3DWTA 1NC4B 4TSCH 1NC2D 3W39B 2MMXA 5CIPH 1VERA 5H2BA 3OAUL 3IDYC 2PW1A 3AVEA 3LH2H 4PGZA 3I3BA 2PN5A 3CVHA 5TGBB 2CDGA 4R90H 3GSRB 4UNTA 1D5ZA 4OZFH 4MLSA 3GI8L 2X4SB 3GIVB 5LCVH 3FOMA 4Q6IB 3UBXB 1JGEB 4PJHB 3H7BB 4QY8B 1XR8A 4PJEB 1JNHB 4FQ1H 5F1IA 1JI1A 1YUHA 3H9SA 4L4TD 4O2CB 2EXWD 1PX3A 1F2QA 1CZ8L 1AC6A 2BRRH 4FP8L 3EYQC 4WEMB 4NOBA 4OB5H 4RGMC 4C58B 1S5IL 3FQRB 1MOEA 3SPVA 5C07D 4AMKL 3QJHA 1J0HA 3OWEA 3FAXA 2XG4A 4OT1L 4JDZA 4PJ9B 4LHJB 2EECA 4LCWA 1B6DA 5IMOA 2QR0B 1EBPA 3PP3H 2WIIA 1HN1A 4OCSH 4M1CD 1HYSD 2B4CL 3VI4F 3DURA 2PCPB 1QFUL 1U41A 2FNBA 4Z78B 1O7VA 2E9BA 5EU5B 4NQSA 5C8JA 4L4TE 4GT7A 3R06A 1ZANL 1U8JB 3Q1SH 4JN1L 1Y0LB 3STLA 3HC3H 3WDIA 4P9MH 2H2SD 1BAFH 5C07E 1S9VB 3BSZH 4NO3B 2XWJA 5DJ6B 2Q6WB 1VEPA 1EGJA 5JUEL 4N5EC 3VD9A 3KDMA 3F7VA 3DUUA 1GGBL 3GDBA 3JWDC 1DQDH 1S9WB 4MQXD 5KAQF 1XIWC 3UBXA 5BV7L 1CGXA 1RQ5A 1WC7A 4IRSB 1B4JH 2O5XH 1NAKH 1EAJA 4YR6B 4XP1H 4EN3A 1HIML 2MNUA 2KKQA 4GRLA 1AGEB 1AGFA 4H5SA 2EYTA 5IFHH 1SJHB 3HB3C 4YFDB 2BNUB 2GSGA 4XNUH 4F9PC 1MSPA 4R2GB 5IGXH 4HS8H 2CKBH 4K8RC 2FZ3B 2QR0A 2X41A 5TFSL 3KLDA 1TVBA 4PYHA 2DKMA 2AV1A 1Q1JH 3QEUB 1EHXA 3GMRB 3VI3F 5KSAA 3P0VL 3ARGB 3ME0A 1EEYA 2V2TA 2MFNA 3BQUD 2VB5A 3MUY1 4YHLL 3OZ9H 5MENA 4LU5H 1VB9A 3NIFF 1IJ9A 1V8HA 2R1XB 2WUCH 1CLCA 1T2JA 3FRUB 4S1SL 4U2YA 1F3RB 2FX8L 4LLQA 5IIEB 1XF1A 1YYLL 3KPPA 4U1NA 1Y0LA 4P46B 1E6JL 4JY5L 1TDQA 1PKQE 3H3PL 2HT3C 5I75C 1T04A 3VXNB 3PWUA 4XX1G 4YFEA 2XKUA 2B1AL 1D5IL 4GAYA 2EC9T 3DX7B 4M5ZH 4LPCA 1MH5A 4IRSA 3F12A 2XT1B 2HWZL 3S36X 2X4TA 3HNSL 4PGDA 1NUDA 3CFJA 1SJHA 3T0BA 3FJTA 4K7FA 5KTEH 4KTYA 3L6FB 4X6EA 3C9NB 3TN0D 4Z7WF 3QQ3B 4EI5C 5C09A 1YMHB 1MIEH 4MDJA 5FYJD 2LE9A 12E8L 4M61B 4WHDA 1T03H 2EIZB 3AM8C 5D7IA 1E27A 1JPSL 2FHFA 1UB6B 4G8GB 4L4VA 1T6WA 1LD9B 2WWMC 4P4KB 4C83A 4X6DA 1R24A 4P57A 3F62A 4NC1E 5I73B 4WI3A 4WGWB 4LPWA 2R0KH 2NXZB 4O2FA 4P99A 3WIHL 2FEEI 3V95A 5FB8B 2OX5A 1N7MH 3VG9C 2X1XR 4O2EA 1FH5L 3OGCA 5GGVH 4L1DA 5HPMB 1NAMH 2X42A 3MACH 3L3DB 1BVLA 1HINL 2CMRL 1GZPA 3MLTA 1KYOJ 3OBAA 5FYJE 3TBYA 5EULV 4DK6A 3OX8A 1YY9D 5FYKH 4YDJA 1BQHA 5BW7C 3ZKMD 3KS0J 1INQB 4F8TA 5D1QB 1FNEB 2Z91B 1CD8A 3T2QA 4C4KO 4IBLT 1J0YA 2OXHA 4HUWB 3VFWA 4NKMB 2HG5B 2E27L 1CICB 4YH6A 1KN4H 5E8DH 4QRPB 2NMSA 4TPRH 3SO3B 4ZYKB 5JW3H 3ARPA 2Q7NA 1F3JB 5IT2L 1A3RL 2R4SH 3UEZA 3HMWL 5LJYH 2I60L 3IFLH 3T2NL 3WMSA 3MBEB 3GSOA 1U58A 2ZPKH 2V6HA 1DQQB 5HHPB 3TWCH 4M93B 1RUKH 1OARH 4LGPB 1HHJB 2XA3A 4OZGA 1LWRA 3FCTA 4JJHA 1X3DA 3LS5L 1U8OB 4P2OC 2BC4A 2PXYC 2ZCKH 1QSEB 3FFCD 5INCB 1NQBA 1IM9A 4G42A 2FO1A 3Q3GA 4KDVA 3DOSA 5C0EA 3WHXB 3U30C 1VENA 3QP3A 4KHXH 5J1AB 2XV6B 5BMFL 4BSVA 1KJ3L 1A7NH 4WJ5A 1JF6A 4MDIB 4GRWE 3EOYG 3MRDB 4FHBD 3QIUA 1UEYA 3MRRB 3X3GL 4NSKA 2A9NH 5IQ9A 4NM8H 5AUMA 3MV7A 4G3YH 3DIFA 1CXEA 3ELAT 5KBNC 3SJVD 4PGBB 3U7WH 1X5ZA 5BZWB 5DT1L 1R3HB 1FRGH 4G7VL 3FONB 5D7JD 2QHRH 3FFCE 4CVXB 2P4AB 3QUYD 1I8IB 1QD0A 1L9NA 1U93A 4BSWB 4U0QB 4MXWH 5EZOH 4BA8A 5E94B 3HI5H 1FZJB 1UVQB 3TA3B 4FZEL 3KJ6L 4FFYH 3IRPX 4XP5H 2VABB 2ZSVA 3BYYA 5DHXB 5TE7H 5HHNB 3KPOB 4WI4A 3WFCL 4EDXA 1PW3A 4OCLC 4HD9A 5I17A 4LPYA 3VFGL 5E1AA 4IRJA 3SJVE 3QUMH 3RX8A 1OAZH 4NRYB 2I5YL 5INCA 2W9EH 5EU6B 1T5XA 2X4OA 1VGKB 3P3YA 3SDCA 1OQXA 3QJFA 4D9LH 1IKFL 2FBJH 3V5DA 1A6UL 5I76A 1GPOL 1V05A 2P47B 4PRHD 3ARFD 2EC8A 4PJDB 1OGTB 2VZ3A 1YJDC 3IKKA 2BVQB 5EU4B 1Z9MA 3HC4L 1VFBB 4HIJA 3RVVC 8FABA 1B9ZA 2A83B 5T3ZL 3TO2A 4UNUA 4HLZH 3GZKA 3MJ6A 4GSDL 4NNPL 5F72S 3UC0L 3U46A 1MVUA 4XP6L 1CXFA 1K6QH 2CDFB 2BSTB 4HUMB 3PL6B 5GJSH 5EBWB 5DRXB 2AGJL 1MHHA 1YEIH 1DBJL 2F19L 4D8PA 5F7WC 2GKIA 2QJDA 4XMLH 4PRHE 3PJSB 4ZPTB 1GH7A 5SWSA 3GBMH 4D94A 3NH7L 5IMKA 4XRCA 3ARXA 4NZTL 1FFPB 4CN6A 4Y4FB 3HI1B 2QHLA 3O9WB 1HNFA 5I8KH 1PQZA 4OUOA 5SX5H 3EHBD 4Y19D 1WBXB 4WU7B 5F1NB 2AJYH 4N8VG 4ETQA 4Q9QH 43CAA 4LSSH 4NC2B 4OLYL 2PETA 3DO7B 1SJVA 5I8EB 5SX4H 4MAYB 2IBBA 5DMIH 1FVCB 1KTDB 1TMCB 3RHWF 4G9FB 2JJTC 4MNQA 3CC5A 2DI7A 1T7YA 2BX5A 5EPMA 1FHGA 2ICWB 1JPFB 1OSPL 3MJ9L 4Y19E 1ROWA 4E5XB 5B8CA 5JPMA 3IT8D 1XZ0B 1U8NA 2WBJC 3FL7A 3HI6L 3VD5A 4X6DF 3PWVB 1D5MB 3SDAB 3DTXB 3PL6A 3ARTA 3N9GL 5DRXA 5EBWA 5IB3A 1NGWA 3DLQR 3WXVH 1ERNA 1UACH 5T5FL 3V52L 3JWOC 3S96B 3I75B 1R3LB 1G1CA 4E0RB 3SHSA 3MA9H 2R0ZH 3TBWA 4PR5A 5E4EB 4UDTA 3OKNA 4Y4FA 2YMXL 4AH2B 3RUGE 4ODHH 4DFIA 3BUTA 3K8KA 4F37K 2X4PB 2EDYA 5DJZB 2FIKA 5JXAH 1G9EA 1U8IB 3GMMB 4E41B 1KEMH 4JHAH 3S98A 5JDSB 3VWJA 2GAZB 1KBGL 4M8QA 1RZ8B 2R56H 3OJDB 4UU9B 3QPXL 1UADC 1WAAA 3QISA 2EDQA 3REWA 3VFSA 3WEXA 3ULSB 4PRBB 3SN6N 1RHHB 3WKMH 4FFZL 5GQBA 4P2RD 1ES0B 2VIRB 5DC9B 5KS9E 1D9KD 2Y07H 4ODTL 3CZFB 3O4LA 3I6KB 5FV1L 1HOCA 4E5XA 4OZGF 4K3DL 3BZEA 2BOCB 4HBCH 2DYPA 5ID0A 3AXLA 2XXCB 2FO4A 2Z8RA 4R8WH 5GGQH 5FKPB 3AB0B 4K9EC 1TETH 4XPGH 5A2JH 2WWKO 3RNKA 2ICES 3DGCR 1JNLH 1BECA 5LGHH 4BZ2H 3T0VA 1A8JH 5F7FA 1RI8A 4P2RE 4OKDA 4KVCH 4AH2A 2XTJB 4UINL 1OTTD 3KYNB 1IGFH 4DN3L 2P5WD 5I1AA 5EZJB 3ZKNC 4U6HB 4F15C 4E41A 2GJ6B 4ELKA 2W0FA 4ZUUA 4K94H 3G6AB 1R0AL 1DE4A 1NFDE 2VSCA 1MHEA 1IAIM 3KAAA 5IFJB 1PKOA 1ZKAA 4RX4D 4JAMA 1F6FB 1SY6A 4Z7UB 2A6JA 3W2DH 5HHXL 2C1PB 4S2SB 1WT5A 3IF1B 4PJ8B 5CJOL 1J9CT 2APVA 3QCVL 4Z5RB 5EWIH 4A6YA 4KKLD 2Y5TA 2OTUA 4UTAL 1P4BH 3MO1A 4EIGB 5IHZB 4N8PA 2VXUH 3AC0A 5D1XC 2P5WE 5IBLD 1N6QL 5D1ZD 1CD9B 3EFFA 1NFKA 3PQYD 4NWUL 5F7DA 3ZYIA 2KBGA 1T2QL 3BN9C 3NCJH 4XCEB 5MEQA 3TIEA 4XHJC 1MNUH 2OL3H 2M26A 5GGRY 4RGNC 2V7NA 1TJHH 1QBLH 4L3CB 3E2HB 3GK8H 1IVLA 4OLWH 4PJ5B 1RZFL 1U3YA 5F7MC 4IHOA 2DLFL 1DQTA 1BF8A 5BOZG 1N64H 1I85C 4QGYA 5DGRA 2DQFA 5SX4I 4K07A 1HQ4A 4V2CB 4EDWL 1J1PL 3MREA 3KPMB 3KYOB 4ENEC 1JWUB 1T2XA 3PQYE 4U1KA 4LP4A 5ALCH 5T1KB 5E7BA 4HQQL 2VDRL 3WIIH 3BKCL 4ODUB 4KKAD 4QRUB 5DD5H 4LQ1A 1CLOH 3EO0B 4MWFB 3ZYJA 4I3RH 1UXWB 4HSQA 1JZ4A 4OSUH 4YO0B 2VZSA 3CH1A 2XQYK 3RWIA 2R1WB 4R4FL 2BCKB 3ZHKA 1U95B 5DR5L 4J3OC 1ONQA 3EO1A 3VGDA 3HZMB 3GSQB 1VFOA 3T4AA 1I7RB 1AJ7H 2XICA 3MRNB 5KW9H 5J06A 2ADGA 3WFHB 3QUZD 5DDHB 3OJ2C 1SBSL 2F5AH 2XRAH 4MB5A 3C87A 1LE5B 1JNJA 2VDNH 3HG1A 2OJEB 3WD5L 4LVHB 5F7EH 1BWWA 3T0EC 3I85A 3ARDA 5INDA 4P9HL 2I9TB 3HE7B 1R3JA 1KCSL 1MEXL 4KROB 4R3SA 5DJ2B 4YC2B 4PY7A 3HR5B 5EN2B 5LQBL 1YMMD 1JGLH 3QIWA 4P4KC 1M1SA 1A7PL 1WISA 1I1CA 4GQPH 4N8VA 4JRYD 4FQQA 5HHVL 2IQ9L 1T21B 1AP2B 1MFBL 3RPIB 1TCRA 1I7UA 2BSRA 3MNWB 3OR6A 5IVOA 4PG2A 4UIKH 5TPWH 5EG6C 2WLZA 2DD8L 1BFOA 5JOFB 2BHYA 3W5NA 1CBVL 1KC5H 2NY2D 4QRRB 3G9VA 3GBNH 1MCEA 5GGSB 4I2XE 1EO5A 1RUPH 1U3HC 1S78C 2FH6A 1C5BH 3MRNA 1FC2D 1YMME 4LEXH 4P5TB 2JELH 4BELD 3ZYOA 3BP7A 1CFSA 4JRYE 5EOCH 4M7LL 1FO0A 3SDDC 4OD3L 5I2IB 1JHKL 3CXDH 5IVNA 2X4QB 3LN5B 4J3UA 5ANME 1WAAF 4OM0H 1PY4A 1DBKH 2IF7A 4OJFL 3IDNB 3LKNA 5DZNA 3WIFA 4YDLB 1UB5B 4PS4L 2BXZA 4NQDB 5C0AB 4UMGA 1EIBA 4S11A 2YRLA 1U8PB 2GFBA 5EO1B 5DD6B 4R4ND 3IS0X 1U42A 2GT9A 1B0RA 2Y36L 4LHUB 4PV9B 4UOJA 4NHCL 2VITA 3LDBB 4MA7L 4JZOA 2P5WA 4G8FB 1I3RB 2AQ1A 4J2XA 1IARB 2HJKA 2DS4A 3RPIA 3LEVH 3WV0A 3MNWA 3BPNC 5JHDA 2J4WH 4Y88A 2OS7A 3UTSB 5CLTA 1MFEL 4JFQA 5FF6B 5D2NA 3F58L 1XFPA 2D7PA 4QXTA 4WWKA 2DQDH 2GCYA 4LLMB 2X70B 1NGYB 4LCYA 2EDHA 4YDIL 4OBSA 4OZHE 1OPGH 3QCUH 1C1EH 4HT1H 2EDXA 4EOWL 2GQHA 4HX1B 2VL5B 4UT7L 3ESVF 4HV8B 2NY4C 2OZ4A 1RZGB 1P84J 2R0WL 5IM7A 4TNVK 3O3DA 3IS1X 4H1LH 3QQ4B 5MHSD 3UX9B 4U1GC 2ZSWA 4PRPD 4JPVH 1CXLA 2R2EA 3VG0L 4RWYH 1CD1B 4OGXL 4NKOA 3RVXD 2Z8VC 3S3PA 1BQLH 1DVFB 2WIMA 1UWXH 4JKMA 4NQDA 1BJ8A 2EO9A 3DMMA 4DKFL 1NMAL 5ILTL 1JRHL 3E6FA 5C92A 4F3FB 1OAXH 2JK5B 3VXSB 1ZHNA 4LHUA 3GB7B 2ARWA 2D7TL 3TT1H 2ERJB 5CILH 4JM4H 3RAJL 3RZCD 2XA8L 2ICWJ 1YNLH 1QFPA 3JV4B 2H8PA 2W91A 1FYTB 3OKLB 1F90H 1YN7A 2H9GB 3TJHC 5EUOA 3X3FH 3B9KB 1JZ3A 5MHSE 1W72A 4PRDB 4PRPE 3VWKD 1J1OH 4GJTB 5DHVH 4JKPL 5FHAL 3F65A 3TO4D 2HTLD 5CP3A 1KIRB 3GMLA 3ROLB 4MSWA 2Z35A 4LF3B 4WUUD 1TVHA 4H26B 4YBHA 3ARZA 2MCPL 2YPVL 5MI0B 4PLJC 2A6KA 5DJ0A 4O02H 2PTTB 4OZFG 5K9OA 3TYFB 3V4UH 5B38G 3E8UH 3VFTA 1NBZA 4BH7A 5J56B 4RFNB 5KJRL 2IPTH 3S9DB 4U3HA 4P23C 1J0IA 2F53A 4NGHL 4I3SL 4JM2B 3BRGC 2QADC 2VN7A 3ZL4L 1F00I 4Y5XA 4F7PB 1YNKL 2EIDA 4KUZH 2F54D 2FSEB 5CEZH 1OOAA 1NDGB 4S0TD 4ZSOB 3SKJL 3CCHA 4H25B 1NEZB 4WUUE 4OIBA 1ACYL 2JK5A 3MRKA 1G7PA 5MP6H 3QIBA 3RU8L 1ZVHA 2FECL 5CP7A 2NQCA 2D0HA 5EBLB 1RZKL 2R0LH 4M6NH 3RUGF 1JF1B 3TBVA 4EUPH 1CS6A 3QA3B 1BIIB 5JQHC 3B9KA 2X05A 3WN5A 4PJFE 1W8NA 2XWTB 4UAOB 4LIQH 5ADPH 2VDPH 4ODWA 1WWCA 2ZUWA 3V5HB 5H94B 4H8WL 2F54E 5KG9A 5KVFL 2YPLD 5ANMA 4LF3A 1LK2B 4YWGL 2IH1B 3D0VB 5KVGL 3O6FA 2WQ8A 3LEXB 3O11A 4RQQA 5GSVA 2R15A 1RUML 2HRPL 2BERA 1OAKH 5KS9F 4NQVB 5TF1H 4OF5A 3TYFA 4M3JA 1N5AA 3U4BL 1AIFA 5JLZB 1QSFA 3LQZB 2V5RA 1FZOB 2IAMC 4Q0XL 4YBLC 4HLJA 3MLRH 2BFVH 5BV7B 5GS1C 5CJQH 1NGPL 1Y18A 3KPLA 3HNTL 2XZCL 5HYJB 1MCJA 2X1WL 3DX9A 5DI8A 3IJYA 1G7MA 1RV6X 3CLFH 2WLYA 2YPLE 5CBEB 5IW6B 1OP9A 1ZE3C 2FJFB 5F9DC 5FM5O 1W0YT 1L0XA 3GSXB 2H1PH 4JZNB 1FGNL 3EFDL 4PGCA 4PJXB 1YZZA 4Y5VB 4YEFA 2LFGA 4F8QA 2NW2B 4GS7C 4OIIH 4Z7WB 2IPUK 1J11A 5D71L 3BZFA 1V3KA 4GG6A 2BK8A 4DZ8A 2O93L 2NTSP 5DHYA 1T5WA 3LEYH 2W92A 5DJ8B 3MRPB 3JXAA 1IL1B 2DWEA 4M43L 3AAZB 5DJYB 4ERSL 2J8HA 1YEFH 4UT9L 3ALXA 1LK2A 1K4CA 3ISWA 2R69H 4M02A 5TJWK 3K3QA 1FLRH 2VXVH 3HC0A 4LLYB 4BK4A 2WNGA 3D18B 4N9GB 4OCMC 4PRNB 3G6JE 3MRLA 3EJZC 4LPUA 2NXYB 5HVWA 4V1DB 4GG8B 4IRZH 3VFNA 1HHIB 3LKOB 4CVZB 4LNVA 1FZOA 3LN9A 5CMAB 4N0UA 3SKOB 2ZOKA 1DQML 1BVZA 2IBZX 1PYWA 2DQEL 3U9UB 1MRDL 2Y4SA 3DVGA 1EXUA 2OP4H 1IGML 5JORB 5HYEA 2PYED 3BEVA 4GAJL 5AZ2H 1F4HA 5IBUG 3O6KL 4OFYD 1FAIH 4FTVA 2RB8A 4QHLB 3RGVD 3M8OH 3WFDH 4KRPD 1K4DA 4QHNA 2C7UB 1ZA6B 3MXVL 3FB8B 3C5ZC 4OGAC 5GRUH 3ULVD 3X11B 2NY3D 4XWOC 3NABH 4K2UL 4BUGA 5EBGA 2QV2A 1PAMA 1NCAH 2V9QA 4XPFL 3WXWL 4JGUA 4X9GA 4L8DB 5DJ8A 3PHQB 4MS8C 5D70H 3UJJL 2AK4B 2ITDA 4JPIA 1YEGL 4JPKH 1AR1C 3MUZ1 4G5ZL 5CGYD 5FGBC 5GS0D 2BVTA 2AERT 3LS4L 1BZ9B 5T33H 2PYEE 1WITA 5IK3B 4YDKH 5ESQA 5IHLB 4LVNC 1G6RH 1X7QB 2GYSA 1E4XH 1EFXD 4FQJH 3VD3A 1HH6A 2ADJA 1II4E 2EDDA 3C08L 3ULVE 2F5BL 2WINA 4Z7NE 4FMKA 4RBPH 5B21A 3SKOA 3GJEA 4W6WB 1JPTL 1P4LA 1S5HB 5F71A 1INDL 3RDTA 3RKDC 1I1AB 5EUOF 1X9QA 3ARBA 1LO5B 1HSAB 2ORBL 3E3QC 1V7NH 2ZWLT 5CD5C 5DMJB 1NCDL 1AHWA 2WUBH 4PP2B 5J11B 1I4FB 4LVOB 4X0KA 3EYQD 3ILQD 3LHPL 3QG7H 5FYLH 3MRIA 1ZA6A 4M7ZB 4UDUB 5JW4N 1C12A 1UM5H 2DQGH 4P5MB 2R23B 1MWAH 3ULUL 4NO2B 5DA0B 2HVJB 3RL2B 1HZHH 1IEBB 5MEOA 2NTFA 3ILPA 1QLFB 1FYHB 1S9KC 3MOBL 4PPTA 3VRJB 4ZAKA 1TQBB 4M5YH 1TTUA 1K3ZA 3DARA 1OF2A 2CR3A 4JB9H 1KLUB 3O45B 2ZCLH 5CIPA 2HA1A 1X5JA 1X7QA 2BVPA 3TZVB 3FO2B 3OKKA 35C8L 2AXGA 5HGDB 1E4JA 4OUUB 4UI2A 1UKTA 3G5ZB 4N5ED 1FNLA 4OZFA 1MIML 4AIZB 4WW1B 2C4XA 4DCQB 2B1HH 4NUGH 5B38A 3VJ6A 3QI9B 3SE3C 3UYPA 2EYSA 5F9JB 3D69A 3CFBB 4ZFGL 1XIWD 1D6VH 1I1AA 4FFWD 4QYOB 2IPKB 3V9FA 3CFIC 1UYWH 3D3VA 3O4OC 4PBXA 2HMIC 2Y9RT 3C6LC 2V5TA 1KCVH 3KXFA 3QUXB 4N5UA 1I4FA 3GKZA 2DBLH 5HYSB 3EOBA 1WV7T 4M4PA 4D0BB 4WVRA 3HB3D 3SO5A 2QL1A 5FA3B 3TVMA 1P1ZB 4Z7QE 1PGRB 4LSRH 4K8RD 3HE6C 1GGCH 4LLVA 3RL2A 1IEBA 3EYVB 3KLHC 4ZFFA 1T7XA 2HFEA 3VRJA 1SJEB 1OM3L 3OMZA 4XWGH 1FN4A 4W6XB 3JV5A 3CSGA 2AVGA 2WP3T 5A16A 3SKNB 3D85D 4F7CB 3MRMA 4XPAL 1KUMA 4HPOH 3SCMC 4YK4B 1RVFL 3IDIB 4OKVB 5DQJA 4HCRL 2HLFC 2HT3D 2YR3A 3VFPB 2APWA 4LSVH 4UUJA 5GZNC 3QUKA 4DVBB 3RY6A 3VXPB 5DWUH 4OZHF 5DJAB 5C0IB 4LASH 4GG6F 4UT6H 1FVEB 5D7SL 3ZKXC 1EJOL 3ARWA 4HLZG 2RHEA 3FTGA 1OGAD 2PW2B 2ZOLB 4NO0D 5KVEH 1UWGL 1OWRM 1KTRL 1Y6MR 2NY7H 1AGBB 1ETZA 4P59H 1A9EA 2F8XC 1FJ1B 4QOKA 4YGAB 4D0BA 4J3WA 2FATH 4KJYB 1DFBH 1BM3L 1NUFA 3MGOB 5ESVB 5F7LB 1UH3A 1ZWIA 2FX9H 4QTIL 2CKBA 4BK5A 1S7SB 4EI5D 3GI9L 4LGSB 5IJKA 1BBJA 1LMKA 2OSLB 4LRNL 5L88H 2Z4QA 3VXRD 2BMKA 3DO3A 2E9JA 2DAVA 2MPAH 5I9QC 1Q9LA 4XVUD 1CQYA 3RWCA 1NC2B 1A6WH 4O4YH 7FABL 2M2DA 4DGVH 2FGWL 3P4NB 2V17L 1HILB 1OGAE 1MCSA 3GSUA 1KPRA 2WWMD 3JVGA 1GAFH 2Z93B 1J05B 2HKFL 4OGYH 2VAJA 1W0WA 4OBRA 1B2WH 4QCIB 1DBMH 2VLRD 1EK3A 4X4MA 3VA6A 2NY1C 3KLAB 3QEQA 1Q9WA 4OAWA 3VFPA 5I18L 2DIBA 4XC3H 2APTA 1TENA 1OSZA 5TE6H 4DVBA 4PJGE 3NPZB 4YHNB 4L4TB 1M6OA 3IRZA 1QKZL 4EXKA 3VXRE 1NANH 4I4WB 4NM4H 3PWLB 4WW2A 4ISVA 1A6TA 5CHNB 2X1QA 4Z76B 1B4RA 5C3TA 1S7TA 1HK6A 3O6LL 4GLRH 4BKLA 4KTDL 1IQWH 1DUYB 1FORL 1XF2A 3AY4C 2CRZA 2UVEA 3LKPB 5J6HA 4OTXL 1FCCA 3MRFA 1CGTA 2JB6B 2VLRE 4MA3A 2YBRB 3KPQB 4APQD 4S1QH 1WBZA 1MJJB 2ERJC 1D5BB 4GRMB 3TP4A 3QNXA 2Z31C 1A14H 4AG4H 4MD0B 1D7FA 3FN3A 5BO1L 3S4SB 2DICA 3PP4H 5D72L 2IANB 1V7ML 2FEEL 1QFWM 4P2OD 4L9DA 4PJFF 3MNVB 2OI9B 4I3GA 1NCWL 3GMQB 1CGVA 3K2UH 3T3PE 5F9WB 1XF3B 1HQRA 2DM3A 2APBA 2D03L 1T1ZA 5GRVL 3VFRB 4JZJC 4XZUA 1NAMA 3VGFA 1A1NB 5FHBL 2AJ3B 1N0LA 1HE7A 2RFXB 4KWUA 1H3XA 1TZIB 5E56A 2FJGB 3NVQA 4YHOL 5HGBB 1I8LA 1PKQB 2FL5B 4AQ1B 2F15A 2Q7YB 1K8DA 1VACA 1I9JL 2BHZA 2FHBA 3VA2C 3E6HB 1RJLB 1XGPB 4WY7L 1OW0C 1CGSH 2A9MH 2JB6A 4XMPH 3S34L 3S35H 1G7HB 4EKXA 1NDMA 3CSYA 4ZPVB 1BQSA 2OTWA 1LGVA 3MA7B 3KPSA 3G5YA 4YHZH 3BQUB 3JWNC 4X9BA 4KZEH 5F3BA 5IB1A 4X80H 3QXAA 4NIKB 2BJML 4QXGH 4DKEH 5K9QI 2YD2A 4X4XA 1A0QH 2DMBA 4XNXL 3S7GA 4NRZA 1PDKA 1CE1L 2NNAB 2IANA 4O58L 4IIQB 1C16B 4ONOA 4ZD3L 4HWBH 1Q72H 3VMPA 4Z18A 3TF7C 2PO6A 1FVDB 1OB1B 5EOQH 3IKCB 4ELME 3NTCL 2E9WA 3MXWH 4JREC 1HXMB 2APXA 2AJSL 5KVMC 1YPZE 2VDOL 3VFRA 5TDOA 4YXLL 5I1IH 4GKZB 3C60C 4WHTB 3MGTB 5FO7B 2AJ3A 4JO4L 5I1KH 1CFQB 2J3SA 1WCBA 5EBMB 4JRXD 3NCCB 4R7NA 4ALAL 1NJ9B 4AEHL 1JYVA 2X1OA 3RVVD 2QSQA 3OG4B 3ULVL 3P77B 3UYOD 3BW9B 2DJ4A 1RJLA 1A7QH 1MJ8L 3IGAB 1BGXH 3AREC 4PTTB 1CDCA 2GJZA 4RCAA 2J8UE 4F2MB 5IFAH 3EAKA 2QQNH 3QDGA 1ZT7A 1KG0A 1DLHA 4NKDB 1KSRA 5GS0L 2DKUA 4O00A 3S5LG 4PFEA 5C0RL 5E2VL 3WS3B 3CU1A 1NSNL 2VDKH 3PGFH 4JRXE 2WW8A 1UZ8B 3QXDB 2B2XL 1RK1B 3QHFH 1OB1A 3DBXA 5ESAB 1GC1C 5DQDL 3IKCA 4WFFD 1CL7H 3QUMA 1X44A 5F7KC 2MOVA 4EQ2A 1H8OA 4JG0L 5J8OA 3C2AL 1GYAA 1IKNC 3NOIA 5C3LD 2AJVL 1QR1A 1WWBX 2DDQL 1YEDA 3Q2CA 1A64A 4GKZA 1INEL 2MHAA 4GLRI 1MJUL 2CIKA 3MGTA 4Z9KB 3IDJB 2BOBA 4KFZC 2Z92A 3DUHA 4Y1AA 5FO9B 5FV2A 1WZLA 5LAXB 2FGZA 4UTBL 4QRQA 3KGRA 4NN5B 5D7LD 1G9NC 5CD3A 5AD0A 3BAEL 2AK1L 4DEPB 3BJLA 2FJHA 5DUPL 5F70A 3ULVF 4I77H 5KANI 1EMTH 5IVXA 1M71B 2WBJD 4WFFE 1UGNA 4GRWB 4IDJL 1S7QA 5F89B 5I15L 4RAUA 5IESH 2O5YH 5DEFB 4NKDA 2AEIT 5LBSH 5JMOC 1RZJH 2FX7L 4MNHA 4OD2B 5HD8C 2DQCL 4TQEH 1WFNA 1AE6L 5D7LE 4JLRB 4WUKL 2QBWA 3FFCB 4WW2F 1XCQA 3S37X 2P8LB 5BJTA 3QSKB 5EZIL 3IFOA 3MLVL 2APFA 5DD1L 2OQJA 3FQUB 5TH2B 2CJUL 3NFNB 4NN6B 5DLMH 5CEXA 4ZFOL 4HWEH 3JWDL 4X6FB 5EC1A 3LN4B 4MJ6B 4LPVA 4LFHD 4YHKH 5EIVA 5L2KD 5FO9A 4I0KA 2D7QA 5FEBA 4WHYH 3O3AA 1QQDA 2EDJA 3MFFA 3UO1H 4N0RA 1A6VH 1JF5A 5D7JB 5HYQA 2P5EA 3IFLL 4JO2H 3QUYB 1AXTH 2FRGP 2VXTL 4XCCH 4EXPX 4QTHB 3OPZL 5DD3H 5L6YH 5J9PA 4Z7VA 3NACH 4K8RL 5DK2A 4F57H 4HWNA 5F89A 4NZRH 3KS0H 4PB0L 4U1SB 3WL9B 5ABDE 4YHPB 2Q8BL 3D5OF 4KJQC 1PLGH 2YUZA 3WO4B 4LSUL 5T3XH 1QPPA 5L2KE 5HGHB 1FNAA 4X99A 4A2LA 4ODSH 1DUZA 1AKJA 3WS6A 3H9HA 4M6MH 4PV8B 2FEDC 1HH9B 1H3PH 2VXSH 4OQTH 1UG9A 2QTEA 4QHUB 5TH2A 1HCVA 3J7HA 3V5KA 2VC2H 4H0HB 3ZKND 1PG7L 3MLWH 2XWBA 4XMKH 4HHAA 3P4LA 2P44B 4PRHB 4V2BA 5IHUL 3ARFB 3KLSA 1NGQL 3HPJB 1XT5A 5E5MB 4UNVA 1JP5A 1MCWW 2J6EH 4NDMA 2A77L 1NBVH 1L6ZA 4Y8DC 3VFOA 4EN3C 3IFNH 3SEPA 4KK8C 3A6CH 5ACLA 4GRLC 4MJIA 2EDTA 1OAUL 3TNMA 9CGTA 1DQJA 5LVEA 4Y4KA 3LQAC 2R29H 4NPYB 5DYOB 1DCLA 3JTTA 3GM8A 3DROB 1H5BB 5A2FA 1QRND 5D1XD 1LO4H 2XIDA 1C5CL 4I48A 5KSAC 1NFIB 3ZYZA 2O5ZL 2HT4D 4U1SA 1FV1B 1YC7A 4JFFA 4H1LG 4XHJD 2UZYB 5E5RB 3HAEB 3T09A 2ZUXA 3MMEA 3IDXL 4MB4A 1KJVA 5BS0A 3FMGL 4Y19B 3WUWB 1CL7I 4XCYA 1KFAL 1EAPA 2LTQB 3SGKA 4CU7A 5C2BH 1TQCC 1YQVH 3SE9H 3W0WD 4PV8A 4ONHB 1CFTA 2IQAB 1HH9A 3QAZC 5TDPB 4ORGB 2CRMA 4U1IB 1QRNE 1S3KL 3BFOA 3B3IB 1R5IB 3MJ8B 4LOUC 3U2SA 4EVNA 2ZCHL 4ENED 4X4YB 1DL7L 3RFZC 3QFJD 4P2YA 1A7RL 3RUGB 5FECB 3BUYA 1PSKL 1NLDH 2HKHH 5LKNA 3EDEA 4RGNE 3WSQL 4PY8J 2F74B 1ZT1A 2DI8A 3W0WE 2B0SH 1A1MB 1HHGB 5KOMC 5ID1B 3GMPB 4X7EC 1N59A 1OD9A 3P9MA 4B41A 1HXYA 3HS0A 2ZJSL 4JO3L 2JIXA 2P46B 3MRHB 2DLHA 4PBVC 1BX2A 4POZC 5BQ7B 5SWZD 1F02I 3IFPB 4NRXB 3D39A 1JE6A 2OL3A 4OF7A 3QFJE 4IEFB 5C0JB 3IDUA 4KU1A 4UV7L 3RHWK 3QQNA 3HZKA 2D31B 4KGLA 4HFWB 2HVKA 5ISZD 5ICYB 4FQXC 1J18A 3S5LA 3NCYS 5F8RC 3T0ED 4HC1L 43C9B 4C57C 1NUNB 4JANB 4XNMA 5TDPA 3CXHJ 1A1OB 1NLBL 3KPRB 1N0XL 3VXMD 1RU9H 5DSCB 3KYAA 1SVZA 2IWGA 2XKNB 4PJIA 5FYKU 2N7AA 1T7VA 5DS8B 2GHWB 3L95B 2OK0H 3KYKH 5GRXG 2EYRA 5SWZE 4P2RB 3MRQB 3MCLH 1D9KB 1I75A 1L7IL 3PG2A 3QDJD 3I50H 3PDOB 3RBGA 3SGDH 3BE1L 3QCTH 4WU5A 1SQ2N 2FLBT 5ISZE 5M7QA 1AGCB 4M9PA 3T3PF 5I1EL 3PV6B 2EXWC 3VH8G 3L5XL 2OTPA 3T0EE 3L7EB 2DTML 1FIGL 3RWEB 2ARJQ 1NFDB 5I30L 1HI6A 3VGEA 1H15A 1A7OH 5KZCD 3PGCA 1FNGA 4JY6A 3FHAA 3VXME 4U1MB 4GMSL 1U3HD 1S78D 2E3VA 5BQ7A 4CGTA 1YN6B 3S36L 3IXTB 3ES6A 5D5MA 1I7TA 1GGYA 1J8HD 1CLZH 2P8MB 4ZOAA 3TCXA 3QDJE 4HAFA 4U6YB 1U92B 5K9JL 3V0AC 1HYSC 1JHLH 3NCEB 3P0YL 4NNXA 4CBPA 3T77B 3HR6A 4GW1B 1FL6B 4UIMB 2W60B 5AZEH 4S1RH 1AQDA 4ZTPH 1OWWA 4N9OB 3C6SA 3DGGB 3WNNA 1DN2A 3KPRA 4HZLA 3K8LA 1ZVSA 2IH3A 1OTSC 5JNYB 3ZLQC 2XPGA 5DS8A 1E4KA 3QIUC 2XN9D 4Z7VF 4ZO8A 4M1DL 5HY9A 1I8MA 4C59B 2C1OA 3LCYA 3RRQA 4HBCL 4MQXC 1YJDL 2X2YA 2BNRD 1SMAA 4PUBH 4LCUA 3GNML 2ICCA 2B7DT 4PGEB 5FKAA 4UILH 4KZDL 2C3GA 4KK9D 3B83A 3QXUA 2YD7A 2XQBH 3RWEA 4PJCE 3PQYB 4OV6F 2L4OA 2DRUA 4CVUA 3L5HA 2JJSA 3GHBL 3EJYC 3LD8C 4PJBA 5CZXC 5MEPB 5CINL 5I1JL 4HS3B 1MREL 2ESVB 3BH9A 3OAZH 4LEOA 3VRLE 3T3ME 5I66A 4XH2B 3I9GL 2NX5D 2NY4D 1T1XB 2XN9E 1NL0L 1PZ5A 1HKLH 2CK0L 4IRJC 4CU6A 3QH3B 4WIQA 2BNRE 3DRQB 1T66C 1KPUA 3T4YA 2G60H 1KEGL 3SGEH 5CBAB 1TZHA 4NNYA 2J8UF 3SDCC 4YHML 1IC4L 5T1DH 3HFML 3HZVA 5E03A 5JNYA 1MFCH 1MY7A 1ZAGA 3THML 5HGGS 4Q9RL 4KKNA 1EA9C 5KN5B 2SEBB 4OZ4B 5T1LD 1IAIH 2FR4A 3MLUL 3UTQA 1JYXA 1OTUC 2NX5E 1DBBH 5E8PB 2DWDA 1U9KA 4GFTB 5HDOA 4HFUL 1G9MH 3BRFA 3QG6B 5IF0B 3P2TA 4HUVA 3P9WB 3TJHD 4PGEA 4JG1L 3H0TA 1LNUB 4M1GL 5FA4B 5C6TL 5I8OL 1WK0A 3K4AA 1ZHKB 4OLWL 3DV6B 3LAFA 1OP3K 1YECL 2VRAA 5EDXA 4FXKB 4UB0H 4X6BA 5F9OH 4ONFH 2ESVA 5CSZB 3TN0C 2VAAB 2XZAH 3BI9X 4PLJD 4U05A 5BZDA 3JWOL 5AG9A 4N1HB 1MQKH 5IEKB 5HBBA 4ZS7L 4YIQA 2YD8A 4LP5A 3LIZL 4JN2B 4P23D 1FAKT 2MQCA 1VDGA 4F7EB 3SGJA 2QADD 4I2XB 1YMMB 2FYYB 3KG5A 1QYGL 4JRYB 1S9YA 5J3HC 2GUOB 1NGXB 3SKMA 3UBXI 3ZE0E 1MI5D 5E6IA 1I1YB 1XGRB 5FK9A 5KN5A 1IC5L 4R0LA 5LGJA 5F21B 3LVEA 3P40A 2AEQH 4OLUH 1NGZB 3V79C 4HXBH 4PRIA 4KVNL 3O0RH 1FIEA 2CO7B 4F9LA 1YY9C 5B8CC 5C08A 4JFZL 1KGCD 2NY2B 3C5JB 5JW5B 5IG7B 1HKFA 3KPNB 1JZ2A 2WK2A 4XCNA 5IB5B 5DHVA 5E99H 1YC8A 4AEFA 1KIUA 1U8LB 4BFIB 1YA5A 3EZ8A 1SVCP 4I8DA 3EZJB 3B8SA 1MI5E 5HHOA 4K9EL 3INUH 1X5YA 2NLJA 1CGUA 3DVNA 1U0QA 4L3EA 4PJIF 4LAQH 3OHXB 2YHGA 2XFXA 1UM4H 3LRSA 5CEYA 2IAMD 4JDVB 1QSZA 1UXSB 4OZHB 1KGCE 3VWJC 1WZ1L 4ZS6D 1YEJL 25C8L 3IB4A 2NW3B 1J8HA 4NC0B 1OT1A 2EDOA 1NGXA 4HKZA 5TPWL 1H3TA 2BXYA 1MRCL 4OGZA 5E6ZA 5I16A 1FE8L 2KQNA 4H88H 4L5FL 3AMKA 2EE3A 4GKSB 3MRBB 5CSBA 2C3VA 5D5MF 2X4NA 1LQSR 2UWEE 3JV0A 3MBXH 3MRGA 4WFED 4P4RB 3FZUC 4DOHE 2W9DL 3ARYA 2D9CA 3BT2L 4RZCA 1WEJL 5BVPL 2BNQA 2BNRA 3CFKB 3BGMA 3QZWB 5IQ7L 3VH8A 5K9QG 3RP1A 2DB8A 2ENYA 2YS4A 2ATPB 4X8XA 5H35B 2MSPA 3P11L 3O2DL 4KC3B 3JSSA 3SGEI 4OV5A 2Z9TA 1WLHA 4PRPB 5FO8A 5ITFA 3TT3H 3EYFB 4Y16A 1SEQL 2O26U 4XNYH 3N1QC 4MAUH 2P49B 4U6VH 1I3VA 4WFEE 3NMEA 1UC6A 3GJFB 3L5WB 3B43A 2RAMA 4WI9A 4GW5A 1WIUA 4P2QD 4N0FA 1I3GH 1IAII 2AJZA 5EO0B 3V2AR 2ATKA 4KPHL 1ZLUH 5D8JH 1ND0B 3T1FA 1MHCA 2NY5H 4NWTH 4FABH 4YFLI 1QLRA 1EHAA 1WT5C 4JFDA 2GTZB 3FT4A 3RWFA 4PJBF 1JGUH 2AJUH 4OGAD 4U0RC 2O61B 3C5ZD 2VE6B 3EO9H 1TJGL 3IU4L 2MKWA 3O8XA 5GS2D 4E42A 4XNQB 4GKSA 2PR4L 3VWKB 4FNLH 4XWOD 3L3KB 4HMDA 3TO4B 2G5BB 4OLZH 2OR8A 4WUUB 3TH4T 4MS8D 1AI1L 2ADFL 3BP4B 2Y1VA 2C26A 4L9LB 5EU3B 4P2QE 3LV3B 1MPAH 1OAQH 1UM6H 4GUPA 1TTGA 1Z5LB 1PEZA 2VZVA 4XP9L 3H2WA 3OXSB 3HUJE 1CXIA 4JFEA 3OKEB 1TTFA 3GMOA 4G43B 4AM0B 3LMJL 4L1HA 4PJ7E 4WV1C 2GITA 5EC2B 4JDTH 3EYFA 3VFMB 1A2YB 3L1OH 1ZLWH 4LKCB 2QEJA 2F54B 1QNZL 5J6GA 4IS6B 3DXAD 2EDRA 1EHLL 4OZIE 4XPTL 3QR2A 5IUSA 1B0GA 3QEGL 5CD5D 4MCZA 4MJ5A 4RMQA 5D93B 1ZGLB 1OCWL 4N1EA 1IBGH 1HNGA 1F58L 5L7XL 1RIVH 5BXFA 3PWPD 5DTFA 3PWNB 3ABZA 15C8H 1G7QA 5DJCB 1OHQA 3VE0A 1YNTA 2VE6A 3TJEL 1EV2E 1V5JA 2X7LB 2JCCE 1J7VR 4LPXA 4DGYH 4LCIH 4ZUWB 3HMXH 5SWQA 2YPLB 4ESKA 5B3NA 3DXAE 3ZTNL 5LGKA 2VQ1B 5EU3A 2HJLA 1MJ7H 2IFFL 2NR6C 3E3QE 1KIQA 2AJXH 3ALPA 4JE4B 3PWPE 3MOAL 2BHUA 3ARDC 1JN6A 3WNKA 3I84A 3OF6A 4L4JA 4NJAH 1BZ7A 1P69B 5E08L 3R1GH 3VFVB 1IGTA 1KN2H 2YUXA 3QIWC 2W38A 3QBTB 2X89D 1LP9A 1IC7L 3G6JB 3RVUC 1G7LB 4LHQB 4HJ0D 1BBDH 3O3BB 4XCFH 4Y4HA 4PG2C 2LU7A 3JV6B 2QSVA 4I0PB 3WDHA 3NA9L 1OP5K 1BFVH 1ZTXH 2ZUYA 3KVQA 1MWAA 2CDEA 5C0DB 1F8TL 3ARVA 2PNDA 3HE6D 1VKXB 1LEGB 2I25N 3D9AL 3OKDB 4QHMB 1CFNA 4DW2H 3QEHB 3FO0H 1E4WH 4HPYL 5D2LA 1ZEAL 4Z77A 1LO0H 1AD9A 3FO9A 4ZUSA 2YSSA 1J5OH 4ZXBA 4RIRA 3RWGB 5GRJH 3S97C 2ENSA 1JTPA 3GSVA 4D0CB 3SCMD 2RCSH 3L3IA 1P53A 1KT2A 1T3FB 2VXQH 5LG1A 2HLFD 4K3GA 5D96C 3MV9D 3UXFA 1VFAA 1FZKA 5E0QA 3VGAB 2FCBA 4DQOL 1P7QD 3SOBL 4EJ1C 4M7KH 3O3EB 1WZMA 5JA8B 3WFZA 2WANA 3PGDA 4P3WA 3O2VH 1BD2D 4U6XB 1AXSA 3RGVB 3T3MF 4KRPB 1G7LA 2A1WL 2ZKHL 4G6AC 2VLJA 5DURD 1RZIB 2NY3B 4WCYL 2N7BA 1RUQH 5IW1A 1X4XA 1SYSB 3TFKC 4XC1L 3QDMD 2ILLA 1UJ3A 4I0PA 5D2NC 3QO1B 3QHZH 4WWKC 1NBYA 2E8ZA 1MAML 3IAGC 1BIHA 3MV9E 5C0DA 4AT6B 3TNNB 3C8HA 4OCWL 2OLDA 5E9DD 2I9LB 3PHOA 1I8KA 1LO2H 1PVHA 3FOLB 1BD2E 3EYUH 4G7YH 1IFHL 2XNAA 1JGDB 3CX5J 1EFXB 3PXHA 4TSBL 2Q3ZA 1C08A 3BH8A 3IDYB 1CGYA 2EDFA 5B39G 1H3GA 5IBLC 2C3WA 1XF5A 5D1ZC 4CNIA 2X4UB 3MJ7B 4U1LA 2PYFB 3NIGE 3VXTB 3BO8B 4YPJA 3QDME 3BPOC 3V8OA 3B5HA 1Z6JT 1EO8L 1BJ1J 2X9WA 4YHYC 1S9XA 3CFEB 3DSNA 3DMMC 3UPRA 3JUZA 4NHUA 3REVB 2X4RA 3Q5OA 2BSSA 3HRZA 3U0TB 5E9DE 1CN4A 1IGCL 1YEKH 1T0MB 4IMKC 4RGMB 4RAVB 5ICZA 3L3GB 3ZT5A 1HSBA 3CMOH 5IMLA 3O6MH 2VDML 1FGVL 4NQCD 3SQOL 4KMQA 4WNQA 1OY3B 3V8CA 5I1GL 3W81A 1GXEA 1G7IA 2G75A 2IADB 3QRGL 4HJGB 3M1BB 4NBXB 5TQ2H 5I1HL 5DVOA 5I1CL 4KKAC 4LKXB 4G8EA 4U7MA 4XB8A 4NT6B 3CDCA 2FDBP 4AT6A 1G6RL 2AI0L 1QO3B 5TDNB 5A1AA 3W9DB 1CG9A 1EBAA 4X9FA 2Z31D 3OB0K 2C5DC 2BDNL 1M7IA 5EUKA 4WO4A 1JGDA 1CLYL 2GK0A 2YA2A 1KCRH 5E2WH 3W9EB 5D7KD 3LKQB 3TYGH 3F7YB 5F3HA 4HJJL 4R4BA 5IVZB 3MV8D 3MJ7A 1S7RA 2K7QA 4HF5H 1O5DT 2YKLL 4NQCE 2NZ9D 3VD4A 3QUZC 3ORJA 4Y5XC 4ZFOB 3B6SB 1P2CB 2X5PA 1CK0H 1XIWB 3HNVH 3CZJA 4D2NA 5D9SB 3CFEA 3BKML 4WHYG 3TIDB 3VW3L 5E00B 4JY4B 1F11A 2BVYA 1LK3L 3L3OA 3QIBC 2CD0A 3MYJA 4M48H 3X17A 3B4NA 4HIHA 4XBGB 1M7DA 2DQJL 5ITBH 5D7KE 5GJTH 3OR7B 3ZDYF 1A9BA 3MV8E 4QRSA 3WN5C 3UTTD 3QFDB 2V7HB 1BWMA 3X14B 2X9XA 4UQ2A 3D25A 4KHTH 1CF8H 4FQLH 1RAMA 1DANU 4OCRH 1U6AH 3NFPB 2F8OA 1DBAL 3G6DL 2Y5EA 1T89A 4WRLA 3VXQB 2DQHH 4HH9A 4FOMA 2J5LC 4YGVA 5E8EB 3OKOA 3O6FC 2VLKA 4GBXA 1E6OH 5GGTH 2HRLA 3FHQA 4JO1L 3D85B 3Q5TA 1CXHA 1LDPL 4LCCA 3T2OA 3SDXA 3B2VL 1F4XL 3I02A 2NY2C 3GSWB 5TE4H 4POYA 3IXAB 5CUSH 2UZIH 4YQXL 1LP9F 3QNZB 3VXUD 2Q76A 5GSRA 5I75B 3RTQA 3L3HA 2YA0A 4X8JA 5F96L 2UWEF 3L9RA 3B9AA 2K3TA 3U0WH 3UTTE 1KJMA 1P2CA 1KCVL 2HFTA 3FQTB 3GO1H 2YRZA 1MF2L 5I1LA 4KQ4L 4NP4H 3OAYK 4ETYA 3FN0H 1OGAB 4NO0B 3C60D 2EDKA 1FSKC 4BH8A 5GIRB 2Y7QB 3TPKA 1MQ8A 1ORQA 3V4PH 3S88L 4L8BB 1GGCL 5KSBA 1UJTA 4XBPB 1GOFA 4FZ8L 4NQED 4QNPE 3E1F1 1P4IH 3VXUE 1VGEL 4TUJA 1DSFH 5D2LF 3VI3E 4RRPG 1TPXC 3NPSC 4PJGB 3A67L 3DPBA 4EI5B 3U79A 4MNGE 5DVLA 3VXRB 2V2WB 2ITCA 3ARED 1I1FA 2Z8WC 2VLLA 3NIFE 4ZO6A 1EX0A 3QDAA 3STZB 3VXQA 4IOFD 3WFBL 1RMFL 2YWYA 2DQTL 3BXNA 4RA0C 1XR9A 5KSUB 4LPTA 3IXAA 4HWBA 2IBGA 3VG9B 4P3DA 4NQEE 4CJ0A 2DQIL 2QQLH 2VNCA 4UT6L 3DHMA 1M05A 4AENB 4J4PA 5C7XL 1HHHB 4O5LH 1RUAL 4GW4B 4X6CA 5A2LH 1B0WA 1RK0A 4FQ2H 1SHMA 3RVTD 1DLFL 2VISB 4F7MB 4PD4K 1UH2A 5EIIB 4XXDA 3VRIA 2EH7L 4LLUB 1MCOH 4PJ7F 1ZGLM 5J12C 1M7XA 2EDBA 4BZ1H 1DEEB 3G5VA 4DGIL 2HAZA 5CGMA 3WE6B 4XGZA 1XCTA 3IDGA 3RZCC 3FQWA 3GIZH 1WQVT 4XTRD 4OZIF 2A6DB 1NCTA 4K3EL 1Q9OA 1WJ3A 3STZA 4OLVH 5I19H 5L9DH 4NQCA 1IGYA 4L8CB 2NCMA 1JCKA 4PJAE 2CLVB 4ODXB 5L2JB 4G6JH 3S3SA 3GUTA 4TVPH 5HD8D 4K23H 4G6KH 5KSUA 4P2OB 1LEIB 5DMGC 2H3NA 2PXYB 3MLZL 3T65A 3X12B 2JCCF 3F7QA 2ZUVA 4JFXB 1S7UB 5ETUA 2CRYA 3MLXL 3AU1B 1U8HA 3OAUH 3U30B 4EQ3A 1GZQA 1FZMA 5B39A 3RDTC 1A22B 3F6IA 4MD4B 5SV4A 4B7LA 3ARBC 3KWWA 5FM8A 3MV8A 2ARJA 3UBXG 3HPLB 2CIIA 4F7MA 4P49A 1IGIL 2G2RB 3H9SD 1AHWC 1KLGB 2AXFB 3BGFC 1PD6A 3QB7C 4J1UB 3P4OB 5DQ9B 2GK2A 2RR3A 1KIPB 4BJLA 1JUFB 5T1MB 3QULA 3PABB 3RL1B 3UZEA 3SY0A 4ELMB 5E8NB 5HGAB 1CZ8H 4FP8H 1YPZB 3BIKB 2H26B 4LQFL 4LCWD 4XNZC 3V6ZB 4D3CL 2AXHA 3V6FB 1S5IH 3BD3A 3WLBA 5E8OA 4AMKH 5DEGA 1MCCA 4Y2DA 1ZV5A 1RD6A 4ZMAT 4OT1H 4ZAKC 1JPST 1N8ZB 1ZLSL 4WGVB 3U4EA 2B5IC 4OCYL 4PYGA 1T7ZA 1D6EA 3BVNB 5F6IC 4KJQD 1C5DB 3H9SE 2EE6A 4H0GA 3T08A 3P0GB 1I7ZB 5E7FA 3GMNA 1KTLA 2B4CH 4JVWA 1YDPA 1QFUH 5DD0L 2UZXB 5K9KB 5C0GB 2H32B 3VGGA 1ZANH 3BEWB 4UV4L 2FEDD 3L7FA 2VH5L 4TOYL 2J8UB 2LABA 4JN1H 5I74C 2X9YA 3CK0L 1HHKB 3BHBA 4XP4L 4LCWE 4X7SL 1BOGB 3RBSA 2UUDH 4HGWA 3ETBF 5JUEH 2D0FA 3U36A 4OD1L 4R26L 1GGBH 4NYLB 4JRXB 4QT5B 1Q0XL 3MLYL 5BV7H 4EN3D 4HWZB 4DFHA 1IT9L 3CPLB 4C56A 4GRLD 3MCG1 5GGRB 5HGAA 3FO1A 3FFDA 3D87B 3TVMC 1JV5B 4PJ9D 1HIMH 4EI6B 2WM0A 3V6FA 1LEKB 3SDXF 1FNSL 4RISL 2VWEC 4M62L 2A6IA 4U1JA 1GIGL 1TNMA 5DRZB 1T0NA 5KSAD 3IJHA 4PTUB 2UYLA 4NQEA 4B50A 5TFSH 4X7TA 3RIFK 1VSCA 5MEND 2AP2A 1N5YL 5CJ8A 1UZ6E 4W4NA 4FQHA 1IAKA 3P0VH 2WAHA 3IJSB 3PP3K 3PXJA 4HIIA 4XVSL 4QXWA 5FCUL 3HZYA 2A38A 4OF8A 3KR3L 1FP5A 1ADQL 4YHLH 5DUML 5EO9B 2V5MA 1MLBA 1NMBL 4S1SH 5DMKA 2FX8H 1EEZB 1YYLH 3O41B 1CXKA 2XYCA 3RY6C 4OQTA 4JY5H 3H6JA 3MR9B 3H3PH 4M6AA 1NEUA 3FB5A 1CFVL 2R2BB 4LOUD 5GGUA 4IRSD 5D7LB 3EGSA 1D5IH 4P3CL 4KK6C 3K8MA 4NBZB 2IG2L 5MENE 1DDHB 1HYRC 4N8CH 1IEAA 3NIGF 2HWZH 4RFEA 3BWAA 2WBJB 3F5WB 3HNSH 2KL6A 5D6DA 5C09D 5IJKC 1NCCH 4HZAA 2Q86B 4XVTL 1P7KB 2VJXA 2GTWB 4RRPA 4KY1L 4L4VD 3MLSL 4POZD 4KQ3L 1N2RB 12E8H 3KYMA 4X6CF 3JVGC 4MJ4A 5DRNA 4PG9B 1K8IB 1JPSH 5DC4B 4CMHC 3A6OA 4QF1A 4KK5C 5BVJB 3ZSSA 5CLWA 1QBML 4IMLA 4HK0B 4X9IA 3WIHH 1KB5A 5C6PB 3M07A 3HLAA 5C09E 3ECBB 1FH5H 5L2KB 1MFNA 4WW2C 5D7IE 1S7VB 4WTWA 5DUBB 2EDEA 5HDLA 1S8DB 2M8XA 4L4VE 3BP6B 1HINH 2CMRH 2YOCA 5CAYB 3VCLB 3MRJA 3IVKB 2YEZA 4FFVC 4X6DE 1U8KA 3K46A 5C0BA 1KB9K 1NKOA 2VKXA 4JFPA 5DFVC 2C4FU 3X13B 1WF5A 3MCKA 4YPGA 4JQIL 1RZJL 3ILQC 4KI1A 4XAWH 2E27H 2EE9A 2JB5L 3WKNA 4AIOA 2ZUSA 5IEHB 5IR1B 4KTEL 3WCYA 5IT2H 1A3RH 2HH0L 1DR9A 3CX2A 3HMWH 2I60H 3T2NH 4DTGL 3SBWA 2NY0C 1QFWI 3UPCA 2HYMA 5C0NC 5IBTL 2NXZD 4TUKL 4NN7C 1IM9D 3TLRA 4I1NB 3LS5H 4L8SA 2VDQL 3TPUB 4F15B 3P9LB 1NC4A 4UQ3B 3W39A 5IB2B 3MUGB 1K9TA 4D0DB 4U6TA 2FHCA 1OTSD 4CADB 5TGBA 1CE6B 4GQ9L 1QVOB 3QIUD 5BMFH 1KJ3H 1MRFL 1W0VB 3DI2B 1TNNA 3GSRA 4EIZC 1S7XB 5CCKL 4OZGE 2X4SA 2QSCL 3GIVA 3MV7D 1D5XB 3CH8A 4Q6IA 4ZOBA 1JGEA 4FFWC 4PJHA 2P43B 3H7BA 4QY8A 1PG7W 1KCLA 3X3GH 4PJEA 1JNHA 3GEWB 4KRNA 1QRNB 5D1XB 1BF2A 3GKWL 4O2CA 3TM6A 4ZUVB 2BY3A 5DT1H 2EKJA 4G7VH 3V6OA 1U8QB 2P24B 2HP4A 3EJYD 3FQRA 4K71C 5CZXD 3G08B 2HFFB 4F58L 1T20B 1J8KA 4RGNB 3U4AA 3PUCA 4CKVX 4PJ9A 3D48R 4TTDD 1OD7A 4QNPF 2PO6C 3W0WB 6FABL 1T1WB 4QEGA 4FZEH 3KJ6H 1EZVY 3MV7E 4LSTL 4IRJD 1QSED 1RSFA 1FG2B 4R97C 1T66D 2PCPA 3WFCH 1WICA 4Z78A 3F7PC 5EU5A 4DUWA 3O2WL 1GC1L 4YAQB 3VFGH 3SDCD 4JFYB 1U8JA 5HJ3B 2I5YH 4D0DA 3QFJB 5JIIA 2F58L 2Y25A 3MFGB 1S9VA 4NO3A 4JEGB 5DJ6A 2Q6WA 5DVMA 5FOBB 1IKFH 1ACZA 1A6UH 1GPOH 2YD9A 1OTUD 1S9WA 5E2TL 1G9NL 3CXHK 4ZDHB 4OCXL 3ZMRA 2BP3A 3RWJB 1K5NB 1QSEE 3HC4H 3QO0B 5T3ZH 3GSNL 4U31A 1GRWA 4GSDH 4HUUB 4NNPH 4YR6A 3UC0H 5SWZB 4XP6H 4M6OL 1AGEA 1Y6NR 3T8XB 1M4KA 3NCYP 2BNUA 5C0CB 3FB7B 3C8DA 1IZJA 2AGJH 5SWSD 4B53A 1DBJH 1NCUA 2F19H 2FZ3A 2XOTA 4R7DB 4PRAB 3T0EB 1GGIL 4Y5YC 3CVHL 3H42L 3QEUA 4XVUC 3GMRA 1RJZB 4YDVB 3ARGA 3NH7H 2J8OA 3QDHA 4NZTH 3VXMB 1R3KB 1GGUA 3C8KB 2YD4A 2ICEB 2R1XA 4YAQA 3ZSTA 1QZ1A 3FRUA 5IIEA 2VLMD 4JFYA 5J3HD 4OLYH 4O51B 4P46A 4PJAF 1RFDL 3QDJB 4GMTH 1GVIA 3VXNA 5SWSE 4NUJB 1GJIA 4MNQD 1CQKA 1K2DB 4TUOB 5J57B 2COQA 3BZDA 4NFBA 3EIFA 2J7LA 4ZDHA 2EXYC 3DX7A 5KZCB 4TRPL 1MUJB 3V4VL 3PL6D 1OSPH 3MJ9H 1U3HB 1H3UA 3WUZA 2VLME 3HI6H 1HEZB 2X40A 3PWJB 4LARL 3TEUA 1XEDA 2F8VA 3SDDB 3N9GH 3L6FA 5FDWB 1CFBA 4GAGL 4XX1E 3I2CL 3C9NA 4APQC 5T5FH 4R96B 1R5VB 3QQ3A 3MV11 5ENWB 3V52H 5IB4B 4R7DA 4Y4FD 1YMHA 4MNQE 4M61A 3WYRA 4PJCB 5LWYL 2EIZA 5EU7C 4YDVA 3ZKQD 1EGJL 1UB6A 4G8GA 2YMXH 1LD9A 2E7LA 1BEYH 4QWWC 3R8BB 4K7PX 4LVEA 3VWJD 3Q6FB 4EUPB 3RKPA 4P4KA 1RJYB 5SX5K 4WI6A 2XN9B 4JQXA 4HIXL 2FB4H 5FB8A 3S8WA 2VMFA 4ZFZB 4Z0BL 1KBGH 3LKSB 5DFWH 1LE9B 2AV7B 3QPXH 3BPNB 5HPMA 1OT2A 1H3VA 3L3DA 4TUOA 3O4LD 2AEWA 4FFZH 4EBQL 3LQAL 2DYPD 4ODTH 1CWVA 1L9MA 4LNRB 1INQA 3FZUD 5IV2B 5D1QA 1FNEA 2Z91A 4K3DH 4U7SA 1WAAE 2NX5B 2NY4B 4HUWA 3PWJA 4PB9L 4NKMA 2HG5A 1CICA 5MERB 5HDQL 3FB6B 4QRPA 3WS6C 4ZYKA 4XBEL 1F3JA 2LQRA 4MA1C 4U1GB 1TJIL 1NCBL 2A73B 2Q8AL 3MBEA 3O4LE 5JPNB 4IOIB 1F4YL 2XACC 1BVKB 4JJ5B 1VESA 1DQQA 3AS2A 5HHPA 3DRTB 4UINH 4E41D 1C7SA 1HHJA 2EE2A 4DN3H 3I3DA 3U1SL 4PJEF 2AEPL 1U8OA 4R6UA 1FFRA 3B5GA 5T1LB 4OLUL 1UZ6F 1QSEA 4P5KB 5JW4M 2VO5A 4KUCF 4OI9A 1R0AH 4NOFA 2D9QB 3WHXA 5DZOA 5J1AA 4Y4KC 3S37L 1WTGT 3ZE1F 3CVIL 5HHXH 3PDDA 4MDIA 1DJSA 3MRDA 5CJOH 3QCVH 3MRRA 4UTAH 5JA9A 5IOPB 4E41E 4RNRB 3BDXA 1AH1A 4OM1L 5IV2A 1JFQL 5M94B 2UY7A 1X5XA 1OAYL 1N6QH 4PGBA 3L3JB 5BZWA 1R3HA 3FONA 4NWUH 1IE5A 1T2QH 4CVXA 3SGKC 3FB6A 1I8IA 3AS1A 5JOPD 4OQ1A 4BSWA 4P23B 1P9MA 4TSAL 5E94A 1MFAL 3WHE1 2QADB 5BCAA 1AQKL 1FZJA 3FRPG 1UVQA 1BVKA 1MY5A 3TA3A 1RZFH 2VABA 4JHZA 2DLFH 5HHNA 1QA9B 3KPOA 4K94C 4ODBD 1MI5B 5ELIA 1A6ZB 5E2UL 4X98B 1T0PB 4EDWH 2YUVA 1QTYT 4P5KA 1J1PH 4NRYA 4HKBB 5EU6A 1PX4A 1RULL 1XMWA 4J8RB 1VGKA 3GM0A 3MODL 5JOPE 2VDRH 3BKCH 4WTXA 3DSFL 4KKBC 3VFUB 2D7NA 1G6RB 1KPVB 4CJ1A 3M45A 4PJDA 4PY8I 1OGTA 4YLQT 2BVQA 4RFOL 5EU4A 2WQRA 4R4FH 5AYQA 3G5XB 5DR5H 1VFBA 5D7IF 2A83A 1IMHC 1EEUA 5HI3C 3L3JA 2NR6D 1F6AB 5F6HI 4GRWH 5DRWB 2CDFA 3HG1D 2BSTA 2UWEB 2XTLA 1SBSH 2IAMB 4YBLB 4NFCA 1MLCB 3ARDD 3VU2A 5GS1B 4NCDA 4DOHB 5I0ZA 3WD5H 2DQUL 4MA8L 1ZA3B 3U9PL 2CUHA 2EH8L 2OJZL 3PJSA 4ZPTA 4NFDA 4P9HH 4HUKB 4LSQL 3QIWD 4YFLF 3IDMB 1FFPA 1KCSH 1MEXH 3IETB 3HI1A 3O9WA 3RVUD 1WBXA 1UQSB 4WU7A 5F1NA 5LQBH 2BVOB 1A7PH 3VD7A 2R8SL 1T22B 4HKJB 3KHQA 4GS7B 4KGJA 1L7TL 4ONGL 3HG1E 3N85L 1KXVC 1IQDB 2JKXA 5HHVH 3DO7A 4PREB 4YUEL 3DX6B 3UAJD 1RHFA 4YZFE 5I8EA 2IQ9H 1JZ5A 4MAYA 4NKIL 3BP5B 1MFBH 1A4JB 1MCPL 5IKCB 2ED8A 4JFOB 2ZUQC 1FVCA 3HMXA 1KTDA 2NPLX 1Q8MA 4F7TB 2DD8H 3TCLB 3ARRA 4G9FA 1DQLL 1CBVH 1CT8B 4LSDA 4CDGC 1T1YB 1Q9KB 2ICWA 1JPFA 1XZ0A 2V9RA 1Z9OA 3PWVA 4RA3A 1D5MA 2R1YB 3DTXA 3SDAA 1XGQB 4M7LH 4OD3H 3F8UB 3BMVA 1JHKH 5HYFA 5EZLB 4BYHA 3TESA 3S96A 1AD0B 3I75A 3EOAB 1R3LA 4P2QB 5EORL 4E0RA 4J6RL 4OJFH