5EZLB

Crystal structure of fab of parasite invasion inhibitory antibody c1 - monoclinic form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
SIVMTQTPKFLLVSAGDRITITCKASQSVRNDVAWYQQKPGQSPKLLIYFASNRYTGVPDRFTGSGSGTDFTFTISTVQAEDLAVYFCQQGYTSPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab c12
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezlB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezlB01
2GJ6B 4WO4A 3D87B 4JG1H 4AEFA 5IFHH 1UH4A 1XGPA 3WFHB 5DSCB 2EXWD 4X8XA 2OP4L 3M17B 1DN0B 3D39E 4WFHD 5DLML 5EBLB 2UVEA 1YY9C 2FHCA 4YFLI 3ARDB 3TH2T 5EC2A 5BMFH 1UYWH 1V8HA 3FMGL 4OM0L 5D1ZC 5EZJA 2GJ6E 3UBXB 5JTWA 2DKSA 2EDBA 1JCKA 4Y19D 2H32H 1A3QA 4LCUA 4LLUB 2Y4SA 1XF5A 1MQKL 4PBXA 1GGBL 2RCSH 2VXUL 5D7LA 2HJFA 5EO0A 2VRAA 2X9WA 3WBDA 4BFBD 1BFOA 3GZKA 2JJUA 5LVEA 3SDDC 5BO1L 2VLJA 4ODTL 1DSFH 1GGIH 1E28B 1MF2L 2VQTA 4QRUB 3SE4C 3VFUB 1IC7L 3FJTA 2FBJL 2NY3D 1AC0A 1A47A 1GRWA 1BQLL 2DICA 3IGAA 4I48A 3T0EC 3JWOL 3CFIC 1C12B 4LCIL 1N5AB 4JHBA 3LVEA 3ULVL 4UUJA 2HFGH 5K9KB 1KJVA 1WAAF 4XCYB 5GJTH 3D0LA 2YUWA 1MCFA 3TFKC 3MRNB 4EBQL 1KPUA 1JHKH 1OTTD 1SEBA 2YWYA 1XR8B 2W1NA 3CDGA 2MJWA 3IETA 5DVMA 5F9WB 3SQOL 1G9MH 4UT6L 1U92B 5L8KB 5GISL 1INEL 1A5FL 1P7QA 2GFBA 3IFPB 2ARWA 3QUZC 4PRHE 3TWCH 4JRYD 5IJVA 1BQUA 3HRZA 3C09C 1S5IL 2DDQL 4R6UA 1Z5LB 5GS0H 3FAWA 4MA3A 4Z78B 5EA0H 4OCSH 1NKOA 3QFJD 4L8DA 2VISA 3IXAA 4O5LH 5DC9B 3ZE2E 1DBAH 1P69B 4PG2A 3VFVB 2WIMA 5D7JC 4MNQD 2Z92B 1S7SA 2B4CH 3HTLX 5MENA 4NKMB 3O0RH 4X0KA 3IFLL 3EDEA 2F8OA 4CVWA 3NIDE 4XP9L 2J6EA 4K55A 1L0QA 4HMDA 3S37H 3HKFA 1CIDA 2HKFH 1S7UB 1X9QA 4GAYB 5HGAB 3U6RB 1LK2A 3VXME 3EOTL 3OG4B 4LNVA 3MZTA 1G6RH 4OUUB 5C70A 5EDXA 5CEXB 1CXHA 25C8L 2R8SL 2CDFA 3RAJL 5TQ2L 4DK6A 3X12B 1ZVYA 3CCHA 5ISZB 3S3JA 4FFWD 4K8RD 2ZCLH 5DD5H 3PL6B 5INCA 1U91B 5J1AB 5ILTH 4MAUH 1JGEB 5FYJD 2XXCB 1DQML 3WUWA 2FGZA 5CFHA 1B6DA 3C9NB 4PV9A 4PJ9B 4XCFH 4GFTB 5ISZE 4GXVH 2XQYK 2YRLA 1RUKL 2J1KA 4NQCA 2MHAA 5JZ7D 2R0KL 5CBAA 5TDOA 1NCTA 1WCBA 2NZ9D 3QUXA 1Q9WA 5EOQH 5D2LB 3KPMB 5KS9F 5GSRA 4YHLH 5E5MA 4FA8A 1KENL 1IEBA 1LP9B 4KHXL 3RL2B 1CFSA 3BKCL 1EO7A 3OKDB 2W0FB 4PP2A 1PDKA 1OD9A 5D2LE 1KUMA 1VGKA 3FO2B 1QBAA 4UTAL 2R4RL 4Y2DA 4KRPD 5DS8B 5C2BL 1VFUA 3FHAA 4ZXBC 3BKYL 2MNUA 2QR0B 4R7DA 4C56D 3HZYA 4RFOL 3BQUC 1J1OH 2E9WA 1FJ1B 1T66C 2BVQB 2GSGA 4S2SA 5I16A 3TM6A 3WNKA 3RIFF 3ZMRA 3DVGA 2B5IB 2DI9A 2A74B 5E6IC 5ACLA 2X40A 3KPRB 4YFDB 3GK8L 4ZUUB 4LOUC 5I2IB 1YEFL 1NBVH 4XNZB 1OGAB 3U0PB 4HXBL 5JOEA 1I9IL 5E00B 3ARBB 2EH8L 3HE6A 5T3XE 4MB4A 4MVBD 3UO1H 4HD9A 4N9GB 5E08L 1W0WB 4P5KA 4MJ2A 1BFTA 4BQ6A 3QG7H 3KPRE 1KPRB 3MA7A 5ESAA 5F89A 1OGAE 4PPTA 3GSOB 3AREB 5I1GL 5A16A 5HD8D 1HH9A 4M48L 1EBPA 1WBZB 1EEYB 5KN5B 3QIWC 4QRSB 2RQ8A 4MJ5A 4HGKC 3OXSA 4ZFOL 5DC4B 1D5MA 3RIAK 2HG5B 3QZWA 4S1SH 1HWHB 4LLWB 4B7IA 1RK0A 2X41A 5D1QA 3RVXD 4MD4A 4EQ2A 2M26A 1MLBA 3SBWC 3JV0A 5DHVH 4FABL 3DV6B 3DYPA 3O2DH 3OB0K 4FG6C 4R4NC 1UZ6F 5JOPD 1SMOA 3MLVH 2P8LB 3QAZB 2H3NB 4ONHA 3V6OC 1OP3K 2ICEA 3LKNA 3LZFH 3TVMB 1HI6B 1MCQA 5C09E 2WBKA 2AJZA 1MCNA 1GHFH 1FE8L 2V5RA 4NJAL 4YHKL 4JPWL 1PW3A 5T1KA 5FHAH 1IZJA 3U9UB 3U4EB 4PJ5E 1ZXQA 4IMLA 2JJTC 2CJUH 5FYLD 3AY4C 5H8DA 2I27N 4HJGB 1AGDB 1NGXA 2H45A 1VADB 5TDNB 3TCXA 1BJMA 3BJLA 3RL1B 3IDXL 4GQ9H 1OAKH 4JN2B 2AI0H 4GRLB 3QIBC 3S37X 4DGVH 4NKDB 3LQAL 4F8TA 4KKCD 5GGQH 5I1JL 3TT1L 2XKNA 1HILB 1W8NA 4NRYA 1LO0L 3DTXA 1Q9KA 2DQEL 2DYPB 4IMKC 4S1QH 4MMZC 4BZ2H 3NIFF 3V6ZB 3X13A 5HI5D 1AD9B 3RQ3A 4HK0A 4KTEL 3FAXA 5C8JB 1EA9C 3EGSB 4JKWA 1ZGLA 4DN3L 4ZD3L 1EHXA 2EKSB 3MCLH 5DVLA 1E6JL 2X4PA 3L5HA 4L29A 4YHOH 4L4TD 4WFFD 2OK0H 1IGYA 4P5TA 3ARRA 4HX1B 2BJML 3BIBX 3RWCA 3OJ2C 3N1FC 3GSQB 1KACB 4DK3A 5M94B 3R06A 5AD0B 1KCLA 4O02H 2DQUH 4NRXA 1XZ0B 2QKIA 1UJTA 5TE4H 4QXGL 1T89C 3FT2A 5F6IB 1UB6A 1CLYL 1IGTB 1IAIH 2CDGB 3U0TB 3ARFA 4HS6A 4S1DD 3MFFA 5TPWL 4DGYL 1BBDH 1NEZG 3PNWB 2WBWB 1EEUA 4MD5B 1G7LA 2X70A 1MY5A 2F74A 3BW9B 4Q6YA 4L3AA 4KQ4L 5CJXA 1J7VR 4K2UL 3ZL4L 3FB7B 4G9FA 4G43B 4ODWA 4PJ7B 3ALXA 1IAKA 1LD9A 2GIYA 3P4OA 4HLJA 4MB5A 5KJRL 2AGJH 1KULA 4CVZB 1Q0XH 2DM3A 3RVTD 1DQLH 2HJLB 3OKKB 5HGHA 3VFWA 4KGLA 4JQIL 4Q0XH 5LGHL 2OTUA 4PJ7E 1WITA 3N1PC 1AE6H 2IPUK 2LVCA 2C4XA 1T2QL 3BZFA 3OR7B 3BWAB 4BQ8A 2J8UE 4TQEL 4OI7A 3X3GH 1PZ5A 5FGRA 2O93L 1HKLH 3TC9A 1DANT 3PHOA 1YEDA 2JJSC 4ZFOA 5DURB 1KF9B 1DN2A 2X42A 2V7NA 5KANI 1FBIL 2YD1A 4UIKL 3L3GB 3MMEA 3D0VB 5JPMA 7CGTA 2V5MA 2VWEE 1OVZA 2PYFA 1LO5B 3ZDXE 1NC4A 5F3HB 1JP5A 1P1ZA 4WHDA 4KVCH 2BSTB 4R2GD 4HJJL 5CZVL 4CW1A 4B41A 3DUUB 3TV3L 3H7LA 3MRIA 4TULH 2VLKA 2ZSWB 4NHCL 2W38A 1C5BL 4HCRL 3K80A 1S9WB 2PO6D 2WWMD 4XP5H 1EV2E 4CU7A 3MNZA 1HH6A 1MWAL 1NAML 1RHHA 1I7ZA 1NDMB 2OJEB 5AUMB 3IF1B 1RAMA 3C5ZA 5IF0B 4J3OC 3TN0D 3G9AB 4MJIE 1T83A 5F1OB 1HYRC 3BDXA 1JBJA 3NCYS 5I8OH 3QDME 4JRXA 4Y4HD 5GRXG 5BS0D 3VWJD 3VFTB 4I0KA 3ZTJH 5GGRB 4MLIA 5C6TL 3ARDC 3PWNA 1FFPB 3S36H 4WFGD 3T2NH 4OZIF 1GPOH 4DGIL 1XGUB 3O11B 4LCCB 3KS0J 4YPGA 5HVFB 3CPLA 4P48A 2GEEA 4JKLA 2HJKA 4JDTH 2JJWA 4CBPA 3QDHA 1ZHKB 4PTUA 3LKQA 2ATKA 3ILQD 3A67L 1K4CB 3UJIL 4F7TA 1ZVHA 4U6XB 4WUUB 3C8KB 5BRZA 4XB8A 3WEXB 4HKBB 4PG2C 1E4JA 5E1AB 3RVVC 4R0LB 1CGXA 2YPVL 1JUFB 1OWRM 2EYTA 1KG0B 4OAWB 4OFYD 4WI4A 5I1KL 4NM4H 4LPTA 3RU8H 4WUUE 5F9JA 3V5HA 1E4XH 1UJ3C 5B39G 5KSBA 4OD3L 3N50A 1Q9LB 2GJZA 1JYXA 1TJGH 2M2DA 2R2HA 3ARZA 4J4PD 5INDA 4OZGF 4UILL 6FABH 1K8DA 4KU1A 1QLEL 5IBLC 3KPSA 4U3CA 3H9SB 5FO9A 1D6EB 5IHBA 3MRMB 3HS0B 4CJ1A 1QSEB 2D7NA 1JWMA 3IVKA 1F6AB 1OP9A 3VGDA 3Q5TA 1K8IB 1CXLA 4O2CB 2B8OT 5EU4B 2WWKT 4X6FA 5JXEC 1O7SA 4LSQH 4TNWF 4IDJH 5I17B 3J7HA 4LDLB 5EBWA 5IJKC 2X9YA 4ELKA 4PJFB 5C08A 3KR3L 1ZLWK 4B0MM 3HPLA 3REVA 1GCFA 2D31A 5DJ8B 4ISVB 5IIEB 5IFJA 3GSNB 2UYLA 2WV3A 1BFSA 4LK4A 4NBZB 5J11C 5DUPL 1FO0L 2PTUA 3DNKA 1GZQB 2I9TA 4U7SA 3RY6C 5KVGH 2YR3A 4JCLA 1EGJL 2YKLH 4R90H 4GMSH 2E5EA 4OZ4A 4PJFE 1HXMB 4XBEH 4Z8FH 2DJ4A 1KGCE 5C0JA 1INDH 1DFBH 2YD6A 4L4VE 1P4LB 2AP2A 3VFMA 5I1DB 1T0NA 4KKNA 5GS3A 1H15A 3G6JB 3PL6C 4XC3H 5J57B 1AIFB 4I18A 4BK4A 3MCKA 1J1PH 5ACZB 1JHLH 1U8NA 4YK4C 4TOYL 5ETUA 4WCYL 3TYFA 1CK0H 1NC2A 4KV5E 4PJ9C 3PP4H 3HI6H 4PJIF 5EU7C 3CVHL 3PWPB 4FXGA 1XIWD 5IB2A 4UINL 4JM2F 2ADJB 4KVNL 3VG0H 4Z7UB 4OM1H 1ZGLM 1TJIL 2DIBA 4YE4L 3SCMB 1P4IL 2A9ML 1A7NL 4RSVA 3Q6FA 3BFOA 4Z7VF 1MWAA 2GJJA 2NY6D 1NAMA 1IM3A 1EBAA 1LO3H 3K46A 3MXVH 2XZCH 5EUOA 4GXUM 1YC7A 3PWPE 3QUML 3HE6C 2GT9A 4F7MB 3ULVC 4XPTL 2R23A 4CVXB 3WE6A 3RA7H 4ZSOA 5E2VL 1DUZB 1ZT1B 1RULH 1UCTA 2JKXA 4LF3B 4YUEH 3GGWB 5E8NB 4G6AC 1AI1H 1Q72L 3W2DH 4HBQA 1XCQA 3UPRB 2HA1A 4KROB 5EORL 4JKPL 2V2WB 3MV9D 1AGFA 2XRAH 5ERWA 5FECB 1KCUH 5DJDB 3DECA 1QHOA 3HNVH 1E6OH 1PX4A 1F2XK 2H32B 3GMPB 3MNVB 3U7YL 4WJ5B 3FB5A 2YC1A 2B5IC 1UM6H 3FQNA 3STZA 4AQ1B 4FQXB 2CR6A 5I1IH 4K3EH 3BRFA 1WF5A 5TE6H 3ARBC 4MZ3A 2PW1B 3RGVD 3ZKMD 4KKAC 4LSVL 4YXHL 4RGND 3WLBB 3VRIB 3T4YB 1JYWA 4XPAL 1PG7H 1KT2B 2CRYA 1BFVL 5E8OB 5EU5A 4EN3A 5MEQA 1UACL 5DUBA 3AREC 4U1GC 2NLJA 3ZE1F 2R1WB 5F8RC 1BP3B 4CNIB 2X4UA 3UPCA 3REWB 4QOKD 1U95B 4Y19B 1IBGH 3F6LA 4JFFD 2NW2B 5EO9B 1MHPH 4HDIA 4M43L 2ESVD 3P4MA 4X7TB 3WFEL 1BD2D 4RMUA 3GMLB 1IM9B 5L0QB 3SDXF 3GNML 2ZUUA 4P5MB 43C9A 3VXUD 2YZ8A 4F3FA 3NN8B 3ZT7A 1KCVL 4Y19E 4C83B 3SGJA 4N5ED 4GG6A 3QAZC 3NFPB 2FWOA 4M3KB 5J6GA 2APBA 3LKPA 1KIPB 5DR5L 4G3YL 5DEGB 4QF1B 3CXDL 3L5JA 2FL5A 4HS3B 2CKBL 5CAYB 5J0BA 3C8HA 3DJ9A 2WW8A 1OP3H 1P53A 1CDGA 1EGJA 3UTQA 1LDPL 5EN2A 4TRPL 1JGUH 2FATL 1UENA 5D7IB 3MLXL 4JRYB 4BQBA 5JW3H 1W72L 4RGOH 5EOCH 2P1YA 3GSWB 3BRDA 4YHML 2F53B 3K4AA 1NFKA 2IH1B 3ELAT 4RISL 5DFWH 4HUXB 5GZND 3U2SB 1LEGA 1BM3L 3GJFA 5D7IE 4NJ9H 4QY8A 2VIRA 3U9PL 4JRYE 1VDGA 3I6GA 1A8JH 1QLFA 2HLFD 1DBKL 3AM8A 1GGCH 3TIEB 3CVHA 2EZ0D 5HVHC 2D0GA 4ELME 3HC0A 4PLOB 3HA0A 1IGFL 5HHNB 4DQOL 1ORSA 1QFWH 3QFJE 3SGKC 4ETQA 3HNTH 5CEYB 2OQJB 5BV7L 4Y16D 5GS1A 3CLEL 3MXWH 1NANH 2ADGB 3FN3A 2O5YH 5AWNL 2LAGB 4U1KA 2F54D 1ND0A 3LAFA 2M8XA 4MNHB 1A4KB 1YJDC 4P4KB 3TA3D 3QUMA 1AJ7L 1QBBA 3QI9A 1G6RA 2AXFA 4UV4H 1QYGH 2DLFL 5JDSA 5J9PB 3P40A 4GSDL 3GBLA 4MAYB 4TVSa 5BOPA 4N0RA 1KTDB 5IV2A 5F6HJ 5C0ND 1KCRH 2Y06H 3GBMH 1A0QH 1HXYA 3GI8L 3JWDC 1KJMB 4L9LA 2FEDC 4P2QD 5I9QB 1TVBB 3DRQA 4G8GD 1XF3A 5A2FA 4RA3A 4OSUH 5ABDE 1AH1A 4UT7L 1NGWA 5KAQF 3PWUB 3HE7C 5IMKA 1YMHA 3W9DB 5DMKA 4OZGA 3MOAH 4PJBE 2X4RA 5FYJE 5T33H 1ACYL 3UDWA 1RIHL 3SKUD 1C5CL 1IQWL 4X4YB 4XZUB 4HMEA 3K0WA 2UZYB 1IT9L 1UH3A 4CN4A 1VEPA 1F4WH 1FCGA 2EIZB 2EIDA 3ROLA 3Q3GB 3QCTL 4JFEB 3MBXL 3ALPA 4HUVB 4UDUA 3U4BL 2RJMA 1JPFB 1SY6H 3G5XB 4YDIH 2CDEB 5ID0B 2LU4A 1D6VL 5BJTA 1EXUB 2R4SL 4Y4KD 4R9HA 3UBXI 1G0YR 4KRPB 3MV7A 3H9HB 3ZDYE 1NCAH 4PRNA 4EDWH 5KAQG 1MCRA 5GGVY 1BJ1H 3F6IA 1T83C 1QVOB 5C0BD 2XWTB 3PQYB 4ZYKA 4LVOC 4X98A 3RX8A 3T0DA 1L7TH 1PG7X 1NFIA 3FFDB 4XNYL 5DK0B 4AIXA 4J6RL 1AGBB 1Y0LB 1K5NA 4P23A 1OCWH 3O4LB 5T5FL 3L9RB 1MRFH 4HWEL 2B1HL 1G7IA 2ZOLB 4G6JL 4ZPTA 3UBXG 4AK1A 2YPKB 5IGXH 3U7WH 3MJ7A 2EH7H 4NZUL 4GBXA 1SYSB 4JN1L 5BVPH 4PGEB 4CU6A 5IB3A 5D8JH 3ZE2F 3LIZH 5IUSA 4LRNL 1JZ4A 3LKRA 5IB5A 4YDKH 3ECBA 2Y23A 2Y7QA 2CKBA 4TVPD 2VXQL 2VDLH 3LDBC 3MREB 4G6KH 4JM2A 1UZ8B 1F13A 4M6AA 5FO7B 4L8BB 4N0YL 1J8HA 4WWKA 5DJAB 4K3DH 2OTWA 4HFWB 3WS3A 2ICWJ 2F15A 4YO0A 2ZUXA 4KI1A 2I5YL 2QSCH 4JAMA 2F5BL 4AQOA 3KNBA 4LCCC 5SWSB 2IALA 2I07A 1D9KA 2Y07H 4QTHB 3LN5B 4BZ1L 2JCCA 5D1XD 2R29H 1A6AA 3P9LB 4PJ8A 3WFDL 3HNSH 3G5VA 3MLZH 4M7LL 5AYQA 3GIZH 2PCPB 3OGCB 5EOTB 3VGHA 1T5WA 2G9HA 4OD2A 4KJPC 2G2RA 3GI9L 1FVCA 4HUWA 2AJSL 5BQ7B 1DE4A 2OLDA 3BMVA 5F3BA 5C1MB 5SWSE 4NKOA 3S7GA 5JOPE 4BFIA 1FYTA 4NC2B 3QNYB 5FB8A 2P4AB 5CS7A 1WZ1L 4XMPL 3OF6D 1Q8MA 4O2EA 1QR1B 4H26A 3SGDI 4LHQB 4G42B 1FL5B 1HQRB 3ME0A 1MFAL 3THML 5CD5C 1WZLA 4CMMB 1H8NA 1UWEH 2EDHA 2GAZB 1DDHB 4HHAA 5IMMB 3EOBB 4KXZH 5HHOD 4PP1C 5FYLE 4FP8L 3NH7L 4GRWE 1M7IA 1F97A 1BIIA 4X6EB 5DYOA 5HYSB 4HBCL 5HYQB 3GUTA 1J0YA 5DEFA 1BPVA 5D2LF 5EUKA 1WWAX 1PAMA 4KQ3H 5C0RL 3D9AL 1UM5L 2YSSA 5JLZA 3VCLA 2VLRA 3L3OB 2VO5A 3LRSA 1LP9F 4IRSB 1W0VB 5SX4I 3AFLA 5C2UB 4YDVB 4AY0A 1FL6A 3I50L 5I1AB 4RAUB 1JF1B 1G7HB 4L8SB 1IARB 5I1EH 5KG9A 4IOFC 4L4TB 1VCAA 2ZCHH 3BH9B 2P7TB 4FQHA 5ICZB 1SBSH 2HTLC 4H25B 4P9MH 4KDVA 5EZOL 2COQA 4M3JA 2GYSA 3OX8B 3QHZL 1JIBA 3MCG1 4L4TE 4WFFE 5C3LD 1YMMB 4M93B 4UZGA 3UC0H 3GDBA 3QXTA 3B2UD 4HGMA 1T1YB 3MUGA 3HG1A 1LEKB 1FLTX 4ONGH 4JRWA 5DZNA 3WS6C 3LH2L 1S7RA 4DVBA 4JGJA 3P0YH 2CPCA 1ZS8A 5CD3B 1I75A 4ZFFB 2A9NL 5F88B 4X7EC 1A6WL 1MQ8A 2ITDB 5CGYD 5I8EA 1NCCH 3H42L 1XGQB 1CL7H 3IDYB 2Q7YA 1NMBH 2CR3A 3KWWB 5C6WH 2FX9L 1C5DB 3CIQA 4IDJL 3VXRA 1X5LA 2R39A 3S96B 3SCMC 3PV7A 3ARSA 3LD8B 1JHTB 2X7LB 3MLYH 3KYOA 4DW2H 1YPZE 3MRHB 5EH1A 2VE6A 3O8XC 4J3SA 1JFQL 1MSPA 4WEMB 3FQRA 3MJ9L 3OKYA 3EFFA 3EO1B 2IBZY 2NTSP 3TJHC 1INQB 1KEGH 5GRUL 3L95A 3NA9H 5GJSH 4G5ZH 4X8JB 1JWSA 1FVEB 5AG9A 3TBTB 2P5WA 1FDLH 4NQUA 4WENB 2VXSL 1RY7B 4HG4K 2X4SB 5TDPA 3MRCB 4JB9L 4YWGH 4RNRB 4EXPX 2VDNH 1B2WL 5I18H 1D3CA 2EE3A 4R2GB 4P3DA 4M7JL 4XT1C 2DM7A 4MQXD 1PKQA 4NYLB 3DMMD 4M6ML 4YR6B 4M6OH 4OGYH 5CINL 5JHDB 4FQXC 2PO6B 3EYFA 3M45A 2O5ZL 1KIQA 4XGZA 3SGJC 2JIXB 1HCFX 3O6KH 2A6KA 3D39A 3SKMA 5DRZA 3SKOA 4YDLC 5B4MC 4E41D 4LBEA 5FGCB 3TN0B 4UQ3A 4YHPB 2IAND 2XQBL 3OJVC 5FGSA 4AM0B 4LFHD 4Q2ZB 5BS0B 3VWJB 4XTRC 3B3IA 3WFHA 1G7JA 1C7TA 3M17A 5HYJD 4FTVD 4HUMB 4QRPD 1F4XL 1NMCC 5I71B 4HC1L 3WNLA 5FGCE 3QDJD 1WBXA 2OSLB 5DJYB 1A2YA 2XTJD 2YD5A 5JMRA 1EAPB 2X1QA 5D7SH 1G9MC 5EPMA 5BS0E 4LQFH 3U79A 2D2OA 1DBML 3S35H 1LEIA 2GY7B 3IFOA 4P3CH 3EFDH 4HZLB 4WFGE 5I1HL 5T3XL 3CU1A 1IGCH 3BP6B 3SOBH 1KLUB 2C26A 1I1AB 5GS0C 4IIQA 1QLRA 4O4YL 1OSPH 4TNVF 2IBGA 3GBNH 1G1CA 3ULUH 3IRPX 5JQHC 1G84A 1ZHLB 4S11A 1ZLVH 3IFNL 3EYUH 3PWLB 1BQSA 3O9WD 2ARJQ 3EOYG 4QCIA 2QQKH 4X7SH 3BGMA 4ZFZB 1J5OH 4PRHA 1Z0MA 1A6VH 2XWBA 2OI9C 5L2KD 1YYML 3VXPA 4BKLB 1U92A 3UMTA 2IMNA 3MOQA 4OFIA 2A0LD 5GHWL 3TP4A 3QI9C 3LEXB 1HOCA 1T03L 5FIEA 3KDMB 3VXSB 1DQJA 1FV1B 2Z31A 4CGTA 4PJ7F 1D5BB 3CFKB 5KW9H 5DMJB 3DRTA 4OLUH 3LY6A 2BCKB 3S97C 1I1YA 4IEFB 3FQWA 3PXJA 4GJTB 5JQ6L 5IQ7L 3TT3H 3MODL 2R0WL 5L88L 4I3SH 4OV5A 1V7ML 3VXSE 1IAOA 1A6UH 1IC4H 3VXMA 5FA4B 5EC1B 3QIUA 4X9BA 3QCUL 2H6PB 4HIEA 5I8CB 3WV0A 1IKFL 4MX7B 3UTTD 4JPKH 4Q97A 2QQLL 2EYSB 3ZDXF 1BZ7A 2BVOA 1H3PH 1NH6A 4P4KC 3RWIB 5JNYB 1UWXH 5KOVC 1WEJH 5GRJL 2GITA 3SE9L 3VH8A 3VRJA 3MJ9A 4XVUD 5D6DC 1F90L 3FQUB 4FQIH 3RDTA 5DI8B 4KDWA 4LCYA 4RDQF 4MAYC 1MPAL 4N8CH 1RVFL 5J12C 1JZ5A 1ETZB 5ISZA 1XF2B 3QUYD 2HKHH 1U91A 5I9QC 1C7SA 4KMTL 4NSKA 3VGFA 3TIDA 2VDRL 5J06A 4LVHB 3WLWC 1FIGL 1XIWB 3GSRA 5F71A 1T21A 1XGYH 1NGQL 2LABA 4LEXL 4OGXH 5D6CB 5F1IB 4MZ2A 1MCIA 4B5EA 1C1EL 4F9LA 1T7ZA 3BP5B 2NY6B 4NPYA 4XXDB 3N9GL 4D9RD 4RDQG 5HGDB 1YEJH 3IDGB 1AP2A 5LCVL 3C2SA 4BA8A 1M6OA 2AK1H 2EDXA 1ZHNB 1KBGL 3HI1A 2F19H 4BSWA 1HHGB 5IFAH 1V5JA 4PLJD 5KZCB 2W0FA 4A6YL 2IADA 1DR9A 2YD8A 2NY5H 1AXTL 3FO2A 3R1GL 4F57H 1CLOL 3C5JB 2OS7A 4HC1A 5TE7L 5GQBA 4KKBD 3ZHLA 3MV9B 1HHIB 1T04A 1IAIM 4H5SA 5DD0L 3ZKXB 3O45B 1GIGL 1MI5A 3HMXL 1YN7B 5F7UA 4ZDHA 1KCKA 2CQVA 2BVQA 2ICWI 4UIMB 3CSGA 4ORGB 1H3TA 4U1NA 3V6FB 4AEHL 4HGWB 5IG7B 4OCRL 1D9KC 3MV9E 3I85A 3G04B 1AQDB 4PJ8C 4ZUWB 3CU7A 4ZUUA 3WIHL 3DUHA 3K2UH 3B9DA 5I2IA 3QEGL 4HKZA 4NIKB 1OP5H 3RGVB 4PJXB 1A9BA 3QO0A 4OKDA 1OTUD 2NXZD 4FQQA 4X5WA 1W0WA 2ZCKL 1IGIH 1BF8A 1L6ZA 4UT9L 4N1EA 5IVZB 5CP7A 1CICB 4M5ZL 1I1RA 3MLUH 1MNUL 1NGYB 4QOKB 2MPAH 1S8DB 1WTGT 3WHXB 4ONFH 1UXWB 2I25N 4L1HA 1R5IB 3UTSB 5T1MA 4OF0A 4JEGB 1Y6MR 1Q0YH 3I02B 1CFVH 5L7XL 4PJFF 5EIIB 1JE6A 3BHBA 4NM8L 5C09A 5HYEA 1AXIB 4OKVA 3U1SL 4QOKE 4UOJA 4EVNA 3ARPA 4JFFE 3VXNB 1W8OA 2BNQD 2F5AL 5DRNB 5F7NC 4M8QA 2NY0B 3UTSE 2ESVE 3MBEA 1BD2E 1MJUH 1NJ9B 4ODSL 1L0YA 4PJ5A 4R4BB 3T1FA 5JHLL 5JXAL 1JNNH 4KI5C 3OKEB 3BZDA 2DB8A 4P59H 3VW3H 1B88A 1Z2KA 2IJ0C 4ZOEA 4KV5F 3H7BB 2O26U 3BPLC 4BSVA 2IGFL 1U36A 1ZEAH 3G6JF 4LPUA 3X11A 3QJFB 4NHUA 4EKXA 2R56L 1KEMH 1YEIH 2PR4H 1FNEB 3QO1A 5TDNA 4BQCA 3GMNB 1II4E 4Q9RH 4KUZH 3CD4A 1FLRL 5C9JA 1HINH 3ARYA 3QXUA 1MH5B 4NN7C 4Y4FD 2O61B 3O3UN 3KJ4C 2QHRH 1IEAA 1HDMB 2FJFB 2N56A 4DAGL 3CFBA 3OB8A 3CFEB 1Z9MA 5DMIH 4GMTL 2WUBL 4NN5B 3VFSA 5HYFA 3KYMB 3ROOA 4GOSA 5DWUH 1T7XA 5D9SB 4PRBA 5F7WC 5CILH 4EXKA 2YXMA 1QEWB 3DO7A 2PYEA 4O2FA 2XWJB 3FOLB 4XX1E 4L8SC 2F54B 1R3IH 5BZDB 4OUOA 1QBLL 5DEZA 3TA3B 4L5FL 1F8TL 1FVDA 5I30L 5F96L 2QQQA 5J56B 1YQVL 2HT4C 3TZVC 4JQVC 1I9JH 3QJHB 1CCZA 4WW2B 4Y7MA 4DEPB 3BH8A 4JO2L 4UOW0 2WIIA 3EHBC 4PFEA 2HT3D 4V1DD 4A6YA 2F54E 2Z8RA 4PJHA 5IMOB 4LARH 2R0LL 3FO9B 4M93C 3MA9H 5CWSB 5MEOB 1AGEB 3PV6A 4P2QB 4WHYH 5DQ9A 1VSCA 3LKSB 3UPAA 1H3XA 3EYVB 4G8GB 1HIML 1RUMH 3V8OA 3WIFB 1RIVH 5T1LD 4RGMB 5E8PA 2Z8WC 4QRTB 1QZ1A 1S7QA 3FCTB 1B0RA 3KPPA 4PRAA 1JV5A 4P2QE 3SE8L 3AMKA 3GHEL 1M7DA 3IDYC 4G8GE 3GSVA 2NYYC 4JDVA 3RWEB 4R3SA 3IJHA 4ETYA 5I1EL 3ESVF 3EDDA 3EZJB 4PB9L 5IBTH 4LSUL 3PGFL 4NC0B 2J8UA 5CMAB 5LJYH 2IAMA 3LD8C 5ANMA 5KVMC 4DCQB 1SY6A 3JTTB 2CLZA 4GKSB 3MRRB 4Y4KB 4XNQB 2YPLA 1FZMA 4XB7A 3MC0A 3QHFH 2HFFA 3HCVB 2WINB 1CLZH 4GW5B 4OGAD 1EEQA 5C0BB 2FJGB 1W2KT 3A6OA 2NZIA 3MSPA 3OG6B 4QXWA 5F70A 2XYCA 4APQC 1ZA6B 1DBJH 3MTRA 4RMQA 4HLZH 5AZ2H 4K3GA 4PJAB 5GGUB 1SBBA 4UBDD 3MRPB 1VKXB 2ZUTA 1IFHL 1NUDA 2DL2A 5C0BE 3DGGB 3IRZA 1M71A 3DX7A 1S9YB 5I76A 2A6IA 3B8YA 1NGPL 2NY1D 1JN6B 4C59B 5F7EL 3LB6D 4PJAE 3INUH 5SWZD 1U3HA 1BX2B 1WZMA 4MJIA 5D7IF 1LO4H 4RQQA 1MJJB 1RZIA 3MZGB 4F33A 3BZEA 3QDMA 1FGNH 5E8EA 3FFCD 3KYKH 4IRJB 1H0DB 4DKFH 3GO1L 4M7ZC 3KPQB 2Q20A 1RIUL 2CLVB 2VDQL 4HW6A 3FN0L 5AUMA 4YBQC 3BIKA 1ZT4A 4FZEH 4JE4B 4XBGA 3Q48A 3SKNB 5IF0A 1WFTA 2HVJB 2ENYA 3V8CA 4WEBL 1OY3B 2BOBB 4RRPA 3C8DA 2FIKA 4D0DA 4XHJD 5IBUB 2R1XB 4TVPE 1FGVH 4MXWL 3S4SB 5I71C 5HSFA 3VWKD 4R4FH 2APXA 3L3KB 3RGHA 4XNUH 1JGVL 2IQ9H 2WQ8A 3ARGD 4MXQC 3KJ6H 4W6WB 4U0RB 2YS4A 1I7UA 3B43A 3O41B 4OQTH 3VFNA 1ZHKA 2AAVA 3FT4A 2CRIA 2Z31C 2PXYD 3P30H 4X4MA 1I1AC 3TNMB 4BM7A 5DF0A 4WUUA 3EJYD 2R0ZH 5F7LB 3H3PL 4ZO6A 3WEXA 1LNUA 1HQ4B 1RZJH 4N0CC 5E1AA 4HFUL 4KFZC 1IC5L 1FZOA 1OW0C 3NMEA 3OKMB 1JUFA 3EOAB 2W65A 3HI5H 1ZT7A 2QLVB 4JDZA 3QIUC 3QDGB 3EDJA 4RBPK 2BVUA 1YY9D 4FQCH 3CFDB 2BSSB 4G80B 1CDJA 4LLDB 4XNMA 5D1ZD 4K23H 2X89D 1Q1JL 4YNYB 2DWEB 5IM7B 4Z5RA 5HHOB 3L7EB 4U0QB 1YNLH 3DVIA 4PS4L 4QHUA 2D0HA 4I0CC 3RDTC 1FAIL 4WI7A 3MRBA 3SDDD 3L6FB 5FDYA 5FA3B 2D7PA 3QDAA 1OAUH 3T4AB 3F7QA 2XNAA 3LN9A 1P4BL 3ZDYF 1I3GL 5H2BB 1GSMA 2WWKO 4W4OA 3U46B 5HHOE 3MRMA 4GH7B 3GMMA 2I26N 4EDXA 1K3ZA 3SJVD 3T0ED 3V0WH 2BFVL 3DBXA 1ERNA 5F1NB 1ZA3A 3TFKD 4P3WA 2AJ3B 5A1AA 4H0HB 1EFXA 2WZPD 2VAAB 1TQBB 1CTNA 1I8LA 4PJCA 4M5YH 5I0ZA 2L7JA 5DJ8A 1SJHB 1A4JA 2W0KA 5ITFB 4L4VA 3F58H 3QUZD 1RUPL 4ZUVA 4CRPA 4ZQKB 1YC8A 2CIIA 2VZOA 3DURA 3D18A 4JFHD 1FZJA 1WVZA 4J1UA 5EZIL 1P4LA 5I1DA 2Q8AL 1F4AA 1JGDB 4RMTA 5D7JD 4DUXA 1CZ8L 1I9RH 4OIAA 3RVWC 2WM0A 4YIQA 1MCWW 2RBLA 1RZGB 2DQFB 3U48A 4TN9A 4X99A 2EKJA 4NP4H 5T1DL 2P24A 3P77B 1M4KA 2AABL 3PDOA 4PG9B 1TZIB 4XCEB 2ADJA 2G5RA 4ZUTA 5AAWA 4R7NB 3UJTL 4DN4L 1QFWM 1X5YA 4HH9B 4X5XB 1B90A 3PIQA 3TO4D 1TJHH 5ECJE 1HYSC 1HHJA 4WI2A 3CC5A 1IGJA 2AK4D 3D2UD 3C6LC 3G08A 3MGAA 4F7MA 4QYOB 2RR3A 1WTLA 4HT1L 3BXNA 1ZT1A 3FTGB 4XAWH 3HC3H 1CU4L 2XFXB 4K8RL 1YEEH 1CE6A 2FX8H 4OLWL 2DI8A 5FYJL 5C3TA 4G6MH 1TETL 2VZSA 4TUOA 1DQDL 4LKCA 3AAZA 2DQCH 4PBWD 2I9LB 1EO8L 1BZ9B 5J6HA 3DMMB 1X7QB 2GI7A 2Z9TA 3MRDB 5CZKA 3MNVA 3NZ8A 4U6YB 5KSUA 4R26L 5DQDL 5E5UB 3QULA 3B6SA 4XPGL 2P5ED 1N4XL 2I24N 1WC7A 1AD0B 1MLCB 5IW1B 1AFVH 2PTTB 4E41B 3MBEC 4O58H 1CDCA 1SYVA 4Z7WA 2FR4B 4KZEL 3PWVA 4F37F 1S7WA 2WNGA 1KTLB 2V5YA 1X5JA 5EOCJ 3HZVB 4N8PA 4PJDB 4ZXBD 5L6YH 1VHPA 2V5SA 4O00A 5HYJB 4FTVB 2NY4B 4QRPB 5GS2H 1CICC 1J11A 3BQUD 3QPQD 4E41E 3QDJB 3DGCR 4CNIA 1M1SA 2XTJB 2IANE 4ODBD 3REWA 2YBRB 4Y19A 1IAII 1ONQB 4JFPB 4FFZL 4P2CG 3L3HB 4O9HH 2DBLH 1ZWIA 4LEOA 4X7TA 4XH2B 7FABL 5JORB 2X1OA 4NN6C 2KKQA 5HYJE 4FTVE 4QRPE 1FPTH 5E6ID 3OJMB 3QDJE 3V5KB 1KPVA 4P5MA 1IAMA 2XTJE 3B5TA 4LSDA 3O4OB 2NY0C 4YC2B 4WNQA 5HYSG 1A7QL 4OIBA 3GM8A 1J1XL 1CR9H 5C86A 1DL7L 1TZHA 4G7VL 4LSPH 4PRID 3U82B 2AV1B 4GAJH 3WXVL 3WSQL 1J8KA 3CZFB 1EMTH 3V7AG 3QQ4A 4HIJA 1YY8B 2HH0L 2JLLA 3O6ML 4OZFH 2AJUL 4TUKH 2WBJB 5HHVL 5L2KB 2X4TA 1I3VA 5IKCB 1SJVA 1FL3B 4JO4H 3LQZB 4PREA 4I77H 3VFRA 4FG6D 1YPZF 4R4ND 4KK9C 1WWWX 1NLDH 2BMKA 2BSRB 4N5UA 4PY7A 5D71L 5L2KE 1KOAA 5DA4A 4ELMA 5EU6A 5F7DB 3X14B 3QFJA 5E99H 3FQTA 3VE0A 4QXUL 1HSBA 2FECI 5IHLB 2QEJA 3SY0B 4XPBL 3WCYA 4MNQA 4XBPB 3QT2A 1J18A 3OXRB 4KJYA 5C0AA 4POYA 1KXQE 1F58L 4OZHE 2IEPA 5HHNA 3LEVL 3UTTB 3TYGL 1RZ8B 1N2RB 5IVXA 4OF6A 3OL2A 2LAAA 1JK8A 4RMRA 1OAZH 4XP4L 4NKIH 2X4NA 3RNKB 5FYLL 1OAQH 4EQ3A 1BJ1J 1GC1L 3AXLA 3QIBD 4WW2C 3UTTE 3V4UH 4DEPC 4U7KA 3BAEL 2J4WH 3B5GA 4P2OD 1K2DB 2JB5L 3DX9A 1A6ZB 3NFSH 1S9XB 4HKJB 1DLFL 1T0MA 4MQ7B 1J10A 1SJEB 1BVLB 4IRZL 4D9QD 3RX7A 1KJMA 3QUYB 1VACA 4PJBA 2CIKA 2DI7A 1TVBA 2E6PA 4XPHL 4M02A 1R3HA 2W9DL 2AEPH 3HLAB 1KIRB 1T3FB 5C7XH 3BZ4A 3PWUA 3Q1SH 5KSAB 3IJSA 2VH5L 4LCWA 1OB1A 1P2CA 4Z77B 4P9HH 2MQ0A 1JPGA 1OQOA 4X4YA 4LSSL 4NDMA 1A3RH 4EUPH 3RTQB 2Y9RT 1EEZB 2HLAA 4G8IB 1MFEL 1U3HC 2XZAH 4S1RL 3W0WA 1RUAH 4GRMB 5H94A 1A7RH 4Q6IB 4AEEA 3WJJC 4OTXL 3EO9L 3E8UL 5EFIA 1E4XI 3OR6B 4JHAH 4Z76A 1MCPH 3KG5A 3QG6B 4JG0H 1OAXH 3U36B 4WW1A 4PV8A 5HHXH 3H9HA 3QXDA 3RNQB 3IJYA 4C56A 3W9EB 3N06B 1O0VA 3MJ8A 1JPTH 1YEKL 4E5XA 5DK0A 4PRPD 3UTOA 1V7NL 2BHZA 4LU5H 5EU3B 1ZANH 4Q74A 3H8NA 3N1MC 4PGCA 4ZOCA 2ZOLA 4JFZL 1BF2A 1I3RA 1MIML 3VXOB 3RZCB 1G7PA 1UWGH 3G6AB 3D1MC 1NMAH 1T1ZB 3ET9F 2NXZB 1SEQH 2HTKC 2JELL 4IRJC 3HZMB 1UKTA 1RU9H 3QRGL 4OD1L 3LHPH 3C60B 1CE1H 3DVNB 1MCWM 4S0TD 2X2YA 4HXAH 5FF6A 1V05A 3H9ZA 5C0IA 3K1DA 3MREA 1J86A 1NFDA 5EG6C 4X7FC 4L8BA 3SO3C 3I3BA 3A6CL 4HKXA 1BIHA 1R3LA 3GIVA 1P9MA 4YFEA 3GSUA 1DBJL 1JZ8A 4H88L 2C9AA 2R69H 3LN5A 4X6BB 2HVKB 1X5FA 4GAGH 4IHOB 3P9LA 2J2ZA 2Y5EA 5ICYB 3HMWL 2W60A 1N7ML 4BH7A 4MA1B 1MIEH 1KIUA 4P4RA 2BNRD 4XWGL 1CF8L 1XH3B 1NL0H 2BNQE 3BDYL 5F9OL 4HJ0C 1MCEA 1F3JB 3PGCB 2ZP0T 5DT1H 2W9EL 3BKJH 5SWQB 4HIIB 2V2XA 5B21A 5KVEH 4NUJA 3ARDD 1I8LC 1QBMH 1UVQB 1T22B 1M7XA 5IHZB 2E27H 4H8WH 1UEYA 3F7YB 4YX2L 1F4YL 5C07B 3SDCA 1IQDB 1NBZA 5JR1L 4AT6B 2IPKB 3TPUA 5K9OB 2J3SA 4RMVA 1A64A 2XQYG 1OM3L 4K7PY 4U1LB 5FXCH 2Q86A 4JFQA 3RVVD 2P8MB 3BSZH 3OGOE 5TGBB 4AYFA 5MEND 1ODAA 1EIBA 4NNXA 1YEHH 1Z3GL 3IDMA 1MFDH 4XCCL 1XCTA 5FK9B 3HRPA 4X6DB 4LRIA 4JFOA 4X9GA 4YDVA 1YNTB 2VL5A 3CSBA 3QFDA 2ZOKB 4WV1B 4L4TA 2C1OB 5JO5B 5CGMA 1TQBC 2GK2A 3KLAB 4X80L 3SKJH 4XMLH 2FJHB 3C6SB 5ICZA 4JANB 1ZTXL 4G8EB 2BY1A 2X1PA 3QR2A 4LHUD 1X4YA 1I8IB 1ZLSH 4B53A 5D2NA 2VR9A 5MP6H 3B2VH 4FQ2H 2FEEI 4FHBD 3O3DB 5IBLD 2KDGA 1DVFA 2IC2A 1BBJA 5B38A 1JRHL 1S9VB 4C55A 3X17A 2Y36L 3S88H 3QNZA 4V1DE 1BGXL 3P9WB 2BRRH 4XVTL 1BOGB 2C4FU 1C8PA 5IT2L 4PJXF 2Q6WA 1AQKH 3IU3B 4EZMA 5JXED 5L9DH 4MJ6B 3RIAF 1WFNA 2J6EH 2F58L 4JFYB 3FB8B 1RK1B 1R0AH 1F00I 3GM0A 3U7AA 1ZSDA 5GPRA 1YPZA 3W39B 5D72H 3WN5B 1GGYA 3BE1H 2I60H 1GXEA 4GS7C 2DM2A 3JV4A 1PD6A 4Q9CA 5GGVH 2K1MA 4F58L 4NO2B 1HNGA 3KXFB 3U83A 4E42B 3H9YA 4LASH 4XVSH 5IROC 4AENA 5E4EB 1L6XA 4OI8A 4F2MB 1DEEA 2ZWLT 1A22B 1D5IL 1INQA 3PL6D 4JPVH 2KL6A 1KLGB 4HUUA 1U8JA 4XP1L 4ODXB 3AVEA 3O6LL 3NACH 1FVEA 4OF8A 3MRJB 4NNPH 3TBTA 5BVJA 3SDYH 4PJ9D 3NVQA 3JTSB 1U8QA 4LP4A 4D0BB 5JUEL 2IWGA 5AG8A 4RNRA 1R3KA 1F4HA 1FHGA 1RJZA 4LAQH 3MNWB 2X9XA 1XGRB 4J8RB 1NUGA 4HWNA 2ITCA 1JTPA 2Z8SA 5DRXB 4CL7A 5BW7A 4I4WB 2AJYL 1T5XA 2PO6A 1QFWI 1I7TB 3HE6D 2OP4H 4WU5A 5IWLA 4N0UB 5DLMH 4QTIL 4P2RB 3ULUC 5DJ6B 5SWZE 5J7CC 2H9GA 4K71C 3FRPG 4OM0H 1A9EA 3FMGH 4HH8A 4XHQA 1VFBA 4JZNB 2EICA 4Y4HA 3KYNA 1HEZA 1XEDA 3FFCE 5BS0A 1MQKH 1GGBH 1H5BA 5B8CA 5CEZD 2VXUH 1MCJA 2YD2A 2NY4C 3K4DA 2FX7L 2Q76A 4P2RE 2VNCA 4U1MA 4R8WL 5BO1H 5LXGL 4ODTH 1CDIA 2D9CA 1MF2H 1QSFA 1MFCL 1IC7H 2FBJH 3VGAB 4MWFB 5FM5M 4ZS6C 3BN9C 1BQLH 4MDIA 1EFQA 2DD8L 3JWOH 1L0XA 4KK8C 1MHHB 1MVUB 3UZEA 4LCIH 4UNUA 3ULVH 2HAZA 3B83A 2Y5TB 3FT3A 4IJ3B 3RUGA 3V9FA 3BGFC 3ARBD 3E2HB 4UV7L 5MERA 1DANU 4WW2F 1EAJA 4EBQH 5CCKL 4KKAD 1QG3A 5IOPA 3AROA 2W0LA 2DQHL 1A6TB 3SQOH 4QHNA 2AQ3A 3CFJA 4OFYA 4YAQA 3IDJB 3KPOB 4UT6H 5GISH 1INEH 1A5FH 1U8MA 3ARED 4PRDA 4XPFL 4LGPB 1UB5A 3HB3C 4NWTL 2WBJC 1KJ3L 1S5IH 2DDQH 3GB7A 2K7PA 3JUZA 3OKOA 5FYKD 2AV7B 3STLB 4BKLA 5CJ8A 1ED3B 1VPOL 2A6DB 2Y72A 3VJ6B 3LEXA 3P0VL 3SDDB 1FV1A 1OSZB 3DETC 2NY2C 5GGRY 2GUOA 3ULSB 2XACC 3CFKA 4AH2B 4QRQB 3IFLH 3MV8A 5I15L 1GL4B 1FNGB 3B9KA 5GGTL 3MACL 3SJVB 3T0EB 4XP9H 4UTBL 1EVTC 3O3EB 4XXCA 5I1LB 1WBYB 1AXSB 1I7RB 2BC4B 1RD6A 3EOTH 5JA9A 3DHJA 4POZD 4NQEB 1U8OA 3T3PE 4PY8I 1CFNB 25C8H 3SJVE 3T0EE 2R8SH 3F5WB 3GJFK 3RAJH 4JJ5B 5TQ2H 4Y5VA 4QRRA 4KRMB 5HDBF 3BEVB 1K6QL 2NZ9C 2IPUG 4PJAF 4F7CA 3QUZB 3BVNB 3C09B 2Z4QA 1FORL 2A77L 4HWZB 1DQMH 1FH5L 5J8OA 1AKJA 5GRVL 4J3TA 2YK1L 1FG2B 2A6JA 1P5VA 4BUHA 4UQ2A 3KPLB 4AMKL 2YD9A 1F6FB 1RUKH 4URTB 1XF2A 2ARJB 3BD4A 5F8QC 3ZHKA 2NY5C 2R0KH 1D5ZB 3CH1B 4HIXL 3DARA 4YGVB 5IP4A 1S78C 1EJ6A 4XCNB 4K94L 3UZVB 4WDIB 2IG2L 4M1DL 5KSAC 4QGYA 4CJ0A 2NX5B 3O2WL 1XIWA 4G9FD 3TH3T 4HPYL 1GAFL 1KENH 4KHXH 2JB6A 1N3NA 2IQAB 2BOCB 4OZIE 4TUJA 3BKCH 1SJXA 2OR9L 3BP5A 3RY4A 4LKXA 3BP4B 1HHKB 3NZHL 4UTAH 2R4RH 4U49A 4ODHL 2X4QA 3IDGA 5C92A 2E3VA 3D2UB 5C2BH 4EI5B 3MGTA 3QNXA 2G5BB 1LILA 3BKYH 4FOMA 12E8L 3DROA 1ZHNA 4RFOH 5GSVB 4D0CB 2FEDD 4YDJA 1GH7A 3EYOA 1C08A 3RWGB 2XN9A 4HIHB 2VDOL 2YA2A 5E2TL 3F62A 2Z91B 8FABB 2AK4E 4BYHA 4HF5L 4KXZI 3MV9A 3PHQB 1YEGL 3QXAB 3D25B 3HE7D 4M7KL 4L3EB 3GK8H 1UXSA 1YEFH 1FYHB 4OLYL 1P9MC 4HXBH 5IBUG 1I9IH 4JHZA 2EH8H 4H1LB 5DRWB 3S4SG 3SPVB 3K1KC 5DFVC 2OL3B 4QLRA 4I3GA 3NCJL 3IB4A 5E08H 2AJXL 3G04A 4YLQT 4OCWL 1AQDA 1H8SA 3RZCC 3IKCB 4UU9A 5I1GH 1N59B 1PQZA 4M48H 1F45A 3TO2A 5DHYA 5T3ZD 2VQ1B 4LPWA 5JA8B 3C60C 2P5EE 4ZXBB 1KN4L 1UQSB 1CGVA 3BQUB 5DURD 3FOMB 4ZTOL 5ADPL 3QEUA 4NQXB 4FABH 4DKEL 1NGYA 3TLRA 4OZFB 5FM5O 4JFFA 2HMIC 2ZG3A 1WIOA 1QSVA 4H20L 2ESVA 43CAB 1BD2A 3SE3C 1ITBB 4YGAB 3SDCC 5F1SA 5E6IB 5GGTA 4Z7QF 3VXUA 3WD5L 1MOEA 4DUWA 3FRUA 2FLBT 3BP7B 1FE8H 1A7OL 1H3VA 4NJAH 3TCLB 4YHKH 4JPWH 4HS8L 4K7FB 5DRNA 2EDQA 1KLFA 4MA1C 5HJ3A 4U1IB 1NJ9A 3FRPA 2W59A 4PRIB 4U3HA 3T8XA 3HUJB 1R5WB 1JTOA 4KAQL 4L1DA 3IDXH 4DKAA 4TVPL 3QIWB 4YXKL 5H37H 3LQAH 4MDJB 1NLBL 2NNAB 1U8IB 4M61A 4PJIE 3TT1H 5I1JH 3IAPA 4PRIE 3K4ZA 3DYOA 3WFCL 1LO0H 2DF3A 3WHE0 1FN4A 3MPCA 2DQEH 3OBAA 2AXGB 5DJ0A 1DBBL 3HAEG 5D2NC 4KTEH 3DUSB 1U8HA 1MCOL 3VGGA 1TMCB 4PJGB 1G7MB 1DVFC 1UCBL 3KPSD 4DN3H 4KJPD 4ZD3H 2C7UA 2BXYA 3P9MB 5DHXB 1E6JH 4YBLB 5IB4A 2Q3ZA 2DWDA 1IL1A 2WLZA 1KC5L 2BJMH 3F7VA 3ZT5A 4ZTPL 3G5ZB 4PJGE 1TLKA 3V6OE 3E6FA 4R97C 1GJIA 4Y16A 5B22A 2VITA 5HPMA 4WI6A 3L3IA 3TBYB 3MLTB 3ARXA 3TBVB 5A3IC 2HFEB 4LLYA 4QXGH 1LE9B 5CD5D 3KAAA 4Y8DC 1CLYH 3P4NA 1VFAA 1Y18A 3IDIB 5IW6A 3KGRA 4PP1D 5HHPA 5TPWH 2YN3A 3V4PL 4DGYH 2IBZX 5FOBA 4GXUN 3MRGB 2GSIA 4KQ4H 3RI5K 4K2UH 3H9SD 5MEOA 2PKDA 3ZL4H 3MO1B 4P2QA 1QSED 2GHWB 4YBHA 3G5YA 4OLVL 4YH6A 1DZBA 4W4NA 1U3ZA 5E2UL 1S3KL 1DLHA 5DUML 3WIFA 5KJRH 4EEEA 3ES6B 3HZKA 4D9QE 4TSAL 3QEHB 2FO4B 1A1NB 1E4WL 3DYMA 2IFFL 1J0ZA 1QO3B 1PY9A 5ID1B 3T3ME 1N64L 2XPGB 4PJDF 4JQIH 5LGHH 2HTLD 5D70L 1MHEB 3JV6B 4FZ8L 4EUPA 5F97E 4I13B 1T2QH 2UWEB 4NRZA 4DZBB 5DJXB 4TQEH 5CMAA 2P8PB 4NQVA 2VABB 4DVRL 2WWMC 3ZHDA 5IWLC 4GKSA 1KXTB 3QQ3B 1FBIH 3MRRA 3GJEA 4Y4KA 2CD0A 1MHCB 4UIKH 1E27A 2DLEA 2WINA 3J8F7 5SV3A 2FJGA 2FIRT 5JDJA 3LMJL 2UWEE 5ESQA 2FH8A 1P7KB 3PUCA 3CVIL 3EYSL 5HDOA 5C0GA 4RIRA 3DIFB 4CKVX 4HJJH 5CZVH 4NZTL 4PRPB 3TV3H 3WL9B 5GGSB 5BZWA 2ORBL 2J8OA 4NHCH 3UP1A 1QQDA 4HCRH 1C5BH 3PWPD 3KLDA 3DGGA 4M6NL 4B50A 1MWAH 3ZLQC 1NAMH 5JPNB 5HI3C 3SCMD 4HZAA 1YECL 1YDPB 4PRPE 5TF1L 5KTEL 5DQJA 1WISA 3LN4A 4BK5A 3O8XD 3HN3A 2APWA 4RWYL 1H0DA 1OT2A 1L9NA 1HSAB 3HPJB 3IDNA 3VD5A 3KPQA 2CLVA 3TJHD 1XGTA 5C6TH 5JW5B 3B8SA 4PUBL 2BVEA 3BD3A 1TVHA 1XGPB 4OZHF 1RZJC 1ZK9A 4DGIH 1FAKT 3P73A 3V7MA 3KPNA 1MCCA 4PJEA 4I3RL 5EC2B 2DM4A 3I2CL 5EZJB 3A6BH 4W81A 1U8PA 3A67H 4LCUB 3UJIH 3L3JA 3C5SB 4M62L 1CVRA 2Y6SC 2HJFB 5D1XA 4LMQE 5CHNA 3D85A 1BFOB 4WU7A 4XNXL 4U33A 3O41A 2OZ4L 2BDNL 2YPVH 1B0GA 4UAOB 4FQXD 1XT5A 4FXKA 3CJJA 4ZS7L 2FBOJ 3B9KC 5I1KH 3E2HC 1F2QA 4IOIA 3EJZC 3IGAB 3MLSL 1MRDL 2BNRB 4I48B 2NTFA 2LVEA 5B4MD 4WY7L 4XXCC 5FAAA 4YFLF 3ZSSA 4OD3H 3UCRA 3EBAA 4NCDA 2P45B 2SEBA 4W6XB 4AJ0A 3D3VA 1K3IA 4UUJB 1KJVB 5JMOC 3D0LB 3OKMA 3HC4L 3MLWL 3OF6A 1KPUB 5HXMA 3T2QA 4UILH 2BNRE 3CDGB 3IETB 5FFLA 1QLEH 4OFKA 1JI2A 5I66A 4NNYA 2XG4A 1P7QB 1F3DH 2GFBB 4Z95L 2QHLA 3VFOA 1CIUA 5IJVB 1F42A 3HRZB 1IM9D 4GKOA 32C2A 5AZEL 4JPIA 4LLMA 1MFBL 4NFCA 3AU1A 5GS0D 3SGEH 5HHMB 1QRKA 4L8DB 2VISB 3IXAB 2D03L 3S3SA 5DC0A 4X4XA 1S7SB 2VZTA 3KR3H 2VSDA 5MENB 5IB1A 4X0KB 5DDHA 1KB5L 3VD9A 4D8PA 5DUPH 1FO0H 1UJ3B 1EGJH 4RAVA 2ZPKL 5MENE 4LHUB 1V3LA 5CUSL 1MREL 3L1OL 3L5WA 3HAEA 1N0XL 4OCNC 4UB0L 5CIPB 5LAXA 2CDFB 3QI9D 5F44A 4QT5A 4JZJA 2OMNA 4ODUA 3QPXL 3D69A 2F53D 1KN2L 4M00A 3GJFH 2AW2A 3CCHB 4TOYH 4GKNA 4WCYH 1TQCC 4QXTB 1BQHA 5INCB 5DMGC 3WUWB 3CVHH 4QEGA 4UINH 4KVNH 4MD0A 4PV9B 1TJIH 4YE4H 5L2JA 1P4IH 2A9MH 1A7NH 4MYWB 2HRPL 5FHBL 1RZGA 4NQCB 2XXMB 2MHAB 3R0NA 2B1AL 1UT9A 2DQTL 1T20A 2N7BA 2WP3T 3QUMH 1WCBB 5J11B 2JE8A 5DGRA 3QUXB 1Q9WB 4OLXL 4P4KD 4XPTH 4BFGA 2D9QB 2YUVA 4YZFE 3V0VB 2KZ1B 2X6MA 5E2VH 5GSRB 5E5MB 1GZPA 1VGEL 1IEBB 1Q72H 2NR6C 3JBG7 5AYUL 1CFSB 5FUZL 4EI5C 4MAYD 1MJ8L 5EORH 2O5XL 3BISA 4JKPH 4PP2B 4AL8L 4RGNC 1VGKB 3VG9B 1L4IA 4U6HA 1QNZL 4Y2DB 3MV7D 3BYTA 2WMPA 5BOZG 1NAKL 4YK4B 4R7DB 3HZYB 1MAML 3U7YH 1OT1A 1CFTB 3FZUC 2GSGB 4GG8B 4S2SB 1DUYB 2R2CA 3DVGB 1BZ9A 4LLQB 5FKAA 4LSVH 4YXHH 4ZODA 4XPAH 5EU7E 1X4XA 1AC6A 4JFED 3I6KA 1BFVH 2Q8BL 3HE6B 3QCVL 1AD0A 1UACH 3FONB 2AXHA 1ZKAA 4P5KB 1CD1A 5K9JL 4JY6A 5FO8B 3GMQA 2IANA 4WTWA 1QKZL 2FR4A 3GSXA 3MA7B 5E94A 3K7UA 5ESAB 5F89B 5CJQL 1NSNL 5A16B 2JK5B 1IGML 4M43H 4FNLL 1HH9B 1LP9E 1X5IA 3PQYD 3LPGA 3WFEH 1U58B 3ULVE 1AHWA 2YXFA 3GNMH 4MJ5B 3OKLA 4NO5A 4PTTB 5GZOC 3OXSB 3QDJA 4S10A 2DRUA 3QZWB 4Z18A 1LO2L 1KCVH 1RK0B 4X6DF 3FO1B 5D1QB 4MD4B 3O4LD 1MLBB 3ILPA 1ONQA 5CEZE 4DFHA 4U7MA 4KJQC 1D9KD 2CH8A 4HSQA 2ZKHL 1QTYT 3ZTNL 4PJ8D 3V5KA 5DR5H 4G3YH 4ONHB 3CXDH 2C3GA 1KB5A 2ICEB 1U8LB 3LKNB 1SVCP 1A1MA 2CKBH 4XVJL 2QV2A 2AJZB 3O9WA 1RI8A 1JWUA 2OXGA 1LDPH 4TRPH 1C16A 2FATH 4U1GB 4N8VA 3MLXH 2AV1A 1S7TA 3BEWA 1W72H 4IMLB 5FUOL 1WSST 4YHMH 4F7PA 1JJUA 5L2KA 4RISH 2DBJA 4BELD 4HV8A 1BM3H 3U9PH 1FL3A 1FRGL 2E8ZA 3IKKA 5SWSD 2VUYA 2OJZL 1QFUL 1DBKH 2XKNB 2HYMA 4NRYB 4WWID 3DTXB 5FYKE 1Q9KB 3PABB 3V4VL 5I1CL 1V3KA 1F6LL 4DQOH 1IGFH 4OZHA 5DFTA 3MLPA 3T77B 1KB9J 2CMRL 5BV7H 1UC6A 3X13B 2UUDH 3WJLA 3CLEH 4HK0B 4I5BA 1NCDL 4YBLC 5AWNH 1RZKL 2NQCA 2VLRD 1ZGLB 3AMLA 4Z0XA 2XI9A 1AJ7H 5IW3A 3CXHJ 4MJ4A 2X4PB 5C0CD 3P2TA 1FFNA 2C4FT 1TCRA 5MEPB 1IGYB 2DLFH 4P5TB 4GSDH 2HN7A 4P9HC 5F72S 3RWCB 2DQJL 1ROWA 1T1WB 3GI8H 3R06B 3O2VL 4NRXB 2QKIB 2C3HA 2QADB 4ERSL 1QD0A 1UB6B 4HKJA 4UT7H 3V0AC 3ARFB 4PBVC 3T0VA 3MYJA 2B2XL 4HS6B 3MFFB 2F9BT 1ACYH 1RIHH 5HVHB 1C5CH 3QEQA 1IQWH 5DA0B 1G7LB 2X70B 4E0RA 4MLSA 4IRSD 1IT9H 2G60L 4D3CL 4G9FB 4Y0GA 3QCTH 2A1WL 4ODWB 1HSAA 3MBXH 3U4BH 4Z77A 35C8L 3FQXA 1IAKB 1LD9B 4OT1L 5ACMA 2Q7NA 3P4OB 5FKPA 1D6VH 4NC1C 3N85L 2E9BA 2EDDA 3DO3A 3TZVD 2QQNL 2Z8VC 2R4SH 4G9FE 3EHBD 4LDEB 5HGHB 2OTUB 4YHIA 1YMMD 3E3QC 4Q6IA 1WAAA 1A1OB 4XNYH 4J6RH 3BZFB 3SDAA 3OR6A 5KVFL 3QG6A 1A21A 4OCLC 3PHOB 1KJ2L 1YEDB 4LLAA 4ZFOB 5T5FH 4HWEH 1B6UA 3TBSA 2B1HH 4G6JH 3HE7B 4J3UA 3L3DA 1QSZA 1AR1C 3MMEB 1Z9LA 4JKMA 5JPMB 4NZUH 4JN1H 4OI9A 1KCSL 5J13C 4OQ1A 1P1ZB 2NYYD 5EU3A 4LRNH 3G6DL 4CW1B 2RIKA 4KK6C 5CSBA 4R96A 3CDFA 3MRIB 1UADC 5D1XC 2VLKB 2VXQH 1N5YL 3SHSA 2VXTL 4LDOB 3MNZB 4XRCA 3WYRA 1HH6B 3UYRL 4ZAKA 1RHHB 1I7ZB 5DJCA 2ZUYA 4N0YH 3AUVA 3C5ZB 2VDKL 3QWOA 3I3DA 4ZOAA 4WO4C 1TXKA 2VDML 2I5YH 4LVOB 4HPOL 4U4BA 4APQD 2F5BH 3T3PF 1RFDL 4BZ1H 3PWNB 5T3ZE 2NPLX 3WFDH 1CD0A 1BAFL 1I8KA 4M7LH 2EXYD 3IS1X 4YPGB 3CPLB 3CMOL 3GI9H 4H8WC 2HJKB 2AJSH 1CXIA 4PTUB 3LKQB 1NPUA 1QRNA 2ATKB 1JVKA 4IHOA 4F7TB 5JHDD 2BNQA 4UAOC 5FOJA 5KANG 1NCWL 1WZ1H 3WNPA 2VDPL 2VN4A 1BWMA 1PVHA 5BRZB 4XMPH 2JIXD 3MOBL 3F12A 1KELL 4GW4B 4Q9QL 1J05A 4YBQD 1SQ2N 2EYTB 3LDBB 2GTWA 1MFAH 5FYJU 3K8LA 3THMH 1QA9A 3UTZA 1XH3A 3V2AR 1FSKC 4ALAL 4RMSA 1Z9OA 5F9JB 4LP5A 1BVKA 3V5HB 4LAJH 5KSBB 2DTML 4B7LA 5EBMA 4FP8H 1VEMA 4EI6A 3NH7H 5KS9A 1UKSA 2P47B 4WTXA 5DJ2A 4HBCH 1T22A 2R2HB 4OCXL 4GLRH 5INDB 1HHHA 4MXQD 4U2ZA 5C0RH 4FQ1L 1K8DB 4HMCA 3D9AH 3P11L 5FGBA 1OGTA 1UM5H 4Y4FA 3A6BL 4AT6A 4JZJC 2Z31D 3X3FL 4N90D 3KPSB 4M7LT 1I1AD 2ICWB 2X10A 3I50H 3S98A 3I9GL 1JWMB 3IVKB 2RB8A 4XC1L 3MFGB 3NCCB 4N0CD 4X6FB 1SM3L 4Y89A 5TGBA 3KPSE 3LS4L 1OQXA 3LV3A 3QIUD 5EBWB 5EZOH 5C08B 4L9DA 5DXWA 2ADIA 2ZOKA 3REVB 3RPIA 3QHZH 2D31B 3EO0A 3I84A 3C2AL 5JO5A 1TFHA 4HQQL 3C6SA 2I9TB 4JANA 4NUGL 1I8IA 5LGKA 4V1DA 5C08E 3LH2H 4OZ4B 1N8ZA 3VXSD 1JNHB 4JVUA 5J3HC 4GUPA 5ESVA 1KJ2A 3O3DA 2BERA 1MCDA 2A9NH 2J8HA 1A6WH 2XA8L 3VFMB 1WV7T 1T0NB 1CG9A 3H42H 4XMKL 4I18B 4GKZA 2CK0L 2FX9H 3MCKB 4RA0C 3RKPA 2QJDA 5GXBB 5T1LA 1U8NB 3HFML 3TYFB 4YHNA 1NC2B 2CUHA 4AIZA 3H9SE 3PWJA 3LEYL 1PEWA 4LSRL 1QSEE 4L3CA 4NO3A 4FXGB 4UDTA 5IB2B 1UA6L 3UEZA 1FNSL 1JFQH 4MQXC 3WN5A 4C4KT 2GQHA 3Q6FB 3QUXC 3MJ9H 4H1LG 1MWAB 4G6FB 1NAMB 1IM3B 4Y2OA 2ADFL 1KTRL 5GRUH 5EUOB 2R9HC 1WIPA 3PHSA 1LK3L 2UZIL 2R23B 5E6ZA 1I3UA 4PYHA 2VXSH 3WE6B 1CT8B 2E7MA 2NXYC 3QWQB 4ZSOB 3CFCL 4JB9H 4F2MA 3VG9C 4X6CB 3B9AA 1B2WH 4Y2DC 5EUOE 1XCQB 2CO7B 1X3DA 3RVWD 1RJCA 4M7JH 5ADOL 1AGFB 1AHWC 5ERWB 3MRJA 4M6MH 3R8BB 4LSTL 3WIIL 1MI5D 5CINH 3L7FA 3BKML 5CZXC 5D7KD 4P46A 3G6JE 1E4KA 4OZFG 2O5ZH 4X6CE 1TVDA 3M1BA 4FFVC 4HCRA 5HI4C 4MCYA 2JJVA 3DXAD 2ZZUT 3FB5B 4JM4L 5HDQL 4JVPA 3STZB 1ES0A 2VC2L 5SWZA 5IK3B 2XQBH 4GW1A 3JWOC 2V6HA 3FO0L 3O8XB 1KNOA 1HYSD 4Z7UE 2NCMA 3CUPA 3FFCA 5JIKA 3C6LD 4LIQE 2K3TA 1NEZA 3MRQA 2UV3A 2CRMA 5KZCD 1F4XH 4HC1H 3TBWA 3O9WC 2WANA 5EU5B 4PJGF 4EN3B 2B0SL 1EX0A 5DUBB 3ARVA 4AG4L 1DQTA 2NY7L 2X4UB 4WTZG 1DBMH 1QFPA 3VDBA 1F11A 1WCQA 1FFRA 2VTFA 3ZE0F 4NZJA 2QSTA 3BMWA 3VWKA 4TSCL 5T3XH 5I1HH 4HDIB 3RWFA 4Y5YA 4X83A 1WUNT 4O4YH 3P4MB 3ARGA 5D1QC 3OZ9L 2P44B 3UX9B 43C9B 3IFNH 1Q9OB 2PXYA 4F3FB 1U2HA 4JZOA 4NCC2 2C1PA 4N0FA 4GG6B 4CADA 2XY1A 2OL3L 4YDLB 3MBED 4KTDL 2FWOB 3WJLC 2G75A 5J6GB 3LKPB 1E0OB 3LKOA 4JY4A 2V5TA 1YYMH 5I19L 1G7QA 4JFDA 2FL5B 3ZT6A 3LSOA 4GG6E 1TCMA 5GHWH 5E56A 5J1SC 3QHTC 1NMCB 1CICD 4UMGA 3T3MF 1T03H 3STBA 3UTQB 5EN2B 5D1ZA 1I1FA 2X89A 3MROA 2H1PL 2AV7A 1ZLVK 3UTSD 1VERA 2PW2A 3PGDA 5JQ6H 2AS5M 5E4IA 5IQ7H 3MODH 4GT7A 2R0WH 5L88H 5MI0C 1FZKB 1V7MH 3SDDA 3EYQC 4ACPA 1OSZA 1LEGB 3SE4A 5IEKA 3GJFB 4QY8B 1OL0A 2GK0A 2VIRB 4YEEA 4QRQA 3QCUH 2NY0D 3I6GB 4CMHB 3T65A 1QLFB 3O3BA 1IKFH 2UWEF 5C0DA 3SJVA 4RAHA 5LQBL 3GMOA 1LE5A 2QQLH 1Q94A 3CVHB 2L4OA 4TYUA 3HC0B 4V2BA 5B3JE 4ETQB 1AXSA 1I7RA 1A7BA 3OSKA 1T4KA 2EC9U 3V79C 2BC4A 2FZ3A 3T0AA 2PYED 1RPQA 5GRJH 3C08L 3SE9H 1FO0A 5DK3A 1A3LL 2OI9B 4QHLA 3NFNA 4U1KB 4AEIL 1ND0B 1F90H 1CFNA 3F5WA 4P5TC 4JJ5A 3QUMB 1MPAH 4Z7OF 3NCEB 3GMRA 1DQQA 1RVFH 3QI9B 2NW3A 1G6RB 3QUZA 2AXFB 4BQ9A 3CLFL 3RKDC 3QQ9C 4D9LL 2H2SC 5JDSB 4KK9D 4K07A 2QADC 1MJ7L 1FNAA 4KMTH 2YD4A 5IV2B 1B0WA 2VDRH 4W6YB 3ARFC 1FIGH 3SDAC 5D7JA 3DRQB 5J1TC 1UWXK 2VLLA 1NGQH 2KPNA 4LEXH 2F53E 1JNLL 4KKBC 4OZIA 4L8CA 1C1EH 2IH3B 3RHWK 2MKWA 5IMKB 5CJXC 1YMHB 5B39A 4OLZL 5BXFA 1K9TA 1A14L 3D48R 3N9GH 4RFEA 5TH2A 5DMKB 4OZGB 2X4RB 3OTTA 4WDIA 5C71A 1CGUA 5LCVH 3IDUA 4G9DB 3BPCA 2MTPA 5FUCC 2N4IA 5ALCL 3ZDZF 3VXQA 2AEQL 2LTQC 1KBGH 2BOCA 5ICXA 4U6VL 4A6YH 1KYOJ 2UY7A 4JLRA 4UDUB 5KBNC 1YUHA 1AXTH 3TO4A 3R1GH 4LPVA 1CLOH 1JF5A 3H0TA 5TE7H 2AK4A 4LMQI 3BUYA 2CLRA 2YMXL 4ZAKC 5BJTB 5J12B 5DD0H 2YPLD 3MV7B 1GIGH 3HMXH 3O81A 4PRNB 5HHQA 1RJYB 2XZZA 4PGBA 4ZYKB 4AEHH 4X98B 1NFIB 4OCRH 4ORZC 4WRLA 2V9RA 2BY2A 4JFXA 4FQPA 1K5NB 1OAYL 4Z0BL 3MV7E 3DX8A 3WIHH 3TPKA 4LNRB 3QEGH 1AY1L 3VDAA 5HDLA 1G7IB 4ZPTB 3LOWA 5DRWA 2FNBA 3GRWL 1FFQA 1YN6B 4UOW1 4GBXB 3W11C 4JO1L 2BVPA 2P5EA 1HZHL 1U3HD 2ZCKH 1G9NL 5IB3B 4UT9H 5A2IH 1W0YT 4QO1A 3LKRB 2V2TB 3ECBB 4M5ZH 5GRZA 1MNUH 1U3YA 2CKBB 2W07A 2YEZA 4MSWA 4OIIL 5IR1A 1U41A 1U8KA 4QHKJ 1MCBA 5ELIA 3C5ZC 2EECA 4JFEE 4M1CC 5DD3L 1S7XA 3RWHA 1S7VA 4FFYL 1JTTA 2R1YA 1J8HB 4WWKB 1AO7D 5L7XH 2KQMA 2OTWB 3NTCL 4NM8H 3WS3B 4NQXA 3MLRL 5E1HB 4YXLL 3U1SH 1OP5K 3LQAC 4YO0B 3KYAA 4JAMB 2F5AH 2ATPA 3PQYE 2I07B 1D9KB 2BVTA 2JCCB 1F5WA 3OPZL 4JGMA 4ODSH 4JQXA 5JHLH 5KSVA 5DHVB 1J8HE 3M8OL 5JXAH 1A6AB 5LGJA 4PJ8B 5H35A 4Y4FC 4K7PX 2DMKA 5EO1A 1T5WB 4OD2B 5D96C 1U6AL 1CGSL 2G2RB 3O4LE 1FVCB 4HUWB 1DE4B 5F3BB 2IGFH 3BOVA 3DSFL 2HTKD 4IRJD 1U93A 2JCCE 1MEXL 1FYTB 4PJIA 4CVUA 4PRIA 3IXTA 3BRGC 2R56H 3MJGX 2PN5A 1KXVC 3N1QC 5C0FA 5IMLA 5C0EA 4H26B 1WQVT 5LWYL 5CLTA 1W72A 1FLRH 1TITA 2YRZA 3NAAL 3W5NA 4Z7VA 1FYTE 4YZFF 1I8MA 1FG9C 4HHAB 4I0PA 4DAGH 4FMKA 4K3JL 3SBWA 1AR2A 4GMTH 2WUBH 3S34L 3NIGE 4LHUG 2GTZA 3TJEL 3VXTB 4JY5L 3UJJL 1M7IB 4HWBL 5EWIL 1BIIB 4Y1AA 5DYOB 1XF4A 3GUTB 4U1SA 5DEFB 5CBEA 1S9KC 3V6OA 4NQDA 3F7PC 4PIRF 4MCZB 3ZZ1A 1PLGL 2YSSB 4FQLL 5JLZB 2VLRB 3LRSB 1QBLH 1EZVY 4NO0D 4L5FH 1F8TH 3W82A 3WUWG 5I30H 3BPLB 5F96H 1JI1A 1CN4A 1FL6B 3OJDA 1YQVH 4HJ0D 5C0CB 3VGEA 1R24A 4NGHL 5KG9B 2BNUA 4JO2H 3CX5J 3QDGD 2JJTA 4KI5E 1EFXD 3AY4A 4FQHB 2DOCA 3TBYA 4IBLT 2VLRE 2MWCA 2R0LH 1ADQL 4G8FA 2X4OB 2PETA 4RFNB 3QIBA 5EIVA 5C0CE 2E9IA 4P2OA 4NN7B 2FGWL 3KJ4B 5IQ9A 1HIMH 4NZRL 2DQIL 1P6AB 4Y5XA 3MUGB 3HG1B 3O3AA 1IZKA 2EYRA 5KVDL 1DJSA 2RFXA 1CD8A 3T0XA 5A43C 2H2PC 2WUCL 3SE8H 1S7RB 3GHEH 3MO1A 4NQSA 4DVBB 1RUQL 2Z35A 4OV6F 4JO3L 3DHMA 4I18C 3ULVF 1ZS8B 5JW4M 1J9CT 1D5XA 2FB4L 4PR5A 3CSYA 5GIRA 5I8EB 1EHAA 4PB9H 4LSUH 2Q7YB 3PGFH 4OFDA 3PG2A 1A1NA 3SDXA 4P46C 4KZDL 3TNNB 5ID1A 3V7AE 4DZ8A 3TZVB 3VXRB 1JGLL 2CUMA 4JCMA 5C6PB 1REIA 3KYOB 2UWEA 1T89A 2VE6B 4OBRA 3O6FA 2UVFA 3FQRB 3F8UB 3GKWL 3EFFB 3HR6A 5E9DD 3L95B 1IFHH 2ZUWA 3FL7A 5HY9A 1JWSB 1YMME 3FB6A 1X6NA 4Y8AA 5FM8A 2P5WB 5CJOL 2E7CA 1AGCA 4RZCA 1NGPH 4XAKE 1JZ6A 3BT2L 5TDPB 5F7EH 1MUJA 1N6VA 5HGBA 4I9WD 5A2KH 1UM4L 4P3DB 1PKQB 1V3MA 3QZWG 1S5HA 2GCYA 5DTFA 2X5PA 3GO1H 1PBYA 3DV4A 5GRWA 4YQXL 1PSKL 2APTA 1RIUH 2VDQH 5JPNA 4RX4D 3FN0H 4F7EA 2IPTL 3EYFB 3BPNC 1KIQB 4XGZB 4WEBH 2A6KB 3D39B 3SKMB 5DRZB 3SKOB 1PKQE 1J87A 4C57C 2QL1A 3CK0L 4ODVL 3RP1A 1NDGA 4MXWH 1F3DJ 4WUKL 5CKGA 5JW5A 3OAUL 3UYOD 4EIZC 1CFQA 4APQB 1JGVH 2JJSA 3B3IB 4EN3C 4UNVA 4XI5C 1M05A 1G7JB 2VLME 3AS2A 1J0IA 3I75B 5I8KL 1WBXB 1A2YB 1N6UA 1VEOA 3CX2A 5MHSD 3MGOA 1L7IL 4HWBA 2A73A 5EPMB 3VFPB 1ZVSB 4FS0A 3RZWA 3C5SA 3IU4L 3WDHA 1EHLL 1WK0A 1XR9A 2C3VA 2FSEA 1LEIB 3IFOB 4POUB 3H3PH 3RBGA 3DX6A 1GYAA 2D7OA 2CGRL 4U05A 3WFBL 4HFUH 1EHNA 4QHMA 1IC5H 4IIQB 1QLRB 3Q6GL 1R3JA 3JZ7A 4M7ZB 1A7PL 3BO8A 3TH4T 4DTGL 1T1XA 3CDYA 3LRHA 3ULUD 2BNRA 2H8PA 1LWRA 4QCIB 2FYYB 1VB9A 2GJ6A 5JHDE 1Q1JH 3BGMB 5DSCA 4TSBL 3VGBA 4PRHB 2ZJSL 1ADQA 3EDKA 1DN0A 5EBLA 3PDDA 2NY4D 4PS4H 2XWBB 3ARDA 1IE5A 4K3HA 4WHTB 3VI4E 1FAIH 3VXPB 3UBXA 2VN7A 5CEZL 4J3VA 4LLUA 1JZ2A 1P4BH 3OWEA 1I3GH 5FCUL 4ZS6D 3BN9D 1HOCB 1DQJB 2Z31B 2XKUA 4KK8D 2BFVH 3OAYK 4OB5L 3DRTB 4MA8L 1WJ3A 5JIIA 5EU6D 1I1YB 1E28A 2OTPA 4QRUA 3U30C 3FQWB 3VFUA 4OV5B 4CMHC 4JR9L 5ALBL 3AM8C 1IAOB 5C0AD 2Y25A 1C12A 4N90E 3VXMB 4ONOA 4F15C 1N5AA 2B39A 3QIUB 5K9KA 3RX5A 4XCYA 4HIEB 1ZHBB 4NBYB 3NPSC 1QFHA 1UH2A 2ED7A 5GS1C 3HB3D 1RUPH 3MRNA 1UJ3A 4FQJL 1ORQB 4YHYC 2D4DA 1BZ7B 1BECA 1JYNA 2BVOB 2WBJD 1XR8A 1Y6NR 1OARL 1YNKL 4X5LA 4PD4K 2GITB 4LHUA 3VH8B 3VRJB 3IFPA 5CIPA 5EZIH 5CJ5A 2Q8AH 5FYKL 3RDTB 1H3WM 3LS5L 3TO4C 1CZ8H 4RCAA 4LCYB 1Z5LA 2DQDL 3DETD 2NY2D 4K7PL 4BH8B 3CSPA 4NZDA 4Z78A 4K9EL 4L9LC 4IS6B 4LPYA 5F6HI 4QXTA 2DIJA 5T1DH 4ZNEE 3VFVA 2Z92A 2AABH 4NSKB 4NKMA 5JXEA 3NABL 1JNJA 4UI2A 3WXWL 4EOWL 3TIDB 2DAVA 1OPGL 3UJTH 4DN4H 1MY7A 5IJKA 2WP3O 3GSRB 1T21B 3UDWC 4LCWD 3P0GB 2X44D 1S7UA 4MA7L 3BD5A 4GAYA 5HGAA 3U6RA 4NPYB 3ZYZA 3RY6A 4HT1H 2EDKA 4OUUA 4ZPVB 3V0VA 2DS4A 3IAGC 5CEXA 3DI3B 1AP2B 3W0WD 2HWZL 1M6OB 3X12A 2BSED 5GRYA 1CU4H 4MNGB 2DMBA 3HI1B 4K8RH 5TQ0L 4BSWB 3DLQR 4OLWH 5DJZB 5FYJH 2IADB 1XAUA 2WQRA 3QQNA 1TETH 4PLKC 4OFPA 1DQDH 3PL6A 1QPXA 5J1AA 1JGEA 4QHKI 4PB0L 2DJSA 1YYLH 1EO8H 1T04B 3C9NA 4H5SB 3VI3E 1S78D 4MNGE 3U0WL 4PJ9A 3QPQC 5E2WL 1CFTA 1MI5B 4IM8A 1EJOL 4ZDHB 4XP6L 3K74B 4R26H 4U2YA 5DQDH 2AQ2A 4P23C 5KSAD 4XPGH 3WO4C 1N4XH 4GG8A 1DUYA 5H37G 4U1NB 3DXAB 5KSBF 2LE9A 4JQXC 3RTQD 5D2LA 4LLQA 3DOSA 3KPMA 1F02I 4KZEH 4GBXC 1MI5E 5D7KE 1YJDL 1H9VA 4HKZB 1CBVL 3C6LB 1A9BB 1LP9A 3QO0B 3DXAE 3ZO0A 3RL2A 4FQQB 3FONA 4X5WB 3OKDA 3T09A 4V2CB 3WNMA 5FO8A 4J23A 2OCFD 5DS8A 5CP7B 3JWDL 4FFZH 4JM2C 2JK5A 2QR0A 7FABH 1U58A 2V7HB 4WWKC 1N6QL 4PTTA 4OCYL 1FJ1A 5T1MB 1EERB 3FO1A 4I0PC 5DFVD 1A7QH 1IC1A 3BHBB 1J1XH 5C09B 1DL7H 2L0DA 4OKVB 4G7VH 2A74A 2EDRA 4EVNB 9CGTA 3KPRA 3U0PA 1OGAA 1EUTA 4M8QB 5E00A 2BXZA 3ARBA 4LVNB 3RZCD 3WXVH 3MBEB 3WSQH 4FMFA 4PJ5B 3T1FB 1U8LA 4N9GA 2HH0H 4NOBA 3O6MH 2AJUH 5BV7C 3DI2B 5HHVH 1RZ7L 3NGBC 1PEZA 3C60D 5IESL 1KPRA 3GSOA 4ESKA 3AREA 4BSVB 4PJXE 5T3ZL 3LRGA 1WBZA 1EEYA 4WHCA 3X11B 5KN5A 2EE6A 4NHUB 4QRSA 2YUZA 2DQGL 5D71H 2HMID 2MOVA 2HG5A 4FRWA 4LLWA 3QO1B 5CSZB 1WGOA 4NN6B 4QXUH 3SDCD 2XIDA 5C9JB 4XPBH 3DV6A 4P2OC 1ZLUH 4G7YL 5E8DL 4EJ1C 1IEAB 1F58H 4Y5XC 5KOMC 3VFGL 1JMZA 3CFBB 3PABA 2APVA 1RMFL 2P8LA 2H3NA 3VFSB 3LEVH 3T77A 3ROOB 3TYGH 3TVMA 5DD1L 1HI6A 5EUOF 5GRVK 2XV6B 4PRBB 3BJ91 5CLWA 4TPRL 3V5DB 4XP4H 3DO7B 4W70A 1BEYL 2PYEB 3EKCA 4O2FB 4ZFGL 5FYLH 3U9UA 3VU2A 3BYYA 1GC1H 1N26A 3U4EA 5HVGB 3BAEH 4GRWH 4KDTA 4X6CF 3AB0C 2JB5H 3MUY1 5MEPA 1FVDB 5LBSL 2RAMA 4HJGA 1G9NC 1AGDA 2V17L 1DLFH 1VADA 3WDIA 3E1F1 2PYEE 1YQ2A 4IRZH 3RL1A 1T1WA 3BH8B 5C07D 4JN2A 2E6QA 2WIIB 4GRLA 4RFNC 1IRAY 4NKDA 4A6YB 4PJHB 2JF1A 3V52L 4Z7UF 1NCBL 2J88L 1HILA 4XPHH 3O6FC 1FNHA 2W9DH 3PV6B 1DVFD 2FLRT 4YJZL 2DYPA 3L5XL 5DQ9B 1P84J 3V6ZA 5ITBL 2VH5H 1AD9A 1RURL 5DZLA 4PJHE 3PXHA 1B4JL 5C8JA 2VAJA 5E8PB 3EGSA 1I4FB 4LSSH 4BSJA 1S7QB 1WWCA 3SGKA 1B0RB 3T04D 3KPPB 4PRAB 1JV5B 4OFVA 2EKSA 2VZVA 1MFEH 1M7DB 2ICCA 4S1RH 5DO2C 15C8L 5A3ID 3GSVB 3GHBL 4JDVB 4HX1A 3NOIA 4KPHL 1CGWA 3OAZH 4R3SB 3IJHB 4OTXH 3EO9H 3E8UH 2J5LB 3I6LD 2J8UB 3GSQA 2IAMB 5ANMB 1ZGLP 5AD0A 4F9PA 2MCPL 1XZ0A 3RVUC 2CLZB 3QXVA 3CMGA 2BP3A 1GGUA 1QP1A 1IGTA 3P4LA 2YPLB 1FZMB 1MRCL 1KB9K 2CDGA 2HFFB 3GFUA 1KTKE 3U0TA 1YEKH 1A1OA 1RZFL 3HMXA 1LVEA 3EUUA 1V7NH 5ANME 3PNWA 4GG6F 4MXVE 2ERJC 4MD5A 5FEBA 2Q1EA 2XZQL 3BW9A 5K93A 5LG1A 3HE7A 3CXHK 4KJWC 2YPLE 4JFZH 5IHUL 1L9MA