5EZOH

Crystal structure of pfcyrpa in complex with an invasion-inhibitory antibody fab.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
NVNLLESGGGLVQPGGSLNLSCAASGFDFSRYWMSWARQAPGKGQEWIGEINPGSSTIKYTPSLKDKFIISRDNAKNTLYLQMSKVSSEDTALYYCARYGSYVYAMDYWGPGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PfCyRPA
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezoH01
3INUL 4AK1A 3DXAD 4NHCH 1D5XB 1IT9L 1MHEA 4QT5A 3SHSA 4LSPL 4NZJA 4RMRA 4YXHL 3QEHB 5HVHC 4GKZB 5D1XB 1RVFL 3BKJL 5T5FL 1CU4H 2BFVL 4O02L 2B2XH 4BFBD 1N0XH 1U93A 4L4TB 4Q6IA 4S1DD 3OPZL 4CMHB 3WJJC 2F5BL 3PWUB 4EI5A 5SX5H 4HFWB 3EJZC 3MYJB 5K93A 4YGVA 3HZMA 1JNNH 3G6DL 3EGSB 4K07A 1DQTA 3QRGL 2E7CA 5IMOB 3NCFB 3UZEA 4OCWH 4HWUA 5HTSA 5FDWB 3ZMRA 5BQ7A 2C1PA 1OB1B 2VN7A 1H8NA 4LQFL 4O51A 2ZJSH 4WW1B 3OXRA 3U48A 3VW3H 1O5DT 1KFAL 4KDTA 2O5YH 4X7TA 2DM3A 2IAMB 3HE6D 4OF8A 1DEEB 3EAKA 3BIKB 1CG9A 5BZDB 3ZE1F 4WI8A 3P11L 3OR6B 2ZUQB 4YQXH 1RUML 3HG1A 4H25A 2HT2C 2Q76B 4RRPA 5C0GB 1TMCB 4KMQA 3IB4A 3ROOB 4MX7B 3S88L 3I2CL 4KVNH 1QSEA 3VMOA 5C9KA 1YEFH 2XZAH 4JPVH 4OQTL 4P9MH 5HVFB 3MOBH 2E8YA 1IGTB 3UTTD 1CFVL 2VZTA 3ARSA 1SYSB 4M43L 3MMEB 3KYAA 4KU1A 4NC1C 4V1DB 1KJVA 2NPLX 2GJ6D 1EX0A 4OZ4A 1ORSA 1YNTA 2EDLA 2ORBH 3MRKA 1KIRB 3C60C 3PIQA 4PLJD 1CDCA 2FJFA 4X8JA 4F7PA 3ARTA 3BZEB 1ZVSA 2VLKA 3FQWB 4ZO8A 5DQ9A 3BW9B 4U6YB 5J6HB 2H45A 3V6ZA 4D9QE 2EIDA 4Y16C 3MJ8B 2CRYA 3NAAL 4Y4HB 1QTYT 1WBYA 5F6IC 5GGTA 1MSPA 3ARQA 3FJTA 3QXUA 4D94A 2JB5L 3BKMH 2X4NB 3V0WL 3RGHA 4P46D 5DRWB 1GGYA 3FMGL 5HHVL 1HQ4A 2EKJA 4NKMA 5ERWA 2AV1B 5MEND 4MNQE 3U9PH 3QJHA 3OKLA 2BRRH 1IAKA 4G3YL 1QSFE 3ZO0A 4CDHA 1ZS8B 4KY1L 2AXFA 3NIFF 3WFCL 4QY8A 5C08A 5MHSD 2FEEL 4R2GC 4WFFE 4EI6B 1TTUA 4OLZL 5FYKE 3SDDA 5K59E 1GC1C 2BHZA 3MNZA 4DZ8A 3N9GL 4BYHA 5C0IA 3RX5A 1IFHL 1WAAE 3L3GB 4N8VA 3MGTA 3TBVA 2AJZA 5I1DB 2UWEF 3SKOA 4LRIA 3C5JA 3MFGB 1NMCC 2V7HA 1XGYL 5JUEH 1OGTB 2V2TB 5FO8B 4D0DA 3IU4L 1J88A 1CIUA 1LO5A 1V7NL 5D5MA 1FNEB 4XX1G 5TQ2L 1NCBH 1I1CA 4JZJA 3KPLA 1U2CA 3LN4A 3GBML 1EJOL 3CX5K 3HPLB 1IGIL 1NCDL 3HUJE 3PWLB 3KPRA 1N2RB 5ESVA 4JFOA 3L7FB 2YUZA 4XH2A 2R0ZH 4ORZC 1KOAA 1ZXQA 1G7HB 4HIEB 3VDCA 4BJLA 4FTVA 4C83B 2F54B 1QO3A 5FM4A 1RUKH 1HILA 2YPLA 5T3XE 3S37H 5GRYA 1KB9K 2QEJA 1WCBB 4S2SB 4NHUA 2VLLB 5MEPA 1BQHB 1URLA 4OGXH 4JB9H 4ENED 1N3NA 2EIEA 4LMQI 3QUZC 4QRQB 3KPMB 5I1AA 2EDRA 1OAUH 3NIGE 4ZXBB 2H2SC 5DJZA 1CQYA 3QUMH 1ADQA 3ESUF 1RAMA 1MJ8L 4WGVB 5GS1C 5TF0A 1X3DA 4AIZA 5CINL 1FAIH 3VRJB 2XTJB 2VMFA 2XFXB 4OI7A 4HCRL 1FIGL 3RIFF 2OYPA 4JRXB 3OAZH 4FQHB 3VRIA 5L0QC 1KN2L 2H26B 3ORJA 4QRPE 1LEGB 1OGAB 2B7DT 3MO1B 3D18B 5I1LB 4UV7H 1T5XB 1CT8B 1XGPA 5IMKA 1MFAH 4LDLB 4L1HA 2B0SL 2ADIB 4U7SA 4WTXA 4GFTB 4IRSB 4OF0A 2EE3A 2FATL 1WZLA 1ZE3C 2ADGA 1M05A 2C3HA 5F8RC 3CFCL 4F33A 3GI8H 3CSPA 2IC2A 4I18B 1ZT7A 4FXKA 5C0EB 5EO1B 1JWMA 2VABB 2FD6H 2VISB 3DUSB 5FKAA 5F9AC 3TWCL 5IW3A 4HZAA 4ZFZB 4KKBC 4KRPB 4X99A 4ZYKB 2QR0B 1CLZL 2R2HB 2HJLA 3VXSB 4PTTA 1BQHG 1I7TA 3RA7H 2GK2A 4FQ1H 1TPXB 4QRRB 3BGMA 1M1SA 4GKNB 3WXWH 1B4RA 1J1PH 4XCFL 4XXCA 2OQJB 4LEOA 1K6QH 4L5FL 2J8UF 3GK8L 1IM9B 3VWKD 4PYHA 4RMTA 3P4OA 4JN1L 1QFWL 5J13C 2X4TA 3MRPA 4HG4J 4Z7WE 5DJ2A 4WY7L 1OTTC 5TDPB 3ZKXC 3EO0B 4NZUL 3VXPA 3HI5H 4DAGL 3MV7D 1JPST 5JXEC 5C0CD 1J1OL 2R56L 1RJZA 1U3ZA 2W65A 3T0XA 1AO7D 3DX8B 1OF2B 5IMLA 5E2TL 3EYVA 1OAYL 3SGDI 4OCSH 5EORL 5C09E 2G5BA 3C5ZB 3QIUD 4KHXL 1U92B 4LPXA 4P2RB 1FGVL 5A16A 4OF6A 1C12A 4K8RD 1NAMA 3V0AC 3WIHL 4NN6B 4EUPA 4G6ML 3NFSL 1DDHA 4KK9D 4M7JH 2D7NA 4XVSH 3ARBB 2IJ0C 2WBJA 4U1HA 1MCCA 3U7YH 3EYOA 3GGWB 1A7PH 2IADA 2C5DC 2DQTL 4YC2B 3QUYA 4LU5L 4HW6A 4WHCA 3T09A 1ORQA 2DLEA 5KTEH 3S37X 3BJ91 2BVTA 5E2JA 4KDTC 2FJGB 5E0QA 5L2KE 4OD2A 1RSFA 4J1UA 3VD7A 3V4PH 5GJTH 4YLQT 3FFCB 1A21A 1AFVL 3P0GB 1K5NB 4EEEA 1G6VK 1LDSA 4P0DA 4J2XA 4H1LA 4MD4B 4LMQE 3S35X 3AREB 1GZQB 4K23L 2R4RL 1EMTH 4H88L 4OTXL 4F3FB 5JO5B 1R3JB 1MREL 3WFBH 4K7FB 4XX1E 1D9KD 1NBZB 1QVOB 1I9JH 2APXA 2BHYA 2CUMA 3P73B 5DLMH 5DD1H 3CMOL 3MA9H 3TA3A 5HHOE 1J05B 1YMMD 2W60B 4FQIL 1OM3H 4WW2B 5T3ZD 4BUGA 2BCKA 3DSNA 5EC1A 2RQ8A 1NFDE 4RBPK 1VFBA 4WUUA 1UJ3B 1NFIA 2BOBA 4X4YA 4HIIB 5J6GA 4P3DB 5I8OH 5HYJD 4HUWA 3JUZA 1D5ZB 4HGWA 1U91B 3O8XD 4R4BA 1GZPA 3S4SA 3TVMB 1A7RL 2FX9L 3ZT7A 5EU5A 5HD8D 2YMXL 5FK9A 1E28B 2ESVA 1YA5A 4UQ2B 4UU9B 3B3IB 2A77L 1T22A 4WO4D 2NY4B 5ID0B 2FWOA 2HFFB 5I1JH 1CXIA 2CK0H 3K1DA 1OAQH 3MV01 3HN3A 5K9QG 4IDJH 2HFGH 1CYGA 2QADC 3IJHB 2VXQH 1MH5B 1NCCH 3IDIB 3BP5B 3IKCB 1DE4B 4ZFGH 1QFHA 1S7VB 2R0KH 3DVNB 2J88H 4TSCL 1G9NL 3H9SE 3I02B 4OCNC 4Z7NE 1C7TA 3SDDC 4YHMH 3SE8H 4F58H 3BSZH 4PIRF 4R96A 5EBLA 5IB2A 4XXDB 4TUJB 5LXGL 4HKBB 3QIWB 1RZJC 4J4PA 1CGVA 3FB5A 3W82A 2UUDH 4EVNB 3MRJB 5D1XD 3QUKB 3HPJB 2VSCA 3QDMB 5ESQB 3CVIL 2OZ4H 4YR6B 4LKXB 1U8MA 4L4TD 2PO6B 5SX5K 2Y07H 2EC8A 4HXBH 4ONOA 3VDBA 1CE1H 5JHDA 3QA3B 5K9QI 2MHAB 1XGRA 3GEWB 3EOTL 4N5ED 1NBQA 1G84A 1MHCA 1YY8B 4GAYA 5I0ZA 5ILTL 4ERSH 1VENA 1RMFL 5FHBH 4JZNB 4PJCE 5I18L 4OZHB 3NABH 2P5EA 5IGXH 2VWEC 3CSGA 5CHNB 3GIZL 4GS7C 3QO1B 5A2IH 1Q94B 3O2DL 5F7MC 1FH5H 2IAMD 2NTSP 5CJBA 1IKFH 5ALBH 4ALAL 3EJYD 4I5BA 3TT3L 1GSMA 4HSQA 3FRUB 4KHTL 2AJVL 2PUQT 3P4NA 1F4WL 3RNKA 1JRHI 4U49A 4EZMA 2XRAL 4IOSD 1X5FA 3UAJC 1ACYH 5CBAB 3CC5B 4BELD 3UBXA 5GGTH 4KVCH 3Q6GH 4RQQA 2CK2A 1F00I 4V1DD 5F89A 3PL6C 4MLSA 5LAXB 5TFSL 1IGCH 1KB5A 3ZKQD 5SX4H 3C09C 5JNYA 2X4OB 1YNLL 2B5IB 5CSBA 5IB1B 3S36H 1PZUB 2ARWA 1MCNA 3AS1A 3M07A 4P59L 1JPTH 3L9RB 4MB5A 4NQCE 1X5KA 4XNZC 4AG4H 2CR3A 1HHIB 4ODTL 3HRPA 4P2QB 4FFYH 35C8L 3UJIL 4B41A 5CLWA 1FYTB 4OCRH 5KN5A 1HZHL 4X80L 3A6CL 1L0YA 2VDQH 2CDEB 2P7TB 4PJ8B 2IQ9H 4CJ0A 1S9WB 4H5SB 1RPQA 2W59A 1AIFB 5E2VL 4U1LA 4U1SB 4K7PY 1GGCH 1KPRA 1NANI 1AGCB 4MGXA 1WSST 3LHPH 5BO1L 3WS3A 4M61B 5C07E 3GSUB 4JN2B 1OCWL 4R3SB 5D7LE 3AVEA 4LLDB 1X5LA 5J3HD 4MNHB 3LH2L 2WUBH 4F2MB 1JNJA 3TNMA 5FO7B 3A67H 1S7TB 3D3VB 3OV6A 4HKJB 3AU1B 3D0VA 2EZ0C 4YHOH 4XXCC 1KJMB 2JKXA 2YEZB 2HT3C 1B88A 3ZDYF 4Y2OA 4NUJB 2UWEA 1LP9E 2OM5A 5IVXE 1PG7H 4E5XA 3DWTA 4NRYA 5LGHL 3IXAB 1KSRA 5F7UA 1DBML 3PP3H 2WP3T 4PJXB 2H32H 1YZZA 2A0LC 4D9LH 5FKPA 2ZSVB 4PJEF 2NY2C 3QDGA 3SDAA 1IBGH 3VE0A 4M7ZB 5C0RL 1DBBL 4WFGE 4C54A 1MEXL 5DVNA 3C8DA 1DBAL 4XCEB 1LK2A 4UT7H 3SQBA 4PB9H 1FZKB 5FYKU 4JR9H 1YEEH 4C58B 1JWSB 1TENA 2XY2A 5JW3L 4O9HL 2FIKB 4LP4A 3PDOB 3CUPB 4XAWL 5IR1A 2J2ZA 2VXUL 1I9IL 1RZ8A 2F54D 1CL7H 3QEUB 2IPUK 5IIEB 4OGYL 5ITFB 3E6HB 4UV4L 1WVZA 3QPXH 4DGVL 2DQFA 2ZNWA 2WBJC 2XNAA 4HPYH 4JE4B 4UTAH 1I9EA 2AV7A 5I76B 4TNWK 1CVSC 3QUYC 2NY1C 4L4VB 2Z35A 3UTPE 1KB5L 1R5WA 5F7WC 5IROA 3QDJA 3V0VB 4ZXBD 4XWGL 2AJUH 3HA0A 3MODL 2NY0C 1JK8A 1SYVA 1CN4A 5IHBA 3MBEC 1L0XA 1UWEH 2ED9A 5GJSL 3QPQC 3JZ7A 3FQUB 1RJYB 2XTJD 1X5XA 3OAZK 1ZWIA 3NZ8B 4JRXD 4NJAL 1VB9A 3C5SA 1FO0H 3DHJA 3MR9B 3NACL 1OGAD 4XPGH 3STBA 2Y36H 5C0BB 4IRSD 4LLAA 1E6OH 1G7JB 3ARVA 3S36X 3BEVB 1MRCL 1YEGH 2Z4QA 4HJJH 5EC2A 3O6LH 4HQQH 5T1LA 5CEXA 4Q97A 2OMBA 3QCVH 3STZB 4JY4A 3T1FA 5F1IB 5SWZB 1MVUB 3WO3B 1MNUL 1AQDA 1U3YA 4AMKL 1ZV5A 4NO3B 4LVHB 4KRPD 2R29L 2APTA 3KYKH 4PS4L 3D25A 4NN5C 4UT9H 3VXSD 4DKEL 1OW0A 3T8XB 4PRIA 2J8UA 3BOVA 5K9KB 4QRRD 1UC6A 5IEHA 5K9JH 1LO0L 25C8H 4ZFOB 4XRCA 2ERJC 2QL1A 3UPRA 1QR4A 1O7VA 1REIA 4TSAH 5HHPA 1IM9D 2PTUA 2ARJB 3W9EB 3OB0K 1YMHB 1TJHL 1IEBB 1OP5H 3DI3B 2R9HC 1E4JA 1BQSA 4C59B 3ULVF 1G7QB 1NAMH 4I9WD 4AENA 1EAPA 3MRNA 3KYNB 5ALCL 4OZGE 1UENA 1MRFL 3VD4A 1G7PB 1PG7X 1S7UA 3WDJA 5DTFB 4GH7B 3FB7A 3IDJA 3BEWA 5I6XB 1K9TA 3TJHD 5T3ZH 4YHKH 3D1MC 3GMOA 4PJIF 3C5ZD 4J4PC 3DV4B 4H20H 4NP4H 1KENL 5HHQB 1F3JA 3CNKA 5I17B 4P2RD 1BX2B 1ES0A 3P9LA 3RWGB 3FN9A 3P77A 5DUML 5E2WL 1CXKA 1YEJL 3JTTB 4OM1H 2W0KA 2OX5A 1TQCC 4K3DH 1FFOB 5TE4L 2OK0H 4X9IA 5KVDH 2D31A 3ARBD 4H1LH 1I7UA 2P46B 4RIRB 1NJ9A 1TJIL 4OGAD 4G6AC 2E27L 5ISZE 1C5CL 1NC2A 3ILPB 1QEWB 4OT1L 4CMMA 3GRWA 4RGMC 3RU8L 5GGSY 2WIIA 3MJ9H 3OX8A 5C92A 3L3OA 3K8KA 1MHHB 5BS0B 3TIEA 3QWRA 1K8IB 2FEDD 3RVXC 1AE6L 5B39A 4JCLA 4F7EB 4JLRB 3FT2A 1H3TA 2Q8AH 5EA0L 3FFCD 1R24A 3ULUD 1L9MA 4NHCL 2A6IA 1PQZA 4GW5A 2PF6A 3VI3E 3ARED 5I71B 4PJ5A 5E56A 3VXOA 2BNRB 2VO5A 1ZLUH 3QH3A 1I3VA 5EUOB 2Z31B 1RIUH 3LKSB 1ZGLP 2OJZH 4CADA 1WICA 4K94H 3M8OH 5MP6L 4G8FB 4LARH 4OLWH 4KI5D 1YN7B 2X9WA 3ARGB 1PVHA 5HDBE 3CK0H 1SEBA 3MX0A 4HV8A 5IMMA 2FECL 4OZIE 4KJWD 3AGVA 1LO4H 4UILL 2A74A 2HH0H 4WI7A 2RFXB 3WCYA 1UWXK 5HHXH 1NDMB 1P9MA 1HINH 1K8DA 1P84J 3KLAB 3QULA 3TVMD 4DW2L 5C0FA 5FO9B 2EIZB 1IGYB 5EU6A 5DD0H 2VDLH 2BY1A 2FGWH 2VC2L 1BZ7A 3VFTB 4PLKD 4P9HH 1AGDA 5IESH 2NY4D 4YFLF 3HHRB 4F9PA 5D1ZD 1MFBH 4C4KO 5HBBA 2ZUXA 2HTLC 1VHPA 2DL2A 2AK4B 2VZUA 4JPVL 5I1IH 4ONHA 1QFUL 3QXAA 3MXWL 1HIMH 1QYGL 4NZRL 3C6LC 2YD2A 1YEIL 2ZCHH 1V3KA 3FOLA 3GSXB 4OM0H 2Z8SA 3MRFA 1H15A 3PXJA 1TZIA 4LLQB 2A38A 3PV6B 4XAKD 3UTZA 2UUDK 4BSWB 5IG7A 3QIWD 4Y5VB 2QQNH 5TH2A 3QDMD 3QNYB 4UOJA 5IBUB 1U3HB 3BJLA 4JKKA 4MAYC 3MROB 3SDAC 1CDYA 5K59F 4WWKB 1WBZB 2PO6D 4J7RA 4QHUA 1MLCA 4L3EA 5DS8A 3U30C 1RZFH 2H2PC 3OKNB 2X42A 1BD2B 1WEJH 4UUJA 1WAAF 2D0FA 3WN5A 3VRLE 4QHKJ 3MLRL 2VDKL 1IZJA 1O0VA 3W11D 3ZL4L 3TBSB 4O2CB 2OLDA 1NLDH 3MRHB 4AQOA 3W5MA 1HHHA 2W07A 4HF5L 2NY7H 1JV5B 3EHBC 2GCYB 1NGXB 4FZ8H 3L3KB 4CVZA 3IJYB 4PRBA 4XB7A 3K2UL 3G6JB 3NIDF 1PKOA 4MXVF 3FONB 4TUOB 1HWGB 1XIWA 4LKCB 5JPNB 1JZ6A 1FL3A 2GTZB 3FN3A 4XBPA 2Q20A 2ICWJ 1I8LC 4LCIL 3DRQB 3QI9B 2XWJA 4I2XA 5IROC 2P8LA 3WIFA 1DR9A 2QBWA 1MHPH 4ODVH 4G8GA 2EEDA 1UACH 2C9AA 4LPWA 4YUEH 4JFXB 4ZUSB 4XP1H 4JPWH 1BBDL 3G5ZB 2R0ZL 3HUJB 3SPVA 5DJ0A 4JO4H 4DVRL 3SOBL 3HTLX 4P2QD 3DETD 2IALB 4L8SC 1FYTD 4NYLA 3GMMA 1ZGLA 1PJ9A 2DQCL 1GAFL 1WGOA 4PJ8D 3DJ9A 1FV1B 3QHFL 5ACZB 1NDGA 1QRNA 3ESVF 4N8CH 4Z7VB 3QEQA 2X5PA 4G6JL 5DRNA 3V6BR 1LGVA 3N06B 3PQYB 3FTGA 1FL6B 2WUCL 3SE4A 3S35L 4YWGH 3RZCA 1RUAL 2DQGH 3QUML 2X41A 1LK3H 2RHEA 4RA3A 1KIQB 1T20A 1OW0C 2G5RA 4OUUB 4LCYB 2CSPA 1P2CA 2IH1B 3BRGC 4KUCD 2YN5A 2BSTA 4YZFF 1VADB 4OKVA 1N4XH 3D3VD 1MUJA 1NAKH 3BP7A 4KZEL 1IGFH 3CVHA 2DMBA 1EHNA 1MCQA 3PWNA 2A9NL 5J8OA 5DZOA 1S7SB 2R1WB 4JAMB 1W72B 4LEXL 2Y1VA 3PP3K 4PJEA 3SKNA 1ACZA 2A83B 1MCWM 43CAB 4UV7L 1EFXB 5CEZE 5CGMA 3E6FB 1KTDA 1T7XA 4I8DA 1K4DB 5LQBH 4OI9A 1N6QH 4N68A 2FHFA 1YPZB 3OAUL 1DBKL 4HHAB 4PJBF 1YYLL 1BBJB 1JYVA 2M1KA 2B1HL 1OTSD 4Z7WF 2R0LL 1TIUA 4H26B 2WANA 4DUXA 3GNML 4YHZL 2J4WL 4IM8A 4PV8A 3SJVA 5FYLH 3UYPA 2F53E 4QRTA 3QEGL 4JY5H 4ZOBA 2DLFH 2BXYA 1JBJA 4DGIH 3RUGF 1HXMB 1ODAA 2X4QA 3HCVB 4CU6A 2X4RB 1BF8A 5I8KH 1YJDH 2FO1A 4Y2DA 2ADFH 3ILQD 1RHHB 3U79A 2DQHL 4HC1A 3L95B 1EBAA 1S7RA 3PGFH 3VA2C 3MACH 2HKFL 4L4VD 1BVZA 4JFEA 4U6TA 4Y5YB 1J5OH 3OJDA 5EWIH 2WQRA 4F57H 3EOYG 2AEQH 3RHWK 4W68A 1HHKA 4WI9A 2ZCLH 1D7FA 4WTZA 2MCPL 1LD9A 2DKUA 5D7JB 4LSUH 2V5TA 2KDGA 3ARXA 4NRZA 3T04D 3DVFA 1A14H 4ODHH 5B21A 2BSRB 2VXVL 4KZDH 1S9XB 5JQ6H 4E41D 1AKJA 1T21A 4FFZH 4PP1C 4ETQA 2ICCA 2CR6A 5FGSA 1Y6NR 4HZLB 4FXLA 4KK8C 2IANA 3CMGA 4OV6F 1MCIA 1A47A 1DJSA 5D8JL 1I8KA 2A9ML 2GJ6A 4MJ2A 4N0CC 5GGVH 4G42A 4X6BB 1QHOA 2HJKB 2V2XB 5C0BD 3KLDA 1KN4L 3V4VH 3TYFA 3JWOC 1LEKA 5D72H 5DJDA 1OSZA 3IFPB 4JFFE 4ZOAA 2PYEB 5DHXB 4NQDB 1HHGB 2ZOLA 3BPOC 2UVEA 1I8MA 5J7CC 1JNLL 3B9KA 1K4CB 5CP3A 4PREA 5SWZD 5KTEL 1A3LH 4U1KA 2IWGA 3N1GC 4LLVA 4LL9A 3ZYIA 3O2WL 3OJ2C 5INDA 1P9MC 1J0HA 2M8XA 3L1OL 5GJTL 4JKPL 4KXZI 2Y6SD 1FFPA 4NCC2 1G1YA 1NFDF 2PTVA 4GG8B 1BFSA 4FNLH 3VXTA 1LO2L 3ULUH 4ORGB 1SY6A 1IAOA 3G9VA 3LV3B 3LS4H 5F8QC 4BFIB 4F9PC 3VG9C 4WU5A 4U1JA 1M6OB 1ROWA 2E9BA 4FABH 3NCJL 1A6WH 3MUZ1 1DBJL 3SE3A 1MIEL 1DTUA 2YN3A 3MGAA 3TM6A 3TN0B 4LLUA 4Z7OF 4WI2A 5GGSA 1G6RB 1T04A 2LVEA 4PJIA 3ELAT 5DEGA 3Q5OA 1OM3L 5CSZA 2GITB 2P8MA 3RI5K 1WQVT 4HKXA 4OJFH 1DP0A 5IB4B 3GRWH 3L7EB 5KOVC 5EOQL 1YYML 4L8BB 3DECA 3GSRA 1RZGA 3WHE0 2BNQE 4JJHA 5EOCJ 4J8RA 5CEYB 4Z7NF 4X83A 4L8CA 1KGCE 5DK3A 3S34L 4LK4A 5J12B 1D5IH 1MY5A 5CJOH 3BI9X 3HZKB 1MI5E 3D39B 4U2ZA 3U0TB 4Z77A 4KC3B 3WLWD 2JELL 1E6JL 4GRWB 1JGEA 3R0MA 3Q5YA 3S6CA 5I19L 3F7QA 1JFQL 3GHEH 1T7YA 5GS0C 4GQ9H 2VR5A 5F6HI 1XF3B 4LIQH 5E9DE 1UWGL 3TNNA 2OL3A 4PBXA 3CFIC 4CVWA 5BS0D 1CLOH 1LDPH 3JWOH 4QRUA 1U95B 3E1F1 2YD3A 4L29B 2E6JA 4Q9QH 1A1NB 4LVNB 4QTHA 2EH8L 3VXMB 3BSZL 5KSUB 1JWUA 3DRTB 4PJCF 1XIWC 5FUZH 4ZPTA 1FNGB 3D69B 1A7NL 5HI3D 2X7LA 5GS2D 5LG1A 5I74C 4M7LT 4YO0A 2HVKB 1ZT1A 2QQKL 2BNRD 2BNUA 2OZ4L 3REVB 2YD7A 2SEBB 3L6FA 4XP5L 2HN7B 1H3XA 2Z31D 3O3DB 1CFSA 4HXBL 4EN3A 4LSTH 4Z7QE 2D7MA 2Y25A 4HH9B 2XKNA 4JO3H 1C16A 1I7ZB 4IRZH 1CGTA 2F5AH 4RMSA 5BRZB 1MVFA 3ARGD 5FHBL 4MA1C 1RK0A 3HAEB 2WK2A 5IGXL 1F58L 5ETUA 3DHMA 3NTCH 5AEAA 3NFPA 4MJ4A 2LE9A 1BP3B 4ELMB 4XHJC 1RJCA 3EFFB 3IDXL 3KWWB 2F8OA 4R26L 3QP3A 5LWYH 1ACYL 4PGBA 2CO6B 1F90L 4MS8D 1OHQA 1IGML 2ICWB 2NZ9C 3LKQB 4RNRA 2AK4D 3FZUD 3RZCC 4MNQA 1Q9OB 4JKMA 1QSFA 2I60H 2YD6A 1EERB 2Q3AA 3EOAB 3UJTL 3UYRH 1Z5LB 4R7NB 5JLZA 1YNKL 1JPSH 3WO4C 3CXDH 3WKML 3CX5J 3JV4B 1ZEAL 4NRXA 1F13A 3MV7A 4WHYH 4P99A 2VLJA 4JY6B 5GS0H 1QQDB 4NC1E 4AQ1B 2Q6WB 4MQ7B 1AO7A 1U58A 4AG4L 5EBGA 3VWJB 4FFYL 5HGGS 5E70A 4FP8H 1QBMH 1U3HD 1WAAA 4OCRL 5T1MB 2NX5B 5F96H 1UH2A 3ULSA 5JIPA 1VEMA 2VDQL 4ODUB 4I77L 1KB9J 4WWKD 3DX6A 1B3JA 1LP9F 4FQXA 2IQ9L 4WFHE 1BD2D 2JLLA 2R2EB 4QXGH 2VL5B 2A6KB 1J8HB 3TIDB 2OL3L 2DDQH 5CD5C 3U2SB 5E99L 2P48B 3QXTA 2OTUA 3LHPL 5IEKB 2BC4A 4PRHE 1TZHB 5HYIA 3RWEB 5IB5A 1YEHH 3MV8B 5C07B 3IDYB 1AGBA 4K7PH 4Z7UB 3GM8A 5C8JB 1FL5A 4ONFL 5D7LB 1T4KA 5F1NB 4AM0B 4GXVH 3MRIA 4U6VL 1EGJH 5FHAL 3W0WE 1ZKAA 4JPIA 3VFMB 3B5TA 3SO5A 2MNUA 2FO4B 4Y2DC 1JGDB 5D96B 3K8LA 1CXHA 4WFFD 1R5IB 1PG7L 3GHBH 3SO3C 1C08B 1HQRB 5IVXB 1PYWA 1S3KH 3QI9D 4OZFB 1NUGA 3AMLA 3L3IB 1OQXA 2ZZUT 4ZOCA 2R1YB 1MRDH 5BV7L 5DSCA 2Z92A 1L0QA 4UDTA 3RPIB 3IRPX 5IW6B 3MRQB 2FEEI 1SM3L 1SEQH 5GGRY 4JR9L 1YEEL 3BPLC 3GSOA 4ZAKB 3WE6B 3BP4B 2YA2A 5K9OB 4GW1A 5F9JA 1JHLH 2HWZL 1S78C 1SJEB 1T5WA 4ZDHA 1NEZB 1YMMA 1KV3A 1TQBC 4FQCH 4K9EL 2GK0B 3P0VL 4QRPA 2NTFA 4O4YH 4S1QH 3VDAA 3SDXB 5F1OB 3CVHH 4UT6H 5T3XD 2MCG1 1T1YA 4HPYL 1MFCH 1F45A 4HX1B 5DJ8A 1T0MA 1J87A 3A6BH 2M2DA 4ODSH 4CAGA 4PY7A 1RIHH 3B9KC 4WHDA 2XN9B 4XGZA 3PQYD 3U0WH 1QLFA 1HK6A 4DQOH 5DRZB 2V7NB 4G7YL 3DVGB 4GAGL 4U6XB 2AS5M 5LKNA 1OAKL 3VXRA 4KJYA 3RZWA 3HS0B 3B5HA 4OZFG 5E8DH 4PJ9B 3MYZA 3MLTB 2VR9A 3HI1A 4NQEB 2VDPL 1BJMA 1EFXD 5SWSE 5L8KB 4PJBA 1S7XA 4S1RH 3SE3C 4K8RL 2Q7NA 3DOSA 5L2JB 4HJGB 4Z7WA 4X4XA 1HWHB 1GRWA 5GRUH 1GJIA 3RNQA 3B2UD 3BH9A 4YDVB 5A3ID 32C2A 4DTGH 5DRXB 3BUYB 1A7QH 1NEZG 2CGRL 1AD0A 5FXCH 2YOCA 4OFYA 3PWUA 5J89A 1F4XH 3RUGA 5JW5A 5C09A 5C0AE 3HLAB 3C2AH 4CVXB 5ELIA 1FPTL 3RIFK 1ND0A 1T1ZB 2DBLH 5K9JL 4XPTL 25C8L 2DYPB 3BO8A 3MRRB 4WIQA 4X5LA 1T03H 3L5WB 3AUVA 2BMKB 5FCSH 3BZFB 2GAZB 3QJFA 4K7PX 3DUUA 5JTWA 5D2NB 5MERB 5E5RB 5ADPH 1MWAB 1U8NA 4PJDE 3CSYB 5IVZB 3V7AE 1DL7L 4M1CD 5IF0A 5DJCB 1ERNA 4ENEC 5KZCB 1NUFA 4AJ0A 1XCTA 3RFZC 5D7JD 3VFUA 4OZGB 2IBBA 4B7IA 4AH2A 2O26U 4PGCA 2A73B 4M6NH 4UOW1 3CH1A 2IFGA 5INCB 5T3ZL 5CP3H 1AP2A 1B4JH 4ZUVB 2W9DH 4XWOC 4PJ7B 4JANB 3CFJB 1DQDH 4NP4L 1MFDH 1OOAA 3GDBA 1Q0YH 1T7VA 3F12B 1JL8A 1AR1D 4EN3C 4O2FB 1UZ8A 4KUZH 4PLOB 2R39A 4HWEH 1A6VH 4K3DL 4CRPA 2D0GA 4LHQB 3WLBB 3GSQA 3ULVH 1SY6H 5HXMA 4LHUG 2PYED 4NQDD 4Y4HA 4TULH 1U8HA 4BFGA 2VH5L 5BV7C 4RGOL 4WFEE 1F02I 3KPPA 5HHOA 4NZDA 1VFUA 3GM0A 1HNGA 2BDNL 2NXZB 4JJ5A 4XB8A 4GJTB 5BMFH 1NFDA 4NBYB 5BVPL 4IOIB 4WVRA 5E95B 3MOQA 3MRGB 5LVEA 4J3WA 2GHWB 2FJHA 4J3VA 3KYMA 4AIXA 4M6OL 3CZFB 5MI0C 1MLBB 1WWWX 5DD6A 5ANME 5E2UL 4OZIF 4NQVB 2ZOKA 4XVTL 1FZMA 1U8PB 3MNWA 1A2YB 5ICZB 2F8VA 2HRPH 3CU1A 3NCEB 1U9KA 4JGJA 5CZVH 1RK1A 1WC7B 3VFVA 4PGEA 2FCBA 1BPVA 1N7MH 2L4OA 3WUWG 1H3VA 4WHTB 3MXVL 3VWKC 1QFOA 7FABL 3S5LG 2GSGA 3TN0D 2C4FU 4LF3B 3O2VL 2DWEA 4LARL 2QQLH 3ARFA 2UYLA 4NJ9H 3O3AA 4HIJB 4KKAC 1FNSH 4PUBH 4ZQKA 2AJSH 5C0NC 5F7EH 1L9NA 4LNRB 2CRIA 2LTQC 8FABB 4TUKH 1LO4L 1GCFA 1I1FB 3TFKC 4G9FE 2YR3A 4MSWB 1YUHA 3O41B 1AD9B 4GMTL 1A1MA 1OP3K 3ALPA 3G04B 3CLEL 3M1BA 1KELH 4FQXC 3FO0L 3UPCA 5DD0L 1KBGH 2E6PA 5KSVB 5B8CA 2JJTA 1F8TH 4MA8L 2P24B 3D39D 4K8RC 4HXAH 1ED3A 3H3PH 4RA0C 1U8OB 1N26A 3F7RA 3VXUB 1LE9A 1UEYA 3D85A 4TSBL 3G6AA 1CGWA 2ITCB 2ZUTA 5JDSA 4NNXB 1HIML 1KC5L 4GW4B 3MLZH 4OSUL 4U1MB 4Y5XB 3L3HB 4C56B 1FAKT 5KSBE 1LMKA 5JR1H 3VRLF 4YK4C 2YWYA 2ZCHL 5AD0B 4EDXB 4IJ3C 1WF5A 3UYOD 2CDFA 1EXUA 4GMSL 3KPMA 4WEUD 2IBZY 4ZTPL 1HHJB 3MCKA 3JSSA 2IMNA 1T1XA 2XA8H 1HNFA 2ITDA 2HFTA 4YXKH 3H9SD 2GW5A 4JFDE 3GBNL 3RGVB 4U1GB 3RAJH 5KS9B 1GGTA 3NCCB 3VJ6A 2IG2L 4XNXH 4NWTL 5IWLA 5FYJD 3B8SA 3JV6B 3GFUA 2OR9L 1X5AA 5HGHB 2ID5A 5SV4A 2EH7H 1EHXA 2BSED 5DC0A 2LU7A 4P2OB 5DGRA 2O61B 4XNUH 3WFEL 1K3ZA 2EYTA 4X6CB 5IQ9B 1TVHA 4K71C 2AKRB 1ZVHA 3R1GH 1OSPH 5KW9H 4U6HB 5BRZD 3AM8C 5B4MD 3OR7B 4Q2ZB 3RDTA 1UB6A 1P4LA 4JDZB 2C4FT 5D5ME 1NGWA 4XPAL 1IC4H 1TNMA 4QHLB 5L9DH 3FQTA 1MFEH 1VGKB 3PJSB 4LCCB 3BESR 3DIFB 2CUIA 4NQCA 4Z95L 3O6FA 1KEGH 3U4BL 3I75B 4JFHD 1FZOA 5I66A 1P6AB 3GSNB 4OLVL 4ZYKA 1WCQA 3GUTB 4RGNB 3ARDA 3O8XC 4FTVE 2ICEA 5FYKH 3MLSL 2VWEE 3OXSB 1FJ1A 3EFDL 5IT2L 3QNZA 1RIVH 4RMVA 1HXYB 3GMRB 4JDTH 2OQJA 1XH3B 4WO4C 2GFBA 1XF5B 3IS1X 2YK1L 4X9FA 1A4JB 4XPFL 1MJ7H 1TETL 1KF9B 3HC3H 3MRMA 4LLYA 1JTTA 4QEGA 3QCTH 3RTQB 3A6OA 1AHWA 4I48B 4NWUH 4UBDD 5CIPB 1ETZB 4OLYH 1ZHLA 3S97C 4Q6YA 3UC0H 3KNBA 4KDVA 3BPCB 4HLZH 3TYGH 2VLRB 3VWJD 1LP9A 4MZ2A 5CBEB 1JZ3A 1KCVH 2DJUA 1ITBB 2NX5D 1YQ2A 1TITA 1CDUA 4FFVD 1WZKA 5T1DH 1XF2B 5T3XH 5GISH 5FIEA 1U6AL 3QQ9D 5JOFB 1J8HD 3MLWH 1R3KB 3QO0A 1PX3A 2AEIT 2EYRB 4L3AA 4JRWA 2QHRH 2DQGL 2DKSA 3EW3B 3MV8D 4N5EC 5C07D 2XPGA 4GBXB 3WJLA 1B6DA 1FHGA 3PWVA 5D7LD 4JFQB 1XF4A 3O4LE 1OTUD 1AGEA 1HH9A 3IFLH 4FG6D 1ZANH 1CXFA 1VESA 1RZ7L 2JJVA 2H6PB 3HFMH 4JPKL 5JHLH 4POZD 4O58H 3T2PA 4PJGB 2Y23A 5D6CB 5A1AA 4F7TA 3NGBB 1DUYB 4D0CB 5GRWA 4NM4H 5T1KB 3BMVA 4JGMA 1S5IH 1IL1B 1JPGB 3DX7A 3LY6A 4O2EA 3ARWA 3GBLA 1FNFA 4BH8A 1KJ2A 1HKLH 1DLHA 3M17A 4WFGD 1NBVL 3SDCA 1JGVH 2FX8H 3B8YA 4N90E 4K7FA 1W0YT 5H35B 1NBZA 3OG4B 4HDIB 1S7QB 3TBYB 4ZAKD 3WNLA 4NUGL 3T08A 4R8WH 2C1OA 3AB0C 4JY5L 1X4ZA 2DLFL 5EOTB 3DGGA 4KK5C 5LBSH 4BKLA 4R9HA 5CCKH 3HI6L 1M71A 4IIQA 5E8PB 5SV3A 4MD5B 3CDGB 4R0LB 4HWZA 2DLTA 3BMWA 2HFEA 5C0JB 3TBTB 3CLFH 4Y4HC 3MACL 4RFOH 4EKXA 5DK0B 1M7IA 1EVUA 3MRDB 4RWHA 2XN9D 1CK0L 2QV2A 5J4MA 4XZUA 2AEQL 5DJXB 3G08B 3UTPD 4AEEA 4Y4KA 1NSNH 3LQZA 1ZT4B 5ID0A 4HT1L 2IGFL 2YRPA 5HPMA 1R3IL 2FYYB 3LKNA 3QG6A 1GOHA 4PJ9D 4CW1B 5F3HA 1H8OA 4PJAB 4RAVB 3IKCA 3PNWA 3VH8G 1XGQA 2FBJH 4NQED 2D9CA 2HG5B 1CFNB 2YC1B 5GGVL 4G8EB 2O5ZH 2W0PA 4YBQC 5EB9A 2KQNA 5F7LB 2EDEA 3RWDA 1JHKH 4AYFA 3BD3A 4EBQH 2ZPKL 3U0PB 3LPGA 5HYFA 5DMYA 3ARFC 3RVTD 4HWBA 2CDGB 5D2LF 1RURL 1QSVA 1NEUA 3RVVD 2GSIA 3MZGB 43C9B 4ODXA 5F3BB 1R0AL 5EIVA 7CGTA 3QZWB 3OJMB 1YY8A 2IFFH 4M1GH 4J3SA 4Y4FA 1U3JA 3D0LA 4U4BA 5MEOA 5HYQA 1CE6B 1V8HA 3VD3A 3G5YB 4WUUE 1UXSA 2DYPD 4FNLL 4DFIA 5B8CC 2JJTC 3FQXB 3CXHK 4PJFB 5M95B 5CKGA 5CP7A 1TZGL 3LS4L 2F19L 3AAZA 4UTBH 2CIIA 4YFDB 1W0VA 3DTXA 4JG1H 4DVBA 3LEVL 5IFAL 5ISZA 5IOPB 1FLRL 2PXYA 3STLA 5KZCD 4FA8A 5CBAA 5DFVC 2PW1B 4KDWA 3RWCB 4NKIL 4HUUB 4HPOL 3W2DH 4ZXBC 1PKQB 2HYMA 2X1QA 3IXTA 5I8CB 3VFPB 1HSBA 4U1NA 2APFA 4FRWA 3HNTH 5IWLC 2BVPA 4PRPE 3OKYA 1ITCA 1EEZA 4W6XB 1Z9LA 3P9WB 5IJVB 1EEYA 1WBXA 2FDBP 2XWTB 1EUUA 2BOCA 1JZ4A 4QTIH 3BT2H 4X98A 2IQAA 4N0YH 4RFEA 4U2YA 5HJ3B 1MI5B 4GRWH 4X5WA 3GJFH 3HMWL 3RDTC 3QDAA 4IS6B 1H0DA 4PJ8A 4Z9KB 1QNZH 2NXZD 4Z6AT 3KJ6L 4Z7QF 5E4EC 3IGAB 4I18C 5HY9A 3HB3D 5E9DB 1CLOL 4OZIA 1VCAA 1F3DJ 4FQQA 4Q9QL 3O6FC 1CXLA 4OLEA 1YEDA 4XCNA 2HLFD 4EXKA 2YUXA 3GI9H 3ARDC 3K4ZA 4TQEL 4BH7A 4ZSOE 1JMZA 1G7LA 2P5EE 1CICB 2LV4A 5HYSG 3FN0L 4TPRL 2F74A 4YDLB 1DVFB 2NW3A 1R3HA 4NC2B 4OD3H 2ZSWB 3SKMA 3FQNB 4TRPH 2NCMA 1WJ3A 1KPVA 1B2WL 4KQ3H 2NY5C 1NCNA 4QXUH 1MAMH 2P5WB 2WV3A 3Q3GA 1Y0LA 5HI5D 1HDMA 4P4KA 1S9YB 2DM2A 4OIBA 1AHWC 2PTTB 5DFTA 5HVHB 2CKBA 2EXYD 2YS4A 4H8WL 3CFDA 5KAQG 4QXTA 5BZWA 4NKOB 1XF1A 3ZKNC 2EDKA 3LDBB 1CF8H 3SKJH 4YDIL 5I1GL 5ADOH 4PRNB 1YN6B 3LEYH 3GMNA 1AGFA 2H3NB 3NZHH 4JFYA 1MAJA 3P9MB 5DD3L 1F11B 4UB0L 1N8ZA 1CFQA 2VQ1A 3QEUA 5JZ7D 4WI6A 1Q38A 4KQ4L 5GRJL 1BZQK 2FECI 1GPOH 4Y1AB 3MLXH 3PHQB 3WJLC 5KVFH 5TQ0H 4C56D 5LGJB 1WZ1L 1DQLH 5EN2B 5ITBH 3BN9D 4C55A 3ECBA 4JM2F 4XPHH 1A6UH 2MKLC 5F7FA 2OP4L 1J8KA 2IPTH 2AJXL 1DQJA 2GT9B 1OAZH 3RGVD 5AZEH 2NYYC 4ZUTB 1YC7A 2VNCA 4DN4H 1KIPB 3TCLA 3PWPE 6FABH 1ZHBB 3EBAA 1NMBH 2UWEE 3CFKB 4PRDA 1F5WA 2YD9A 3L3JA 3X3GL 3T65B 4LCWA 4P2OD 1RY7B 4PR5B 3V5HB 3T0AA 3OKDB 5B38B 1A6AA 4K3EH 3SDCC 1SJXA 4YE4L 2Y7QA 1YECL 4Y16B 3QDGE 5F6IB 1Q9WA 4Z76B 4X6FA 2XI9A 5DUBB 5T33H 2FB4L 5GRVL 1X6NA 5CJ8A 3DNKA 4KI5C 3R06B 5DJ6B 3P30H 1JN6B 5DMGD 4PG2A 1LEIA 5L8JB 2GKIA 5EUKA 3OKEA 3VI4E 4IIQC 3D2UA 4QHMA 2NXYB 5FB8B 5L6YH 4POYA 2BY0A 3RY6A 2KH2B 1D6EA 4KAQH 1PY4A 2R2BB 4C4KT 3U83A 4HUXB 3QXVA 4RGND 2KZWA 3TH2T 2H8PA 3GSVA 4XCYB 3TO4A 1I9RL 3IF1B 5C2BL 3UMTA 2VKXA 2WWMC 4KKCD 2X05A 4PTUA 4XT1C 1T66D 2C3VA 4Y4KC 4R2GB 2AABL 3LQAH 1FCGA 2VR4A 1XZ0B 2VZOA 1OPGH 5FF6A 2IEPA 1KLUA 4PGDB 5F7DB 1CBVL 4M6MH 5DQDH 4FFWD 3QDJE 1UYWH 1QPXA 4XVUD 3S96A 5H8DA 4Z5RA 5IV2B 1FE8H 1CTNA 1NMCB 3R4DA 2YXFA 1KXVC 2IH3B 2AJ3B 1MOEA 3DX9A 1FORH 2VLRD 4HBCH 3QCUH 4AEFA 5DTFA 4D3CH 4F15C 2X4PA 2PW2A 4S1QL 1U8JB 4XVJH 3ZT5A 3UX9B 3D6GA 2AI0L 5I17A 1BX2A 2X4SA 2XQYG 1QBLL 2EDBA 3U0WL 1AI1L 5CLTA 5HHME 3V5KB 4Z0XB 8CGTA 4MJIB 4AEHL 4GBXD 1UA6L 5EFIA 1K3IA 2F53A 1INDH 2CLZA 3HZYB 4NDMB 1F6FB 1JF1A 1KJ2H 4H8WC 4Y4FC 4B53A 5BVJA 4NPYB 1VFAB 1SHMA 2X4UB 2K3TA 3NCBB 3QUZB 4HUMB 1ZLVK 4TVPD 2JB6A 1WTLA 4IDLA 4LSRL 5BS0A 4OCXH 2FL5B 3IVKA 4BSVB 1FVCA 2Q86A 3BWUC 3MA7A 1JRHH 2Y72A 1XCQB 1FYHB 4MJ6B 5GS1B 5SWSB 3JV5A 4M7LH 1DQQA 2PXYC 2DOCA 4CVUA 4Y19A 2I9TB 5T1KD 4Y8DC 3H3KA 4DTGL 4E0RA 4N9GA 5L0QB 1A7QL 1KNOB 3DSFH 2Y06L 4YFEA 1TNNA 2JF1A 2DLGA 1OLLA 4GXUM 2AAVA 3CCHA 1DFBH 2V5YA 3MGOB 4NQSA 5FM5O 2BY3A 4BZYA 2DICA 2YXMA 4R7DA 12E8H 1XEDA 2EO9A 3MCLL 3BDYH 3HC0A 3KS0J 3FB8B 4IEFB 4M5YH 2YUWA 3QNXB 4DKFH 5IKCB 1P1ZB 3ARPA 2JIXA 4JFFA 3L3DA 1R5VB 4PJ8C 4GG6E 1MWAH 1S9VA 2A6DB 4PJDB 3VXQA 5HVGB 4JGUA 3WHXB 3PGDA 4JO1H 2EKSA 3IJSA 3QHZH 4HKZA 4I1NB 1XR8B 5FCUH 3U4EB 5J13B 4PJHB 1AXTH 5J9PA 1SBBA 1IVLA 3LRSB 3ZKXB 1T3FA 5EIIA 3EDKA 1Q0YL 1CXEA 1VKXA 3F8UB 4PV9B 3PG2A 2FGZA 5JORB 4G5ZH 3D9AH 5D2LA 1NKOA 4G80A 4P4KC 1F42A 5DWUL 2CMRL 4PJ5E 1UB5A 4PFEA 1MHEB 1IAMA 4QT5B 4X4ZA 2EXWD 1E4XH 3WFDL 2ZKHH 1B0GB 1KTLA 1MCDA 4Q9BA 3LRHA 5H37H 3OB8A 4NFDA 2HVJA 1U93B 4MCZA 4Q6IB 3HE7A 1BD2A 3O45B 4LFHG 4EI5B 4MYWB 5F1KC 4YGVB 1EZVY 1YY9D 1E4WL 1OARL 2HLAB 3HZMB 4XMLH 4APQA 4O2CA 1JYXA 1TTGA 2DM7A 2BNQA 4MDJA 4ZO6A 2EDOA 3LB6D 1VPOH 1JV5A 1NMAH 1INQA 5BQ7B 5GS3A 2C1PB 3BPNC 4O51B 5EBMB 4OLXL 4Q9RH 2X1XR 1YEKL 3T4YA 1PY9A 3HC4L 4X7TB 2JCCF 4ZTOH 4HAFA 2NMSA 2AXJA 3ILQC 4AEIL 1CG9B 5TF1H 5ICYB 1FC1A 3J7HA 3R8QA 3HG1B 4H25B 5CGYD 3WHE1 4KTDL 1VEPA 3Q6FA 3I3BA 2VSDA 3TH3T 1QSEB 1BWWA 1UEMA 4P2CG 5IUSA 5KVGL 4JKWA 3RKPA 3SGEH 5D1QA 4DEPB 5FECA 2E7HA 3K0WA 5KSBF 1PLGL 3RWJA 1IJ9A 4YBLC 4LPVA 1KJVB 3VMNA 5I15H 2BZDA 1QLEL 4O00A 4BK4A 3K81A 3IU3A 3QFJA 5C0DB 3B4NA 1NCAH 1KBGL 1ORSB 4DGYH 1YNTB 3MRKB 4JVWA 1F6LL 1BVLA 4I3RH 4WEMB 2FJFB 4X8JB 2DTML 4F7PB 1ZVSB 2VLKB 1WWAX 2MQ3A 5DQ9B 3LPFA 1BVKB 5HDQL 1YDPA 4BQ8A 3V6ZB 1MI5D 3QFDA 1IC7L 2E9JA 3QAZC 1JCKA 4YAQA 1WBYB 3WDHA 1UM4H 3THML 3X17A 2WSKA 5CZXC 5JR1L 3U6RA 4PG2C 4M1DL 5E9DD 3OAYH 1I3GH 1Q1JL 1HQ4B 5ERWB 3RY6C 4B50A 3QJHB 5I1HH 2CKBH 3OKLB 1U42A 1IAKB 4LVHC 3MFFA 2DJ4A 3KDMA 3PHOA 2QADB 4YPGA 1QKZL 1KIQA 1HEZA 1CICD 4OUUA 4YBHA 3TCXA 1FLTX 3UTSE 3WD5H 2DI9A 5H2BA 3TO4C 1DVFD 4X8XA 2IH1A 3BISA 2AXFB 4M3KB 5C08B 1ZHNA 3RVWD 4XC3H 1B6UA 3W9DA 3SDDB 4KRNA 2P5WD 2VLMD 3MNZB 5AYUL 3R8BB 4DZ8B 4YDKH 4NNYA 5C0IB 1KYOK 4N8VB 1T1WA 1UVQA 3MGTB 3TBVB 2AJZB 4ZFFA 1YQVL 3O6KH 1I7RA 3SKOB 3T4AA 4KTEH 4MCYA 1DZBA 5CUSL 3C5JB 1JUFB 2YKLH 2V7HB 3C87A 3KXFE 2FIRT 5IHUL 4D0DB 3EJZD 1LO5B 5D5MB 1KCSL 3T0EE 2YZ8A 4YJZL 3VGEA 4BZ2H 4JZJB 4QKXB 2VKWA 3KPLB 1NGZA 1L7IL 3LN4B 2BJML 3QHTC 3VCLA 1P4BH 3KPRB 4FQJL 4OFVA 5ESVB 3WFHA 1CGSL 4LGSB 4XMKL 4XH2B 2KKQA 3GSNH 1JPFA 1DN0A 3C60A 1FGNH 4XHQA 2N7BA 1GH7A 1QO3B 2NNAA 4GS7B 3UZQA 5C2UB 2YPLB 3CU7A 4JM2A 1EJ6A 4YXLL 3B9AA 5EZJA 2AJYH 4Y1AD 4PRHA 3L95A 3BWAA 4NHUB 5MEPB 1Q9KA 4GAJH 3QEQE 4FQLL 2HT2D 4LCUA 2DQJH 2XOTA 1N3NB 3X13A 5I1AB 4MJ5A 3W0WA 5FV1L 4MZ3A 4PY8I 5CIPH 1UM5H 3G5XA 2DWDA 1BFVL 2FHBA 3ZDYE 4LSVH 3LCYA 1Q72H 1X5GA 2BSRA 4AL8H 4AIZB 1TCRB 4G7VH 2RJMA 3C09B 5IBLD 3V8OA 2J5LC 2H1PH 3OBAA 3VRIB 5I1EH 2B4CH 3V6FA 2GIYA 2X70A 4PJ7F 2VXSH 1JZ7A 1XGPB 5IMKB 3DXAE 4E42A 4Y16D 4YHNA 4TTDC 2DQUL 1CLCA 4JHWL 2ADGB 1M05B 4WRLA 5TE7H 3D48R 3IFNH 4F33B 3TBWA 4OD1H 4ZO9A 1WWBX 2DQEH 3HNVH 4FXKB 3VD5A 2NXYD 2Z91A 1JWMB 1LO3H 3KHQA 5FKAB 3TLRA 1MCOL 1EO7A 4X99B 1G9MH 3MLVH 2HJLB 4S10A 4I3GA 4M9OA 4PTTB 1W72L 5CJQH 1I7TB 1DSFL 2QJDA 3AXLA 3NN8A 4Z78A 4B5EA 2IBGA 4NM4L 3BGMB 2WQ8A 5CEZH 1C5BH 4R2GD 4MAUH 4LEOB 1BM3H 1IILE 3RWHA 4BFIA 4TOYH 3P4OB 2IBZX 2X4TB 3MRPB 5DJ2B 5C7XH 1L7TL 3K2MC 4JREB 2EYSA 5IFHL 3VXPB 2NY2B 5FUOL 3TV3H 4BQBA 2XZCH 3VFGH 1RJZB 1W8OA 2W65B 4P3WA 5DDHA 4XI5C 1I85A 3TT1H 5IMLB 3UTTE 4Q58C 3EYVB 4XPBH 4ONGH 2G5BB 3C9NA 4M7KH 4J3OC 2LQRA 2EDWA 2GJ6E 3GKWL 4RFOL 3EYSL 5DR5L 4OBRA 1NBYA 5A16B 4BUHA 1NAMB 4EUPB 3HE7C 1A4KA 1DDHB 3DROA 4MJID 3QG7H 4NQUA 3MRLA 4M5ZH 5IW1A 3L5XH 4APQC 2WBJB 3EYUH 1LVEA 4G8IA 4U1HB 3EYOB 2IADB 5C0AA 2E9IA 3QUYB 2DQDH 3QUZD 3BQUA 2NY1B 2Z9TA 4OQTA 1ZHKA 1ORQB 1U8IA 2WAHA 1A6TA 2I25N 3TO2A 1RD6A 4ZD3L 2H2SD 1TCMA 3LKRA 3V52H 2F8XC 4RISL 1RZIA 4OD2B 5EZOL 4J1UB 1N64H 4HFUH 3VXMA 2DD8L 5SWSD 4CN4A 5EPMA 4XP4H 3D69A 5JA8B 2R8SH 4X7SL 2EECA 4KROC 4H1LB 2DRUA 1ZLSH 4ZUUA 5MHSE 2C26A 1IE5A 5D1QC 4JRYA 1EUTA 2OJEA 4WUKH 5I30L 2EICA 5DHYA 4KPHH 4MVBC 3TA3B 5IM7A 4HAGA 1E4KC 4G6FB 5BRZA 5I1KH 3GMLA 5DHVH 1HI6A 2VDOH 2BCKB 1GGIH 5EC1B 3RVUC 1PDKA 4WUUB 4NZTL 2X89D 1NFIB 2BOBB 3F7PC 4DK6A 4KKBD 2HJFA 3T3PE 4YHPA 5J6GB 1KTRL 3WNKA 4HUWB 4NN5B 1IKNA 3B2VH 4HGWB 4R4BB 4D9RD 1BQLH 1CD1A 1GZPB 5GSRA 3S4SB 1RZKH 2PR4L 1AJ7L 1IC5H 5EU5B 4G6KH 2ESVB 3SQOH 3T0BA 2ERJB 4LOUC 1AQKH 1T22B 2W1NA 3C6SB 3F62A 4WJ5A 2FWOB 9CGTA 1G6RL 1SMAA 1CZ8H 5DT1L 2DQIH 3PABA 3U36A 1OTTD 3AFLA 1A7BA 4EQ2A 3BYTA 3I3DA 4ZNEE 5TE6L 1JGLH 3WS6C 5ANMA 4LVOB 2ZUUA 3HNTL 5F9OH 4P4RA 2BVUA 1AC0A 3PGCA 2MWCA 5D7IF 2PNDA 4LAQL 1U8KA 4R4FH 1F2XK 4QTIL 4DUWA 1QQDA 4WV1A 3GMPA 2A2QT 3NA4A 4R96B 2Q6WA 4HUKB 5EBLB 5F9WC 3SDYH 3ZHLA 5IB2B 5E08L 3PE9A 4X6EA 3OKMA 2XZQL 2VQUA 3FB5B 4RMWA 4IMKA 1AY1H 1A9BA 3MOAL 4R90H 1EO5A 5D71H 1K2DA 1U8MB 3W39A 2WLZA 2CLRA 3PV7A 1LE5A 5GZND 4EI5D 5JHDB 3CFEA 1TQCB 4U05A 3WV0A 1XGRB 4MA7H 3OZ9L 3U1SH 5BOPA 4DOHE 1GIGH 1MHCB 4GAYB 4G9FA 1U8LA 1YC8A 3BD5A 1H3PH 2I07A 3RY5A 2JCCA 1NLBL 3OMZA 4RGMB 5F97E 1Q0XH 3MLYL 4MB4A 3IDNA 4LDOB 5IB3A 4TRPL 3BVNA 4YEEA 3DVIA 5FYJL 1NCUA 2G2RA 2XIDA 3KPTA 4JM2C 1JGDA 4HCRA 4I5BB 4NO2A 1PG7W 3QRFM 5DA0B 4JQVA 3HG1D 3EO9L 4EOWL 3ZTNH 5J1TC 1F6AA 4UQ3A 3RNKB 3T0VA 3P4NB 1A7OL 1BREA 4LBEB 4OZFA 2VXTH 5KSBA 1MPAH 1QSED 3LN5B 3UXFA 3KLHC 3BKCL 3UBXB 2ZUYA 2AK1H 5D7JC 5CILH 3MJ6A 4RQQB 3WNMA 1CF8L 4JFDA 5F89B 3X14A 2YWZA 1KB5B 4KJQD 1Y18A 2Q8BH 4G43A 3MV7E 5C0CE 1GHFH 5JNYB 2VLJE 3LEYL 1BWMA 5F88A 3WEXA 3TZVA 3KHOA 4KFZC 1AO7E 4GOSA 5J1SC 3H42L 2VLKD 3RL1A 1ZA3A 3B5GA 3DV6A 3BZ4A 1TJGL 5KVEH 5JXAH 3V7MA 5KN5B 2CXGA 5J1AA 3MCG1 4RSVA 2GI7A 3OAYK 1DQLL 4N1HB 2HKHH 3BHBA 3EUUA 4PP2A 4U1LB 1ZTXH 3LMJH 1KPRB 4U3HA 4OUOA 2YSSA 3LIZH 3WS3B 2VDRH 5LGKA 1FCCA 3NIDE 2QADD 3O0RL 3OGCA 3QWOA 4U6XA 4MXVE 5EU7E 3VI4F 5JOEA 4DN4L 4QF1A 2VERN 2D03H 3TNMB 3VFOB 5C08D 5D7SH 5EBWA 3HMXH 5L88L 4XCCH 3D0VB 4KJPD 4XMPH 5ABDE 3SDDD 1AXIB 1I1YA 3UBXG 1KJ3L 2UWEB 5EZLA 4E5XB 1UZ6F 3JWDL 4CU8A 4XP6H 4NRYB 4J3TA 5I9QB 4D8PA 3WIHA 1P7QA 4FOMA 5FKPB 3TN0C 5FOBA 4JQIH 3OKKA 2P4AB 3QDGB 3SDAB 5T33L 3VE0B 5DUPL 3U30B 2AXHA 3T77A 2V2WA 1I85C 5KSAA 1EFQA 2AGJL 3ES6B 3DMMA 3BKYL 3PL6A 1LK2B 2RBLA 1HYRC 1TVDA 4X7FC 1QR1A 4NSKA 3KPRD 4LHUA 5TPWL 3K7UA 3HLAA 1YMME 3RQ3A 3H7BA 4P23A 1P4IH 5T3ZE 3TH4T 4FTVD 2NLJA 1RZ8B 4S1SL 4JFZH 2P8PA 3UBXI 1NGPH 4HH8A 4X0KA 4JG0L 3U9UA 2YPLD 4LRNL 4YH6A 5TDOA 1M7DA 2DQFB 5HYJE 1G7IA 2XNAB 2AEPH 1GC1H 2AV7B 3L5IA 1JHTA 5L8LB 1BJ1H 2F58H 3BQUC 2Z35B 4WEBL 3BDXA 3UAJD 1Q8MA 3U4AA 1BIHA 3O4LA 3RKDC 5GGUA 5E6IA 2YPKA 4YZFE 3QDJB 1X7QA 4Q0XL 1PZ5A 5HGAA 3VXRE 4X9GA 3RL2B 1SYVB 5FA3A 3WUWA 3RX8A 4A6YA 5EZIH 2AXGA 3S5LA 2J6EA 3ZDXF 5DMIL 1KCUL 1JGUL 1QP1A 2E7BA 3B9DA 4PJ7A 1FP5A 1ZWIB 4P5TA 5ENWA 5HVWA 1FN4A 1NGYA 3WS6A 1Z6JT 1CFBA 3EO1A 3I6KA 3WIIL 3C5SB 4PJBE 3TP4A 2Z93A 4UINH 1D5MA 3OB0H 3MRBA 1T2QH 5ACMA 3INUH 1QRKA 4NKDA 5JOPE 5KAQF 3SY0B 1IT9H 5JPMA 2Z4QB 1TVBA 4LSPH 5EC2B 4YXHH 5T1LB 1RVFH 4L4TE 4RWYL 5CEXB 5GGQL 2XT1B 3BKJH 4XNYL 4JY4B 1J0IA 4O02H 3T1FB 5DZLA 1RFDH 3LKPB 4PG9A 3LAFA 1AQDB 2VITA 3OPZH 3RUGE 2F5BH 4QO1A 4Z0BL 4NO5A 3JTSA 4ZS6C 3D25B 1U36A 3G6DH 1IKNC 1DQML 1J18A 3VGAC 4PRIB 2J8UB 3QRGH 2VOTA 5IEHB 4GSDL 4XRCB 1KCRL 3UPRB 3P0YL 4NBXB 5C1MB 4N1EA 4LQFH 5HHPB 3LEXA 1L6ZA 1KFAH 2C7UA 2R1XA 1SJHA 4GG6F 3UO1L 3T2QA 3O3EA 1UQSA 4NT6A 4AENB 1TFHA 1EAPB 3MRNB 2A0LD 3P11H 1V5JA 4KTYA 1RUMH 3KJ4B 4LF3A 2NY2D 4M00A 1II4E 1RHFA 3S88H 1S7UB 3I2CH 1UT9A 4OIAA 4UBDC 3HNSH 12E8L 1B0RA 3FB7B 3IDJB 2K7PA 3BEWB 3MBEA 3CXHJ 4OQTH 8FABA 3NA9L 4WV1C 5GSVA 1D3CA 1CFVH 3GMOB 3SEPA 1XR9A 2WP3O 1A3QA 4XC1L 4IMKC 5HGBA 1F3JB 3O2DA 1S9KC 5A2FA 1ES0B 3P9LB 3P77B 3I9GL 1N5AA 3JWDC 5FA4A 1WV7T 5DFWH 3GZKA 1PSKL 1OAXH 3F7YA 2D31B 3VFRA 1I7UB 2WBJD 1NJ9B 1OVZA 3VXUA 2W9EL 4G9DA 4DN3L 4FQPA 4K2UH 5D4QA 3NAAH 3QUYD 1QACA 4A6YL 1NC2B 2NY1D 4YIQA 3F7VA 5E00A 3NCYS 4CMMB 2J6EL 5A43C 3OX8B 3L3OB 3V0WH 4GLRH 1OTUC 4OAWA 4W6YB 3TIEB 1T2XA 2MQCA 4FG6C 5B39B 3FMGH 4NN7C 4G5ZL 3FT2B 3RBGA 2EDHA 4DKAA 5EOCL 1VGEL 1R24B 1UWXH 4G3YH 3QPQD 4JQVC 3WMSA 5IQ7L 3RGVA 2DN7A 3CFBA 2RCSL 4KY1H 5HHNA 2A6IB 1PQZB 4GW5B 2B39A 4XP9L 3MBXL 1I1AA 2J12B 1E4XL 1KLGA 4PJ5B 3VXOB 4NNPL 4Z7OE 5D1ZB 3QH3B 3WFCH 1NCWH 4U3XA 2VQTA 5SWQA 4OLZH 2KQMA 5A2JH 3DYOA 1UCBH 3N9GH 2WBKA 5IQ9A 4CADB 1IFHH 3O11A 3TA3D 4HD9A 1T0NA 4G6FD 4P5KA 4ZOEA 4BZ1L 4PRPA 2VJXA 5D70L 4LQ1A 1SEBB 5IMMB 4HV8B 1F3DH 3TZVC 3PWJA 4JEGB 1XGYH 4WUUD 5FGCE 4Q9RL 4LPCA 3IU4H 2A74B 3B43A 3QISA 3O81A 4QCIA 1BEYL 4PB0L 3ZE0F 4KMLB 4OIIL 1CI5A 5E7FA 5TQ2H 5C0FB 3QULB 4MXQD 3C8KA 1UJTA 3GBMH 1EJOH 1IQWL 5EU6B 1NCDH 2ESVD 1INEL 2ZG3A 2F54E 1X5ZA 1BZ7B 5H94A 1AGDB 3C08L 4NQXA 5B39G 2NY6C 3VG9B 3EYQC 1A6ZA 5EU3A 1BIIA 2R9HD 4L9LA 4ONHB 3QXAB 1UXWA 3IETA 5D7IA 2V17L 1EHLL 3JVGA 3VG0L 1FRGL 4ZSOA 3RTQA 3BGAA 3FOLB 1UFUA 3ARUA 4QRSA 1D6VH 3MRFB 4HJ0D 4TTGA 1H15B 1TZIB 5A40E 3VGHA 5DO2C 3G5VA 2Z8WC 3UTZB 2N1KA 5IG7B 2I24N 5JDJA 4J4PD 3DYPA 1MJ8H 3OKOA 2XTJE 3AS0A 5CINH 5TH2B 3B6SA 2ZCKL 3SCMA 3F5WB 4RAHA 4QHUB 1ZSDA 1MLCB 4HCRH 1QPPA 4L3EB 2W92A 4DCQA 3Q2CA 3TPUA 1Z3GL 1OGAE 4UUJB 5JHDD 5KSAC 2VZSA 3WN5B 1KN2H 3DMMC 4ODWA 4HIXL 1PGRB 5DYOA 1U41A 2XWBA 2B0SH 4GO6B 5D93B 2XG4A 1F4YL 4P23C 3CFCH 1PFCA 2RGSA 5HYEA 3RVXD 4XC3L 4PRBB 1MIML 2WLYA 2XTLA 4POUB 2X6MA 1T0PB 1W0WA 2D7PA 3TWCH 3VXSE 1XIWB 2VE6A 1GYAA 2A6JA 1JP5A 5E6YA 1CLZH 4W4OC 1FL3B 4FXGA 1R3LA 4XBPB 2CO7B 2UZIL 3O6KL 4I2XB 4K3GA 2XWJB 5I74B 1RZJH 2P8LB 5E6IC 3WIFB 1PEWA 1N59A 3MNVA 5ID1A 3VH8A 1FG9C 2HTKC 3KYOA 2JTDA 4WCYL 4XCFH 3V4UL 2FZ3A 3MLUH 2CRZA 4G8GB 4L5FH 3ZHKA 2PCPA 1KT2A 3C6LA 1QFWH 3KPOA 4JN1H 1G0YR 3KPSA 3QQ4A 1I1RA 3BAEL 4WY7H 5AWNL 3H6JA 4NZUH 4P5TC 4A2MA 4DAGH 2R0WL 5C3TA 3PWPA 4MA1B 1EVTC 1X4YA 5C70A 4QOKA 5EOTA 1J1OH 3SPVB 5C6TL 5DJ0B 4KGJA 3ETBF 3LSOB 4K55A 4OKDA 3OF6A 3DURA 2A1WL 3SN6N 4NYLB 3VFSB 1OAYH 4RAUA 4UZGA 3GMMB 1ZGLB 4MA3A 4MAYA 5EORH 5DMJB 4WHYG 1EZVX 4XBEL 1NDGB 1MJUL 4P2RE 1QRNB 4KHXH 3VGFA 4KH2A 3QEQB 1FGVH 5DRNB 4Y0GA 3SGKA 3WIHH 4G6MH 3FTGB 5IHZA 3E8UH 3V2AR 2HTLD 4WNQA 2BSSA 3RZCB 1FFNA 1DLFL 1G9NC 4LSVL 1T20B 3BGFC 1ADQH 1P2CB 1EPFA 3O3BA 4MWFA 1BZ9A 2BSTB 4U0RC 2R69L 1VACA 4I3SL 4LU5H 4OKVB 3WO4B 1MUJB 2W9LA 3BP7B 3FB6A 3CVHB 4JDVA 1UM6L 4JVPA 2CLVA 1BGXL 3PWNB 1KG0A 5I1EL 2YC1A 3VMPA 3SKNB 4PJEB 3FFCE 1QLRA 1WFNA 1KTDB 3U7WL 4OCMC 1B90A 2Y5TA 1I8LA 3QDGD 3SDAD 3IYLW 4R4NC 1LWRA 3BX7C 2H2PD 2R4RH 4H88H 4OTXH 3BE1L 2P47B 3FO1A 1FNLA 3DLQR 4UIKL 3OWEA 3PUCA 3F65A 5EO0A 4E41B 1MREH 4TVPL 1Q9LA 4PV8B 3E2HC 2HP4A 1VERA 3SJVB 3B9EA 3MLVL 4KI5E 2Q7YB 1LILA 4CJ1A 2DJSA 4QRTB 3KR3L 1MCPH 4CNIA 1RUQL 3CMOH 1AXSA 5IBTL 1H3UA 3BH8A 2D7QA 3BP6A 4FQIH 2X4QB 1RV6X 4MAUL 2LU3A 4L8SA 4Y2DB 1BM3L 4H0HB 1CCZA 1XGUA 1S7RB 3SO3B 3D87B 2X1PA 1NC4A 5C7XL 5GHWL 1IGJA 4HIHA 2O5XL 3ARRA 4RX4A 4JFEB 1A7RH 1G7MA 3OJDB 5HYSA 3QDJD 4NO0A 5CZKA 3HRZA 1HHKB 2YMXH 2DTSA 5FYLD 3TV3L 3V6OA 5F70A 1LD9B 2A77H 4X7CC 5KJRL 2QSCL 2WINA 4NRZB 1J0ZA 3O6ML 1CLYL 2FX7L 1AKJB 1T21B 4ETQB 3RGVC 4U1GC 5I8CA 3VFPA 5EU4A 3BPLB 1I1AC 5B3NA 3PP4H 3FO2A 2IANB 4OB5L 4JO2L 5DEFA 1G9NH 2AQ2A 3KS0H 1I8KB 4X7EC 4M62L 5IJVA 1TQBB 4G42B 4XAKE 1J1XL 4LSDA 4EUPH 3TYFB 1EEUA 4M48L 3QDME 5LXGH 5DJDB 1OSZB 1EEQA 4ISVA 3T0DA 5E6ZA 5T1LD 2ZOLB 1I8MB 3GIVA 15C8L 3B9KB 3IRZA 5DJAA 3REWA 4PREB 4U1KB 1QUNA 4U31A 4LLWA 4ZUWA 4LLVB 3EOTH 5INDB 4TN9A 1S7WB 4PRID 4JZOA 5ILTH 4JM4L 3FFDA 1FFPB 2I5YL 1RMFH 3QUXA 4OZHE 5IK3A 3VXTB 4OV5A 5CD3A 5I18H 2ZG1A 4GG6A 1CIDA 3FHAA 3T3PF 1J0KA 1IAOB 1HSAA 5MEQA 3IFOA 1NCTA 1WWCA 2NZIA 1NGQL 4F7CB 3GIZH 4WU5B 3O2DH 3MV9B 4U1JB 4L9LC 1RUPH 3TT3H 1OD9A 5ESAA 3U46A 3JVGC 4KHTH 4U3CA 3RTQC 4LLUB 1WZMA 3LZFL 3DARA 4FFWC 2XRAH 4XVUC 5GGSB 5LCVL 5CWSA 1RJLA 1T04B 4PJIB 4YHLL 1DUZA 5DEGB 2IPKB 2E7LC 5CSZB 2P8MB 5JW4N 4X5XA 1GGIL 1MF2L 4KQ3L 3GMQA 5I73C 4MMXC 4PD4J 1FC2D 4MLIA 3GSRB 1RZGB 4XBGA 3B2VL 4J8RB 5TFSH 1HKFA 1CU4L 3GSWA 3SCMC 1PD6A 4L8CB 4R97B 2B2XL 5BXFA 1N0XL 1YN6A 2P43B 1IQDB 3LD8C 3SQOL 4P59H 4P2QE 1JNNL 4Z77B 1FYTE 1JGEB 4ODTH 4NOBA 35C8H 1I3UA 2DQIL 3UJIH 1HZHH 1NC2D 4X80H 4GBXC 5F7NC 1BOYA 4OCWL 1U8QA 3MREA 3TNNB 2OL3B 2ZJSL 4P48A 5AUMA 3VW3L 2N7AA 3QWRD 4KKLC 4JHBA 5EIQA 5E2VH 4QRUB 2O5YL 4QTHB 2GUOA 5DMKA 1JWUB 4PP1D 4M4PA 4ZPTB 1OCWH 4YQXL 2HMIC 3I6LD 2X7LB 3NGBC 3U82B 3LH2H 2DAVA 4BQ9A 3D3VE 4KK8D 4YO0B 1AY1L 4KVNL 2VIRA 4PJ5D 1ZT1B 2BNUB 5D71L 4IRJA 4UAOB 4N0CD 4L8DA 1YEFL 2XZAL 4P9ML 4X6DF 5HGDA 1J0JA 3MOBL 1CFSB 1IAIH 4EN3B 3FO9A 4PJXE 4I0PA 1GIGL 2XKNB 2ARJQ 1C16B 5LGHH 1DBMH 5EG6C 1H3PL 1RK0B 2EDXA 2NR6C 2ORBL 3QUMA 2YPVH 3QIBB 2QKIA 1MEXH 3X11A 4D0BA 5ETUB 4F7MA 1DBAH 5DQJA 5J11C 3NFPB 5E94A 5MI0B 2IF7A 3LVEA 4HLJA 4J23A 5EU6D 4A2LA 3BKML 5JW3H 1VFOA 1KYOJ 1MJJA 2NW2B 4XAWH 4J3XA 2VXUH 4PGBB 2P49B 2VAAA 3SGKC 3U9PL 2BRRL 4OGYH 5FOJA 2R23A 2AK1L 4UV4H 2J8OA 4MNQB 3FCTA 4W4NA 4DGVH 2BP3A 3KPNA 2DBJA 1QSFB 2X1WL 4L4VE 5FDYA 1PBYA 3KAAA 5JLZB 2GTWB 5I2IA 3UTSA 2Q8BL 2DM4A 1KB5H 2XY1A 3UCRA 1LNUB 1OY3B 4NRXB 3DO7A 3PHSA 2VLJB 4XWGH 4LSQH 2LTQB 3OG6B 3FKUS 2Y5EA 1U58B 5F93C 1KPUA 4LASH 4UI2A 3ULSB 3O9WA 4LCWE 1IMHC 3DX6B 1ONQA 4L3ED 5JUEL 4FQXB 2CXKA 4NJAH 3NACH 3CPLA 3KXFA 1ZTXL 1NCBL 5C0BE 3LIZL 4N0FA 2OTUB 2YUVA 3T0EA 2BC4B 2FR4A 4KKNA 5IBUG 4Z0XA 5IFJA 5IB5B 3FT4A 1I8IA 5GS0D 1AGBB 1KUMA 1MRCH 2YBRA 1FL5B 4S0TD 3O3UN 5DK2A 1T4KB 3O4OC 3OTTA 3MRIB 5SWZE 3NH7H 1RUKL 4JPIB 2LAAA 3S37L 1MCLA 1C5DA 1MNUH 4AMKH 3BXNA 1XIWD 2GJZA 2ZG2A 2R29H 2WWKT 4OGXL 4JB9L 1PYWB 3FT3A 3FHQA 3X12B 5KG9A 1ZA6A 3V6OC 1LO0H 1OAUL 3FQRA 2Z8RA 4PRAA 4JHAH 5E5MB 2Z92B 4G8GD 4KRLB 1CFTA 4U1IA 3WFZA 1F4AA 1TJHH 2P1YA 1FQ9C 1FAIL 4YFLI 3VFWA 5DURB 2X1OA 3GSOB 5ALCH 4ZPVA 4GW1B 5F9JB 1MRFH 3N1PC 1T5WB 2HA1A 2W0LA 4ZDHB 1FVEA 4JFZL 1NGPL 2W0FA 4WU7A 1MFAL 5E03A 4QRPB 2H9GA 2NTFB 3MJ7A 5E8EA 3DXAA 5TGBA 1T1YB 2AEPL 5DJ8B 1QRND 4XHJD 1T0MB 4HLZG 3GI8L 1A5FH 1KENH 4BQCA 2D7TH 2F58L 4LSSH 3QEQD 4PY7B 3K8MA 4XGZB 2FD6L 1QLFB 5DUMH 3I50H 5E2WH 3GJEA 1YEJH 2NZ9D 1M4KA 3RZCD 5TE4H 2EE6A 1J10A 3RWIB 3RWFA 4HS6B 3VXRB 3RA7L 3HZVA 4KJYB 4FQ1L 3E3QC 3QUXC 5D7KE 3WXWL 5BS0E 4OT1H 5E1AA 1J1PL 3RU8H 2AQ1A 1K6QL 1MQKH 2OTWA 3HI1B 2I9LA 1AE6H 2VRAA 4GUPA 2JK5A 1T6VN 1L4IA 5E5UB 3HE6A 1Z0MA 4PJBB 1S7XB 1WT5A 4LHJB 5EA0H 5I16B 1T2QL 2YA1A 4Z7WB 2YD4A 4X4XB 4Y19E 3HI5L 5D6DC 4UDUB 2D4DA 2ADJA 2BNRE 4E9LA 3RNQB 1P7HL 3BH9B 5EUOE 2MFNA 32C2B 1B0GA 5CD5D 3WUZA 1RFDL 1AD0B 5J0BA 1HOCA 4AT6A 3O45A 4OCSL 3H0TA 1P7KB 3UTTA 5AAMA 3IAQA 4HS3A 3LDBC 3SJVD 2AQ3A 2HLAA 3RUGB 5JW5B 5C09B 6CGTA 5MP6H 3EOBA 1ND0B 1ZAGA 4M8QA 4WDIA 5ECJE 4RZCA 4ACPA 4M7JL 3BO8B 3CGTA 4Y2DD 4FZEH 5EBMA 1I3RA 5CJ5A 4XVSL 4UILH 3QJFB 3DUUB 3U7YL 4IMLA 4J3UA 1A7PL 3N1MC 2OZ4A 3UJJH 4ESKA 5EO9B 1U8NB 4JFED 4QWWC 4DW2H 5ICYA 5IF0B 4MHHG 4JFPA 1OQOA 1P69B 2VC2H 4N0UA 1XCTB 4P46A 1JF6A 3VFUB 2AK4E 4MQXC 3HNSL 5MENA 2XACC 3V4PL 4AH2B 5L2KB 2DL9A 4PGCB 1H9VA 3CH1B 1AKJD 1QFUH 1PAMA 4MDIA 1AP2B 3MXWH 1QYGH 4NZRH 1JZ2A 2PYFA 2IAND 1YEIH 3AB0B 1EMTL 1S78D 4IRJC 2YZ1A 5C0DA 5IBLC 5D2LE 2CIKA 3WFBL 1UZ8B 3KGRA 1I9JL 1OAXL 2UY7A 2L7UA 5DLML 4I0PC 1BVKA 1J12A 3EYFA 3GSQB 3MRCB 5DD1L 1Y6MR 2DI8A 3MA9L 3PF2A 4K2UL 4MHHI 1U8HB 4YDJA 5LJYH 3KPPB 5HHOB 3B9KD 1BD2E 1FVDA 2EO1A 2ATKA 2DIBA 3OL2A 1QA9A 4JJ5B 1IEHA 2ED7A 5I8OL 1NFDB 2NXYC 4JHZA 3MLRH 2VDKH 1KACB 3ZL4H 2FJHB 3KYMB 5C9JA 5DD6B 1OP3H 4HGKC 3I6GA 2ZOKB 3IDGA 4HF5H 5DC4B 2LVCA 1FZMB 3ULVD 3MNWB 1BHGA 3F6LA 3G6JE 5I1JL 2CK0L 3GJFB 3ZKMC 3MPCA 1NCWL 4QNPE 1OAQL 2FH8A 3MV9D 1RK1B 3K2UH 4IDJL 2HFGL 4PGEB 3VFVB 1CDJA 2VXQL 1NCCL 4EIGB 1UCBL 2GSGB 4X7DC 5AYQA 2DWEB 4ZNEA 4ZFGL 2R0KL 2J88L 3OHXA 3ARFB 2UYLB 3CZJA 4MD0A 4LCIH 3O3AB 1IRAY 1T7WA 5AG9A 2XKUA 4YHML 4ZQKB 1JUFA 3SE8L 4F58L 3H9SB 3ROLA 2MQ0A 4DZBA 4IHOA 5E1HB 3DBXA 2CH8A 4NC0B 1YUHB 5FGCB 1IM3B 3IDMA 2BVQA 1XGTA 5BJTA 1A1MB 3QFJE 5TDNA 2BERA 3O9WC 4XNQA 3M1BB 2Y07L 1BBDH 1EV2E 5B8CB 1CE1L 1ED3B 4DVRH 3SOBH 1QSZA 2H32A 3T0EC 1LE9B 2FSEA 4ERSL 3D85B 3VXNA 3G6AB 5JDSB 3H9HA 2AVGA 4Z7VE 4Y7MA 2DQCH 1GAFH 2KPNA 3QHFH 2K7QA 4LNVA 4X4MA 5L7XH 4PJCB 3NABL 3PQYE 4U7MA 1D6VL 2CDFB 1EXUB 1H3WM 4G6JH 1FH5L 3MCKB 5ALBL 1IKFL 1T1XB 2ITDB 4HS8H 4HUVA 2WUCH 3S35H 1RUAH 5E8NA 3ZTJG 4YNYA 5HI4D 4X6DA 4XWOD 3VFNA 3VJ6B 1TCRA 3AY4C 2OSLA 5GGTL 4I4WA 5JA9A 4KVCL 4KZEH 3Q6GL 4HBQA 1N5YH 4EN3D 5FFLA 3VWKA 2A9NH 4XNMA 3UTQA 2EYTB 3MJGX 3SBWA 5HSFA 4LEXH 1TVHB 1IGCL 3MUGA 1YPZE 3SE9H 1FZJA 3RDTB 3OAUH 2J7LA 1UB6B 3S36L 1P4LB 3QQ3A 5C0CA 3QXDA 1DBKH 1H5BB 1JPTL 3QIBD 1NGWB 1YYLH 5E4EB 2B1HH 3P4MA 4S11A 3FQTB 2R0LH 3FOMA 4NQCB 2NY3C 3GNMH 3FAXA 2OTPA 3O6FB 2J4WH 4YHZH 4HK3J 2QTEA 3WYRA 4D9QD 1FZOB 5I66B 3QIUA 1FO0A 3ARDB 3ZHDA 3QEGH 5E8OB 2ICEB 3MSPA 3HAEG 1FJ1B 2OI9B 1RZJL 3QNZB 1GGCL 4S1DC 2BY2A 1FG2A 3ZDZF 2N4IA 4MNQD 3MLUL 4N9OB 2GFBB 3RBSA 2DQHH 1QSFD 2F9BT 2E8ZA 4GKSB 2NQCA 2WUBL 3MRMB 4LLYB 5GIRA 3A67L 2HKFH 3WNNA 2G9HA 4RFNB 1AHWB 4KKAD 4YHOL 5C0ND 1ZHLB 2VLJD 1JYNA 2MCPH 3K4DA 3KNBB 2BVOA 5FYKD 1BLNA 3TFKD 3HE6C 2X44D 1LP9B 4B7LA 1WT5C 1IC1A 4QHKI 1IEAA 2VXVH 4M3JA 4D9LL 5K33A 5GGVY 3AS3A 1IBGL 4FQXD 2J1KA 1BJ8A 3ULUF 5CMAA 5D8JH 2A9MH 3QO0B 2RIKA 4Q6IC 1KEMH 4UT7L 1BOGA 4PB9L 3E8UL 1Z9OA 5GZNC 4EI5C 4UOW0 1D9KA 3AM8A 3DI2B 1KN4H 3LKOA 2XPGB 2PYEE 4NQDE 5GGRB 4QHNA 3PWVB 1ADQL 1XF4B 4P57A 1AGEB 1HH9B 1BFOA 3S7GA 1CL7L 2ICWI 3WL9A 1JNLH 1S8DA 4PLJC 3KPQA 4L3CA 1EIBA 3QPXL 4KI5F 2ATPA 2FLBT 3V5DA 3VGGA 4QYOA 4UIMA 3O2WH 4UTAL 4WW2F 4AIOA 3NMEA 5HYJA 4GRMA 3O8XA 4UMGA 4F7TB 4P5MA 4HK0A 3L1OH 4JKPH 5D9SA 2QSQA 1A1OB 1LO2H 4MNGA 1E27A 2AJUL 5KOMC 4P46C 3JUYA 4WO4A 3FRPG 3DX7B 4O2EB 4BH8B 1KJ2B 1DLHB 3M17B 2X40A 1UWEL 4DEPC 3SDCB 3NCJH 1DBJH 3CD4A 3MJ9A 1JMXA 5DURD 1MIEH 4FMKA 2E9WA 1FIEA 2C1OB 1MCPL 1NUDA 3P3YA 4KJQC 5DI8A 3GB7A 1FO0L 3DGGB 1HH6A 4BKLB 4XPGL 1CTOA 1M71B 4IIQB 1JYWA 4QRPD 5I75C 2Y36L 4HWZB 1E6OL 5EOQH 1YYMH 1D5XA 2HFEB 1YEGL 4HJJL 3O6LL 4HQQL 3QEHA 4HC1H 4GKZA 5D1XA 4ELKB 4GAFB 1BFTA 3QCVL 1M7IB 3S9DB 5E4IA 3S34H 4L4TA 4XZUB 3I84A 3ARYA 3D39E 3WXVH 1CD9B 4GRWE 4HFWA 4Y4KB 1BF2A 3MYJA 3KYKL 3LQZB 3C6SA 5T5NG 2GJJA 4UT9L 2JELH 1E6JH 4N5UA 3VXRD 5HPMB 3EGSA 3NPSC 5I19H 5DEZA 4LP5A 1JFQH 3LKNB 5IMOA 3QG6B 5F3HB 5FDWA 3PNWB 3PP4L 5C6PB 1OB1A 1UWGH 4WW1A 4PGJA 4TSAL 5ACLA 3Q0HA 1KTKE 1XGQB 4K3JH 3VXME 2IAMA 3AS2A 2L0DA 4KJPC 1DEEA 1BECA 2EH8H 3BIKA 5C3LD 5BZDA 1NAML 4F15B 4MQTB 4OZHF 3RWDB 3OR6A 2Q76A 5FYJE 1A7NH 5C0GA 4CU7A 3ROOA 5JOPD 4MX7A 2JJWA 1EA9C 2QQKH 1QFPA 4LRIC 4JRYE 2AERT 4XP5H 2GSIB 4ODXB 1IGTA 4OFYD 4YHKL 1SYSA 3MMEA 4V1DA 3HR5B 3QSKB 5C09D 4H20L 2W38A 5BRZE 4JZJC 4Y4FB 3D0LB 4LVEA 5MEOB 5HYQB 1UXSB 1TLKA 3BDBA 1KIRA 4OM1L 3BZEA 2OK0L 5CP7B 3FQWA 5KVDL 3K3QA 3BW9A 3AAZB 2ZUWA 4U6YA 5J6HA 1F58H 2CIIB 1W0VB 3WKNA 3DTXB 4RMQA 3MJ8A <