5EZQA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural Protein 2 Cysteine Protease
publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase
total genus 110
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezqA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezqA01
4OA5A 1YZ3A 2G72A 4RTSA 3KPVA 3M70A 3P9KA 1JQ3A 5EEGA 1FJXA 2YXDA 3BGVA 4ZTBA 1G55A 4MQ4A 1X1AA 4FSDA 1NV8A 2ZLBA 4LG1A 5H02A 1BOOA 1UIRA 1I4WA 1JSZA 3RIEA 4DCGA 2GAFA 4R8SA 3BT7A 2PVCA 5BP7A 4CWAA 5K05A 1JG1A 2YTZA 3CJQA 5K0NA 3DLIA 1KXZA 2FPOA 5JR3A 2I62A 4PINA 2IFTA 3BWCA 1XDZA 2QYOA 1QAQA 2HTEA 3FPHA 5P8WA 2IH2A 2FK8A 3NWBA 3MAGA 1XXLA 1VQ1A 4GEKA 3DMGA 3GRZA 4OBWA 3H2BA 1QZZA 5DM1A 1XDUA 3IHTA 3GDHA 3UJ6A 2NYUA 3B5IA 3A7DA 4IV8A 1Q0SA 3JWHA 5EC8A 3DP7A 1KPHA 3L8DA 5EZSA 1ORIA 5IH3A 2CWWA 2EG5A 3EMBA 3GO4A 2VP3A 3FRIA 2AZTA 1RI1A 5MHTA 3C6MA 3LHDA 2OO3A 4RVDA 3IV6A 4H0NA 5LQAA 2IP2A 2NXEA 4R8RA 2GLUA 1JQEA 2VDWA 5LR6A 2EJTA 2JHPA 5LQRA 5HIMA 1KR5A 2YX1A 3I53A 5GP1A 3UJCA 3FYDA 1N7JA 3TKAA 1SQGA 3TM5A 1EJ6A 2P3LA 1EIZA 3HA5A 4K6MA 4YV0A 4RTPA 1G38A 5E9QA 3EVZA 3AXTA 3T7RA 4DCMA 4C4AA 3QV2A 2HNKA 2WA2A 5EKUA 5HIIA 3KHKA 1YB2A 5K0GA 3KQSA 1PJZA 2P41A 5E2AA 3DXXA 4YMHA 3AJDA 4MIKA 5EGSA 1L1EA 3BXOA 3LKZA 1XCLA 3E23A 5DXAA 4DZRA 2UYQA 3HCCA 1WZNA 1G6Q1 2ZZKA 3KPWA 3NWEA 4P7KA 2ZWAA 3P2KA 3A25A 2XYRA 3E8SA 5K8VA 4PYLA 1RI4A 4GF5A 1N2XA 4KW7A 3ELYA 1N7IA 4G56A 4HGZA 3RW9A 3UBTA 4MWZA 4C05A 3LDFA 1D2HA 1VP9A 1XDSA 3BUSA 1QANA 1RI5A 4DMGA 2AN5A 5DRYA 5FQNA 3G5TA 3NDIA 5K0JA 2CL5A 5EQJB 2JG3A 9MHTA 4ISCA 3LPMA 3Q7EA 2B78A 2K4MA 1KYZA 1L9KA 3FUTA 3EMDA 3GRRA 2FCAA 3P2IA 4E2XA 2R3SA 5K01A 3P9CA 1WXXA 4RSRA 1ZKDA 2AN3A 2B2CA 3E7PA 5K0FA 1ORHA 5FWDA 4PGGA 3KQTA 4P7FA 5DRTA 3SMQA 4OA8A 1R8YA 3UJ8A 3HTXA 3G8BA 2PWYA 1WXWA 4EKIA 3EVGA 3TLJA 3UJDA 1NW6A 1FP2A 3LDGA 3FPFA 3SXJA 2A14A 3UJ7A 4EQZA 2P40A 5FWAA 5EOVA 3ER8A 5CVEA 1EG2A 1INLA 4PYQA 4AZSA 5GM1A 4RV9A 4E32A 1YFLA 5M5BA 1KHHA 5EVJA 4X63A 3PS9A 3FUUA 2JJQA 4FP9A 1L3CA 2G71A 3P8ZA 1NBIA 1JG4A 3GCZA 4HTFB 1YZHA 2PY6A 2QY6A 2ZTHA 5HOQA 4RTJA 1SVUA 3TOSA 2C7RA 2B25A 4QPPA 5DWQA 1M0EA 2O0LA 3C3YA 4CKBA 2BZGA 5C9ZA 5EIWA 1VL5A 1EAMA 3REOA 1B42A 3BGDA 4E2ZA 3EGEA 3KQYA 3OZTA 4PGHA 1R74A 5EIFA 2WA1A 2HMYB 2IIPA 2N47A 2CMGA 2PX8A 3I58A 2ZBPA 3JWGA 3T0IA 3UZUA 3GIWA 1ZGAA 4PCLA 4QVGA 2F8LA 5KQRA 4E30A 5BW4A 3HP7A 3PX2A 4ATNA 2EX4A 3DXYA 4GOOD 3G8AA 2B9EA 4QDKA 5FCDA 3TRKA 4ER7A 1KPGA 2PKWA 4HGYA 4QQKA 1Y8CA 4X61A 1WY7A 4B17A 1NW7A 1RJFA 3ANXA 4FR0A 1JR4A 3OFJA 5CVUA 5HIKA 4E2WA 1R00A 3OU2A 3DMFA 2O05A 1YF3A 4E70A 5EPEA 1X19A 3M33A 2EFJA 2B3TA 3V97A 3Q87B 2ESRA 2ZULA 5CVDA 2I7CA 3FTDA 1R18A 4R05A 1TW2A 3AWIA 3A27A 3CKKA 2GS9A 4CXMA 3EVFA 3BWBA 1L3IA 2BR5A 2BM9A 1WS6A 3DMHA 1O54A 4DA4A 4IWNA 3HCEA 5HEKA 2G70A 5DTRA 5DM4A 3SX0A 5LQJA 3EVBA 4CTKA 5EHGA 2ZZMA 4R6XA 5HILA 2ZIFA 4M38A 1VBFA 3PT9A 2Z6AA 1KPIA 3DXZA 1ZG3A 3BWYA 3G2MA 3O7WA 3DR5A 3EVEA 3P71T 4C04A 1VPTA 5HIJA 4C03A 2OPBA 4GOLD 3CBGA 2PSSA 5LSAA 3ME5A 3RODA 4RVHA 4U7PB 2YVLA 1JTFA 2AS0A 2IH5A 2O06A 3PLAE 10MHA 5E8RA 3MGGA 3G5LA 5EZQA 3LSTA 2NXJA 5BXYA 3HVHA 3X0DA 4NECA 1QAMA 3UJ9A 2DULA 1X1DA 1SG9A 2AOTB 3GRUA 4QVKA 3PB3A 1DCTA 2HR1A 3EGIA 3MTIA 3GRVA 4BP3A 5EMJA 5FA5A 1BHJA 5DTQA 3EGVA 1I1NA 4QPNA 4RVGA 4XCXA 1AF7A 2ERCA 3OU7A 4C06A 4KIGA 3M6WA 2V7EA 5E8JA 5KS2A 4AZTA 5KVAA 3FUWA 3MHTA 1RJGA 2YXLA 4RYLA 3HEMA 3GJYA 3OE4A 3FPJA 4KRGA 3O31A 1VLMA 3GGDA 5C1IA 3VYWA 3CC8A 2ZCJA 1UFKA 5DSTA 5CVJA 2AOWA 3UJAA 3KR2A 3KQOA 4PYMA 5DSXA 3ERCA 1KYWA 3CJTA 2YXEA 3G89A 2UYOA 2P1DA 2ZW9A 3KQPA 4GC5A 3BGIA 3BKXA 3GXOA 4P7JA 4V0RA 1JTEA 1EJ0A 3UFBA 3TFWA 3P9IA 1OR8A 7MHTA 5F2NA 3G2PA 2P8JA 4YMGA 3NW9A 3BKWA 3FPGA 3M4XA 3DOUA 3V8VA 4FS8A 5T64A 4IV0A 1NW8A 1RJDA 1ZGJA 4HTFA 5CUQA 3KQQA 3KQMA 2Z6QA 2P35A 2AOUB 4XUEA 3K0BA 5E1DA 2PX5A 2E5WA 5E2BA 3HA7A 3MB5A 2CMHA 1O9HA 3LKDA 4FT4A 4ER3A 2PT9A 4X41A 2Y1XA 3NVMB 4RWZA 3GNLA 4CKCA 1V39A 2PJDA 5FULA 3M6VA 1YUBA 3DH0A 3OCJA 3FRHA 2AN4A 3HVKA 1IXKA 4HRAA 2HWKA 2AVNA 4XUCA 5FHQA 1TW3A 4KWCA 5FTWA 3FYCA 3TMAA 3BZBA 1F3LA 3EVCA 2P7IA 3LCVB 4MHTA 2GA9A 5CIYA 1DUSA 3SVZA 4YV2A 3P9NA 5CCXA 5EKXA 5E1BA 5DTMA 3OU6A 3LCCA 5K09A 3OZRA 2FK7A 3T7TA 4CTJA 2BR3A 4GUAA 1AV6A 2BH2A 3R9XB 3C3PA 1XJ5A 2ZWVA 5FA8A 2YR0A 2C7PA 2IDJA 1WG8A 3T7SA 1G8AA 2G1PA 3I9FA 3QOXA 4P58A 2PWPA 3OE5A 4FZVA 2G8NA 5LQNA 2QRVB 1SUSA 5DT2A 3LCUA 2C7OA 4FGZA 3KR1A 5DM0A 2XYQA 4PYKA 3SSMA 2O07A 3D2LA 1T43A 1NW5A 1JSXA 4C08A 3LDUA 3OFKA 5FHRA 1R6AA 2R6ZA 4OX9Y 3MERA 5GOZA 1AQIA 2I6GA 3M6XA 5JUWA 1ZHFA 2YUIA 2JHCA 2VZ9A 3R3HA 3MTEA 3MQ2A 4MTLA 2C7QA 3MCZA 2BM8A 2PBFA 3HCBA 2ONYA 1M6EX 4F86A 4L7VA 4BY9E 5ICFA 4RTKA 5U4XA 2KW5A 4C07A 3KPYA 3R0QA 3P97A 5GM2A 2QM3A 3WSTA 3FZGA 1D2CA 1MJFA 4GC9A 4PIPA 5K0BA 3A26A 5GIOE 2PT6A 3GWZA 4XUDA 3CJRA 2AOTA 4AUKA 4YUXA 1G8SA 2FRXA 3SGLA 4EMSA 1TPYA 2PXAA 2OXTA 4DF3A 2PLWA 3EEYA 1BKYA 4Y2HA 2LD4A 2ZSUA 3K6RA 3QOWA 4RTQA 5CVVA 5BW5A 3C0KA 4M37A 2P3QA 4ER6A 4IKPA 4FSXA 4X60A 3U81A 5KQSA 4PONA 2AVDA 2H11A 3G7UA 1AQJA 4LWPA 1P1BA 3KPUA 1RI2A 3P2EA 1L3BA 3IEIA 4QTUB 3PVCA 5EMLA 5LQUA 1X1CA 2HV9A 3GRYA 3LL7A 5B1SA 3HNRA 4QTTB 4EKGA 3FTCA 2UYCA 2OZVA 1NE2A 4KDRA 5EG5A 3ELUA 3TPZA 2ADMA 4OQEA 3G88A 2EJUA 4GQBA 4BLUA 4POOA 2NXCA 1JQDA 4RTNA 1NV9A 1U2ZA 4Z2YA 2IH4A 4RTMA 3CVOA 1VIDA 1JG2A 1EQAA 2P7HA 5K0LA 5GINE 1Q0TA 3LECA 4ER5A 4F84A 3EVDA 3ORHA 1XVAA 4WXHA 1MHTA 4M36A 2NP6A 5CM2Z 5ERGB 2AOUA 2XVAA 3B3GA 4RTOA 3NJRA 5K03A 2PGXA 5GWXA 3HA3A 4DQ0A 1VP3A 3KR9A 3B7PA 1KP9A 3HVJA 3O4FA 3VC2A 8MHTA 5DM2A 1ZQ9A 3VSEA 3I5UA 1XCJA 3R6TA 5E1MA 5E1OA 5IKMA 3NDJA 4AZVA 2YQZA 4HSGA 4RTLA 3EEOA 5FADA 2XVMA 4AZWA 2VDUE 4PYNA 2PX2A 4V0QA 4R6WA 4PYJA 1SQFA 4YUWA 4BLVA 3AXSA 4PIMA 3UA4A 3SM3A 3VC1A 2GPYA 5FQOA 5EMMA 3TM4A 1O9GA 4YUYA 1UWVA 1NW3A 3OPNA 2ZVJA 4WVLA 4KIFA 2NNWB 3HM2A 2V74B 2PV0A 5HFJA 2AR0A 3PFGA 5ICGA 2P3OA 2ZIEA 3HVIA 2UZ4A 2OB1A 3ELWA 4RTRA 3ER9A 2IBSA 3NMUF 2XYVA 3FUVA 3THRA 4YV1A 3M6UA 1X1BA 1FBNA 2OBFA 1FP1D 4GBED 4HG2A 2GB4A 2QRVA 4CKEA 2AOXA 3HCDA 2CKDA 2H1RA 1PRYA 1HNNA 3A4TA 3HCFA 3I64A 4LWOA 5ICCA 4DKJA 5GIPE 2IPXA 3S68A 2H00A 3SSOA 1HMYA 4GOMD 3LGAA 1NKVA 4M7RA 5LQCA 2ZFUA 3B89A 3E05A 2Q41A 5DX1A 2UYHA 3ELDA 5T67A 3EVAA 4DM3A 3MCTA 4ER0A 4EK9A 5CCBA 5LQKA 5DPMA 5CD1A 4HC4A 3FUXA 3KU1A 2NP7A 4KDCA 4PYOA 1F38A 1P91A 2GH1A 2ONZA 4JXJA 3DUWA 3DULA 3FTFA 2PXXA 3BWMA 5C0OE 4KVZA 2QE6A 5KYGA 4X1OA 4BP1A 5K0CA 2WK1A 3DTNA 2OB2A 3A7EA 2IDKA 5F2KA 4UOEA 1M6YA 3PFHA 2XBMA 3C6KA 2VS1A 1IM8A 5DLYA 1QAOA 5DX8A 2JHAA 3B3JA 1KIAA 4HH4A 2OY0A 3TR6A 3G2QA 1NT2A 3ID6C 4RVFA 3THSA 3UA3A 1FPQA 4E2YA 3TQSA 1P39A 4FT2A 3SR4A 4QDJA 5ICEA 3GU3A 3EPPA 3LX6A 2NXNA 3OZSA 5E9WA 3F4KA 3FPEA 4PYIA 3CGGA 4P7GA 5G02A 1QYRA 1Z3CA 1JG3A 5D1NA 5D1HA 4YUVA 1DL5A 5EEHA 4F85A 1H1DA 3CCFA 2IBTA 5F2OA 3AY0A 2ZBQA 1NBHA 2Y1WA 3DLCA 5DXJA 2AOVA 3JWIA 4U7TB 3KQWA 4E31A 3SSNA 3HCAA 2ZZNA 4A6EA 3PX3A 3NVKI 3KQVA 2OYRA 4PNEA 4QQNA 5K0EA 4OBXA 3B3FA 3LBFA 3G2OA 1YFJA 4PWYA 1SKMA 3IYLW 4E33A 3KR0A 2JH8A 3KKZA 2ZIGA 4RX1A 5T6BA 4EVIA 5HZMA 2DPMA 1RJEA 3KPJA 3PTAA 2I9KA 1IY9A 3FTEA 4A6DA 1VE3A 1R8XA 3UJBA 4O29A 4AX8A 4OQDA 2O57A 2BR4A 4LECA 1BC5A 3LBYA 5EHIA 4BLWA 1I9GA 2FHPA 5FUBA 2FYTA 1SUIA 4PCAA 3TKYA 3NTVA 5E9JA 4YUZA 2Z6UA 3R24A 1RI3A 1D2GA 1XTPA 4Y30A 2JH9A 2PX4A 3JWJA 2OKCA 5DX0A 3UWPA 2PXCA 2ORED 2VDVE 2IGTA 5EMKA 1G60A 2ZBRA 1P1CA 4GOND
chains in the Genus database with same CATH superfamily
4H1TA 4IQFA 2CVFA 3DOOA 3NBMA 1TB4A 2C9OA 4M0EA 2IPMA 2ZUBA 3BH0A 4OAOA 4ZI7F 2JVKA 1JQ3A 3QKSA 5IM5A 3K09A 5EXXA 4YCSA 3DZCA 3SHQA 1QHXA 1NV8A 4F45A 3UC5A 4B87A 4D0NA 2AFIA 3BQ9A 2GAFA 1OY1A 1TF5A 2ABWA 4PX2A 3SE0A 3WNQA 4A8JA 1F2CA 5FTMA 5D3KA 1N5KA 3FNQA 4JAVC 1UJBA 3BTOA 3FSEA 2VHQA 4JASB 1YA8A 5BR8B 1KXZA 3O92A 3ETDA 1UC9A 1VLJA 2BSAA 2GFOA 3SZGA 2B21A 1T3HA 2HHNA 2O3JA 4HUQB 3Q40A 3TD9A 4IF6A 1Z6YA 2W2LA 4Z86A 3GRZA 3UAGA 1QCYA 2VG8A 3QPDA 1TZCA 3HN2A 2H4ZA 2HKIA 2FQ1A 2OAQ1 3B5IA 3IEUA 4NCIA 3WGUA 2J31A 1I3NA 3QPBA 4CPDA 2ACWA 3E53A 1MOPA 5EZSA 3HABA 1YTUA 2XIQA 1VLQA 4Y8VA 4JYCA 4DJTA 1TM3E 1V2HE 3F3SA 5B2ZA 3HKEB 3LUGA 5LLTA 1Z56C 4OHCA 2J3DA 2IKSA 1NZFA 4G5FA 2HSEA 2EWWA 4YP1A 3U3DA 3IV6A 3UAVA 2O59A 2IEBA 2BVNA 3FDZB 3WP0A 1I4TD 4RZ3A 1O4VA 2ZTMA 3F3MA 4O25A 2VSNA 3IVMA 2GAJA 5LQRA 4YRPA 2DC7A 1JN0A 1KR5A 4BV3A 1PT6A 2GHTA 2Q29A 2ZJFA 5GMOA 3GA5A 1B4DA 3TWOA 1YB7A 1M7BA 3TM5A 5ALPA 4TVSA 2FWJA 4IDCA 5KOHB 1BX0A 2L42A 3E35A 3R3VA 2GVDC 5E9QA 5JZEA 3WV4A 1M2OA 3C3MA 3B36A 1XQXA 3IHKA 3K5HA 3OQIA 1J5EB 4AXXA 2IELA 2CW5A 3WMEA 3T5MA 3JASA 3OOYA 1H8ED 3C3CA 4WZAE 2Y0CA 1TT5A 3D64A 2JH3A 4GI3A 5D3MA 1CJLA 1VKRA 4QYSA 1X70A 3JPWA 1GUAA 2ZRBA 3A10A 4YJHA 5H5JA 5HGXA 4ZYVA 2I22A 1JVBA 4ALMA 4Z0HO 4ZDKA 1K7FB 2ZPTX 1TTHA 4EG3A 2OHVA 3ISVA 1FVOA 4M0DA 3GEGA 2FI1A 2ODBA 2YZKA 3ED5A 1WHTB 4M22A 1Y1LA 2XRFA 4G56A 1U2RA 3ZDDA 4JMLA 3KZNA 1QH1A 3ADPA 5A7HA 1GZ4A 1HE4A 4WCFB 4ZHSA 4YRSA 4GP6A 1HEYA 3AM4A 1LZKA 1IXRC 3BUSA 1QANA 1EWRA 2WJ4A 4BP9A 3CB4A 4X7BA 3THWB 1DPFA 1AHIA 1PK7A 1MV8A 2H2FA 3EQ2A 4FYKA 4PFSA 3FVQA 3HM9A 3FHTA 3C48A 1C9EA 4R40A 1N1EA 2KS6A 3H6KA 3FUTA 3IFUA 3EMDA 4KAAA 2H07A 3DWIA 4RSRA 1QSGA 5ENDA 1ZD3A 5BN4A 1GXSA 2J6BA 5F73A 2PRJA 4MDFA 1BRMA 1DINA 5HBRA 2WJAA 1E6WA 1E9BA 3IS3A 3L43A 3BTSA 3Q3IA 4L1KA 3VKUA 4LQ4A 3B1WA 3LBAA 1HV8A 1U1FA 1U4SA 2E89A 1L5LA 3TIIA 1Z4KA 1HDIA 1AB6A 2HSWA 2INGX 2OLKA 1G20B 4LVUA 1GAWA 4RDIA 5EJ6A 5IANA 2AYOA 3RLIA 2HLNA 3FPFA 1C41A 4J0JA 4N4AA 4NABA 1D2RA 5DYTA 3WLNA 1O58A 2VXBA 3ND5A 3F73A 2CEKA 1BMDA 4O33A 3TX2A 4MTCA 1RPJA 3DEFA 1NMEA 2GYVA 5JZOA 4KLRA 3I9MA 3N2LA 4AZSA 3C74A 2G8EA 3DS8A 3EBOA 1GZUA 1UPBA 1GZ5A 3ZJ5A 4EARA 1L7OA 1DT3A 1YZHA 3DVLA 3TSOA 3JQRA 3K73O 4HO1X 4I1PA 1FU7A 4MKFA 3WGMA 1R7RA 1W88B 1Z6QA 2PTHA 1C3VA 2PVPA 5L7TA 2DOSA 3H11A 1OI7A 2CLSA 1IYZA 2YVQA 1QJ4A 2UDPA 1M0EA 2BZGA 2CZCA 1K9SA 2NU6A 3ZKWB 4XE5A 2IS2A 1NJ6A 2VPXA 5IBQA 3L3BA 3IV2A 4KUGA 1IFXA 5H1YA 5F9FA 3GGOA 2OQRA 1TA9A 2AI2A 5IT9A 4Q3NA 1AU0A 3JQBA 5J23A 1XZAA 3T38A 3UTDA 2G76A 4IVQA 1S9DA 3PEFA 3VO8A 4CMBA 3RJZA 3F74A 1ZNZA 1E8DA 1KJJA 1CY1A 5BSTA 3REQA 1LPBB 2XWJI 3HP7A 1UFQA 3ESYA 5G0WA 3JYOA 1KPGA 1GTSA 3B8HA 4RK6A 3TNLA 4HZIA 2Q3BA 2YYSA 1FLVA 1I13A 1S3IA 1RJFA 2VJYA 4CG2A 2JAUA 1W2GA 2FN3A 1DQYA 2LCQA 1KARA 1N0IA 4AUMA 1FQKA 1X0VA 3CIFA 3IALA 4FYJA 4E70A 3ZDQA 3R0VA 1FSSA 4DS3A 3I6YA 4C0BA 2XWBF 2ZULA 4FYPA 1V37A 1VIYA 3OOEA 4L5CA 5CVDA 3WMGA 4GMXA 3KKLA 1A7JA 1DBSA 1E3DA 2HGSA 3DOHA 1WXHA 2Q0SA 4OP3A 1PFQA 5DFAA 4CXMA 1VA4A 1M76A 1UMKA 1XLUA 3GLSA 2Q4EA 4JQSA 1ONOA 4OHOA 2FEMA 3F5DA 3LM8A 5THKA 5LQJA 2J9FA 3EVBA 3EK2A 3S29A 3DPIA 2QDXA 5HKBA 2HLPA 3BXFA 2JVJA 3WA7A 3KUKA 3KBOA 4B4WA 2BGTA 4DABA 4FZJA 5EIXA 4N48A 3W9UA 3KZMA 5KC9A 1K27A 3V3TA 3PD7A 3UH1A 1XDDA 5B6JA 5CNIA 4Q4CA 4DFDA 3E1KA 3E61A 1UM9A 1NZDA 1VI6A 2ZDQA 1SUAA 2JBWA 1WE2A 2FLWA 2C07A 3M6IA 1MRNA 1DRVA 4D44A 3PC3A 2BMVA 1YVDA 3U4QA 4N3NA 2F7DA 2WAMA 3DTTA 2QMOA 3O9MA 2WU1A 1PZNA 1NUSA 3OX1A 4OH1A 1YASA 5I9IA 3IVAA 1N0HA 1SG9A 3PB3A 5BN1A 3PK0A 2ZRGA 4KAJA 2GTHA 3MTIA 4CMCA 5EZ6B 1EDOA 4BAUA 4O6VA 5KZMB 1QIGA 1ILEA 1J2UA 5TMEA 2DLDA 3QVWA 3EH2A 1ISMA 3KYBA 3RIGA 3R44A 4PXSA 2XUOA 3L7DA 3QPCA 1WU8A 1RVDA 2X4LA 2J6HA 4KG7A 1WCYA 2CV2A 4ZV7A 1T26A 2QX9A 3AOEC 4MKZA 3ZQ4A 4AF7A 1XMPA 4H17A 4BQSA 2BWJA 3GLHE 1WEKA 1KYWA 2GKGA 1J23A 2ZW9A 1A96A 1EZZA 4D9FA 4IJUA 1M1YA 4XOIA 4CCWA 3OTOB 2OP3A 3ENNA 3A6JA 5FR2A 4UQOA 2QV0A 4YMGA 3O0UA 5FNVF 2TMDA 2B1RA 2WFMA 1E1RA 3K53A 4RMIA 3ZE0B 3I5XA 521PA 1VCIA 3IT3A 4BFWA 2DT8A 2Q1WA 4RKRA 2IOHA 4RGQA 4MWOA 4OJNA 1W19A 2W6NA 4FK5A 2Q3EA 4OQXA 1BDJA 3H2ZA 3N8NA 2E5WA 3EA0A 1LV7A 2V96A 3KZ1E 5DBEX 3ICPA 4ERXA 5K8TA 4RY9A 3KDSE 4X41A 3SQWA 3NHSA 1JE1A 5KTOA 5FULA 4BNDB 1YS9A 2JPDA 1KJZA 3LF1A 1IXKA 2W6QA 4M0MA 3MD0A 1TW3A 2IS1A 1Z0KA 1D4OA 4B6RA 2YWBA 2YHBA 3U9LA 2E5LB 4J03A 4LOLA 4QKQA 4M46A 2WMDA 2R84A 4Z9YA 3L04A 5ICMA 1VIMA 3N8GA 5JH7F 5C5IA 1AHHA 1G1AA 1S2IA 1E9SA 4OH7A 3KOZA 4RNDB 4U6NA 5EPUA 4TS9A 1JU4A 3STYA 5K3EA 3HI6A 3IQHX 4PXYA 3E1GA 4RNAA 4J0QA 1WCXA 3K9GA 2OL4A 5J2UB 4TS1A 3OQNA 2BMFA 1GRRA 1PX0A 3LOUA 5KQGA 3AHFA 1KFBB 3ECAA 5JH7A 3DBRA 2RI6A 4HX9A 4LOAA 5EJ4A 4I3HA 4H1VA 1QFSA 4AL4A 1Z73A 2ICAA 1MB9A 1A8UA 3UWDA 1H5NA 4ZA2A 4NCHA 5B57C 2FPPB 2XA9A 3CH2X 2Z9DA 4UQPA 5JSZA 3L8MA 5ER9A 3L0ZA 4YT5A 4GP7A 3LDUA 1JFVA 3QEOA 2VJLA 1E89A 5ESDA 2EQBA 5E4JA 2QE7D 4BKQA 5BSGA 1WXQA 4JI5B 1S8OA 2OAP1 1MPXA 4HNAA 4EA6A 1KQFA 5CDSA 2C5SA 3DZHA 3RCBA 4AKGA 4ENPA 1C9NA 2WF5A 2I80A 4JVOA 2FPRA 3HADA 1TGYA 1WCIB 1TKBA 2YYAA 4J0GA 3TLGB 4R7ZA 3RO7A 5ICFA 4B3XA 3L1KA 4UEQA 4ER6A 2FETA 4HVCA 3AFIA 3FZGA 3BB1A 4M89A 5IEBA 1RKQA 5C53B 4OV6B 1AXEA 3NTXA 5AJYA 2ECFA 2FQWA 3GWZA 4K9LA 2OE2A 1L4FA 2BEWB 2DCMA 1F0KA 3JYNA 1P18A 4V0KA 5F35A 4F4JA 3THXA 2G3YA 1JGTA 2C4TA 4ZZIA 3AV3A 3CW2A 3ZHTA 1VLLA 1E0SA 1U8EA 1Y7HA 3ERVA 1PUXA 1EDZA 4G5RA 1DZ3A 1QDUA 5B6PA 3FX2A 5GONB 3MTGA 4J6EA 1TQ2A 3RASA 2V7VA 4IR7A 3L4SO 1N6LA 4KO2S 3ZEIA 4DLBA 2I0FA 4BOPA 3ZJ4A 1ORVA 3I3SR 2Z08A 3LUHA 4BWVA 4CFSA 5L3ZA 4V39A 5LJIA 4MRNA 4MSXA 1K7CA 1H6CA 3VDXA 2R47A 1YOVA 1GPLA 3A9VA 4WZZA 1V7PC 2K7FA 3BBAA 4GQBA 3SC6A 1JXOA 2NXCA 4XIJA 4D41A 2IH4A 5AW6A 4YJGB 4HXFB 3FNEA 4DRYA 3AEUA 4BNXA 4XEHA 5IUNC 2OCKA 4NQRA 3E9RA 4FBLA 3VAYA 4DV7B 1AV7A 2HADA 1LC0A 2ZQYA 5IKOA 1J39A 1OE0A 2I33A 3EEFA 5FL7A 4UTPA 5AVOA 3OQHA 1NUUA 4QFDA 4PX9A 1UKAA 1JDVA 2E03A 3A4VA 1ITZA 2QZJA 5E1MA 2F1JA 3PDUA 2W42A 1WX1A 1E2IA 1SUBA 2O1SA 3MT8A 3SYMA 3FMVA 4FHEA 4HSGA 3VYUB 3WGQA 1XZBA 1ZRNA 1NOJA 1G7RA 1GRVA 5EP4A 5DK6A 3VR0A 4A36A 2WVJA 3O3OB 1U9WA 2O2IA 3NCHA 1U1IA 2Y6UA 3WZ2A 3BJMA 3HKCB 1ZSVA 3A3NA 3IHWA 4PIMA 5GGYA 2WJVA 4BIMA 3UA4A 3SM3A 3D8NA 1FPMA 1K86A 2YBEA 1F5SA 2VK8A 5F9MA 4J2HA 4QPZA 2JHGA 3PUHA 5G2OA 1KI6B 2IEYA 2BKLA 5K51A 5KNDH 1WW8A 2X8BA 3PFGA 4PW0A 2ZIEA 4WK2B 1EFRD 5HWSA 2OB1A 4MINA 4UASA 4LTDA 3VUFA 1EA7A 4MGKR 1BA3A 1G8YA 4PZDA 2GB4A 5CM8B 2OR3A 5AHRA 3ST7A 4TRNA 3BJEA 1N1DA 3I64A 4KZPA 3VU8A 2YOFA 4CZ2A 2C3YA 1QIIA 4FC6A 2QUIA 4KRYA 1CJVC 1H2BA 4PE5B 5ERYA 5I7VA 4FUQA 5AIAA 3NBQA 1T2NA 3H1PA 1ULSA 4JL8A 2PLFA 4W9NA 2JANA 4HBGA 2GXAA 1KBQA 2Z1NA 1NVBA 3WLPA 4B85A 1XVTA 1L9XA 1QE0A 1MO4A 1J21A 1PT8A 3PNVA 4PYOA 1V1JA 2HJWA 3DUWA 2BFDB 3AZQA 4B79A 3EW9A 4B7CA 4MR9A 4BQPA 4D0RA 1L7AA 1V41E 4JJZA 1JDTA 2TECE 3LUAA 3WGNA 3A7EA 4QG3A 4FQ8A 2FW7A 3L46A 1XLVA 2C7GA 2B1IA 3FFTA 3T52A 2QLJA 3MJHA 4RVFA 5M3BA 2O2JA 3D3WB 5EXSA 4TWBA 3ZIAD 4JI7B 4HK4A 5KWVA 2RMKA 3WK8A 4X44A 2BMAA 3T7KA 5CYFA 5FI1B 4ZEXA 5JWHA 5H59A 1G291 2XU1A 1DXQA 1PN3A 4R4JA 4DY6A 1IRXA 2ETVA 2DB3A 3ZTWA 1WDMA 1J8FA 1U3UA 1RM0A 2W2TA 2ZBFA 3N59A 3TD6A 4C9BA 3E4CA 3SDBA 2P0AA 3Q3EA 4P7GA 3TJRA 1GTJ1 2E48A 3N0VA 3AVWA 1UXHA 3A2KA 5KOJB 2ADOA 3PNLA 1QVWA 3H3FA 1P9RA 3PENA 3CX8A 2UUCB 3K8UA 4ZGWA 1FRQA 4FNAA 3SS7X 1P5HA 4LJSA 3QMMA 3IFSA 4A23A 1QMPA 3MPOA 5F21A 2AMFA 4RPJA 2IX3A 1O8CA 3L6OO 4NC9A 1BMTA 7AT1A 1RABA 4QNNA 4JJAA 5IM4A 2ZJBA 1XPOA 4KGDA 5D51S 1FFBA 1YJQA 3ZWMA 5CR9A 2HN9A 2RI1A 1P4RA 3DBLB 3LBFA 4WK4B 4ESOA 1IBMB 1WB5A 4WN9B 1OXKB 4ZT2A 1DKNA 4ZXPA 4XWKA 1PG0A 3FWKA 5LMCA 3M99A 3WVNA 1L5WA 3QJ5A 2RAVA 3JQ8A 1R1DA 5IARA 1HYEA 2J9ZB 4ZI7A 2JF0A 1DC8A 2ACEA 4O2AB 3K8ZA 3WX0A 1TEVA 3ETEA 4HWYA 1Q1GA 1QXPA 1DO2A 5JCOC 4UTZA 1HDEA 4WCDA 4YHHB 1O0BA 1F20A 1R12A 1TPZA 1EKXA 4I1SA 1IUNA 1XCPA 1P5RA 2HUNA 2QL6A 3TZEA 2D06A 5KYWB 4BB0A 1EBBA 1QFJA 2H1LA 4WT7A 1T6ZA 1YZ3A 5I9TA 2GSDA 2RG1A 5DF1A 1SVNA 4BMNA 3AWDA 3MORA 2PR2A 4C87A 1S8AA 4RACA 1XL0A 3DWEX 1O96B 1NVFA 4S04A 1JMKC 1Y8RA 4AB1A 2HPVA 5AJUA 2ID9A 4QRVA 3IERA 4IHKA 3BT7A 5I8WA 1ZHHA 1BJKA 1XZIA 2E21A 2G40A 3TSWA 4BZWA 3NI2A 5BR1A 3CH3X 2E37A 3B6IA 3CJQA 2Y1DA 1TU0A 3TW8B 1NJGA 1JBEA 1O94D 2FPOA 2I62A 2F4NA 3IDZA 4UDOA 2ACTA 2C2BA 2HIGA 2HTEA 3DF7A 2RHGB 4WLOA 2WTUA 1EFVA 2HLDA 2LDBA 2VJOA 3NWBA 4TQGA 4WUVA 5FOQA 4CKBB 5IJAA 1I4OA 3GDHA 3IRUA 2D3WA 5JRDS 4YMLA 3QBDA 5LL6P 2G6TA 1LDNA 3RWOA 3JV7A 3MWEB 4LRSB 4KV9A 4NXMB 1D6MA 4S12A 2DBQA 5FI0B 3UMJA 4ADSG 3K6SB 1UK8A 3NHZA 3PITA 5KYVA 2V7GA 1MGPA 4JUFA 2FEWB 3GO4A 1CV8A 1PZGA 3GZTB 3L8GA 3OJ0A 4UAVA 5F1KA 1GDDA 1KH1A 3C6MA 4KLCA 3U3XA 3AILA 2HWWA 1HURA 3IMFA 5MHTA 1ZGHA 4JJ4A 4QRXA 2IP2A 4EZBA 4JXZA 1BYUA 3M81A 4KXLA 1XLTC 2BAGA 2ZE6A 2RKOA 5HIMA 1RWQA 2XAUA 2DUWA 2OWDA 1UKYA 1EIZA 5G0SA 4LXTA 4TYYA 2WM3A 1YDHA 4GBJA 1X7ZB 4OXRA 4LNAA 1NRIA 4DBLE 2GEVA 4J29A 4XDHA 4BO2A 1C0PA 3R5SA 3ORSA 1XQWA 4GOXA 2XSZA 2PS9A 3DKVA 4ENTA 5LP6B 2QRPA 4A7PA 4X6IA 4S05A 2GHQA 4L73A 1ZCJA 3S0JA 4AY5A 1F2TA 3ZZUA 4QYXA 4H4EA 2H5JA 3FN4A 1DRWA 1L1EA 5FO1A 2C96A 1BJTA 2RKWA 3EIQA 4TV9F 5H9WA 3CLSC 3NWEA 4B76A 2GBLC 5FWYB 3KJHA 2VO1A 3G3EA 2J3KA 2QDKA 2I65A 2I4NA 2W8ZA 3H4MA 2J59A 1CLUA 2CJPA 2ZT7A 4KW7A 4YCNA 2BFPA 1TZ2A 2HIHA 3I2HA 4HGZA 4E5YA 3EG9A 3RJ9A 1S1MA 4EYGA 5FX2A 2EL7A 4DIEA 1T0IA 4I19A 1G1MA 1NXVA 3IP5A 4G1BA 5TGZA 1QG4A 2P62A 4KE9A 5E0OA 3U2QA 2Q6IA 1DAKA 3H7AA 1P44A 4XJXA 1QF7A 4GZ6A 4DRZA 3T5DA 2VJPA 1DDIA 2ET6A 3ZUAA 3OMXA 1FW6A 2F59A 2H3HA 3P2IA 3GRRA 4AO8A 4QJIA 5DWVA 4UXHA 1MABB 1MN6A 1CXZA 2B2CA 4NOKA 1UOQA 4QHYA 3SXPA 4L8VA 3EXHA 3KQTA 4TROA 3V34A 1OILA 1R8YA 1XMJA 1CJKC 1WSWA 5IKEA 3DVRX 3OCZA 1PWEA 2ZRMA 3V2HA 1NB5A 4N5IX 5CHTA 1YZGA 2H5EA 4Y9TA 4QTZA 1GA4A 2OOKA 3C1AA 1Z2DA 1VLZA 4RKYA 3AYZB 1Q50A 1RCTE 1Z7GA 4UOZA 3IPYA 4PYQA 1XQVA 2B6NA 3BF8A 3ET4A 4I4CA 4L51A 1YV9A 4LHZA 2ZETA 3JQQA 4GIBA 4ID9A 1SQ6A 3A9WA 4X63A 1T35A 1RXEA 3MWLA 3R0JA 1ESZA 2Z3VA 3ETHA 2CUTA 1RAIA 1W4CA 2QP3A 2VOEA 3B2QA 3EZNA 4GPIB 4NJMB 5P21A 4OELA 2BEKA 4COOA 4HWKA 3HN6A 4YI5A 4MKRA 1XMOB 1ZNQO 5F64A 1X2BA 1UBCA 1W1UA 1Z26A 3FNRA 5EIWA 3QNUA 4QTXA 1RMTA 5IJXA 1B42A 2GPAA 3NIGB 1ZGCA 4TMYA 4L6AA 4LJ8A 2N3ZA 2N9UA 1P3Y1 4RANA 4RPKA 3AKYA 4LVOA 4I08A 1UINA 3OJXA 2JI7A 3GIWA 5CLJA 3H2GA 1EP2B 3JAKB 3UMMA 4HN2A 1T2FA 4NZMA 1J8QA 1IE3A 4FGSA 4XYLA 1FUEA 1Y8CA 4LQDA 3T41A 3ZDXB 4A5OA 1NW7A 1UAYA 3LG2A 1HE1C 5FFFA 2X13A 1PZXA 4ASUA 1WZUA 3ZE2B 4J94A 2ZWIA 4D02A 2EFJA 3V97A 2WVHA 1NULA 4GNKA 4D9EA 4KXVA 1TMYA 3ILVA 2R79A 3CKKA 2O48X 2AXPA 5LIRA 1T9DA 1UPAA 1GL3A 1U98A 4IZ6A 3DMHA 1IVNA 1PFUA 2YY6A 2D59A 1DWOA 5HEKA 3GX1A 3GRPA 4CTKA 4KK3A 2ZI9A 1RLUA 2ZIFA 4HNHA 4PZYA 1Z4JA 2LTAA 2H1IA 1TRHA 3I05A 5DNDA 1XTRA 3FCSB 1KYTA 2V4UA 4PPYA 1PTJC 5J5CA 5DYNA 2BGJA 3T8YA 3I2JA 3VZDA 4EQ6A 2CMDA 5ALWA 3QHPA 5ILQA 1QTNA 4QQ8A 4JP3A 5CBPA 3I9NA 2OORC 5AW2A 3IUTA 2Q62A 1N5DA 3RUDA 2AS0A 2C0YA 4PZPA 2HJVA 2NUAA 3MGGA 4IZHA 3S2SA 4ZYZA 1R4MB 2VHTA 3CY6A 4J16C 3FPBA 4M98A 4JB3A 3WL8A 3NEAA 1UKZA 4OKNA 4TN5A 3FHJA 1MP0A 4HNVA 1L5YA 2XKJE 4HH3C 2SHKA 3MLAA 4KN6A 3T35A 1UR5A 1QF6A 4J3NA 2HTFA 1V8OA 4DIBA 1SKUA 4KHPB 3Q2KA 2Z56A 1I3MA 2A4MA 1S6YA 2XNKA 1R9NA 1V7CA 5FNVA 4MI1A 3FUWA 1QTQA 1GGKA 4YNBA 3SFTA 3NT5A 4MVJD 9LDTA 2V9PA 3GJYA 4FD2A 3W6PA 3AFGA 5TS3A 2PAFA 4PVDA 1AQYA 2A9PA 1QH0A 3QTBA 4DNQA 1ZUNA 2PUFA 1RS0A 4XWOA 1BWSA 4XZ3A 2WKSA 4CM6A 5H3CA 1VSBA 2DHDA 2ZI6A 3ZOKA 1V3VA 2R2GA 1ZH0A 3W30A 4QFMA 1GUZA 2XODA 3BKWA 5ALTA 1Y5RA 4A03A 1KDRA 2PFGA 2IWHA 3QLTA 4LWZA 2VTBB 2JFBA 1UQUA 1RJDA 1AHNA 1S01A 4BNWA 2R1VB 4URXR 3OPYI 2GUGA 1U8ZA 4D96A 1TQ8A 3AIKA 3GFQA 4Y0NA 5D8DA 1W4RA 4ZQCB 1GGJA 4D25A 4XWAA 4M1SA 1X7DA 1O95C 3SF8A 2V6MA 2DPHA 1IXYA 2GXSA 1TEXA 5TLSA 2BFBB 1HZZC 1ZH6A 5FBWB 1CNFA 2I4RA 2RK3A 2EOAA 4G1MB 2PIAA 4KL8S 3UTCA 2BUCA 4IHAA 5K3SA 2JLUA 1WTAA 4R2XA 3BIFA 16PKA 1P4JA 1GNSA 5AK5A 5KYUA 4OEMA 4IMRA 4EA8A 4BFSA 3UBMA 1AVTA 1H4QA 2HO5A 4O1MA 3V4ZA 2XXAA 4L0DA 4UAGA 2AFHB 1DBWA 4PHTA 4TXNA 4B45A 1LPMA 3NBKA 3TDNA 1H0SA 2ROQA 4KR0A 3QVLA 1Q77A 2D0OB 2X5XA 4M21A 5EL0A 4YYUA 4ZQHA 2WJPA 1J49A 3GDGA 3G8DA 1VKHA 3MG9A 3PLNA 5IMBA 1CUBA 4QU9A 1W5BA 2G08A 2VXYA 3PIRA 4CQJA 2WB2A 2ARYA 4ZT6A 3UWSA 2GGSA 3JVUA 1VI5A 1G0NA 2YHUA 3ASVA 2CVHA 4IGIA 4R98A 4LY0A 1WULS 1NXWA 5PNTA 1T1RA 3WA6A 1QG6A 1TEHA 3KOWA 1TAUA 1UBUS 1ZHFA 4Z5XA 3ZCQA 2PKRA 3E03A 4P4LA 1T15A 4PO8A 1L0BA 2BM8A 3JYQA 3VVMA 3MUOA 2ONYA 2ZYGA 1KYYA 4L7VA 3WYCA 4TXMA 5CXUA 1GMYA 3EPLA 3IIEA 5J94A 4BLPA 1OI3A 2WT9A 3WSTA 2ODAA 4JFAA 1CRZA 4ETWA 5J5VA 2W6OA 1SCUA 1QCCA 2BBOA 3T7AA 3DBOB 3E48A 4X84A 1PWYE 2OP0A 3HUTA 1SNKA 1YO6A 2HSGA 1E2FA 4PPFA 5K8CA 1FFYA 1C9YA 3QENA 3S2YA 2ZSUA 3N7TA 3IOCA 4WE3A 2IITA 5JAZA 2I91A 1FLAA 1OIVA 2VQSA 1EWPA 3BFPA 3HP1A 1C9MA 2G7YA 4X3CA 4LXIA 4LHYA 5JNSA 4NYJQ 4QLAA 2GHUA 4DMHA 2H11A 4YMWA 4NFYA 2UVDA 4N41A 2VQFB 1DNPA 4KPFC 4ZN6A 3JALA 4EABA 1KTVA 1TCVA 1U9YA 4Y9UA 2O8EB 3RHSA 4F6CA 2OKGA 2DEUA 3GLIE 4NMXB 3UMCA 4I2VA 4B09A 1N2EA 3A4IA 1GLGA 4POOA 3GMSA 3AY6A 4DPLA 4MB6A 4B4DA 5A4IS 5L40A 3CVOA 2DJGB 4D9IA 1ODIA 5K0LA 2B4AA 2BL4A 2IPNA 1FP4A 2RIPA 2XUZA 3LECA 1JQKA 4RKFA 4XB2A 3I4LA 3NTUA 5LMZA 4S1TA 3DVAA 2WB4A 3K0CC 4AMYA 3S5UA 3NJRA 5F3WB 3AERB 4IIGA 2QTFA 3E3OA 5EVCA 1OAKA 3O4FA 1NN1A 2A78A 2JIBA 3DYBA 3N2GA 1X74A 4YT2A 4M1OA 5ELXA 3U1TA 5LMUB 1DRJA 4GG1A 4L9SA 4M1EA 4YROA 4FKBA 2PJRA 4W1PA 3Q88A 2CNOA 3B9QA 2IYUA 4G26A 5EFOA 2NV2B 1P6UA 3JVDA 2AC2A 4BLVA 5C4MA 1U1DA 5AUOB 5JS2A 2PUDA 3MTQA 3R3JA 1U04A 1UBEA 1G3QA 2WSMA 3FOAA 3CNHA 1U63A 3NRJA 2K2WA 2V74B 2BGUA 3BJIC 3S2GA 2YINC 4OMFG 3UAOA 3HB0A 3RC1A 2H2IA 2L19A 3KSMA 3L0PA 2P3OA 3AF1A 3FI9A 4UFNA 3UQZA 5JAOA 2WIKA 2QN8A 3GH1A 4BRSA 4Z6KA 5JC1A 2XCLA 2RARA 3QT4A 3EJ6A 4WZAB 1LQ2A 3ML1A 2QJWA 4PRLA 3V8MA 4MI7A 4LWOA 3CO5A 1VRVA 3VPSA 3FYUA 1DBRA 4O4LF 4UM8B 5KDLA 3MXOA 3TZKA 2C95A 1ZI9A 3IKVA 4J8PA 1NKVA 2X0RA 1FP6A 1T9GS 2Q4BA 2FEAA 2Q8NA 2I4MA 2LXNA 5T67A 4DKXA 2OHXA 4LE0A 3VBEA 4DAEA 2X5KO 3GAZA 4L95C 4EHNA 1SUWA 4OAQA 4QXOA 4MMZB 1YRLA 2ZRIA 2HHCA 4ZI3A 3D4PA 2HA6A 3A05A 4RHXA 2MINB 3DULA 4EG8A 2O8FB 3ZHYA 4BCDA 2QAIA 4I9FA 5JO9A 2AJBA 4W9MC 1JLLB 1OOEA 3IOBA 5EIHA 1E1RD 4D56A 3HFRA 1B73A 2QTMA 2P30A 2Z2XA 3R5KA 2HSDA 4F9TA 1NM5C 2V4ZA 1SD1A 4BN4A 2COKA 2VXCA 3GI1A 2CUNA 2FPMA 1NT2A 2H2HA 2RJOA 2Z5GA 3ID6C 4IP0A 4Q1CA 3UOAB 3WYAA 3LQYA 3WHIA 1PT9A 3W2IA 1NASA 3FIJA 3NASA 2R8OA 1BCRA 1QHHA 2DFLA 5I4BA 3CH5A 1KMCA 2XITA 3BSSA 1ISRA 1KBOA 1YHNA 2DHRA 2EU8A 2FQXA 4P81A 1E98A 5D1HA 3ZHCA 3DJYA 4YUVA 2HO4A 5IXSA 4S1WA 1DJOA 4BX0A 1B7GO 4WGGA 2HYIC 3ORQA 4OEHA 4WBNF 5A1JA 1TJPB 1XI2A 4NENB 1X9IA 4D1YA 3KSEA 3OLZA 5BMVB 4LDNA 1FVHA 3D6AA 2Q3MA 4F6RA 4JP1A 4AQ7A 4PP1A 2PT5A 5H68A 1W85B 2JFNA 3LQFA 4W4TA 3F6RA 4WSOA 3S81A 2PYZA 1EFAA 1Y3IA 2JARA 2QJTA 1ZMRA 4ZC8A 1QGED 3IAS6 2C2HA 4Q1EA 1SXGA 2ZYAA 2X1HA 3QE9Y 1FSPA 4G86A 1BH6A 2MOKA 1NHGA 1SWWA 4NU8X 1KNQA 3OJOA 4XWYA 2MMGA 3E1ZB 5FOTA 4BNIA 1LW7A 2Y1FA 4HX2A 2DPXA 3FYHA 3IQXA 2H06A 3CLRD 4PNPA 5DGHA 5FUBA 3RUIA 3MWDB 4J0FA 1SUIA 3RBXA 3N2ZB 4AWAA 1DPGA 3WOHA 2C2KA 1SKYB 1UMBB 2C2OA 2ZRAA 3CX4A 3KFXA 3PPVA 4I3FA 4QASA 1KE1A 1AIMA 3H05A 3I9LA 2ORIA 3FMFA 2CXSA 1Z82A 4I7EA 4X91A 3GLVA 4D82A 4YCCA 5I3ZA 3MEQA 4IRXA 4DBVO 3ZHBA 3FB4A 1MVOA 1K8YB 5A4KA 5EEGA 4EB0A 3LWBA 4MRMA 4O63O 5I01A 1O3YA 4IGAA 3Q7PA 1PFVA 4LMBA 1YL7A 2RAFA 1CTQA 4D2IA 3TMYA 4UE6A 2DBRA 4F1KA 5CAEA 3F75A 1IAQA 2W2MA 3F4BA 4R8SA 2PVCA 2WZDA 4FHDA 1WMBA 2ID7A 1ZCFA 4IXDA 3ILYA 4ND8B 1JG1A 1YD7A 3TO5A 3OPYA 1WCWA 4ZMSA 1MD9A 1JDPA 2D4AA 2IPOA 2OCAA 2OVFA 4NQZA 1XDZA 4O8ZA 3EQ8A 4RIHA 4Q1DA 2PZEA 4X20A 1KMNA 4F7DA 2CDCA 2P1ZA 2I2CA 4N5LA 5EAIA 2ZP1A 2C00A 4OUDA 1JAIA 5FFNA 4AMGA 4X92A 5DM1A 3T1TA 4JI2B 1HDGO 4PZCA 4A27A 1NA5A 1N2SA 5DU2A 1ZCZA 1FTGA 4LYYA 4E2FA 5A02A 4YS6A 4WKOA 3PP8A 4GZ5A 3TKLA 3GCGA 3UXYA 3NGXA 5KWSA 4KN9S 1U7HA 1KEEB 1VE5A 4L74A 3X2EA 5ITZA 3MTBA 4PN7A 4UHEA 1VMAA 1T6NA 4TGLA 1CUZA 4FGWA 4JROA 2I78A 1Y3HA 1FU4A 1R5NA 4RE6A 3WQRA 5AH0A 1FH0A 1EHYA 1BNCA 1B8UA 2WF7A 4M83A 4B4KA 3NATA 4R8RA 4V0SA 2UZ3A 3GZNB 1T2UA 5TC4A 4EVRA 2VDWA 1GOTA 2DKOA 4N7RA 1M7HA 1ZVVA 2XRMA 4GX1A 2HYDA 1F8FA 3DUFB 4DLPA 5CDGA 3N2KB 4RMHA 1FUKA 1HO3A 1YACA 3HA5A 4K6MA 2H54A 4TV9A 2RHOA 3WP1B 4RTPA 3NNSA 4Y6RA 4LSMA 4IJQA 3T7JA 2GF0A 1A72A 4G84A 2XT6A 1RAHA 5LMNB 4G1VA 5BNTA 4GZMA 2PQ0A 1UDCA 1PJLA 2AFIE 2WA2A 4NNJA 1EFPA 4B43A 1E20A 5FPYA 4CMIA 2F00A 4YV8A 1LRLA 4XGNA 1IM5A 4JODA 3PICA 1BYIA 3W5HA 2Q0QA 1QPBA 2PL9A 8ADHA 4LEIA 2FUEA 4KR7A 2XJ9A 1GQYA 2BLNA 4DMRA 2GNAA 4L0MA 3FNHA 3IESA 1IONA 4ZJPA 5EJ5A 4U0KA 1XZGA 2AX3A 2WWFA 5T57A 1W4LA 4CEJB 4M0UA 4YPOA 2DPGA 2XYRA 3GLUA 5HA5A 3DLHA 4JLWA 3KFVA 4A16A 4A8HA 4AJLA 5CFQA 5L3SA 1N2XA 1MBZA 5MGBA 4ENSA 1JFSA 4UHKA 2C1XA 2CNKA 1PTKA 3GVPA 1KRHA 3HCNA 4CJXA 2YN4A 1PWXA 1P17A 1VP9A 4MR7A 1H05A 1RI5A 4DMUB 5E2IA 1YS2X 1WXFA 1XLWA 3PKZA 3RTBA 4Q3CA 4E5NA 2VKTA 1UMCA 1KDYA 1M0SA 3KLPX 1G8PA 1KXJA 3RUHA 3ZLUA 2NQDB 1WXXA 2QNBA 4IIYA 4LX8A 2WQ6A 2ZM6B 4AKHA 2QTVA 1ORHA 4PGGA 2IRWA 4OA8A 3MTNA 2FEXA 3VZBA 4B8WA 1XDGA 5DLEA 2XCSB 2VNIA 1OXMA 1T5DX 3KJIA 4G25A 1RU3A 2CLFB 3HZHA 4B3DA 1B6RA 1A71A 1XAGA 3G2HA 1MC5A 1BMQA 2C5GA 3A1UA 3EBLA 4QAJA 2P40A 1JHMA 1T1EA 4K2HA 3ER8A 5TDHA 3FLBA 3LKBA 4FHGA 3EOAI 1XA4A 1U7ZA 3AF4A 3RNLA 2P6RA 1KHHA 3F1KA 2ZS7A 1UBKS 3FMGA 4IVRA 4GX2A 2R9VA 1ZMTA 2OK7A 2ERYA 3STHA 4Z9AA 1H65A 2NZ8A 1K3TA 4F8JA 5HOQA 1NXTA 2WZBA 1CHDA 2C9ZA 1AT1A 1JUDA 3ZPXA 1W1IA 3WC4A 4PI3A 2C2XA 1QHGA 3MJCA 2Q3JA 4C4SA 1QR2A 5FORA 2YHSA 3AVXA 2AFRA 1ZM3A 4ZVVA 3QHAA 4CV0A 1QUFA 1EWKA 2HQBA 2IIVA 5KJCA 2AUXA 4WK0B 1RACA 2IIPA 2Q3CA 821PA 2V5VA 3HKDA 3TLYA 1VDZA 2JIPA 3GN1A 4JLKA 4R68A 3TW6A 1O97D 2QNIA 1GEGA 1PS9A 1U8XX 2ODPA 2RGDA 5B58T 3SG0A 4BWFB 3LDAA 3E70C 4I4TB 4QDKA 4ER7A 4PAMA 1Z7BA 5J4VA 3H87A 1K5DA 2VNJA 3K4QA 2XNDA 4FR0A 4Y2RA 2IEIA 5CVUA 2ACKA 2QLLA 4HRYA 3RB8A 4KUHA 1LFDB 5LA6F 3WR5A 2O05A 3FNIA 4BVAA 3FHCB 2ZB4A 4NSNA 3P2JA 3QSGA 1XD8A 3TRHA 2JGIA 4WY8A 4FTWA 4O8CA 1UZMA 3QG5A 1ENOA 1EPUA 1LS6A 3INYA 3TLZA 3UK7A 4F38A 4TTRA 4XVUA 3EVFA 1QFYA 4ABTA 4ARZA 3LZCA 3NO4A 4H08A 4QELA 1QH8B 4R8LA 8AT1A 3G2IA 4L8YA 4AQDA 2W6MA 4I8IA 4XYMA 4CQNA 1JEYA 2NTYC 3DLPX 1Y80A 2OXCA 2ZKLA 2HOQA 1XKXA 1Q0QA 2JZCA 3GRFA 3L05A 1EU1A 2AR7A 2O50A 1NYLA 3KSUA 1KPIA 4Q1BA 3RTAA 3VRHA 4KFTA 5ER6A 2NOAA 4S2UA 4HJXA 4LOJA 2GCOA 2X9VA 4Y1GA 2ECQA 1M6HA 2XLCA 4FBGA 2FRDA 4DJJA 3LUCA 4EOGA 4LFAB 1O0EA 4BOZA 2Y1OA 4N03A 3RODA 4DJEC 2XDYA 1IULA 1AKUA 4I9NA 1A4XA 1P4GA 2PN1A 2RCNA 4K6HA 2JIZA 5AXCA 4QTYA 4EHAA 1BXRA 4JJIA 3U4GA 4KEAA 2PEZA 4KQKA 1R0RE 1ZM2A 3BAZA 3UV3A 1U0OC 3Q7RA 2ZE7A 1G5HA 3HJGA 3QLUA 3QUTA 4MQFA 4FVTA 3TMKA 4C7KA 2O8BA 3HHAA 4K9KA 1FUYB 4OL9A 2O2EA 4BGIA 1Z07A 1IOZA 2WLSA 1PR9A 1T1JA 3QI2A 1V1MA 4ZANA 1S02A 1QV9A 4FOSA 3TN7A 4EJ0A 3HSKA 1M2KA 1PLJA 2QGFA 3P2YA 3OTIA 2OBMA 4JK3A 3ADOA 5KS2A 3HB1A 3I42A 4BUJA 1ECPA 2R66A 2E5FA 5C3UA 5LKAA 1CT9A 4NESA 1YS4A 4FEAA 2CJWA 1VBKA 4KRGA 1AM4D 3RVVA 2ZWMA 1L4BA 4ESEA 4BOUA 4X94A 3UPDA 3IP1A 4BDSA 1X9HA 4Q1AA 2FGKA 1I1QB 3RAJA 5DSXA 5SZJA 4UNQA 2OT3B 1AN9A 3HB5X 4WNAB 3RVKA 3RS2A 5JSQA 5KJ6A 2QJFA 4HS9A 2E0IA 2IW3A 4M0CA 1XN1A 2C5BA 5JFOA 3KQUA 1A69A 1U6JA 4UMEA 3U37A 4OP2A 3V7YA 3KSRA 1RFGE 4KBYA 3PD1A 4KXNA 4PSDA 1JAXA 2BT4A 3LHKA 4TQUS 5D00A 4UREA 1UZLA 4JBYA 3F97A 3VAAA 5E6UA 4BP8A 2DGDA 2J9XB 3GFBA 2FWIA 4FDTA 4MS1A 4D5GA 1RZRA 1NVMB 3OQCA 3DONA 1CUHA 1THGA 3KSBC 3DAHA 1Z13A 4RQAA 2J3QA 3AMVA 1WIWA 3O5AA 5BWLA 5KVQA 4QUBA 1W96A 4WPGA 1N5JA 4N6NA 5BWMA 4DDVA 1P6QA 2AG8A 1GNTA 1MB3A 2H1HA 3GT0A 3M9XA 3OH8A 4KWCA 4YMIA 4LC1A 5IUKC 5BRJA 5BV8A 3CLUC 2IHBA 3K8QA 4QC2A 2CDRA 1QRSA 1U9VA 3CQ9A 3VH2A 1Q1AA 3EUAA 1CYEA 5CDFA 3L07A 4DC1A 1BDIA 3FPSA 4YAIA 3KKKA 1ESDA 3P9RA 4MIOA 3WMFA 4JX8A 1J0AA 3WY9A 4B44A 1LSOA 2D00A 1BWPA 4MO9A 3UK2A 4K6OA 2XUAA 1YCGA 2HREA 5JQGA 1VL2A 1N8SA 2R6AA 3ESZA 4A0QA 2XXBA 1ISFA 5I7FA 1L7MA 2YWGA 2ZTVA 1ENPA 5AW1A 1LVUA 3PHUA 1KS9A 1ZK1A 1RKUA 3BZUA 4PF1A 3C43A 4KIJA 1QDEA 3WWCA 5DGXA 1AO0A 4P84A 3TQHA 1M1YE 3DVSX 1I4DD 5J58A 4Q9AA 3N76A 1Y34E 4PT5A 2GPNA 1CUAA 4BAGA 1W36C 1A7AA 2SCUB 3SJZA 4PYKA 1HFWA 1QTIA 3ZY5A 3TLBA 1PBHA 2Z1MA 1POWA 1TKAA 4C08A 1H3NA 3OFKA 3KELA 2I3AA 1PGNA 5CH8A 4DT1A 1DCMA 2B4TO 2FJ0A 5CEEA 2HRZA 3ZS9A 1DMRA 1ELOA 1U0NA 4FN4A 4NMLA 2WF8A 5ALHA 1XTQA 1XAIA 3C7TA 2O8NA 3BHIA 3G6KA 2WG0A 1THTA 3C98A 5BQFA 3PFFA 4CIAA 2PG3A 2LKDA 3KZKA 3QFFA 4BNTA 2QRKA 4YAGA 4L57A 5ALVA 5KU7A 2XBLA 4Y1RA 5FXMA 2PL5A 4CI0B 4EUKA 2B7LA 3IL2A 4UE3S 4GM4A 5B6IA 1LBEA 2WJYA 1UBMS 3I4CA 3CVYA 3QX3A 2DZZA 2FLKA 4YRGA 2OOSA 1PT5A 2CC2A 2L82A 4MVJG 4WACA 1Z0UA 3U4DA 4CTOA 4J07A 2VDPB 2FVYA 4N1AA 2VH2A 2E01A 4DA6A 4AO6A 3IUEA 2JK1A 3MTJA 4O4HB 5IKXA 2I7TA 2HT1A 3V1UA 3LQQA 3F47A 4TKVA 4MARA 3K6RA 3O4IA 1PT7A 3ITNA 1DCFA 5EZYB 2JIQA 5KNCH 4WLFA 4WVFA 1GCBA 3C8DA 4CDFB 3WK4A 2FPUA 1GFWA 1NVWQ 1K63A 1RI2A 2DTDA 3P2EA 2DKNA 1FDTA 3PC2A 1UKEA 2CJYA 1X1CA 1CW2B 4MAAA 5A6SA 1SR8A 2OHHA 1U02A 2B8NA 2HBYA 2IU4A 4ME6A 4AKIA 1GFZA 2HDNB 4QOFA 3LY7A 4XLLA 4CIXA 4OGLA 4JHXA 2QKYA 4D92A 5KTMA 4KSYA 4D57A 4P1ZA 4J7UA 3WTCA 3WXGA 1YVUA 3SYNA 3P94A 5KI6A 2C31A 2VWPA 1YWGO 3W9YA 4AMZA 3U7RA 4ER5A 4L5JA 4QGFA 3VR4A 2PUGA 1N9GA 1XVAA 3DMDA 3HL0A 4IJ6A 3INNA 5FWXA 3ZNHA 3C5CA 4NBLA 5TJHA 2D13A 5IVHA 3CNNA 1BOFA 2W6CX 1MOQA 1KP9A 1KVRA 2QL7A 2B8JA 4LQLA 3JTMA 2HJHA 5H3HA 3QKWA 2W7TA 2PX3A 4X7PA 1Y82A 4AZVA 3KXDA 2XCUA 3C3DA 1LBTA 4DE5A 1S8NA 4IM7A 3JVIA 3NAZA 1GPAA 4PX3A 3W6UA 2XNCA 2QI9F 1VMIA 4JVMA 5C32A 1OXUA 4RF1A 3E7XA 3LYHA 2WWHA 4TMTA 4D4HA 1ZD1A 2GRUA 4G81A 4JYMA 4O4LA 3SX2A 1SIBE 2AYNA 5DULA 4C2TA 3SEZA 1HBJA 1NAIA 1SBHA 1OC2A 2VTEA 5K6TA 2J9GA 3PJEA 1ZWLA 3K15A 5TPZD 3R9XA 2IP1A 3NPAA 2GXQA 1PG5A 2X76A 2C2YA 3U4CA 4AXMA 4QXQA 4LF6B 3THRA 3HU1A 1FP1D 2POQX 4N7MA 1RWXA 1UJ4A 2A4KA 2AOXA 1J9ZA 2CKDA 4H35A 2C5HA 1STOA 3PDWA 3INRA 5GQSA 3RYFB 2ZSJA 4WADA 3SFZA 3OVZA 4EJ6A 3S68A 2I6QA 2JGDA 1EFHA 1EM6A 2VHWA 3CXUA 4ZPJA 1OCEA 5TVKA 3FGOA 4IIEA 3SSOA 4BKUA 4OVZA 1JZSA 2ZFUA 2G9NA 4YAJA 2BBSA 3TX6A 2KHZA 1EXMA 1KSHA 1PCIA 2H4WA 3B1KA 4R81A 1OUMA 1UQRA 3MCTA 4PGMA 2B20A 3MMPA 5AICA 3OETA 4FZRA 4ZRNA 2F1OA 1DIHA 1P72A 1L4NA 1U7DA 4Y1EA 1V9LA 3RNOA 4C5BA 2ZYUX 4KODA 1Y33E 1FTNA 1RE0A 4AKTA 2XUGA 2QTRA 3WO0A 4RD4A 4ETMA 5KYGA 4W99A 3FBTA 4A6PA 2Q8PA 3OQMA 1Y1SA 1XNGA 3I12A 5BT9A 4D3YA 4O4IF 3NRBA 3DZDA 3WGOA 2VR1A 2H4JA 5DX8A 3ROFA 4BWGA 1YFJA 1XFAA 4JBHA 2FSUA 3NKFA 4DR2B 1U0BB 3IPRA 3M4YA 4BNGA 2QXTA 1RQ2A 2P1RA 3IBFA 4NPAA 4IRUB 4QDJA 2GMWA 2YOGA 2C8KA 3WIBA 4BWYA 3VU9A 1LTKA 1LLDA 2O3TA 3IAAA 2ZIXB 5KVCA 4OLHA 1V11A 5B36A 1P9LA 4WJKB 4DM7A 1NR1A 3GGJA 1PJBA 1UH5A 4J76A 1J42A 1MW9X 2X1VA 3P52A 2BKEA 2IYFA 1Z5VA 3HNPA 3ESBA 1DAOA 1JIJA 2WPDA 3O3NB 5JOQA 4YXWD 4FYWA 4KZKA 1Z5NA 4G9EA 3ZU2A 4WBNA 1QBGA 4BS6A 2UZAA 3VPDA 2R6DA 2VJQA 3PX3A 2WYVA 3WNZA 2O6XA 1Y1TA 4Q16A 3CVWA 4DCSA 3H2YA 5FUWA 3RYIA 4BO7A 4MMXB 3VO2A 1YIOA 1CDEA 3KR0A 2C3UA 4UAUA 3T7DA 5B7GA 3DDNA 3OZCA 4BOYA 1U2TA 1JEJA 1RJEA 4D7AA 3G68A 5JY1A 1KF0A 1VMEA 1JIVA 2FNAA 4XD2A 3TZ6A 4ZICA 3HO1A 3W04A 4BMXA 4OU5A 3RHZA 2BSQA 1XEAA 2YMMA 2DY1A 1YA6A 1RQXA 1QO0D 3DAPA 1XZPA 1RAFA 3DL4A 4AT1A 1IZ0A 3K5PA 5JATA 1M2FA 2IZZA 1WUJS 2B61A 3LT1A 1W93A 3E27A 3AVQA 3DQZA 3LCUA 5IBPA 1I4LD 3IUSA 1E18A 3IAHA 2JA2A 4IINA 4BKMA 3ZS8A 4YI3A 1AGYA 4DLZA 5DO9A 4DV3B 3HDYA 4ZTBA 1ZBQA 3GMIA 4DMMA 1A1SA 4L28A 1GGEA 2KWIA 3W4KA 3GC6A 1IIRA 1VB5A 2XADA 3IIIA 4H7IA 5LU9A 4AS1A 3RSHA 2FP4B 4DLKA 1XHFA 3WGZA 2GN0A 3MGKA 4MUXA 1S2DA 5K0NA 4DZZA 3ZY2A 1JU9A 4GI1A 1JPVA 4Q9KA 5JW6A 2P86A 2NV0A 3PDIB 3S2UA 3QBEA 5JHGB 4ZJZA 3AOGA 3CZRA 3E84A 1G4HA 2E18A 3AVPA 3IV7A 4DQKA 4TM8A 3DMGA 1QQ7A 1DS6A 2FPIA 4H7JA 3N86A 3U7QB 3IHTA 9GPBA 4KK4A 4PBTA 3WXBA 4F2HA 3K0KA 4K9RA 4ODIA 3WLTA 3G7SA 2NNLD 4CV3A 4ETIA 4TT3D 1KFJB 1QKJA 2IYWA 3OZIA 4QM6A 1DJNA 4O5OA 4BZPA 3W06A 5TEVA 3MVEA 3C3BA 1XVVA 2AC7A 2OHOA 4K88A 3VVCA 3WGYA 1MIRA 1ZRSA 2A5DA 1K6IA 3NBZC 4HRXA 2VSYA 2I6FA 3NP7A 4L2IA 1W34A 3RQSA 4DW8A 4DR4B 1NLFA 2FX5A 3E9MA 3L02A 1GPH1 3OY7A 3NV9A 4EP1A 5LDDC 4MO2A 2GLUA 1JR3E 2WV7A 5FR1A 3T5CA 1Q5PA 5G4KB 3ZUGA 4K8OA 1Q0RA 2YX1A 3ZTYA 3PUYA 4JYPA 2W9XA 1OT5A 3AG5A 1EJ6A 3VOAA 3UCEA 1KC1A 1R0CA 1JW9B 1UWLA 3U0BA 2IYRA 1TO2E 3KOMA 1E5VA 4FB4A 2IS6A 4BVHA 3WFJA 1AUVA 1QONA 1T4GA 1V47A 2UUOA 3E82A 3IO5A 1QVRA 3ONFA 4JLDA 3ZZMA 2YKGA 1IQPA 1Q2XA 3L2OB 5ES3A 4Y6PA 2P41A 1YCHA 4DMYA 4BMSA 3WB0A 4ES6A 2JFOA 1KDPA 5EGSA 5LYJB 3EIUA 2QLBA 4Q1VA 2W2PA 3RTDA 2WFLA 3MJ5A 5T8KA 1NX6A 5EI5A 2GEKA 1I3OA 2Q5HA 3FIUA 1G6Q1 1E1QD 1RPNA 1B76A 2AZDA 1AY0A 2H2WA 3CF0A 5FBHA 3Q2IA 3DZKA 4BTLA 3HWRA 2ODEA 1BMFA 3G17A 1OLUA 2JA1A 4GF5A 1E1KA 2ZUEA 2ORYA 3QWIA 1E2HA 4FE3A 2Q4RA 2VAWA 1TC1A 4G9GA 4XUGB 4ZHQF 4KNWA 3ROMA 3IB6A 1Q11A 3LDFA 4B2IA 1Z63A 3GV0A 5FRDA 4Q00A 2IXDA 3YASA 4DEXA 4A10A 3SQXA 5JJKA 3UWMA 1CVLA 3LXMA 2A57A 3ZE8A 5TXGA 1Q7GA 3ANMA 4CTNA 1EEXB 1F2UA 3DD1A 3LPMA 5I7EA 4ARCA 4F5YA 4K9MA 3GMDA 2K4MA 4M0FA 4A6XA 4D98A 2UZ1A 4RKWA 1J00A 2G83A 2FMTA 2FCRA 3OUZA 4EHDA 4M99A 4PTLA 5KO2A 3HVRA 1GNLA 2BFWA 2CXRA 2GFIA 5COQA 3ONNA 5JI3E 3F6PA 3UOGA 2VJNA 3BIJA 4MPDA 5KTYA 3SLRA 1JAYA 4NS1A 3WJ2A 3EVGA 5A9RA 1CRQA 2HHLA 3PXCX 5B7PA 1X87A 3NGMA 3QVSA 3MMZA 3SXJA 2HSJA 2A14A 4EHBA 2O6HA 4QLOA 1FE8A 2QTLA 4LOIA 5FWAA 1ZNYA 2X8JA 4AN4A 3E0QA 2BTOA 3C6YA 3A14A 4I55F 1CP2A 2MMCA 3HFSA 1IHYA 1VKNA 2EGHA 2HMAA 2Y77A 3QUBA 4MWTA 4KRFA 1EJBA 5EP1A 4KQMA 4KPUA 1ISJA 1NI3A 2BTQB 3BC1A 3OSZA 2NYRA 4RPCA 4EEKA 1BTOA 1NUHA 4F8EA 1U9IC 4DUGA 4NHOA 4RW0A 1LPPA 1Z33A 5DWQA 4GPD1 2G5GX 4EF6A 5CFRA 3PIDA 1D0SA 3OZ7A 4WXRA 2DH6A 4E11A 4ITVA 4K46A 5LA6A 5FTKA 2QN2A 5KKCA 2FV8A 1SEPA 2K6GA 1J0DA 1KR2A 3BSYA 5CX1A 4ZDJA 4FDAA 3W2GA 2F8LA 5BW4A 1KMQA 1QHNA 4YXFA 5HM6A 5D86A 5GADl 3TRKA 2PLAA 3G8AA 5BN5B 4IDOA 4QQKA 2VJMB 5T4FA 2XECA 1KEUA 2JB9A 1EBFA 1I24A 4DQVA 5BV1A 7MDHA 1EXDA 2PADA 3L6RA 1WBBA 2XYGA 3AIMA 3T7IA 2J41A 3AJ9A 3LY8A 1SBYA 4YHBA 3TQTA 3KSAC 3UHAA 1X19A 5ETJA 2DC1A 1SBCA 1KVQA 3ITDA 4RJIA 5TX7A 4IWYA 2W71A 4LYFA 3VPXA 3WNBA 3WSVA 2V7WA 2GF2A 1GQ2A 1DQPA 1EWLA 3OI7A 2BR5A 4JLNA 2CUKA 3ICVA 5CCDA 4QGSA 1VSNA 3D2AA 4CL2A 3ZWAA 5CGQB 1VG8A 3GLIB 3NU1A 5FOVA 1XPUA 1O6BA 5A0VA 2YWHA 3MLEA 4WKCA 5HILA 5CHEA 3AESB 2FX2A 3FWZA 3F6EX 2CFCA 3G0IA 5HM8A 2EBWA 3CWCA 3RI3A 4BKOA 3IT2A 4NZOA 4C04A 2R7AA 1YZUA 1YR3A 2V1XA 2DPYA 3H2HA 3EDMA 3FJYA 4NE7A 5LSAA 1SXJA 2OD7A 3KEOA 2Q7XA 4GBMA 1QNLA 5ALXA 1ZEJA 2VF2A 4RVHA 2M32A 3H8SA 4W8GA 1JTFA 5FI5A 3WLJA 3B3QA 5MGNA 4RELA 1WP4A 5DN6A 3AFOA 4UUMA 2CCGA 5EHGA 5EZQA 4L0QA 5J3JA 2BONA 3HVHA 4NBSA 4D6XA 2AI3A 3PA6A 4FHFA 4NECA 4DNOA 3GRUA 2CKMA 3H4TA 3SR0A 4RZ2A 3DLBA 3CINA 3EGIA 2G5CA 1V4VA 3GFTA 4G85A 1PLKA 4BNDA 1E8NA 1HG1A 2CIOA 2D0DA 4YIKA 4NBVA 3QEBZ 4G23A 3IBGA 2QRNA 4KIGA 1AUOA 4L08A 5K8UA 1Z75A 5BQ5A 5HXAA 1EWVA 4LPKA 3OE4A 1YGPA 5F02A 2C8JA 2Q1TA 3KD2A 3PV0A 3N8DA 1HZJA 1UP6A 3ERCA 3EEBA 2YXEA 1QVZA 2Q0HA 4TKUB 2ZE8A 3JQGB 2AMVA 2QIOA 4LNHA 4OB6A 2QT9A 3H89A 1IY2A 1OR8A 4N5NA 1TFRA 4MV6A 5IJ9A 4BYMA 1PVJA 2FW6A 4Q3OA 1JJIA 1Q17A 1H23A 3DQQA 2QQ0A 3OOJA 4WKGA 3WWOA 1G21A 4YDRA 5ABPA 2C5EA 1ZGJA 2RCYA 3JQEA 4F97A 2GETA 1P2BA 5A5GA 3V8RA 2PD6A 4F72A 1BW9B 1NBEA 1UMDB 2CYAA 4OSOA 3DNPA 1OWMA 2PX5A 4RPLA 3TIGA 3EH1A 2OV1A 2DPLA 3HA7A 3L7IA 1MJNA 1DX4A 3MB5A 3BFJA 3HC7A 4QUDA 4UBNA 1WZEA 4CUZA 3IR5A 2ENWA 1AZWA 2V7QA 3OP4A 1ND5A 1BGVA 3M6VA 3LT4A 3N3AC 4MGZR 3X1XA 4D3ZA 1JYSA 3VU3A 3I9JA 2OBLA 3ANTA 3K9CA 2H5IA 1B93A 1X1RA 2AQKA 1J07A 4LOHA 3SYKA 4AP9A 2VHSA 1DT5A 4G09A 4MNTA 4YFVA 1RAAA 3BX1A 3VAZA 4AUEA 3P9NA 1KFUL 2QJRA 5LCXA 4Z1MA 1L7EA 1C14A 2OK8A 2Y1KA 3CZMA 3QNWA 5BW6B 5K8IA 4CTJA 2E4WA 4LDJA 3ZWKA 1GR0A 1KZHA 1T2VA 3EGOA 1CZHA 4EG7A 3GAFA 1QWSA 2PE5A 3OBIA 4MW6A 2ZAMA 3W1WA 4PXAA 3A4YA 1GCGA 1M2VA 1ZCBA 2VTVA 3K5IA 5FA8A 3KD3A 1JDJA 3AP3A 4XSVA 1QIMA 1R6VA 2EFCB 4RKXA 4TL9A 4HYYA 1GAQA 1SUSA 1U2SA 1UDWA 1Z6AA 2FZVA 1K4YA 1HDXA 3MSCA 3KZVA 5JCPA 1JP7A 1P1FA 2QM8A 2QN6A 1JG6A 1BX1A 4EKYA 2QAGC 1ZJ6A 3SSMA 1NQVA 1EVYA 2M6LA 1KKUA 3HR7A 3IAM6 4BU1A 1CPYA 5JNLA 1ME4A 1K8RA 2RGBA 2DHCA 2Q5QA 3G0CA 4OK6A 1IXZA 4RENA 3U39A 3VH3A 4FEEA 1JALA 5A9SA 3EXHC 5F78A 3MRXA 2JHCA 2VZ9A 5DZSA 3MCZA 5IVDA 2X14A 4YJ3B 3L6CA 5TF0A 4UUAA 1S3GA 4G89A 1NI4B 1MAWA 4YCDA 5CHVA 4IS3A 4ZVTA 3REGA 4P4TA 1SVKA 2QM3A 1BFKA 2YMPA 2VH1A 621PA 3KC2A 1OQAA 2BFCB 4YPVA 5IF3A 3EC7A 1XNRB 1XD2B 1HX7A 3DWFA 1F2AA 3HHPA 2D1QA 1G8GA 3FPKA 4RF5A 1QDLB 5AM4A 4GGPA 3C1OA 2XYPA 3H4VA 1UODA 4RA9A 3HJNA 3CN9A 4AZ3A 4RTQA 1HORA 4B33A 1PSDA 3L8CA 1VFNA 4F2WA 4CKZA 4HDNB 2F1HA 4DCUA 4FSXA 3PCTA 4J4BA 1PBNA 4X60A 4F71A 1MC8A 4J0KA 4R9VA 1AQJA 3GLRA 1P1BA 3KV3O 3EDOA 4J2TA 4OLJA 4JLSA 5C4IA 1OH8A 1L3BA 1NJ8A 3A58B 3KKMA 5M29A 2IV3A 4C0SA 1PNVA 4AJJA 1P5JA 2KMLA 4QTTB 3ANNA 4YYSA 2DH5A 1VIVA 3A06A 3H1TA 2ZJ4A 4AMVA 1NE2A 1GKIA 4U0JA 2ZRLA 3G88A 4B34A 1JAHA 5JZMA 3V8EA 5J40A 5CEFA 5A06A 4D9JA 3H6SA 2Y76A 3EN0A 2FZEA 3JWPA 4DJFC 4CT0A 1Q0TA 2CL6X 3UAYA 5ELMA 1DEHA 3W8DA 2MHCA 1MHTA 4M36A 5AI9A 1CVRA 1KJ9A 2DOKA 3EA5A 4RTOA 5TS2A 4RORA 5ECGC 4D4JA 2D74A 2RHWA 3HFJA 3TL2A 4ALJA 4AWXA 5DNWA 1SRQA 1YRAA 3IBCA 2HQOA 3MRVA 3PQ5A 4D80A 5K3OA 1A9YA 3EFOA 3H5AA 3LX8A 4TXLA 2C1ZA 1CB7A 2VDUE 2XQIA 3Q6NA 5CLQA 4MUJA 1YR8A 3IMCA 1AOXA 3OKCA 2IOFA 3C7KA 1EVIA 2C4KA 1PL6A 1FZQA 2EATA 1JQJC 1KJQA 1Y6FA 3S1AB 4H4DA 2C61A 4HNRA 3BXZA 3A1WA 2OV6A 1YR1A 3GD7A 2OESA 3LT2A 1W35A 4IOKA 4DJAA 1CR6A 1V48A 3QKSB 3WGGA 8PCHA 2JK0A 5FBKA 3NMUF 3SX4A 1FFWA 3DOCA 4JQZA 4PPGA 4WFKA 2AFIB 2JAPA 2H29A 1JKMA 4A8JB 4X97A 4BY9E 3MCVA 3R0XA 3L7OA 2DE0X 4LMAA 4S2EA 3H97A 3E9QA 4KAXA 2WWYA 1NN5A 2PO7A 2QTHA 3JX9A 1YBHA 1H4VB 3LGAA 3CWZA 4OHZA 3DOFA 1T24A 2IPPB 2V0NA 2EZ9A 1NLZA 1UPFA 2Q41A 1YJAA 1IN7A 3MUFA 4R83A 3RABA 1XDWA 5I6DA 1NVEA 1Y4UA 4GS5A 4O4IA 1K88A 3SKYA 4DN6A 2YJ9A 3GR6A 3K0FA 5DPMA 4KXQA 2CV0A 3HB4X 3T1NA 3TSZA 5CCEA 3ZKAA 3INTA 4M54A 5HRCA 5BQPA 1CERA 3KRTA 4OHFA 3LQ1A 4RCYA 2V58A 7ADHA 2WK1A 1DIRA 2OB2A 1A2QA 1PDOA 4G5OA 1SPBS 5F2KA 1A9XA 4DCCA 5B3LA 3TLKA 4HH4A 2W2QA 2RJ3A 3ECSA 3TR6A 1J25A 1OU4A 4URWR 4KPEC 4FIPA 5DCWA 2ZUCA 5KYTA 1R4NA 1PQUA 4Q9JA 4AG5A 2HPZA 2QMYA 4M7OA 3SR4A 4WOPA 4PLYA 4CMHA 2J0SA 3NHFA 4IIHA 3Q0TA 1M2OB 3ANYB 2WJGA 3OQIB 4ZYWA 1E7YA 3R8FA 3JASB 1BCSA 3EZGA 2CYCA 3CUUA 2HGZA 2QA5A 5HRUA 1TT5B 1H9CA 4JBIA 5D3MB 4YJHB 3FJ1A 3GFPA 3KWLA 5F77A 3AY0A 1NNEA 2DECA 1UC4B 1JLSA 5E7IA 3DV2A 1ODCA 1T0UA 1IVSA 4RDCA 4ZC1A 5HE8A 4N65A 4UPDA 4D4IA 1GSIA 1V3UA 3PVZA 9ABPA 1DKRA 3BJRA 4F96A 2QL5A 4HFNA 3ACBA 5G1NA 2BDLA 2OYRA 1ISIA 4KMSA 1P0FA 3KUXA 4LJ9A 4OBXA 3UGQA 1QH1B 2VP5A 2OO7A 1NPDA 4YQFA 4OO3A 3PL1A 5HKLA 4ARBA 1VBNA 3KPJA 3SMVA 3UB3A 4WESA 1EVLA 4OBBA 1XALA 4UD6A 3VJLA 3IQIX 3MTDA 4PSKA 2PRYA 3QF4A 1QNFA 1M1ZA 1PPNA 1BC5A 1V1RA 1T25A 4G01B 4NE9A 1J09A 2FHPA 3UN1A 4M9SA 4CDMA 1Y8AA 1Z36A 1ZSNA 3H3XA 5BN4B 2KQUA 2CVQA 1GXSB 4EO9A 3R9XB 3HMQA 4F3KA 1XTPA 5FB3A 2ZR7A 5LQSA 2FPLA 4MPPA 2YJ4A 1F7UA 1TUIA 4YP9A 1EFTA 3DE7X 1N2BA 3CNEA 1XQ9A 1RJ9A 1R9JA 1U9JA 1C7FA 3OTHA 4EYEA 4E09A 1W7AA 3U49A 3CRZA 4WKNA 5DM70 3HLKA 4CEHB 3AF2A 3C15C 3NYQA 3C2QA 4IF4A 2YZ7A 4CLRA 3QPUA 3H5VA 3V4FA 1OSNA 2ZUSA 1TYZA 1C2YA 1QYXA 5HF5A 4AW9A 3GNQA 5AW0A 3G85A 2XH8A 2GZ2A 3ZVRA 2IFTA 4XX1A 1PX2A 4UDYX 4OVKA 3HUFA 4QBFA 3SZOA 3H11B 4FUTA 3SJCA 1L4MA 1NJ1A 2PSDA 1QORA 2WIFA 3DNMA 2AW5A 2NU6B 3QLVA 5FKJA 1RZVA 2QL9A 5DH9A 2PUVA 1SVMA 3V8QA 3A7DA 5CJJA 5CW2A 2P67A 3DP7A 5AW5A 1GCUA 5AESA 1SMKA 1F2BA 3BOWA 3KEFA 3PD0A 4YAOA 4QVIA 3U4IA 2Q3DA 3RRFA 4Y6SA 4CM4B 3RSOA 3EMBA 5KMGB 4XGKA 3REQB 4HPXB 5B3KA 4KITB 2LW7A 5SY4A 2QN9A 2OO3A 4MW5A 6PFKA 1X1SA 5FV7A 3EVTA 2F2TA 3EXEA 4PC3A 1CJCA 1KZYC 3RROA 4N6GA 3EC2A 2JEOA 3R7WA 3I53A 2BC9A 4FIZA 3W7BA 3NB0A 4RS3A 4MGHA 1FVFA 3F5SA 3WIOA 1XWIA 1K6JA 4IOMA 1Z3IX 4GLBA 5JSYA 3U44B 3BULA 4WNIA 2ISQA 1L4EA 2HNKA 2PIDA 3IRVA 1CUXA 1Q3HA 2A0FA 5EKUA 5CHYA 2QK4A 5C1OA 4ZHQA 5K7SA 2Q1UA 2Q8QA 4AJNA 1JB1A 1U9ZA 4IUDS 2J9FB 4JBXA 4MV1A 3RARA 4G6ZA 3RV4A 4ENWA 2XNJA 4CT5A 5J2TF 4IDHA 1ZINA 5DXAA 4EFDA 3L0DA 1AO3A 1GILA 5T3UA 4D4MA 1MPTA 3KDPA 3E8SA 1UM9B 2AJTA 3D3KA 1TX4B 2FR8C 3B52X 5FPKA 1WO8A 4QUEA 2XUJA 4RZSA 4J91A 5ULLA 2VC2B 1E1MA 1SXPA 2WSYB 4MYUA 4RJ2A 2XZOA 5K6AC 1C7RA 1B43A 4M8KA 3H0EA 2CLEB 2JG3A 2QMQA 2B8EA 5DNYB 3QV1A 1ODFA 2ZRKA 4EMTA 3PGMA 2AI1A 4AS3A 1CS8A 4H77A 1DG9A 3B6JA 2ODNA 1ZPDA 5EKSA 1QE3A 2AH5A 3EHEA 3ZDRA 1P2UA 1ZKDA 4MH0R 3SBDA 4QH6A 1YIAA 2G4LA 3OA0A 4Y2XA 1L4HA 3H0KA 4I55A 4IX1A 3EY9A 4W9RA 3ZGNA 2R9CA 3BIWA 3WHKA 1A9ZA 3E3LA 5GPBA 1JIXA 5JAHA 4PRZA 1WXWA 1D7OA 1YS6A 2GPBA 4NDZA 4TMZA 4H31A 3WYNA 3FCOA 3TQQA 4EZEA 1ONNA 1D4ZA 4IOJA 3ETLA 3V1MA 1XEXA 3KNZA 1ZR4A 1XJCA 2PGLA 2YHIA 4HAWA 3CWQA 1M1YB 1U0JA 5CVEA 5EXDA 2ZM5A 2FQYA 7REQA 2WDPA 3VH4A 4EYOA 2J7KA 1G3RA 3V2GA 4E46A 3GEEA 1LI7A 1GUBA 1RWWA 1EGAA 5EWJB 3H1AA 3T4XA 2X3YA 4ILKA 1F8UA 4C5CA 5CLGA 2EHDA 2PKYX 3IAUA 1TM7E 3L9WA 3GNTA 4JUCA 1LU9A 5DYIA 4DDHA 1Z4MA 2OFXA 2YJ5A 3TOSA 1Y8ZA 4QPPA 1Z4PX 4L6IA 3KVVA 4NH0A