5EZQA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase
molecule keywords Non-structural Protein 2 Cysteine Protease
total genus 110
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezqA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezqA01
2AVNA 4L7VA 5E1BA 5DX1A 1FJXA 1KXZA 4C07A 1G8AA 3ME5A 1QANA 2AR0A 3R3HA 1M6YA 3IEIA 3P9NA 3GO4A 2ZWAA 3OZTA 3UJDA 2QRVA 5E2BA 2IIPA 2EFJA 3LPMA 4GBED 4XUEA 2AOUA 3PS9A 3BZBA 3TR6A 1I4WA 3KPUA 4P7GA 1PRYA 1M0EA 3AXTA 3C6KA 3A27A 3B3FA 3EGEA 2PX5A 4E32A 5CVVA 2H11A 2NXCA 2VS1A 4HTFA 5DWQA 5EKXA 5U4XA 2OO3A 3MCZA 4FT2A 1KYWA 4RTPA 4MWZA 2I9KA 5K01A 1AQJA 3P8ZA 3DUWA 3KHKA 1BKYA 4ER0A 1F38A 5E9WA 4CWAA 4DCGA 5IKMA 4PYMA 2I62A 2ZIEA 3GCZA 3HM2A 4XUDA 9MHTA 5E8JA 5D1HA 3TKYA 1JQEA 1WS6A 3EVAA 2LD4A 5GM2A 5DM4A 5BXYA 1X19A 3P71T 5MHTA 5F2NA 5GP1A 2OYRA 3G88A 5HEKA 4WVLA 3PB3A 3K6RA 5DXJA 1XDZA 5EMKA 2OY0A 5KS2A 4QQKA 3M70A 3R9XB 4E2ZA 1D2GA 3C0KA 4A6EA 1NT2A 1FP1D 4KIGA 4ER5A 1L3IA 3VC2A 2UYOA 5EMMA 3UZUA 3DXXA 4QPNA 3UJ6A 3EVFA 1XTPA 2YVLA 3HNRA 2P3LA 4OA8A 2NP7A 3HA5A 2NNWB 3B3JA 4Y30A 4F85A 3IHTA 1RJGA 4G56A 4V0QA 2HTEA 4QTTB 5BP7A 1V39A 5C9ZA 1KP9A 4H0NA 5KVAA 3LDGA 2O57A 3BT7A 1NV8A 1VL5A 3BGIA 2ZIFA 3ID6C 5M5BA 3O4FA 4P7FA 2ZTHA 2G8NA 2NXEA 3HCFA 2VZ9A 3NW9A 3DH0A 4YUYA 3HTXA 2PGXA 2ONZA 1EQAA 2FK7A 4GQBA 3TLJA 5HIKA 2P1DA 2CL5A 4ER6A 1R18A 3R0QA 3PTAA 4FS8A 1P91A 4P7KA 4PIMA 5CUQA 5EOVA 4DQ0A 2YX1A 5EIFA 4E2XA 1XJ5A 2ZW9A 5C0OE 4NECA 2H00A 3DXYA 3REOA 3UJ8A 3E23A 3C3PA 1NKVA 1O9HA 1SKMA 3NVKI 1QAMA 2AZTA 1SUIA 3BWYA 4FSXA 4M7RA 4PGHA 5FCDA 5EQJB 4AZWA 4EKGA 1SVUA 2KW5A 1Z3CA 3MQ2A 3MAGA 3UJ7A 5K0JA 4RTNA 5KYGA 5F2KA 2UYCA 2UZ4A 1IM8A 4C03A 3THRA 5EMLA 1BHJA 3E8SA 2ZVJA 3DLCA 3KQQA 2V74B 4RYLA 2XVAA 3P9KA 1G6Q1 5ICEA 2YQZA 2XYVA 3FZGA 5HZMA 2XYRA 3LCVB 2ZSUA 5DX0A 2AS0A 3DMFA 1JSZA 1JG1A 4PYKA 5EEGA 3KQVA 3HA3A 4U7TB 4QPPA 5FQNA 5K03A 5K0FA 3KQYA 5LQRA 3JWJA 4C04A 1EIZA 1JG2A 1RI5A 2XVMA 1KPIA 5CVDA 3KR2A 2G70A 2OBFA 2I7CA 3KPYA 2EG5A 4YUZA 3MHTA 1KHHA 1X1DA 1DUSA 2IFTA 2O07A 1YZ3A 3FTEA 2XBMA 2PX4A 1NE2A 2VDVE 4CKEA 5CVUA 4JXJA 3MCTA 1RI2A 3SX0A 1ZQ9A 4HSGA 5KQSA 2C7OA 1B42A 3NTVA 5LR6A 3ELDA 2AOUB 3TM4A 1KPGA 2HMYB 3HCAA 3EVZA 2C7PA 2ESRA 2G71A 3LKZA 2IDJA 3UJBA 3T7RA 2P3QA 5LQNA 5GM1A 1YFJA 3BGDA 2ZZMA 5FADA 4PWYA 3V97A 5LSAA 4RTSA 3G89A 2E5WA 3I58A 3G2PA 1NW8A 2YXLA 2PVCA 3SVZA 3CBGA 3EEOA 2Z6QA 3M33A 5JR3A 1KR5A 2BZGA 3FYCA 2UYQA 3PT9A 3HVKA 2PT6A 3OU6A 2ERCA 1ORIA 4FT4A 3EVEA 1ZGJA 2Z6AA 1QZZA 4WXHA 5K0LA 5HIIA 3H2BA 3THSA 3X0DA 1MJFA 1RI4A 2JJQA 2R6ZA 3GGDA 3OFKA 4PYLA 5E1OA 3B5IA 4HC4A 3DP7A 5EVJA 4R6XA 2CKDA 3SSNA 4E2WA 3CC8A 2QY6A 3T7TA 3P2IA 3NJRA 2Y1XA 4RTKA 4F84A 3DULA 4QDJA 4GOLD 4YV0A 2QYOA 3FTDA 2BH2A 4EKIA 1VP3A 3GRUA 2AOWA 5D1NA 2ZFUA 3UBTA 2A14A 4ATNA 1G8SA 4FZVA 5HIMA 2FK8A 4E2YA 1NBHA 4XUCA 2PKWA 5FWAA 3MB5A 3KU1A 5IH3A 4OX9Y 5BW4A 4YV1A 2PJDA 2ZZKA 1SQFA 3P2KA 4HGYA 4YUVA 5CVEA 5FA5A 4CKBA 4E33A 2B2CA 2ADMA 3SR4A 1HNNA 5HIJA 3Q7EA 2G72A 3TKAA 1R8YA 3PX2A 1RJFA 3BUSA 3TM5A 1VLMA 2R3SA 4QVGA 3LBYA 4R05A 3ANXA 3TQSA 5KQRA 1G38A 4MHTA 3F4KA 3ERCA 3KKZA 1BOOA 1RJEA 3NVMB 3WSTA 5LQAA 3KQMA 3M6UA 3EEYA 5T6BA 3EMBA 1EAMA 5CCXA 3DOUA 4PINA 3LX6A 5EPEA 5LQJA 3GIWA 5LQKA 3E05A 2FCAA 2IH5A 1SUSA 2WA1A 4RX1A 4PYOA 2YXDA 4OQEA 5K0CA 1JSXA 2IBSA 3DTNA 3AY0A 1X1BA 3A4TA 3FYDA 1XCJA 2K4MA 1SQGA 3G5LA 3OZRA 3PVCA 1IY9A 1NV9A 3LBFA 3GRVA 2F8LA 2NXJA 4X61A 1FBNA 1R6AA 3CJQA 3GXOA 3UJ9A 4RTJA 1R74A 4POOA 2Z6UA 2ZLBA 4E30A 2ZULA 2EX4A 3HCDA 4OBXA 3OE4A 3SGLA 4DF3A 2PT9A 3A7EA 3JWGA 5FUBA 3SMQA 3LHDA 4Y2HA 4RTLA 3CKKA 3SSOA 1NW5A 1VE3A 1XDSA 4IV8A 3KPWA 3FUUA 2PWYA 1KYZA 3ELUA 3FUTA 3G8BA 1JR4A 4GC9A 4XCXA 1X1CA 2AOTA 4BLUA 4YUWA 4PONA 3NMUF 4P58A 1QAQA 4DM3A 3NDIA 2IBTA 5DRYA 2BM8A 3FPHA 3KPJA 5EHIA 5T67A 3GWZA 4LWPA 4LECA 5EIWA 2ZBRA 2ZBQA 3LECA 3B89A 5ICGA 1MHTA 2GA9A 3EMDA 3KQPA 4MTLA 2P40A 3A26A 3DXZA 1AF7A 1FPQA 4MIKA 3UJCA 3PX3A 4GOOD 3SSMA 4AUKA 4OQDA 2ZZNA 4RTOA 2FPOA 3B7PA 4PYJA 3O7WA 4IKPA 3UWPA 4M38A 3G5TA 3TRKA 4ER7A 1NW6A 2IPXA 2I6GA 2VDWA 3KPVA 4FP9A 3OCJA 3VYWA 1UFKA 1YUBA 3B3GA 1WZNA 5CM2Z 5FA8A 2P3OA 2PXAA 3E7PA 2JG3A 3FUVA 5K8VA 3G2OA 5C1IA 1L3BA 2HWKA 1T43A 2AN5A 1UIRA 2JHAA 1KIAA 2IDKA 3GU3A 3UA3A 1N7IA 1VBFA 2ZWVA 2P7HA 3CGGA 3GDHA 8MHTA 3LSTA 5ICCA 4ZTBA 1DL5A 3FRHA 3K0BA 3CJTA 1G60A 1XDUA 1JTFA 5DT2A 1EJ6A 3EVBA 3FUWA 4ISCA 4V0RA 5DTMA 2UYHA 4DA4A 4QQNA 3C6MA 1VQ1A 2HR1A 2YUIA 2AN4A 4GOMD 2O06A 3DR5A 3DMHA 2GAFA 3VC1A 5DRTA 4BLVA 5FHRA 3FPGA 3IV6A 4PYIA 3TMAA 5GOZA 4K6MA 3ER8A 4B17A 2PX8A 1F3LA 5E9JA 3GRYA 5ICFA 5K05A 5CD1A 1JQ3A 5HOQA 4X63A 1RI1A 2PWPA 2V7EA 3LCUA 4PCLA 2OKCA 3PFHA 5EZQA 3BGVA 3RODA 4GF5A 4EK9A 2AVDA 2B9EA 2IP2A 2NYUA 3GNLA 2GLUA 2P35A 2IH4A 4GOND 2C7RA 4PCAA 1X1AA 2BR4A 4QTUB 4R6WA 5FULA 3KR1A 2GS9A 2PX2A 5DXAA 1Q0TA 3DLIA 4P7JA 1HMYA 3L8DA 2ZBPA 4RVHA 3AWIA 3QV2A 4KDRA 4PNEA 1YZHA 4RTMA 1WXWA 4X1OA 3SXJA 5K0GA 4RSRA 2YR0A 3GRZA 3HVHA 4PIPA 4AX8A 3PFGA 3KR9A 2YTZA 4GC5A 3Q87B 4HRAA 1FP2A 2FRXA 5P8WA 4X60A 3OU7A 5DPMA 3MTIA 4LG1A 4RVDA 5EHGA 4LWOA 4QDKA 2B3TA 2OB1A 2JH8A 2JHPA 3EVGA 3KQWA 5EEHA 3CCFA 4EVIA 4KVZA 2PXCA 1YB2A 4QVKA 3ORHA 3V8VA 3M6VA 5HFJA 5E1DA 3KQOA 3ER9A 4DMGA 5K0NA 2WK1A 3TOSA 3JWHA 2OPBA 4KW7A 5LQCA 4OBWA 5GWXA 4C06A 3FTFA 2HV9A 3OZSA 1P1CA 4FR0A 4R8RA 3ELYA 5F2OA 4FSDA 2AOVA 3OU2A 5K0EA 3OPNA 4EMSA 1D2HA 1O9GA 1XVAA 1YF3A 1U2ZA 3ELWA 4E70A 1TPYA 3T0IA 3D2LA 5FTWA 1RJDA 3BKWA 4PGGA 1VPTA 4CKCA 3LCCA 3QOWA 4YV2A 3U81A 3P9IA 2EJTA 4RTRA 2P41A 2IH2A 1AQIA 3DMGA 2PLWA 3BXOA 4KWCA 3TPZA 4BLWA 3EGIA 2N47A 4MQ4A 1P1BA 3JWIA 4KDCA 10MHA 4C4AA 2YXEA 5CVJA 3EPPA 2BM9A 3NWEA 2G1PA 3HVJA 5FHQA 3TFWA 4O29A 5JUWA 2ZCJA 5DTRA 7MHTA 3I64A 4M37A 2WA2A 5DSXA 3RIEA 3BWMA 3M6WA 5DM1A 3UJAA 1P39A 2H1RA 4HH4A 2PXXA 4M36A 2JHCA 2Q41A 3EVCA 3P2EA 4BY9E 1JQDA 5FWDA 4E31A 3M6XA 3RW9A 2GB4A 4RVFA 1EG2A 3KQSA 4EQZA 2ZIGA 5DLYA 1L3CA 2BR3A 3KQTA 5LQUA 3UFBA 3G2MA 3HCEA 5GIPE 2C7QA 1N7JA 1JG4A 3I9FA 3S68A 5E8RA 2IGTA 3BWBA 3NWBA 5K09A 1ZGAA 3MGGA 5GIOE 1G55A 3CVOA 1IXKA 4GEKA 3AXSA 4Z2YA 2AOXA 2PBFA 3P97A 5EZSA 2HNKA 1YFLA 1NW3A 3NDJA 3IYLW 5FQOA 3UA4A 4DKJA 5DM2A 2B25A 3O31A 4FGZA 4KRGA 4BP3A 1TW2A 4F86A 4CTJA 2P7IA 2VDUE 1L1EA 1R8XA 3PLAE 1Q0SA 2AOTB 4R8SA 1EJ0A 5DTQA 5DX8A 1XXLA 2OB2A 1M6EX 4YMHA 4IV0A 4HGZA 3G8AA 1D2CA 3FPEA 3P9CA 5E9QA 2QM3A 2JH9A 2CWWA 3AJDA 4GUAA 4C08A 3MTEA 3SM3A 3LKDA 1AV6A 3HA7A 4U7PB 2OZVA 1BC5A 4IWNA 3VSEA 2B78A 2GH1A 4OA5A 3LL7A 3QOXA 2CMGA 2OXTA 4UOEA 1PJZA 3BWCA 4RVGA 1H1DA 3HVIA 2QE6A 2O05A 4BP1A 1RI3A 2NXNA 3FUXA 3LDUA 1TW3A 3FRIA 3BKXA 4KIFA 2PY6A 1NW7A 5CCBA 5BW5A 3OE5A 3LDFA 4AZVA 5E2AA 1JTEA 1L9KA 1ORHA 3A25A 3A7DA 4YMGA 3EVDA 3HEMA 2Y1WA 2GPYA 4RV9A 4C05A 1JG3A 1Y8CA 5H02A 1I1NA 3T7SA 2DULA 2BR5A 3MERA 2QRVB 5G02A 1VP9A 3HP7A 2PV0A 3I5UA 3OFJA 5ERGB 1UWVA 1ZHFA 5EMJA 1N2XA 2EJUA 1ZG3A 2ORED 3FPFA 2FYTA 2FHPA 3HCBA 2O0LA 5EG5A 4ER3A 4YUXA 1DCTA 4A6DA 1O54A 2CMHA 1INLA 3HCCA 5EC8A 1WG8A 3G2QA 2NP6A 3R6TA 1KPHA 1WY7A 4AZTA 1R00A 1VIDA 1QYRA 3C3YA 3FPJA 4HG2A 3FTCA 4CTKA 5GINE 2PSSA 1XCLA 5EGSA 4DCMA 3GRRA 4X41A 4RWZA 5HILA 2XYQA 3EGVA 3M4XA 4DZRA 2AN3A 3KR0A 4CXMA 5CIYA 4PYQA 5T64A 2P8JA 3G7UA 1OR8A 3I53A 1I9GA 5E1MA 4AZSA 3LGAA 5DM0A 5EKUA 1SG9A 1ZKDA 2VP3A 3GJYA 1NBIA 2ONYA 3R24A 4HTFB 5K0BA 4PYNA 1WXXA 3CJRA 5B1SA 5DSTA 4RTQA 1QAOA 2DPMA
chains in the Genus database with same CATH superfamily
4FFPA 4L7VA 1FMCA 1ZK1A 1FSSA 2G77B 3QPUA 2R79A 5JZOA 1Z36A 4H6VA 3JY6A 1YACA 3Q5EA 4LKOA 4CV2A 3UH1A 1HTWA 3UICA 1GKIA 2YS6A 1RWNA 2WMOB 2Z1MA 3OUUA 3PS9A 2EXXA 3T0FA 1XO1A 3TR6A 4H1UA 2RGNA 1XP8A 3AM4A 3D3WA 1GQFA 3CN7A 2GM5A 3ZDXB 2GWRA 2PZFA 3AXTA 3C6KA 3VTKA 2IE8A 1R27A 2BW0A 1RADA 2ZAIA 4NJOA 3ZHCA 5A5EA 4WXEA 4B2LA 4FDMA 1C0PA 2J8ZA 1NHGA 3ROQA 2FQ9A 4XDZA 4DEVA 2P9TA 4J0QA 2G9QA 2PO5A 3MC1A 4KFSA 4ITVA 3UJ3X 1TMGE 3IPYA 3VMFA 4TL6A 4EIWA 1J9EA 4MRPA 2X15A 1NXSA 1L1FA 2Q99A 4MZXA 1K7CA 1S2GA 3GLFB 1S8OA 4CMJA 3W5JA 4JI8B 4DR5B 2O7QA 2IS6A 1YZBA 3IIMA 2H85A 3JATB 1P4GA 4O4LF 1PNOA 2EOAA 3QYAA 2ZPTX 3N2YA 3AHFA 4ZAVA 1GNSA 5FR1A 5FLEX 3RSSA 1SA0A 4YRFA 3SM9A 4YXWA 2A5FA 1MMFB 1QKIA 4MUHA 1RPNA 5FFMA 5FF9A 4E2ZA 1GNRA 4MGZR 2YZGA 1ZU4A 4UTPA 3KTOA 3OT5A 3VOSA 3BTVA 3DXXA 4QPNA 3I2FA 4FYJA 4M1OA 3MPUA 1B15A 4CQJA 4LJ6A 1I3CA 5B4VA 2P3LA 2Q2VA 4UVGA 4H3KB 2QVZX 1AUVA 5JARA 3KQKA 4BCDA 2QTBA 2WJWA 2NW6A 3P32A 4YRBA 3CW8X 2V7UA 2D7JA 3L46A 1L7NA 2WTBA 4OGKA 3H0EA 1JFRA 3DXFA 4S0ZA 2I66A 4K1XA 1ATZA 4QYSA 3VR3A 2G8NA 1GCUA 1OUMA 4LI3X 4G63A 1MQ8B 3VR0A 1A2QA 3OIFA 4B1FA 5B57C 5FTLA 5HIKA 4JI2B 1MB2A 4QARA 3TQFA 2QAGC 3SE7A 3PTAA 5ERYA 4DV0B 5C0OE 3PITA 4RETA 1U3GA 1QK3A 1X92A 2X42A 3DA8A 1ZXXA 1Y4ZA 2QAGA 2IXEA 3WHIA 5BWBA 2CBGA 4F5DA 2ZUDA 1D2AA 1JEOA 4PXAA 2A86A 2QRHA 1DX9A 3E23A 4B9EA 4DCVA 1U8YA 5KYUA 4BBJA 1ZN8A 5IVPA 2IT1A 1YRWA 1RT9A 1SZJG 3V8QA 3WRVA 4R2IA 4NG5A 4QH6A 2JC3A 5FWNA 5BQ5A 3LK6A 1JYFA 4R1OA 4TQUS 3KQQA 4HZGA 1GNTA 3SLRA 1IOLA 4KR9A 2XITA 4YONB 5ICEA 2FH5B 3GFSA 3ZWMA 1BA3A 1W88A 2TRSB 1AKUA 2AZMA 3OOEA 3O8OB 1NVKA 1Z4KA 1B0ZA 3GEIA 1GXSB 4PAMA 3AEQB 4HQFA 3STYA 4BFYA 1RYMA 1KPIA 2B7LA 2BGLA 2H7VA 3GEDA 3IQGX 3AF6A 1P77A 3MTDA 2I7CA 2F43A 1CRPA 3S2IA 1SVSA 3CV3A 3QMMA 4OOEA 3WZLA 3BFJA 4CMBA 1FIUA 4MS1A 1KZ6A 1C29B 2I76A 3KBBA 1HNWB 1Y34E 5E7IA 3BXGA 3NTVA 2I1QA 1KK1A 1RXWA 4HWYA 5EUMA 2J6IA 3OCZA 1KPGA 4ND8B 5ALXA 2ZYHA 5U9CA 4MVJA 1BNCA 5B7NA 2BDTA 2WIKA 5DDIP 5GTDA 5LMCA 1XCBA 1SIUA 3HXQA 3VBEA 1VHDA 4ZAZA 2AN1A 1MBZA 1O4WA 3A31A 1CETA 1NZFA 5JZBA 1EM6A 1JEQB 4LXUA 5H4HA 3PQ4A 3SVZA 3W8DA 1I2AA 5K0ZA 2JEZA 3UO8B 1ULSA 5TXGA 1MVNA 3RIMA 3G68A 4PQEA 4BNKA 3GDFA 5LYJB 2RHOA 2IEYA 2EGUA 2OBYA 2PT6A 4FMDB 4UAJA 3QFTA 1KI6B 1ZM4A 2N0SA 1NFFA 2QZ4A 3ENWA 4Q9KA 4TRJA 1LDBA 5K0LA 4AF6A 2VJMB 3DD1A 4EHAA 5AW0A 3E1ZB 1T5BA 5TMBA 3ZV7A 4NH0A 2E4WA 1ZAKA 3KB6A 4BO3A 3G0HA 4XR7A 3N1UA 1SCQA 4KH0A 4D4IA 5JSZA 2C8JA 3THOA 1DWUA 1XRMA 2XHEA 2XDAA 2Y1XA 2QG4A 1EDZA 4GEGA 2YYYA 1TYCA 4O2AA 1WUHS 2H1FA 5CYFA 4N4AA 2B7BA 5CLJA 4D79A 2XRFA 1KJNA 2E3JA 3GZJA 1YT7A 1A8PA 2WIDA 1IMOA 5THQA 3D8RA 1OJLA 4AUMA 1DOHA 1PEDA 1UBJS 2PJDA 3S1AA 3UK0A 3IEUA 3A8TA 1G5IA 1XCMA 4IHJF 4N6OA 5E4FA 3RS2A 3SZRA 3WYGA 2RGXA 2ADMA 4TKVB 3P4XA 4YDRA 8AT1A 1OXMA 1B3RA 3ZK7A 3OEHA 4YA6A 1B3BA 4LYJA 1WCXA 3DE2X 3DUFA 4YMSA 2PUGA 1QCCA 3JQ9A 3QPDA 3S44A 3WLQA 2XMGA 1JHQA 4DJEC 1EAMA 1GA6A 3LX6A 2ROQA 2HC9A 4JI7B 3CY6A 1A88A 1BGWA 1LJUA 2C3PA 4RZXA 5CGZA 1GAXA 4RX1A 4E11A 3JQBA 2YXDA 2D2IA 1ZVQA 3BK1A 4L75A 5CFLA 2EF0A 2CJYA 2DHEA 1AURA 2GTHA 2PSHA 2M6RA 3A4TA 1IPEA 1KDTA 3MMXA 3FCUB 2JBWA 1XTTA 3DMRA 4WADA 1SB9A 2G1JA 1NVDA 4CNBA 3CJQA 3K1YA 4JXKA 3P4YA 4POOA 5GJVC 1Z83A 3SU8A 4Y6RA 3NATA 3PJFA 3PUZA 1PZXA 1OX4B 2XEXA 3QA3E 4DQDA 3NH6A 4YYSA 3ZNOA 4JYZA 5A9SB 4BKRA 4QOEA 4KPGA 3TECE 2WKPA 3IJEB 4RK4A 3N58A 1FSZA 1KVSA 3L02A 2P5UA 1HTBA 4IMIB 5HS6A 2EYQA 3EHEA 3FVVA 1S6YA 3WLTA 1VJTA 4YCMA 3WRWA 3EWIA 2QK4A 3TGPA 2PH7A 1EFAA 3FPHA 4ZO4A 5DASA 5JS2A 3EXIB 3RFFA 3TLYA 5FPHA 1QVWA 4G1CA 3VTZA 5K20A 1J07A 2O1EA 2WYOA 1KYXA 2QGFA 3BHNA 4GECA 2HLHA 4ENTA 1AMNA 2OFPA 2P5SA 3A4MA 4FTWA 3OSUA 2YWDA 1MCZA 4HZIA 1VA5A 3DO5A 4EA7A 4OX9B 2FPOA 1OBCA 2WM9B 4IKPA 5IJWA 4PAWA 3TNYA 4CBVA 4R16A 4G5QA 1ZD3A 2C0CA 2X40A 5H59A 1UFKA 4PAOA 2Q3LA 2JAQA 3GFGA 2O7NA 2BF7A 4X00A 5IXJA 4HLDA 2ASEA 3HVUA 1MENA 4UPDA 2X3UA 1GU7A 2ZJ2A 2EJVA 1H4VB 1A9RA 1GOTA 1OWPA 1XKTA 2FR0A 2QZPA 3FKSD 4MW5A 5E95A 1CJCA 2B83A 2XCIA 4LIPD 2P7HA 5TSDA 2VTBA 3U7FB 3H13A 2ECPA 1SVMA 1XOIA 2JI7A 3BJEA 4KYUA 5DWDA 2GBCA 4Y1RA 1D1QA 3RPEA 2E49A 3INYA 3C0RA 4ISCA 3KAJA 4TYYA 2MHCA 3JVIA 1Q50A 4ZVTA 2QMEA 2RGCA 5HK8A 1ESCA 2QXUA 3ZDAA 2KYRA 3DR5A 3NTXA 3VC1A 4G4SP 1WV1A 3UUWA 2BKLA 4YCLA 4PYIA 2YJBA 3N86A 1ZVJA 1NF9A 5A3VA 1ETUA 4O2BF 4B3BA 1JQ3A 3COSA 4FYWA 2PREA 2EP7A 1WB9A 1UPCA 1IB6A 3EEQA 4PCLA 3PC8C 1TF2A 4DIMA 4MS4B 1QO0D 3TBHA 1Y6FA 1F17A 1PGPA 2O2CA 3WGQA 5HMMA 1PN3A 1DSSG 4HGNA 4LOKA 4RZ3A 3RH0A 3WGKA 2FPXA 5FNVF 4ZI2A 1XNQB 2DJGB 3G3EA 3Q9SA 1GADO 4QQFA 1UJ4A 3I32A 1HLFA 4Q6WA 4CG3A 1K3BB 1CRWG 3QV2A 4Q9HA 3TAHA 4A3SA 3WHLA 1NBAA 2ZQZA 4X1OA 2VRNA 3JRNA 3U4MA 5F33A 3VVCA 2YR0A 4BLPA 4EI2A 5L3ZA 1JFTA 4A2CA 1CEYA 1CT9A 4PIPA 1GAEO 1XAJA 1NVTA 2HBZA 2YTZA 3H5WA 3H6GA 1QX4A 2Q6IA 3AP2A 1K8QA 3QX7A 4IYRA 5CAEB 2C04A 5GGXA 5TS3A 4LG1A 4ZKDA 1UJMA 2XUFA 3TINA 2ZP1A 4O8ZA 4RJJA 2HDHA 1Y48E 2B3TA 2OB1A 1PSZA 1S1MA 3R76A 2G5CA 2E55A 2HDWA 3ORHA 3ZZTA 1FPMA 2K2WA 3L1HA 1PR0A 4Z9XA 3QFCA 3B52X 2HZ7A 1PV1A 2XUGA 2YHBA 3ASZA 3DVAA 3NDRA 1MNAA 3NRCA 4R83A 5SV2A 3VU9B 3ZV6A 3EFBA 3UCEA 1UZMA 3RDPA 2Y1OA 3VYTB 4BQFA 2KPOA 1QVAA 2IYNA 2ZT6A 1P18A 3Q8KA 5G3YA 2P67A 3T9DA 1VBMA 4BYMA 4P98A 4EW1A 5J1SB 6LDHA 3OU2A 4XX0A 5JQGA 3DZCA 1OBVA 3TKLA 1QX3A 2HLDA 3QM1A 4P36A 1R6BX 3RBAA 4AVYA 1CLEA 1JPJA 2G1UA 1XTBA 3SMVA 4N82A 3PRPA 3WB9A 1GPJA 1OQAA 1QHGA 1W93A 3I73A 2OPHA 1M34A 3TLEA 5K8CA 3ML1A 1ZH6A 4X7PA 1E2LA 3BXOA 3PQDA 4EKDA 1CRLA 1L2TA 3RAPR 3E0XA 4QOGA 4YK7A 2WM2A 4I5FA 1BFDA 5KI6A 4HNVA 3RRYA 1T9HA 4Z4EA 5D3KA 2BMEA 2QUKA 4DRZA 2RHLA 1FP4A 3W05A 1M66A 4Q3NA 3VU3A 3T1YB 2WT9A 1CUVA 1NPTO 2XVYA 2KX7A 4D44A 5TGDA 5M04A 1UMCA 1N3YA 4MV4A 2ZUWA 4UBMA 4X6IA 3DE1X 2WTNA 1KP3A 2A1TR 4QT4A 2C54A 4X8OA 4RGYA 2ATEA 4BY9E 2IOFK 2R2AA 1SD1A 4TTRA 5CX1B 1YE8A 4LI0A 4TKZA 4G6ZA 2GB4A 2XD9A 3NP7A 3ZH2A 1FCJA 4CIBA 3EXAA 4TX1A 5DLYA 3AT1A 2VAXA 4DDUA 1RLMA 1W8DA 1CCWA 1PJCA 2P27A 1UCFA 3DE6X 4O4IF 3T38A 2FUG1 3ZJVA 1TYEB 4GPBA 1E3TA 5EP2A 1ENYA 3BX1A 1Y37A 3NEPX 4ZIRA 3QVTA 5ESXA 5DNEA 1YFLA 1LRKA 4RNDB 1U2GA 1HEYA 1QF7A 4UW9A 1TEHA 4FC7A 4GPD1 2CE7A 1HTTA 3T5GA 2GYUA 1DBVO 2WAYA 1ES9A 4W7SA 2VUSA 4PSKA 3I5MA 1AV7A 5BO5A 2P7IA 2VDUE 4PBSA 4Z1MA 4HLQB 4B4KA 2IYYA 13PKA 5LB4A 3VR6A 3C24A 4GIBA 4DEXA 4FE7A 1DCMA 5BWMA 4F9TA 4YMHA 4D4JA 5AIBA 2BFCB 2A5YB 1EQ2A 1M75A 3MWLA 1XRQA 2R0QC 1BE1A 1QQAA 1TIKA 4HAZA 1EHIA 2YVUA 3HU1A 4EF5A 3BK7A 2I8AA 1BD4A 1TVKA 3QOXA 1QFXA 2OVFA 4RF3A 2OXTA 3QXJA 3L0BA 2BTQB 2VJDA 3HR4A 1YL7A 3P0FA 4W99A 4JJKA 4M7WA 1H1DA 4PRYA 4H7FA 2EZ4A 2FFQA 1P3JA 1T3HA 1XTQA 1H8EA 1U3DA 2H2WA 4V38A 3UOAB 3FRIA 1QIKA 4OQYA 4ZDJA 3CB4A 4U2GA 3NEJA 3R7NA 2V5VA 5L3SA 1J8FA 1ZMOA 3AZQA 3KUXA 2DVMA 4GX1A 5FUYA 4EM6A 1F2CA 3C87A 2IWRA 4XRGA 2PS9A 3II6X 4F4FA 2V7PA 3PSHA 2HIMA 1Z4NA 1YR7A 3QKTA 4AMGA 2P6NA 2EL7A 5ALJA 2WUWE 1WPQA 3Q8LA 1AKWA 4L6CA 3M6LA 5EZ5A 5ED0A 3U3OA 3WO0A 3K70B 1IZYA 1DKOA 2WC1A 4L73A 3LL4A 3HCBA 4TTTS 3U1VA 2K2QB 4PRZA 5FO1A 2PUFA 4A6DA 4LJSA 2J3KA 3TZHA 4AXXA 2G6DA 1OAOA 2QPLA 1XLWA 3B1WA 2HH9A 5AKIA 4JWKA 1E1DA 4KVAA 3SE0A 2HPZA 1KPHA 3B51X 4I3FA 3U3MA 3ZCPA 4TMFA 1Z5GA 1T3ZA 1F8FA 2EWWA 2GPSA 4KFUA 5B1DA 3GFVA 1THGA 5EXPA 1A2OA 1GWNA 1P1RA 1WPGA 2CL0X 4U5XA 2JARA 4OJMX 5LA6A 1KRXA 4UTOA 3IBCA 2KBEA 2BFPA 5AKLA 3ZCVA 5CIYA 3D7RA 5ALUA 1Z4PX 4P4NA 5I7SA 1U0BB 2QVLA 2UDPA 1N78A 3QKUA 1LLQA 4HRYA 2ZBGA 3ZU3A 5K0BA 1DTSA 4BWFB 5F35A 5BR8B 3K9QO 4QYWA 5DI3B 1A4IA 3DUFB 3NEYA 5DYWA 3VYSB 1GO2A 3I62A 3RUFA 2DOSA 2Y67A 3AB7A 3NVAA 4G9BA 1V5WA 2WICA 1KXZA 3IPRA 3CZ4A 4NCNA 3LYAA 4QSMA 2Q0SA 1L4UA 3EXIA 3IAEA 1K66A 3IP9A 3V1YA 4UTRA 3PQ2A 3U62A 4P80A 4QXAA 1IOVA 4Q02A 4QRVA 2HBQA 1GNVA 4N3AA 1NLUA 2MSCB 1X80A 3FLBA 2HQ1A 3GMTA 4C0WA 3KQUA 1I94B 1EWMA 4BO9A 4D81A 4J90A 3H8VA 1KYYA 1Z33A 1G0NA 1M67A 1UPBA 3FNFA 1OX4A 2VXYA 4MVYA 1FOEB 3OHMA 2QP9X 2C92A 2Y0BA 3DNMA 3AKYA 3INNA 4HNAA 1O0EA 3GV0A 2A92A 4NZMA 3L0SA 4QO7A 2E4XA 4RADA 3ZHVA 1COWA 4CWAA 3GEHA 3PGMA 3EA4A 3I0NA 1RAIA 3B13B 5E3JA 2YZKA 1PT6A 2BLNA 1E1LA 1F1BA 1KZGB 3C8UA 4R8LA 1E4VA 4BFTA 3S2EA 2LD4A 4RJKA 2C1ZA 2XI4A 3QIVA 1VKZA 4M0UA 3TEJA 3U17A 2FUEA 3QEOA 4B3XA 4EPTA 4YRGA 5C81A 1XU4A 4TTVA 4ZU1X 4EL0A 1CPYA 3D8UA 3NV7A 4LYGA 3LYHA 4V24A 2AKEA 4TSFA 1W0KD 1FU4A 4JYBA 4TVKA 4FHZA 5D7BA 2O7RA 3OQHA 3V7NA 4A6EA 5K0TA 1DRKA 1RE0A 3ZK9A 3I06A 2FDRA 1SHLA 3QUSA 3UZUA 4W5CA 4BQVA 4CYMA 3LBIA 4FHGA 3V6EA 1SJ9A 3EVFA 1Z5WA 1P1FA 3WYDA 5IYZA 1P0CA 3HNRA 4MS1B 3L0DA 3HA5A 1K7EB 5JANA 2GZ3A 4OG2A 1T4GA 3ETJA 4EABA 5KKCA 1YS9A 3DR3A 3FCSB 3G49A 1E7RA 3A1UA 4JFAA 2FSPA 2JDID 2O57A 2VR1A 1C8LA 1SVIA 2O8NA 2JK0A 1KXJA 1Q92A 2YNMC 3NI2A 3PHBE 2NU8B 4HJRA 3GIDA 4OAQA 2ZTHA 2X0DA 2ZXUA 3HB4X 2FE8A 1K6MA 3HTXA 4D45A 4J1SA 2H1SA 1OI3A 2CBXA 1JDBB 1IFXA 1XZNA 4F4IA 2IS2A 2FEPA 2ISCA 4CU5A 1FLAA 4LDJA 3T5AA 2CK3A 2YIVX 3O3OB 4J3JA 4UNRA 2F3SA 2PZ8A 4PX5A 5LP6F 1DDIA 1U5CA 4BC1A 2O7VA 3KKMA 3WAGA 3M5CA 5HFAA 4WXPA 1NVBA 1QYIA 3WG9A 2HLNA 2VAMA 1NKTA 3IUBA 3VFDA 4BB9A 4CRWB 1QLJA 1WDKA 4MKFA 4DLPA 4J03A 2GTIA 3ZD8A 5JXHA 3NVKI 3QVWA 1JECA 4PLZA 2QW0X 5KYGA 1NVVQ 4QATA 1FRFS 1HH4A 4X94A 5JAHA 1G59A 4URFA 1NNLA 1O96A 1UT6A 3ESYA 3W3AA 4I55B 4MQFA 2G7ZA 2HJVA 2MYNA 3I9OA 4RCVA 1W46A 4DSTA 5JVDA 2O8EB 4TV9B 1QMYA 2XYRA 3EF0A 4B32A 4L0MA 2FEXA 2VPXA 2PKQO 4N9QA 2HEGA 3HA3A 1CUDA 4LZOA 2VBIA 4MYSA 4OKSA 1WHSB 5G0SA 4KPFC 1KAOA 1W0CA 3TJZA 4ZYZA 8LDHA 3A28A 1M5RA 2G70A 1V3QE 2OBFA 1VGVA 4MVJM 2PRKA 4R0MA 5JAZA 3CUYA 2E87A 2MTBA 2O07A 2RK6A 3HACA 2VT7A 2WQZA 3D64A 3KYIB 3RVLA 3KVYA 1BQEA 4B3JA 2J0QA 3BRQA 4V3CA 1W4RA 4BKOA 1WPXA 1Y3HA 2XBLA 2W9XA 2QM7A 1HDRA 1D6MA 5CTJA 1RBYA 3I6BA 4K9OA 1DJOA 4PSDA 4MP3A 1BMTA 4EO7A 1Q6YA 2IDJA 2IITA 4PLFA 3G6KA 1EKXA 1ECFA 2ZZMA 4E88A 2JGJA 3AB8A 4F92B 5LSAA 1RXCA 4K9SA 4GMDA 4D6XA 3G2PA 2KE5A 4W5JA 4EQ6A 1E9AA 2UZAA 1PTJC 3FF4A 3NB0A 5JCOA 2C4VA 1ZPDA 4TKLA 5KWVA 3IRVA 1FF9A 4YRLA 1DDGA 4GOKA 4YLGA 2B1IA 1KFKB 1P2BA 2CF6A 1H66A 4R98A 1GPNA 1U1FA 2CDCA 2GCEA 1SIOA 2DBVO 5EJ2A 4KN8A 5GADl 4CQMA 1TAGA 1P9RA 3AUJB 4BMSA 1YKGA 4LS3A 4Z9AA 3C14C 4HAWA 3GP5A 4BVAA 4BV3A 3THSA 5LXTA 2JJQA 3MWJA 1C7JA 2JLYA 4ND6A 1ZOSA 4UXHA 5L9AA 4JH0A 1PYOA 3T15A 5FPKA 1CZLA 4ZI3A 2FSHA 2P69A 4XOUA 2J6HA 4DY6A 3SCZA 3CYFA 4ZOLF 3P2IA 1Q77A 4E3ZA 1C9JA 5KOHA 3LQ1A 4MEJA 4JLJA 1CYEA 2H1HA 1PLLA 1Z6ZA 2DFVA 2WV9A 3OPXA 2A14A 3QPCA 4NH4A 5C4MA 2X41A 1ID8A 2QRZA 2R6HA 4P81A 4KRFA 2JQFR 1JR2A 3JQFC 2ZIXB 5C35A 1NATA 3L5KA 4HH0A 2J3MA 1U8CB 3RTCA 2WWTA 4IZOA 4DMLA 3OJCA 5TMDA 4KE8A 1O6ZA 5HIJA 5JFOA 1PX0A 2DKNA 2ZETA 1U0SY 1Q0PA 1ZKMA 2H31A 3FXAA 3L7YA 3QKIA 4U39A 3UMCA 3HJTA 3QU7A 3T06B 3NBZC 2PVSA 4EJSB 1W36C 4MHTA 3BMNA 1FL9A 2HBRA 1RWOA 1M2OB 1WCIB 2X8JB 3P94A 3UTDA 4OMCA 5EPEA 3N2ZB 5LQJA 3WL8A 2QN6A 4LGVA 4MYHA 4OFZA 2WY2D 2ZYDA 2KQUA 2F4NA 2OOSA 2WP0A 3AW8A 1Z25A 2X3FA 3A6FA 4MPPA 1WKBA 5ER6A 2PMEA 1E32A 3AIOA 2DTXA 1I0LA 2DPHA 1MO6A 1I36A 2Q8PA 3ER6A 3OX1A 4FKBA 4K6KA 4OJKA 5FPPA 5GONF 4YV8A 1I2ZA 3PHLA 5L45A 3CA8A 3QUTA 4E5PA 3MS7A 4BATA 1OA1A 1XE3A 1JHUA 4UDYX 4TXJA 4XGKA 1N0IA 1VBKA 4KRXA 5KJ6A 1GGJA 1XNJA 2EX4A 3HCDA 3QLEA 5LD2B 3DFKA 5GOTA 4MS3B 3SC3A 3A4IA 3DOCA 1OI2A 4PSVA 4GMFA 2FPGA 3JASB 4KOEC 3SMQA 3Q0IA 4BAGA 2XYGA 2WKSA 1Z2PX 4E2FA 1F7UA 1NR7A 1NW5A 4I5IA 4YR7A 3ERVA 3G8BA 3V33A 1KOFA 2BFBB 1IVYA 4Y0AA 5I4IA 4A10A 4WBNA 1RYYA 4KEAA 1WSWA 4WN9B 5BOVA 4P4UA 1TJ5A 4HP8A 5LUAA 4N5DA 4F6RB 4TTPA 5IAEA 1E0AA 4OB8A 1A4RA 2VXBA 4QYTA 5JLAA 5JECA 2Q2WA 2P40A 1UZUA 2F3UA 1TCVA 3DVSX 4IDPA 1MABB 4EKNB 3RFCA 1MGPA 3PXGA 1UBRS 2FPLA 1UBTS 3U3ZA 3QBJA 4EG8A 2XZPA 2ZRPA 2Z1NA 3ABZA 4B87A 4EA9A 1EBBA 3TRKA 3OBBA 2VDWA 4BZZA 2I3DA 5BN1A 1N92A 5CDFE 3OMXA 2ZSHA 2YW9A 4MR7A 2IY7A 3LH5A 2FTKE 3LUFA 4EFNA 1T8WA 4YGYA 3U1TA 3H8BA 4PICA 1I6WA 4JR2A 2IDKA 2MYUA 2IXGA 1VBFA 4B4DA 2JA2A 3L7IA 1E63A 1HYHA 2HK9A 2JATA 3DQZA 4PC7A 4XUGB 1IWBB 1U0LA 4IF6A 4F8JA 4TLEA 4NXMB 4K8RB 3FB4A 1PG2A 3H11A 4P2GA 2H5EA 2YJNA 4WLVA 5JDCA 3VJRA 5F12A 1CE8A 1MXHA 2IQ5A 3L4BA 4GKAA 4XTRA 4Y2TA 1CJTC 3FPGA 1ME3A 1GSAA 2VDKB 2WU8A 4EY5A 1HPLA 1DARA 4FFMA 1QYDA 2OZLA 1PJAA 1XRLA 2FO5A 4QJ5A 4DLLA 4WOBA 3MYRA 2QMZA 4AIRA 4UD2A 4DLVA 1PHRA 2ZI5A 1E7QA 2NPOA 3LCUA 3MOGA 4CTJA 1ULUA 2KBFA 1R4MA 4GF5A 5TNXA 4EK9A 5C37A 1I1QB 2WOJA 3GDOA 2VYVA 3FDFA 2RAVA 1X1AA 5C34B 3HXOA 4KSBA 4HMOA 3T1QA 5C8XA 3SPXA 3SLKA 2Q27A 1PU2A 1N5RA 2FV8A 2HU7A 3CLUD 3OOJA 4BNGA 4BXOB 5T8KA 1TNDA 1A6RA 3K6KA 1WSAA 2BGWA 5AVRA 2FLWA 4TQAA 5HW0A 1JEYB 5DN6D 3EA5A 4HUQA 2Y9MB 2ZRCA 3ZHQA 2NO7A 1XIVA 1J42A 1THMA 1VIMA 3LQ4A 3TSYA 3ZY5A 5BV2P 5LVAA 4QDTA 1YCHA 4F4HA 2H3EA 4H77A 1SD5A 3QKRB 1BCSA 1QG2A 3ZXIA 3PNYA 2GXAA 1P4HA 1T8SA 2RHWA 4UAGA 4WHMA 4EVIA 3LD9A 4MUKA 1U9QX 2EHJA 4ZALA 2F8MA 2XPCA 3ZEAA 4BRSA 1GCOA 3O9MA 1GA1A 4OHMA 3BGSA 4YVFA 2ECKA 1EFLA 2NO9A 3R7AA 4FNAA 3WZ2A 4D3ZA 2JJ2D 4OV6B 4JI3B 3WOHA 2IZZA 3GI1A 2PGAA 1J0EA 4Q1FA 4Z0NA 2C4HA 2X7JA 1KYTA 1MVOA 5K0EA 1VE5A 2R86A 3MT8A 3ZHYA 5H80A 1XVAA 4JLWA 4Y2VA 1HL3A 3ND7A 4NBLA 1TPYA 3REGA 5BQ3A 3T0IA 4AN1A 1SXJD 2ZIVB 3KDSE 5DW3A 4N0MA 1NVAA 1S3IA 2IHTA 1D0SA 2VF2A 1PD1A 5EHNA 3RWBA 3HC7A 4NU6A 1OI4A 3ZTYA 1AQIA 2Q7OE 4ARAA 1QP8A 2QDXA 2OR3A 3BERA 3KG2A 3FJOA 4RC9A 5AOVA 1GTRA 1VG9B 1T9BA 2V65A 3OT1B 4S12A 5FD8A 4KDCA 5IJXA 1TI7A 5KYWA 1XD9A 1YHZA 2AMFA 4CCWA 1REQA 5DJ5A 4E21A 8ADHA 3HVJA 5AI6A 5DTRA 2VVTA 3CEJA 1ENZA 1NI3A 4IS3A 3ZQUA 2QZ9A 1P39A 4MWTA 2VDWB 3EVCA 1W49A 4TMTA 4NYMR 3M0EA 4E31A 2CF5A 4RY2A 1U4SA 1PQWA 1P9WA 3WLKX 5IU6A 3D1LA 3LBNA 2DG2A 3K1ZA 1ZNYA 3LFYA 2XXBA 1E92A 2B30A 3KSMA 2C7QA 3T35A 3OP1A 1IRXA 4B73A 4CZ2A 5E8RA 2O1XA 4EGAA 3PNQA 2HRDA 5ISMA 1UEXC 4QHTA 4D96A 3ED1A 3CNNA 4OVZB 5HKAA 4BO8A 4DKJA 4N5LA 4FJCA 2HT1A 1TKCA 2P1RA 4ZVPA 3CZCA 3O31A 3WLPA 5EIBD 2FUNB 3H1AA 1K5DA 3IP1A 1YJ5A 1FXSA 3IUPA 4KXMA 1YK0A 3ZOKA 2O6LA 3OLVA 2FQYA 3PNSA 4X1YB 4XVUA 3I6QA 3I0ZA 2G8LA 3PQ8A 4LKRA 3QE4A 5AHKA 1OX5A 1M6EX 1DUVG 1XZ8A 3A2NA 3K53A 4HL6A 2FWBA 4D56A 4L1KA 1L5OA 1XMVA 2FPMA 4Z2AA 3ETLA 1VECA 4HQLA 4YP5A 5U4QA 2OZVA 4QICA 4J1TA 4EWLA 3CZQA 1JQ5A 1KZ4A 1NMEA 2GH1A 4K9RA 3KKLA 2WVHA 2WLTA 1OYOA 1U8EA 3HH8A 1HE8B 4ZEXA 3HVIA 3KL4A 5EE1A 4BP1A 1F60A 3PW3A 1VZ3A 1G3UA 1NM5C 3T9EA 3EUEA 3R3SA 1VKNA 4JGIA 2H29A 3OD5A 4L9WA 4QJBA 4G09A 2HK7A 1YRYE 4OHBA 3S5UA 1ZD5A 2AU1A 1ZNWA 4RUKA 4ME6A 1US8A 2IDZA 4WY5A 1T1RA 1RRKA 1V6CA 4IVNA 1JIKA 4LF8B 1XQVA 5B3AA 3AVQA 3B3QA 1CHDA 1ULBA 2C31A 2H17A 1W2HA 4ZGGA 4E13A 4IH9A 3TVTA 4C05A 4O4IB 3SWWA 3JYOA 2WZQA 4ZTZB 1R9NA 2HSDA 3L6DA 2E4YA 1QHYA 4ZEWA 2HA2A 1DRWA 4DJTA 1QIFA 5IJ9A 2WF6A 3UC9A 2XDWA 3H9EO 3RSGA 2DPXA 3BH0A 4EHHA 4PXYA 2CVZA 4BMZA 1EJ2A 3K94A 1T29A 4MUMA 4P3XA 4U6SA 4WRRA 4BIMA 5JNTA 4F7WA 2QBYA 2DUMA 1WY7A 2K6GA 1CQJB 1PGQA 2FE4A 1EDBA 3A1EA 4YMTA 4AO8A 3GQBA 3EE6A 3P5UA 3SXPA 2XYQA 1OXVA 1W1UA 1W1WA 3PFWO 3PVZA 4CQLA 1OXSC 4DWOA 4PYQA 3WLEA 1C9KA 3LP6A 2AE1A 1CQDA 5EUCA 5BV1A 1FX0A 2G9VA 4O4JF 3HCRA 1J00A 4ON9A 3LQKA 2VHZA 3NM4A 1T8TA 1T8YA 4KQGA 4UQOA 4C4OA 4C6TA 4DM7A 1QXPA 1HFWA 1C50A 3CMMA 1YULA 2SHKA 1F9EA 1PWHA 4FQ5A 3KE8A 4ABYA 3RTAA 4Q1BA 1QNLA 1M2OA 2GJKA 2XWQA 2YWGA 3N0RA 4L5AA 4MXDA 4TKUB 3LQFA 3RM3A 4MRNA 3WLHA 1J7KA 1QTIA 4C07A 1EE2A 2R68A 1NJ5A 3ANSA 3LY9A 1WLSA 3W5IA 4CF6A 2W2OA 2A30A 4X0EA 3FWYA 3KPUA 1E2KA 1TL9A 1WBJB 4NHOA 1VPEA 4QGGA 1ZGCA 1HDYA 1KEPA 2VJBA 3F8TA 3RJ9A 3O2SB 5TIIA 3S3RA 3CNLA 2NXCA 3H5LA 1EWYA 3R41A 2WTMA 1JIUA 4RTPA 1DZ3A 2N1BA 3A4NA 3LBAA 4BJ6A 2SICE 1Y4HA 1UK6A 4IIVA 3UAGA 1QH1A 2ZYAA 4FFDA 3F49S 4RK7A 4IMPA 3I0MA 4KYTA 1BRMA 1R3UA 3LGXA 3A9SA 4PYMA 4NENB 2I62A 4KXXA 1GPH1 3UW1A 4XUDA 3VDMA 4JI5B 4CR7A 3FFAA 3FSGD 1JFSA 2NT4A 4LY0A 2ZVDA 1K4KA 2GUGA 2VNKA 1DX4A 1O96B 3DV0A 4I55A 2APJA 1AU2A 2FRDA 2Y9PB 1X19A 2VDPB 4D4HA 2YHIB 4QECA 3UMFA 1WMDA 1ODSA 2K7ZA 1FFAA 2J7PD 2O52A 3GELA 1BS1A 5A4AA 3DYIA 3FOFC 1E4YA 3N39C 4BU0A 3PUIA 3PDHA 2ENUA 4E07A 3I45A 4QBKA 3U26A 4I1VA 2Q62A 2PKYX 2EGGA 5DLPA 4LX8A 2QT9A 2XZLA 3LOQA 3OP4A 2HGSA 2JRCA 3IPLA 3OSZA 4N79A 1P2FA 3C4VA 5WRFA 1R4MB 3IUEA 3RADC 2W98A 4OA8A 3T7JA 4DCPA 1OF1A 1SELA 2Q7DA 1MPXA 3HKDB 4MVJE 3ANNA 1YZNA 3BB7A 1W85A 2G63A 4GU5A 5JISA 5HRUA 5KVAA 2AVWA 1E4EA 4OUDA 1L4LA 2J5QA 4YYWA 1TVEA 1KS2A 3DL2A 3ID6C 4K5QA 4NABA 2NXEA 2VEDA 4WGGA 4HJXA 1BKDR 1KEVA 1EVYA 4XQEA 2PX0A 3ZDQA 4ER6A 1BJRE 1MOPA 1K2WA 3ESXA 2P6RA 4OQXA 4RK5A 4LF7B 1FSFA 4XLTA 3TNLA 1WDMA 2ZU0C 4HMPA 1XT6A 4HVTA 1TGYA 3TLCA 2MR6A 1AHIA 5A4IS 1UBLS 3Q9NA 1C7IA 1JHYA 2CFRA 4LBVA 3R3XA 4PPFA 4ANFA 4MVJG 1AKQA 4RY9A 2A9FA 2L0XA 3JTEA 4X97A 2FZVA 5J5CA 2PUBA 3AI7A 4FSXA 3ER8A 3H83A 1H9CA 1SVUA 2PGLA 4Q4DA 4Z4GA 4YAIA 2QV7A 4N8SA 2QD1A 1NN1A 3JQAA 4B74A 3OHSX 1P0PA 1THEA 3LVBA 4FB4A 2XW6A 4AJPA 4REZA 1EFPA 5IW8A 4BNWA 5EJAA 3RAGA 3KZNA 4B35A 2DUUA 1TB4A 3C1TA 5ITSA 5CH8A 4N0DA 1QK5A 1JQKA 1XA4A 2XH8A 4B75A 5K03A 1Y3IA 4PNZA 2YHUA 5A7GA 3QP9A 5KNCA 4IHJA 2O3SA 3QKSA 4YQFA 2OGTA 1GECE 5K5EA 3WR5A 1YR6A 1IE3A 4XYMA 3BVPA 4WERA 5ALTA 4EENA 5CK5A 1PR6A 5HZHA 3RVXA 4NFHA 3GH1A 4FOTA 3LDHA 1U8TA 2PX4A 3NETA 2VYND 3NANA 2YKGA 4FFWA 5CVUA 3T5TA 4LJ9A 4F1KA 1FZTA 4BX3A 1C81A 2NO1A 3MQ4A 4OYLA 3I2IA 3AHHA 1IXSB 3HCAA 1P19A 1T2CA 5IP5A 1U7UA 3BJZA 1KKMA 2DBZA 4YAOA 1E7SA 3UJBA 1Z15A 3W3AH 3OTWA 4DREA 2XXJA 3W0LB 3R3VA 1HLGA 1NC3A 3G89A 2E5WA 5DH9A 2Y0CA 3ZGYA 2CJFA 4F6LA 1X39A 1PQPA 2CHFA 4IMRA 1U7HA 1A2BA 2A6PA 3UV3A 521PA 4CEIB 4JYAB 3PT9A 1X3SA 1VI5A 4GR5A 3D6VA 3ESDA 4MLZA 4M54A 3WGNA 4G97A 5E7QA 4ZJPA 2J3EA 4OREX 5DF1A 4JWTA 1DMSA 2BM0A 2CLFB 1OT5A 3K0CA 3VKWA 3UMMA 5EIAA 2AG1A 4S1VA 5K3CA 3HJBA 4IHJB 4P4GA 1GR1A 1QH0A 4RZIA 1R0BA 1O0SA 2GZ1A 1U9IC 2V4ZA 2M2IA 3ZK8A 2W4QA 4HVLA 1KA9H 3TNDA 2DQ4A 1FNDA 3HV0A 3LUKA 4H3SA 2IXFA 1LH0A 5DISB 2UZIR 3UB4A 2LWIA 5E2IA 4YB8A 1DEAA 4YJ3F 3JXEA 2IF2A 4TPKA 2F3PA 2SKDA 1S8AA 2WNIA 1UWLA 1YZKA 2ZFUA 3LY5A 1BN7A 1HQCA 1QZUA 1T1IA 4G2TA 4EOGA 4XUCA 3MB5A 1EUDA 2B0CA 2JVKA 3TW4A 5BW4A 4NARA 3E9NA 5IHPA 3IOQA 4EPWA 1SC1A 4DLTA 3EQ7A 3H5AA 1C8KA 2I3AA 5CVEA 4DADA 4JOBA 5DHPA 1EF7A 1J9GA 4QE3A 1NMQA 2JZCA 4IDBA 3ZY6A 1QB8A 2WZBA 3U61B 3BD6A 3KT6A 1HEIA 1JN0A 1W59A 2EWMA 2R3SA 3B1FA 3TQSA 3GLUA 2IKQA 1S02A 2BAGA 1BMDA 2BH9A 2ZE7A 1SOAA 4KTVE 2LKCA 3IP8A 5T6BA 3EMBA 2B1MA 1T9DA 2E9SA 1MOQA 2GD0A 3QXCA 4MQLA 5G41A 3FOWA 4LBZA 3TLGB 3IKTA 1GSOA 5B1HA 1SWVA 1DAFA 2WOOA 4BUZA 1KVQA 1XMIA 1Y3FE 3EXFB 1RPZA 2XXAB 1NW4A 1ZGGA 2RGUA 3NM5A 3ZCRA 2QQGA 3ADKA 1XCJA 3JVVA 4EQ6B 4U6QA 3CVVA 2R8PA 2LVBA 2HHHB 3HWNA 5BQPA 3UMJA 1JEEA 4ZMBA 1AKEA 2F8LA 5FJJA 721PA 1ND5A 1NVEA 4US1R 1OHHA 1Z4MA 1DHRA 1JTVA 1SBYA 1M1YA 3IR7A 3ZCTA 4L8LA 4W5TA 1RTKA 3AFIA 1TZMA 1DKUA 1RMQA 1L7PA 2RHCA 5DCUA 3PDFA 3LHDA 3CT6A 5JALA 5IT4A 2EZ8A 3DOJA 3PSAA 4F45A 1U0FA 4YUWA 4EVSA 2GJAA 2Y68A 4BOYA 1OZGA 1Y4AE 2I6TA 1FEZA 3ILSA 4K9MA 5JD3A 3P7MA 4FZ5A 5CIQA 3W78A 1VL6A 2YBEA 4G26A 5KYVA 2D5CA 2Q5HA 3MCVA 2I4OA 1A5SB 3K09A 2R44A 3KQPA 4DUZB 2J5BA 3A26A 3IAHA 1UBGA 5CA0A 2BMAA 4M0FA 3S40A 2CKMA 4PHTA 1SKAA 4OHRA 3GLTA 3OAAA 1H22A 1PGJA 4BO2A 5KYXA 3AVYA 1F6BA 3E9QA 1BDBA 4MH0R 3HZHA 1NSFA 4GQAA 4ROSA 2V1XA 1F8XA 1WHTB 2X1MA 2CUTA 1KK0A 3PXDA 2A1UB 1A8QA 1SK9A 2OG2A 1GUDA 1GPYA 5BNWA 4QODA 3CSDA 1BJTA 1ZNQO 3WWEA 1AZSC 4QOHA 3WLRA 3WRXA 3N0TA 5AJHA 5FUVA 3MOIA 4BJHB 4C6RA 4FVTA 4MGEA 2FP3A 2AN5A 1EWPA 4AXBA 4DQVA 1IWPB 1L8AA 3NYIA 2TMKA 4YP9A 5L40A 2ZWVA 3L18A 4NJMB 1NP6A 4HDOB 4BNZA 3LSTA 4JL5A 4ZN6A 2R5FA 2HJ9A 1MKYA 3QA9A 3SJZA 3THXA 1N5DA 1NB3A 3CEAA 3EGXA 1Q3HA 2XQJA 3KP1A 4LXHA 3CH2X 2XUDA 2CVOA 4GBJA 3BWEA 5ARCA 3WK7A 1JV2B 2V3CC 2Z95A 2ZIZA 3A1WA 3CF4G 3RU3A 2HMSA 2H2FA 2TMGA 5JO9A 4RXMA 4BS6A 2MSLA 1KZ7B 2P4HX 2YHSA 1AA6A 1EFTA 4IIBA 3ASYA 5F78A 1M83A 3VZQA 2OGSA 3NC4A 4AFNA 5K05A 1UFRA 5CD1A 1T91A 3OVZA 2H1LA 3V55A 4KN6A 3JQRA 5EZQA 3FMVA 4DMYA 1MJ5A 4MVJI 3E2IA 3LIIA 2PTGA 4IO0A 5J9FA 2CL7X 2KHZA 2VTVA 2DKOA 1ZWLA 2PV7A 3BMQA 2UVPA 3RYFA 4YRIA 1EUCA 2J31A 2X0KA 2JLWA 1CZUA 2AWOA 1VMAA 2I4LA 2JIQA 1A1SA 4CCYA 2RD2A 2GDZA 1EE1A 2KSQA 3UAVA 5AKHA 4Q7JB 4IGFA 2IK8A 1K8XB 4LYYA 4AY5A 3H3JA 4YCCA 1V4NA 2ZJBA 1AB5A 1WF6A 5K0GA 2I2WA 3T4UA 3OVMA 2Q5JA 2ZYGA 1OZFA 4PZEA 2V1UA 4UU7A 3RO7A 3KR9A 8OHMA 5HKLA 4GC5A 5BVHB 2GO7A 1DTWA 5CVCA 3L77A 4UMDA 1R6DA 2PBLA 3FWHA 5KYNA 1P72A 2G80A 3KYBA 2YFHA 4GGOA 1KK3A 3MIIA 1ZBQA 1ZVMA 2X22A 3PD7A 1WD7A 4KWHA 4QOFA 3SEZA 4FEYA 1U9WA 2ZAYA 1ENPA 2Q6VA 2V45A 5K0NA 2QMYA 1EPUA 3N8KA 4P31A 3IOMA 4ROTA 1EK0A 1IRIA 3DLTA 3K5HA 1G8KA 4YY3B 3M3PA 4Y98A 2HH5A 3A04A 1V43A 4GM4A 1MLDA 1XXHE 1QOLA 1XF9A 1X80B 1L5GB 1L7QA 2Y2VA 1SR8A 4RDXA 1J99A 5CYOA 1G16A 3P96A 3A4YA 3ZV5A 1JEDA 2EYUA 1RJDA 4Y8VA 1TAHA 3LA6A 2Q5FA 3E15A 2Q9UA 4GSYA 3EQ6A 3NHYA 1ZJYA 2RARA 4GLFA 4W7HA 3EQ9A 5LA6F 1YQGA 3U81A 3JV7A 3VZRA 2MIIA 1VPLA 2ZIUB 2C82A 2DP4E 1ZMRA 4YPOA 5K2OA 4G54A 1J0CA 1U99A 1YI1A 4NP6A 4R1TA 2Y5BA 3FLEA 1NQVA 3ZDZB 5AM3A 5SY6A 2OKGA 3JSAA 1DJLA 3OWHA 2ZBDA 1R6UA 4MEBA 2PIAA 4MPTA 5DGCA 1CK4A 1VXOA 5J59A 1XQ6A 3NBQA 2RIRA 4BNDA 3WX0A 5IVHA 2VRBA 2XMSA 4WIAA 4MI7A 2RJOA 3PXAA 3JZIA 2HAEA 2PXXA 2PPLA 1E20A 1GG2A 2AK3A 2PZBA 4GMHA 3VPAA 1C9NA 3HB9A 4ZKEA 3W8EA 1PUJA 2QT1A 3D7SA 1JEJA 1P7YA 4WOPA 1L3CA 4G0WA 2XKBA 2DSTA 2PS0A 3EGDA 4E7PA 4G1EB 5K6RA 4U7GA 5JD4A 4H7HA 1D2RA 4A82A 4IKOA 3RYHB 3WFZA 1D6SA 3BFXA 3CG4A 3PQ5A 2IGTA 5JNLA 1QG6A 4XM1A 1YUMA 4MV9A 4TMYA 3VPXA 3EC1A 1ZN7A 2JIDA 2WFMA 4MWEA 4OEHA 3V7WA 3I6ZA 3P97A 1ZL2A 3K24A 1TF7A 1WETA 1JS1X 3DMTA 3ADDA 3BULA 4RHXA 1K6IA 4FGZA 1RBZA 4JC4A 2ZIAA 3SJBA 5AW9A 4JQZA 3KZXA 2IYSA 1W94A 4GGPA 4JIMA 4DLRA 5HCNA 4BVHA 1Y4SA 3B1JA 3KEOA 1IHYA 1DPGA 2DHRA 3GEEA 4D57A 3L6RA 1F20A 2GCGA 1N3BA 4DDWA 2P11A 3L4EA 3MTEA 3VH2A 1AV6A 1VSVA 5DT9A 4LMRA 2WG2A 1QE0A 4XCVA 3V7FA 3EPHA 1NRWA 1YC5A 3LPNA 5K8JB 4EP1A 1NW9B 1J2JA 1GUFA 4DXAA 4OA5A 4BFCA 2ABWA 4M0WA 1ST2A 4AJLA 1NOJA 1YR2A 4MK4A 2R4TA 4MVXA 5AP9A 1EESA 1AQ6A 1T34A 4GVLA 2JFHA 3AUXA 4KO2S 2VF7A 1L5WA 1Y9AA 5IF9A 4IQ8A 1LF0A 3EAFA 5AK0A 2LBPA 1M8PA 2JF0A 3C7CB 3UT5A 4P5EA 3DAPA 2D74A 4OI1A 3ZKAA 4WW0A 2H9IA 2QYSA 1XCOA 4PE5B 3DFUA 3VSAA 4B44A 1PGNA 2YWBA 2V6FA 3EULA 4KPUB 3AINA 4Q7QA 1N5JA 1GCBA 5LLDA 3BA6A 1UJCA 1LZLA 3DKPA 1NOIA 5ENZA 3W6NA 1IY1A 5BT9A 3RJMA 2ZRNA 3I2YX 5MGBA 3CLSC 1WABA 1N5LA 3HP7A 3I4CA 1TL7C 5CR9A 3V5NA 3WMEA 1XMSA 4FKZA 1ZHFA 1Q7BA 2XWBF 4WCFA 5EESA 1YGPA 5EMJA 4J0CA 3RIXA 3LF1A 5EG5A 1DCTA 5GAJA 4DLZA 5FDFA 1GRCA 1IUOA 2BFEB 3K15A 4OHFA 3HU3A 1U63A 4QXMA 4RA6B 5AKYA 4DA0A 3QUCA 4MRMB 3PE6A 5BQFA 1G8PA 5FYQA 4RJIA 3REFA 3TFOA 4IKEA 1MP0A 2FW1A 3A6GA 1Z6AA 2H92A 3IDQA 3L1JA 3UWSA 3DDCA 1MA0A 5CHTA 1V8BA 1IN1A 4YJFA 1UIMA 4X92A 5A05A 4U2KA 2OD7A 3IQXA 2ODPA 4X41A 2CCGA 4FINA 1PR1A 4I6EA 1GQYA 1W4BA 3H6KA 1K86A 1OD6A 3GPCA 2QN3A 1MAHA 5E1MA 3EXHA 4G0QA 2YYAA 2AFRA 3HHPA 3TDNA 1Q7TA 3HG7A 1G7SA 2EBUA 3GJYA 4BKQA 2AGAA 3KJQA 5LA6B 1U2EA 1YJ8A 3UYKA 1M6VA 4PZLA 4RMGA 4OYYA 1F29A 3M34A 3EYAA 2GFOA 3NHFA 2I91A 3DL4A 5DX1A 3FH0A 1XL0A 1QIMA 3KKQA 3ME5A 3Q3JB 4XM2A 3WV4A 3VZCA 4F97A 5CDYA 4JVLA 3KZVA 3HXMA 3P9NA 1PZNA 1IK6A 3MMZA 5AO9A 4DC0A 4S1PA 5CHYA 2LP4Y 4D3SA 4HWPA 2MR5A 4KN9S 3F3YA 1R4AA 1HYBA 2LTAA 3O75A 1R12A 3NHLA 2QRKA 4INOA 5F2EA 4RF2A 2YFKA 3CCBA 1E2HA 4P7GA 7PCKA 4NYIR 2DXIA 1J97A 3RYTC 2JANA 2IYUA 1C3LA 2VS1A 3NV9A 4HTFA 3FPAA 3MCZA 3K5WA 1LTKA 1LVUA 3B48A 3NHUA 5IZCA 2HXZA 2VOJA 3K8YA 2F1KA 3VI4B 4OHXA 2COEA 4OL0A 1DAEA 4R8VA 1E7MA 3KTAB 2L82A 3L0ZA 3OC0A 1PW7A 1QOZA 2JBHA 3FM9A 4Y6GB 4KAJA 2BLLA 3ZWQA 5FBHA 5DM4A 3KNZA 3K2EA 1TM3E 2BL4A 3U8EA 1FRQA 3N76A 2YHAA 1E5TA 3NTRA 4I46A 4J1NA 4JK3A 4QU9A 3WJ2A 5HUQA 4BX2A 5HEKA 2B8TA 2JFZA 1YTUA 3TOCA 4EI8A 1FMTA 2VHSA 2H4ZA 3T5PA 4OXRA 1EFVB 2HSZA 2QW8A 2QS9A 1RTTA 5K3FB 3TZLA 4YRRA 2CXHA 3T7KA 2FFRA 4PZUA 2GX6A 2BZ1A 1PIPA 1UPUA 1ZDMA 4W9NC 1WXIA 4BMPB 1Z4OA 2VF8A 3ABRB 3C8ZA 4Q3BA 2F4VB 1FA9A 1PR3A 3B3JA 1MH9A 3U9TA 4G86A 1GR0A 3TF5A 3QU4A 2ETVA 1AU0A 3PHHA 3RS8A 5AW1A 5AJXA 5HS4A 4FMBB 1Y6QA 1X2EA 4W4TA 1EVZA 1Z37A 4N0PA 1KO5A 3HDYA 2NSLA 1CF9A 1RXVA 4N76A 1GP2A 4HQRA 3RABA 1OLUA 3V42A 4RLFA 5T4BA 2PQ2A 5FYDA 2ZYVX 2DLCX 3TZCA 4FFOA 1R1DA 5DK6A 3U4QB 3MWKA 3KB8A 1P61B 2DCMA 4TL9A 3EXG1 1JAYA 1ORDA 3DFFA 2HRBA 1DEUA 2OA0A 1T9CA 4IXWA 2NZVG 4EJSA 2H00A 3DXYA 2R9VA 5K9ZA 1K5HA 2AYXA 5IANA 1R5NA 1Q83A 2YRXA 4JHXA 1YGYA 4MX8A 3REOA 4BZQA 1Z68A 1HDGO 1CV2A 1U5BA 3IAXA 3FCYA 4HPJB 1HQDA 2XLCA 1I4LD 3DMPA 4UHJA 4C4RA 2RGDA 5KQGA 2IDMA 2DLNA 4W5QA 2JGRA 4JBXA 2BM1A 1WOYA 2BZSA 1RKXA 2GN1A 1TLFA 2YNMD 5F2KA 4YPFA 3WGVA 4ZOLA 1D2NA 3QVJA 4Q5IA 4HDNB 4JA0A 2HFKA 2JCVA 3E9RA 1JR3A 4EA6A 4QUEA 4JLSA 4FN4A 1PG0A 2Q8QA 4KUHA 1NSYA 1XB2A 4E0BA 3V8EA 1XWWA 4QPPA 1F0YA 1N0VC 4HDRA 5JMTA 1Z63A 1QNFA 5CHVA 3PC2A 4IUCS 1H0SA 3TNFA 4U7DA 3R7WA 5JA7A 4IIEA 2HMWA 3TD6A 5A2GA 1DCKA 3TRIA 2IPNA 2XDQA 4QFBA 3FTEA 5C8YF 2QM0A 1ST3A 4AY2A 3QQ5A 1YNOA 2VL7A 4P4SA 2WD8A 2MCFA 2OAGA 4DWWA 2OV3A 2YRWA 4JXJA 1XELA 4S1NA 1U4NA 1FTSA 5F7JA 3DVAB 1DG3A 4Q4JB 4FE4A 2M9MA 3O26A 5KTMA 4UMVA 2AZXA 2C20A 1NQTA 3BXPA 4H6XA 2R62A 3SQWA 3WDLA 3S5JA 1YFJA 3GFFA 5EA2A 3SNKA 3TIVA 2O8BB 4BZXA 2JFNA 1GUYA 1RQPA 1UEJA 2PGDA 3B70A 3P0IA 3I3TA 4RD6A 4OF4A 2WP8J 2IOQA 3SEQA 1NXTA 4Y1FA 1HR0B 4OIMA 5CIWA 2CLHB 4QBGB 5JU6A 3B5JA 3DAOA 4C0JA 4MRVA 2JLSA 3OU6A 2E4ZA 5AD1A 1JDJA 2A9QA 2AV6A 5DWVA 4DM4A 4DNXA 1XNGA 4JC5A 2JFVA 4UUNA 4ZVOA 5ESDA 5CLFA 5IMBA 5E1OA 3PI7A 3E70C 4DSOA 1H2AS 4A92A 1TQHA 2A1TS 3UPDA 3X1XA 2C2WA 4CF3A 3N2KB 1TIPA 1ZICA 1PPDA 3PL1A 1A8SA 1L4YA 3QF7A 1OTYA 4F84A 3O8BA 1TO6A 4XAQA 2A1IA 3EUAA 4MB6A 1D9XA 3DC2A 3G9TA 3HB1A 1KSGA 4CEHB 3BN3A 4ATNA 2G09A 2ZATA 3DEIA 2FK8A 2IHZA 4JY7A 3KHUA 4EBFA 1HDXA 3FDZB 5EJEA 1KRWA 2NSYA 4ZHSA 3D81A 2F9FA 1DIHA 2GK7A 2VH5R 5KCMA 3WMGA 3TG8A 3ZWAA 2O2ZA 4QFMA 5CDFA 3UC5A 4I99A 1PJ2A 2N42A 1E1MA 3KXDA 4ETWA 2VN8A 1H42A 1KC1A 2HADA 3GFRA 3QBTA 3ANXA 5EUBA 3SHQA 5JT1A 1V8DA 4K81B 3AEYA 5JTUA 3QNMA 1SHKA 2VQSA 3WSTA 2QMOA 4NZ9A 2REQA 1A9YA 2O20A 3R5SA 5EXSA 3DOUA 1Y1PA 3HB0A 4XSGA 3VNUA 1BMFD 3Q6MA 3VKGA 3ZW7A 1VSBA 3LC1O 4Q1EA 4RF5A 1NX6A 1E9CA 1Z06A 5LMUB 4LJRA 2RAFA 3HI4A 4OQEA 2B4TO 1PWXA 2XE6A 3GF4A 1WX1A 3H7DA 4AL4A 3D4LA 3HXKA 1BEEA 1Q15A 2IEZA 1CUHA 5CGQB 3ZBTA 5HQ3A 3PVCA 3TSAA 1LY1A 1DIGA 2BHSA 3VISA 4GZMA 3KEMA 1AXEA 2WJ4A 3P2MA 3AF2A 1SQ6A 1XP5A 1XPOA 4OBXA 2GZ2A 4XWYA 5DBGA 2DBQA 2AE2A 1LDEA 3IMEA 3IE0A 4Q3KA 2YC2C 5FUBA 2P4SA 3SOPA 4RPJA 4AURA 3OQNA 4MRMA 2WFLA 2NQTA 2OCGA 1H93A 3ELUA 3EW7A 5H4GA 3Q2OA 3TSOA 4BO6A 4CKEB 1BX3A 2KLBA 4RK6A 4Y1EA 5EQFA 4NBSA 3EUFA 1RQNA 5DRYA 3ZHZA 4D8YA 2Q4RA 2WRZA 3HYNA 5AI9A 3ZXYA 4B47A 4Z54A 3LTEA 3IV7A 4OXIA 2XQFA 1OU4A 4KPUA 1H05A 1FPQA 1UOPA 4CNQA 3I09A 3MHSA 4M60A 1V3TA 4G1VA 1Z0JA 3H0CA 1ZQ1A 1L1RA 2D59A 3ZKWB 5IUJC 2PUEA 3NOQA 1OASA 2JJ2A 3HUEA 4ZCQA 4F2DA 1YMUA 3NRBA 1QCDA 3QVOA 1MEMA 4BZPA 2PXAA 4PN7A 1Y8QB 5TT1A 3HBFA 1P2DA 1S3FA 3MN1A 2EBHX 2AC7A 2IZ6A 2VP4A 2EFCB 1E8DA 4YCJA 3DBOB 3QKWA 4CLOA 1OB2A 2QAGB 3RKRA 1KI3A 4TMKA 1JHPA 1PDVA 2BKEA 1JMVA 2IP4A 2QVGA 2RHRA 4GI5A 4UHEA 4NF2A 4A9AA 4RKWA 4FLEA 4CCYB 3OZEA 1ZOOA 2Z6VA 4QPCA 4DA4A 1AKTA 1L1QA 1SBTA 2JLQA 3K1AB 2RGEA 3P20A 4BS9A 2ZVPX 5CFQA 1AH2A 1E60A 2QTHA 3ETGA 3B9QA 3CRNA 2OZPA 2VSXA 3GLSA 1B41A 4MVWA 1NYLA 3FDXA 1L5FA 3KXLA 4I8IA 1WXEA 1CDOA 2YJCA 4LE0A 4K6MA 3TBFA 3T3PB 4M9CA 2ZUUA 4I4TA 3SIRA 4BDTA 4H0CA 4QVIA 2DZYA 3DEJA 1O0BA 5KWSA 1E9EA 4OI4A 1RJ9B 3B6KA 1ZCZA 2R8OA 4X8MA 2VHVA 3BMOA 4KP7A 4QNNA 2NYUA 3QWHA 4V02A 2DPLA 2FJPA 3QYFA 5SZHB 1SXGA 1W4ZA 4EHJA 3ZCXA 1DKNA 5DXAA 3UAXA 1QHHA 4KSYA 2AJBA 5A71A 3SBXA 4LYDA 1TC2A 3Q7QA 3ZEIA 1VXRA 2BELA 2L18A 3IHKA 4MI6A 4CDMA 4IAOA 5KIAA 5F3WB 1E59A 2QSYA 3BICA 2QN9A 3V4ZA 4OKIA 1NWCA 4ZRNA 3W6ZA 4LBYA 3P52A 1C9MA 2IYAA 4HRAA 3FSGA 3EGOA 2A5GA 1SD2A 2XCUA 4XQ9A 3ZCUA 3CNEA 3MAJA 1LU9A 4GE3A 4QOSA 1TRKA 4RVDA 2ZR9A 3HYRA 4UNSA 3X43A 4Y2PA 4HDKB 1PJTA 3IMAA 1Q7RA 1OLSA 3C6ZA 4MS3A 5AKZA 5CYGA 4QVKA 4PPNA 5BSMA 1TO1E 3VR4A 1MT0A 5LZ9A 1JXOA 2WFLB 4GI3A 1BH2A 1ZR4A 2Z84A 3K70C 2J3HA 4KW7A 2FT2A 4MARA 3UWOA 4A1OA 1GM5A 2CIOA 3GVIA 4BBZA 4DMFA 1S7GA 3PDCA 1SB8A 5IK2D 1UMCB 3DZBA 3WIDA 3KUDA 4JUAA 1II8B 1IWOA 5JZMA 1YRBA 2AI2A 4LC9A 4QWMA 4AMYA 2I6SA 3U7JA 4E70A 4IY1A 5JCXA 4M0CA 3H5TA 4C2TA 2D62A 1HO3A 2ZRBA 1W6RA 4L2IB 2G7MC 4PGGA 3GBSA 4LDAA 1X74A 1B1CA 3X2EA 3LHSA 3VR1A 5I9SA 2FPWA 1Y1RA 2A5DA 4RDIA 4DLYA 1SNKA 4JDPA 3DMGA 4V0NA 3OLCX 4LHSA 2WAMA 2XR1A 2BJWA 1E6WA 1VLZA 2PMKA 4M0MA 5JCOC 3LT4A 2AFHA 2FUDA 1FRNA 1FUKA 4CV3A 1U7PA 1YR1A 2RGYA 3PC6A 4L4UA 5DIFA 3VJKA 4CG2A 3RVPA 5CVJA 4C4AA 3RC2A 4HDAA 2NTEA 3JATA 4UEKA 3L93A 1RYFA 5GVRA 4H1HA 3UXHA 4XX0B 3DMNA 4PTYA 2JFGA 3RVQA 4NOJA 2W43A 3ZNQA 1A82A 2OAEA 1XTKA 3H8WA 4ZQBA 1X0VA 3TL3A 1E6LA 1ELOA 4BWYA 1JQDA 4G0OA 1OH7A 5AJWA 3M6XA 1UPFA 3ZYZA 4NMXB 1EG2A 3AKDA 2BKUA 3WIVA 3CBJA 4GI7A 1FDUA 3KFQA 1L4HA 4WLUA 3WYBA 3VR2A 3KVNA 3NWBA 1KXRA 4YYQA 1ZGAA 5C5IA 4Z4HA 1TRHA 2AI1A 3C3AA 4HGRA 1YVBA 1O1YA 3OQIA 4YRNA 1SH7A 4LTMA 4Z2YA 3ZV4A 4ZYWA 4H1TA 1V3VA 4F4CA 4JN6B 3IHPA 2GO1A 2WJIA 3CPHA 3W5HA 1NMZA 5AOAA 3CNOA 2XMBA 4EY7A 2AX3A 2CSUA 2G9ZA 1FUEA 1X42A 2O0HA 2R8XA 2PYDA 3M9LA 5K2MA 4BP3A 5HSGA 2J7QA 5T57A 5CJPA 4PY2A 4L4RA 4RV4A 1Z0SA 4R2WA 4ZCPA 3N70A 1KTIA 1NP3A 2PWAA 2ZK7A 1ECGA 3L1UA 2DQYA 2QL7A 3Q15C 5HF6A 4UFOA 1FFDA 1B6SA 1BS2A 1G21B 4IV0A 4WKOA 4O4JA 2PS1A 3KYJB 1P81A 2IPMA 2J45A 1Y3AA 3F90A 3TXYA 4DW8A 1EZZA 1MG5A 2IVZA 1KKLA 2PA0A 1O77A 2QL9A 3F1KA 4GBMA 2M1XA 4IHAA 1E3WB 3E2PA 4HBGA 4QLAA 2Z08A 2MT9A 5LDDC 2VPWA 1RWMA 2PKEA 1RKVA 3JVDA 3K73O 4UOEA 2ODEA 3E4CA 3O0TA 3HCNA 4EB6B 1RW4A 1A9TA 1JEAA 3THYB 3ROEA 3GJ6A 4TZ0A 1XRJA 4ZAGA 3LCJA 1MHWA 2OQIA 3WFIA 2PX6A 3LDFA 4MIOA 1RE1A 3ORQA 3K1AA 1WZ2A 4K86A 1L7XA 1UL1X 2W48A 1T1GA 1QMGA 5FBLB 1UMDA 3PRHA 4PNPA 4LWZA 2NVBA 2VUTA 4QSHA 1P9LA 4R0NA 5HJ7A 3H1FA 4UDXX 3NHEA 1Y7TA 3AHCA 5KTTA 1K5PA 1JG3A 4FK8A 3LRPA 5H82A 2HF7A 5A3QA 3MLEA 2H5IA 1OFUA 1T36A 3FW1A 3I5UA 4X7MA 1YOBA 3VO8A 1X7XA 3ZE6A 4PP1A 4NY1A 1VDMA 2FYTA 3M4JA 1ZCAA 4Q01A 1FS6A 4MYDA 2DCAA 2VHJA 3BPFA 3F8SA 2HWWA 5CM9C 1HBJA 1MO3A 1QORA 5AI4A 2DHQA 3V4OA 1VIDA 1SPBS 3IIIA 4JYPA 4HG2A 2RONA 1B0PA 3PUWA 1CYDA 3RAFC 4OQ4A 1I5EA 2PL1A 3ESCA 4FNGA 1VB5A 4P6GA 3PGXA 1TUGA 2GBFA 2QQ0A 3H5NA 3ILHA 2O8CA 3JARB 3TX6A 1M0SA 4MS4A 5FWXA 2AUZA 1CZKA 4KXQA 1CQIB 1DKQA 1PQUA 2YDYA 1J0BA 4XEHA 2CXTA 3FNIA 1B7GO 4WZAB 3DPSA 1RP1A 4RF0A 1Z2NX 4M55A 3LO5A 4HTFB 5EIHA 1L7VC 1JLLA 1W4AA 4IOLA 3CW2A 5IT0A 4ZZ1A 2RHHA 1Y5LA 3BL5A 3D43A 4YUAA 4JLMA 4X71A 3ROPA 2AVNA 2R00A 3LFTA 1FVHA 2VRCD 1CP2A 5KYWB 1AS3A 3GVCA 3UN1A 2FB9A 4FIPA 3QOFA 2ACVA 2E48A 4JLUA 4U63A 1U5IA 2OQ2A 2FMTA 5AVZA 4AY6A 2IIPA 1O7JA 3WNVA 1U3CA 4GBED 1KEEB 3AI2A 1CHNA 3O8NA 2CXRA 2Q21A 1DO8A 2G0TA 1H3EA 3TRFA 2YWRA 3WVNA 3UHJA 5I7VA 2EV9A 3EG9B 2Y1DA 1FFWA 1Y6RA 1KF0A 2NZXA 1Z45A 3A27A 3IP3A 2DC1A 4ZJYA 3DTYA 2X9VA 3WICA 3OF2A 1T2EA 2WAOA 2GEKA 2ZJ5A 5EKXA 3D2CA 4P3PA 3RS4A 3WLJA 3SBOA 1O57A 3WI7A 1JDBC 4QXPA 1AY0A 1WTAA 4DB4A 2PA3A 4MUIA 4ACAA 1N9ZA 5TC4A 4B2PA 1W76A 1BKYA 2WKRA 4IGAA 5ECGC 1F2BA 2P2DA 5E9WA 3TN7A 3MHHA 4D99A 2VTDA 2OSVA 3BE4A 1ZIOA 5DN6A 1F0KA 3PPYA 5E3IA 5B37A 3VUEA 4MSUA 3DLHA 2B4KA 3ZQJA 1XJQA 4PIVA 5IZCC 2NZ8A 1AUQA 3I23A 1PCIA 4HYYA 1A9OA 5AICA 1I6MA 3GLGE 3C1OA 2J67A 1LBHA 4WFIA 4CLHA 1WDTA 3AVOA 4PQYA 4UBNA 3DLBA 1C0EA 1TF5A 2FPPA 3FGPA 3SYTA 2GN2A 3AHGA 3K6RA 4LZLA 5DXJA 4OHCA 2WWXA 3TZ6A 5KS2A 4XD7A 1QDLB 3ZE8A 4RMHA 5FORA 5EJ6A 5EHQA 3CR7A 3ROKA 2Z5LA 5CCDA 3U4IA 2HU5A 4Y3UA 4W4UA 2BSAA 1XZMA 2XZDA 2JIRA 3EXEA 4EYOA 4FC6A 3MZ0A 3NWJA 5FPYA 3A1TA 5H83A 4FYHA 1K89A 3CE9A 3KM0A 3U40A 1SXJB 2X6RA 4DR3B 1C9EA 3M7IA 4XQGA 1QKKA 1Y5MA 2WYIA 3Q72A 4JT9A 4B3DA 2V0CA 4O0MA 3VNQA 3QLUC 1KYQA 5J2TB 2AQ8A 2CB5A 2WVGA 3BEDA 2Q4BA 3GYGA 4TS3A 2NV2B 4Y2GA 3LWBA 5GPBA 4AG3A 4ZEVA 4I7EA 2B1RA 2VZ9A 2IA5A 4AULA 3DH0A 5BV7A 2QENA 3AUKA 2WQ6A 2FK7A 1KFJB 1XVIA 3PCTA 4DG5A 4P7KA 5I9TA 1KOJA 1LPSA 2GJ4A 2YX1A 3P5BA 3QLJA 4FOPA 3G02A 4HRXA 4JU9A 5AKKA 3SP1A 1VFPA 2XUJA 3PIDA 4AWXA 4BOSA 4DSUA 4UD6A 4N3NA 2GD2A 1ZIYA 5H0IA 3MEQA 1NKVA 3NHJA 5AVQA 3KC2A 1FX1A 4AJ2A 1B00A 1TQ8A 1U1CA 1I1HA 1MDWA 3EY9A 5ALVA 1Q7EA 3COZA 2J9ZB 3W7BA 3NP9A 3ZZNA 2I5PO 2MMCA 3M2PA 4M0KA 4UCFA 4B33A 4CLRA 3G9XA 1NU6A 3WZMA 1XZDA 2NGRA 4Q21A 3AM1A 4G5YA 3PK0A 1G6Q1 5IVIA 3M1LA 1QFYA 1QTNA 1Y0BA 2A0UA 1L5ZA 2YV4A 4L72A 4QFDA 2WJ3A 1DC5A 1L8OA 2O5RA 3ESRA 5AJZA 1CVLA 1KU0A 1JSZA 3D7LA 3DMFA 4FDLA 3KQVA 4QNRA 5P21A 3RG2A 1P9NA 2CGEA 2J30A 2J07A 3JAWA 4B9AA 1P6UA 1MOSA 3QW2A 4PC2A 5ICMA 2QXYA 3AB3A 3KX2A 5F02A 1X1SA 1UADA 4QRDA 1F2AA 1L5RA 3E1GA 1YJQA 3KPYA 1FH0A 1ATIA 4N65A 1KHHA 4LC0A 1JXAA 2NU7B 5TQ2A 4J91A 4D8BA 1IDN1 3A6ZA 1H8HD 1P5RA 3DZHA 4IZHA 1ONPA 3B6EA 5KTNA 1UR5A 1UWCA 5E6RA 3F73A 1C8VB 3F5QA 4WKBA 1CEXA 1P7ZA 2G5GX 1CUJA 3JQ8B 2WG0A 3MTJA 2IQIA 4HSGA 4L9SA 1GHTA 3TRHA 4RVOA 1ABBA 2Z2KA 4TWRA 2D2EA 3C3BA 2D3TA 3OZUA 4XIYA 3IUQA 1R6VA 2IYVA 4PPYA 1F2DA 3R3JA 4HDQB 5FADA 1YB6A 4ZO9A 2XSZA 3HUFA 1F14A 2B4YA 2YXLA 3LQQA 5B58T 1W5FA 3DMTC 4U1RA 4GICA 3LUGA 1NPZA 1P3DA 4C6TB 5A0FA 3FNRA 3TAUA 1V71A 3HYSA 3G2JA 2BV3A 1EGVB 3FWZA