5EZQA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
320
structure length
320
Chain Sequence
b'DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural Protein 2 Cysteine Protease
publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase
total genus 110
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezqA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezqA01
1L1EA 4YUWA 1UIRA 3FRIA 3P71T 5E9WA 3NWBA 5GOZA 5DTRA 2IBSA 3HA7A 3S68A 5KS2A 2YUIA 1BOOA 1NW6A 1QYRA 2E5WA 3GWZA 1XDUA 4GC9A 4OQDA 4QTUB 1L3BA 3PX3A 5G02A 3TFWA 3PFHA 2P41A 9MHTA 2AN5A 1NV9A 2ZBRA 3G8BA 3LKDA 3A25A 5E1OA 2O06A 4X1OA 2JH9A 5DX0A 2NXEA 2ZTHA 2UZ4A 3PX2A 2AN4A 3CKKA 4HC4A 3EVEA 5K0LA 1KPIA 4AZTA 4YMGA 5ICFA 4PYMA 1P39A 5K09A 2XBMA 2BR4A 2JHCA 3PVCA 3DXZA 2OO3A 4RTLA 3R6TA 2I9KA 4FT2A 5EC8A 1UWVA 5EVJA 3AY0A 3MB5A 1AQJA 2AS0A 2K4MA 1R8YA 2PX5A 3FUXA 2PXAA 4QPNA 5DXAA 5JR3A 3LECA 4BP1A 1ZGAA 2IIPA 3FRHA 1L9KA 1X1DA 3FTCA 3P2IA 5K05A 1SKMA 3REOA 3UJ6A 2NYUA 3LBYA 3QV2A 3JWIA 1PRYA 5K0CA 1N7JA 2ZBQA 4X60A 5CVJA 1JR4A 3THSA 5K0EA 3V97A 4HTFB 5EIWA 3PS9A 3G2PA 3OFJA 4U7PB 5GWXA 4ER5A 3EVGA 1QZZA 1TW3A 4M38A 2AOUB 3DR5A 3FUVA 1G8AA 4AZVA 5GM2A 3EGIA 3GRVA 3JWHA 5C1IA 1R74A 2B3TA 2VDWA 3B3GA 4QQKA 2AN3A 3HVJA 4ER7A 2HWKA 4Y2HA 3BWCA 2ORED 1M6YA 2FK8A 1O9HA 2P7IA 4PYIA 3TQSA 3PT9A 3I64A 4KRGA 3HVKA 2OB2A 1SQGA 3HCDA 3KR1A 4FT4A 1JG3A 4M7RA 5IH3A 3P2KA 3GCZA 4DKJA 1EJ0A 4DCGA 2CKDA 3G2QA 3HM2A 5EG5A 1BHJA 3SSNA 4A6EA 4POOA 5LQCA 4XUDA 3UBTA 2R3SA 5DSXA 3EVFA 2QRVB 4GF5A 2PV0A 4R05A 5DLYA 1P91A 5FQNA 4EMSA 1R8XA 4EQZA 5MHTA 3AJDA 3R9XB 1JG1A 2Y1WA 5EQJB 4ER6A 3QOXA 1FBNA 3BUSA 2PJDA 2OXTA 3P97A 1O54A 2PGXA 2ZFUA 4CTKA 4RSRA 3HP7A 4PCLA 2IBTA 2IFTA 4OX9Y 2NXNA 1YF3A 4YV2A 1EIZA 4YUZA 3P9CA 4XUEA 4RWZA 1M0EA 2P3QA 2UYOA 1U2ZA 5KYGA 2IGTA 3VYWA 2BM9A 4LWOA 1V39A 5CIYA 2JJQA 4RVHA 4PWYA 3C0KA 3PFGA 3R24A 2B9EA 1X1BA 3CJRA 3HCEA 1VL5A 1JTFA 4O29A 4RX1A 3Q7EA 2VDUE 4CKCA 3M33A 2ZCJA 3GRUA 4X63A 4K6MA 3G5LA 2BM8A 5EHIA 2PWPA 5ICEA 3KR9A 2DULA 3SMQA 1NV8A 3KQTA 3NDJA 3LHDA 4FS8A 3MGGA 5E9JA 4RTSA 3MTIA 2GA9A 5EZQA 1MHTA 2YQZA 4QVGA 3DLCA 3KPJA 3GGDA 4E2WA 1WXXA 3OZRA 3DXYA 5E1BA 4MWZA 4PNEA 3UWPA 5KQSA 4P7JA 4PINA 2YTZA 3GU3A 3MAGA 4RTOA 5ICCA 1G60A 1XDSA 3ID6C 1WS6A 3G2MA 3M70A 2PKWA 3A7DA 4WXHA 3UFBA 2NP6A 3K0BA 5E1DA 3DMGA 4M36A 2H11A 4PYOA 5CVEA 4YV0A 3U81A 4YUYA 3HTXA 2C7PA 3LCUA 5FTWA 3EMDA 3B89A 3NTVA 2VP3A 2IDKA 3C6KA 2NNWB 3KQMA 1YFJA 5IKMA 3BGIA 3I53A 2G71A 3E7PA 3KHKA 2OPBA 5DTQA 1RI4A 2YVLA 2ZVJA 3CCFA 4RVFA 1FP1D 4IV0A 5DTMA 3EEOA 4CKBA 3FUWA 3GO4A 5E9QA 3FPFA 2JG3A 5KVAA 2C7QA 2G8NA 1TW2A 3UA3A 1KHHA 2GB4A 5E2BA 5HFJA 4BP3A 2PLWA 3DH0A 3Q87B 2QE6A 2QM3A 2R6ZA 2XVAA 3EVBA 3KPUA 2NXCA 5FUBA 3OFKA 2ZBPA 3LKZA 5CUQA 5DPMA 3LSTA 3HA5A 1JQEA 2EFJA 3SVZA 2OKCA 3QOWA 5FWDA 2GH1A 3UJCA 1JG2A 3ELYA 4AUKA 4PIPA 5HEKA 1KIAA 3E23A 1NW5A 3DULA 5BW4A 5EKXA 2Q41A 4KWCA 3G2OA 3FPEA 5DSTA 3KPVA 1VBFA 2ADMA 3CJQA 4OBXA 3ERCA 2ESRA 2I6GA 3TKAA 2BZGA 3HCCA 5E8RA 3O7WA 1INLA 3NJRA 2PX8A 1P1CA 3A4TA 3DLIA 3IEIA 4IWNA 4RV9A 3SGLA 1EAMA 4E70A 5C9ZA 3UJDA 4ATNA 2PWYA 2H1RA 2VDVE 2YXDA 3BWBA 3EGVA 4QPPA 3V8VA 3VSEA 4E32A 1QAOA 2I62A 3SSMA 3UJ9A 3GRZA 1R00A 3BXOA 5DWQA 4CXMA 1NE2A 2HMYB 3CGGA 3P9IA 5DM2A 1L3CA 3BZBA 4NECA 1RI2A 1ZHFA 4DCMA 3WSTA 3L8DA 3OE4A 1IY9A 1KPHA 2YXEA 4AZSA 4EVIA 3KR2A 4H0NA 2FCAA 4RYLA 3P9NA 1D2GA 3T7RA 3NMUF 4C06A 4OA5A 1O9GA 5HIKA 1JSXA 4C07A 3ELWA 1QANA 4PYLA 3BT7A 4E2ZA 4PONA 3TLJA 4DMGA 5LQUA 1M6EX 4E31A 3F4KA 2VS1A 1VLMA 3DMHA 3TM5A 2XYRA 3M6VA 4X61A 2IH4A 5EMJA 3MTEA 1R18A 1RJFA 1WZNA 2OY0A 1G6Q1 2XYVA 3BKXA 4PCAA 5FULA 3ER8A 2NXJA 2ONYA 2F8LA 4KVZA 4PYQA 4CWAA 3R0QA 5F2NA 5F2OA 5BW5A 5T64A 3FUTA 3SX0A 4LG1A 2ZZNA 3EMBA 4OBWA 2XVMA 5EIFA 3OCJA 3G7UA 1NBIA 2P7HA 2LD4A 4C05A 5EMKA 3FPHA 3TPZA 1HNNA 4HH4A 2ZSUA 3BGDA 5E2AA 1KP9A 5LQAA 2P40A 1VE3A 5EHGA 4YUXA 4R8SA 4Z2YA 4RVDA 4PIMA 3EVAA 5EEGA 1TPYA 4GOMD 5GINE 3I9FA 1ZG3A 1DUSA 4RTKA 1F3LA 1N7IA 3MCZA 5DT2A 4AZWA 3HVIA 1HMYA 4G56A 3T0IA 4KDRA 3KQVA 2EJUA 4GEKA 1D2CA 1D2HA 1VQ1A 3KQOA 3HCBA 5E1MA 8MHTA 3O31A 4C4AA 2ZWVA 1P1BA 4RTRA 3GDHA 3KQSA 5EOVA 5LQKA 4PYJA 3LDGA 1SUSA 2ERCA 2GS9A 2H00A 4QQNA 3VC1A 2B2CA 5LQRA 1ZKDA 1YZHA 1VPTA 3X0DA 5EGSA 2V74B 2P8JA 3R3HA 5DRYA 4YMHA 1KR5A 2AVDA 2B25A 4FSXA 3GRRA 1G38A 3M6XA 1QAMA 3MCTA 5DM1A 2P35A 3TKYA 5EZSA 2QY6A 2Y1XA 3C3YA 3GIWA 4C04A 3LGAA 3HCFA 1I9GA 4QDKA 5CVDA 4C03A 3CJTA 2G70A 5GM1A 1NW3A 1NW8A 3T7TA 4HTFA 5K03A 2O0LA 3KQPA 1VIDA 2CWWA 3FZGA 1SG9A 5F2KA 4ER0A 4QVKA 2HV9A 2AOUA 2FK7A 3HVHA 3OU6A 1VP3A 3LCCA 5E8JA 1OR8A 3OE5A 5FA5A 3FTDA 1BKYA 2UYHA 1N2XA 4R6WA 3MHTA 3DUWA 2NP7A 5CCXA 2C7OA 3B5IA 3C6MA 2AVNA 4WVLA 4DQ0A 2WA1A 3OU2A 3BKWA 4P7FA 2P1DA 1JSZA 3PB3A 5H02A 4V0QA 2JHPA 4BLWA 4KDCA 5K01A 5CD1A 3GNLA 2VZ9A 3UJ8A 4E2YA 4RTNA 2JH8A 4LECA 1YFLA 4Y30A 2OYRA 5CCBA 5D1NA 1IM8A 2IH5A 3GRYA 4RTPA 2ZZMA 1RI3A 2QRVA 5K0NA 1WXWA 3KPWA 1AV6A 5K0JA 1I4WA 1Y8CA 4IKPA 3LDFA 4PGGA 4HSGA 1NKVA 5T67A 3KU1A 1B42A 2P3OA 4P7GA 3TOSA 4HGYA 4ER3A 5LR6A 4RTJA 1Q0TA 4F86A 5CM2Z 3OPNA 3TM4A 4DZRA 4GC5A 3HCAA 4GQBA 3VC2A 4EKGA 2G72A 4FSDA 2YXLA 5GIOE 3DOUA 4GOOD 5JUWA 3UZUA 4E33A 2PXXA 5HZMA 3FPJA 5HIJA 4BY9E 1YB2A 2UYQA 4MQ4A 2CL5A 2GAFA 3FUUA 2ZZKA 2PXCA 3MQ2A 1XJ5A 5FHQA 3I5UA 3CBGA 4HG2A 2B78A 4KIGA 4RTQA 4M37A 5DX8A 3NVMB 3UJBA 3ELDA 2EG5A 10MHA 1IXKA 2I7CA 2EJTA 1BC5A 2PT6A 3IYLW 3LDUA 4P58A 3FTFA 5EMMA 1H1DA 3EGEA 5DRTA 2PSSA 4B17A 2ZULA 1KYZA 2N47A 4QDJA 4QTTB 4DF3A 2BR3A 2YX1A 2OZVA 2ZLBA 3KQYA 5K0FA 2PX2A 3CVOA 3LX6A 1XCJA 1XXLA 3EVDA 4U7TB 5B1SA 4GOLD 2DPMA 4UOEA 2BR5A 3E05A 3THRA 1FPQA 5U4XA 2AOTA 2KW5A 5BP7A 3B3FA 3G88A 1F38A 3GXOA 3MERA 4P7KA 1NT2A 5DM0A 3UA4A 1KYWA 1NW7A 2YR0A 3EPPA 4X41A 1X1CA 1MJFA 2FPOA 3KR0A 1VP9A 5FCDA 3G5TA 5C0OE 2AOWA 4XCXA 2AOXA 5FADA 4EK9A 1WY7A 5FWAA 3KKZA 3EEYA 2PBFA 4RVGA 5HILA 3TR6A 4MHTA 3OZSA 1X1AA 3PTAA 4ZTBA 5DXJA 2FRXA 1YZ3A 3DMFA 2O05A 2O57A 3RW9A 4F85A 4YV1A 5K8VA 5LQNA 4PYNA 1DCTA 4CKEA 2O07A 5EKUA 5D1HA 3FTEA 2C7RA 2ZIEA 1XTPA 3A26A 4C08A 5HOQA 3PLAE 3H2BA 3JWJA 3RIEA 2PVCA 4V0RA 2WA2A 4MTLA 4CTJA 1RI1A 3K6RA 3BGVA 3JWGA 5EMLA 5EEHA 2OB1A 5DM4A 4EKIA 2PY6A 3I58A 3ER9A 3NDIA 3SR4A 2GLUA 1WG8A 2XYQA 1XVAA 4DM3A 2HNKA 3OU7A 2EX4A 3LBFA 4HGZA 4R6XA 4PYKA 3HNRA 4RTMA 5BXYA 3A27A 1T43A 1Q0SA 2OBFA 2GPYA 3B3JA 3KQWA 4JXJA 5CVUA 1Z3CA 1R6AA 2IP2A 1SVUA 3ANXA 2A14A 4GUAA 1RJEA 4BLVA 4L7VA 5GP1A 1JTEA 3BWYA 1FJXA 3AXTA 1KPGA 1QAQA 1JQDA 4A6DA 3OZTA 1RJGA 3IV6A 4GOND 1ZQ9A 3FYDA 3UJ7A 2ZW9A 3CC8A 1RJDA 4GBED 2CMHA 3P2EA 3LCVB 1G8SA 1DL5A 3ELUA 4AX8A 1EQAA 5DX1A 2Z6UA 3P8ZA 4HRAA 1G55A 2AR0A 5FHRA 2CMGA 1PJZA 5CVVA 3ORHA 3LPMA 1ORIA 4FR0A 5T6BA 3KQQA 5HIMA 3ME5A 1I1NA 3DTNA 3TMAA 1RI5A 4PGHA 4OQEA 2P3LA 1AF7A 5HIIA 3RODA 4IV8A 3NWEA 2IPXA 3TRKA 1FP2A 2ZWAA 5FQOA 5LQJA 1JQ3A 1L3IA 2FHPA 4E30A 2HTEA 3B7PA 4KIFA 2ZIGA 3IHTA 3P9KA 4ISCA 2JHAA 4R8RA 3KPYA 5KQRA 4DA4A 1YUBA 2WK1A 4LWPA 2IDJA 4FZVA 3E8SA 1EG2A 1XDZA 3SXJA 2AZTA 3AWIA 1UFKA 3EVCA 3M4XA 5EPEA 4MIKA 3DP7A 2QYOA 3T7SA 1ORHA 4XUCA 2Z6QA 1AQIA 5ERGB 3HA3A 3FPGA 2ZIFA 1NBHA 4BLUA 2AOVA 4OA8A 3NW9A 5M5BA 2AOTB 3HEMA 2HR1A 3BWMA 3EVZA 3FYCA 2IH2A 2PX4A 3M6UA 1ZGJA 5P8WA 2Z6AA 1X19A 3LL7A 3SSOA 4E2XA 1KXZA 4F84A 5K0GA 1SUIA 2UYCA 2BH2A 1JG4A 2FYTA 4YUVA 5GIPE 2G1PA 5FA8A 3A7EA 1XCLA 2ONZA 2PT9A 3C3PA 3UJAA 3G8AA 4KW7A 3DXXA 3AXSA 3D2LA 5ICGA 3M6WA 5K0BA 1EJ6A 3G89A 4FP9A 3GJYA 2V7EA 4FGZA 3SM3A 7MHTA 3NVKI 5LSAA 3O4FA 1SQFA
chains in the Genus database with same CATH superfamily
1CRWG 4QBKA 3I5YA 1AD2A 2QWXA 4R81A 3CZQA 1DBSA 4UBNA 2XBUA 2R8EA 3W2GA 4TYNA 1CPYA 5DTRA 1JB1A 3ETDA 3PG5A 5AVYA 4BX2A 4G0VA 3TZ6A 1NUAA 1YVDA 2Y05A 1XD8A 2W90A 3E9ZA 1E0JA 1E3JA 2VAMA 3QG5A 1DMRA 3Q3HA 3T5BA 4BWFB 3MMPA 3HXOA 1V6CA 1DU4A 5KAMA 1R6UA 1D07A 1PR1A 3IA7A 3ZQ4A 2ADFA 1OU0A 3PC7A 5FUXA 1HOTA 1Y81A 1IAVA 1M8PA 3P0RA 1WSAA 1FVFA 3ULKA 4ND1A 5EE5B 4EZIA 4MDYA 2EF0A 3HDQA 3KVYA 4JVMA 1IG0A 2QE7A 5BPFA 4ZVTA 4EUSA 4QVIA 4FT2A 5I6DA 4FYWA 4DMKA 1DADA 2PUVA 1HZZA 3PQ8A 1UZAA 3UGQA 1V8OA 3EA4A 3MB5A 1VZ2A 4WH0A 4HATA 1H6BA 2ID8A 4FFSA 3LUGA 2GPWA 5EMNA 1D9ZA 2HEGA 2EKBA 2WPDA 4TV9A 1ZR2A 1NBAA 1PGPA 3AF2A 3O91A 1YBFA 2WJIA 3ZZUA 1U6KA 1QOPB 4A8JA 1GNPA 2O8FB 3LHKA 1Z63A 5WRFA 3UFXB 2CXTA 4G09A 3EVGA 3O8DA 3LO8A 4DR7B 3V6CA 3BQ9A 4H27A 4BNYA 2PUJA 2PTGA 2VUIB 4RW0A 2HH9A 1E2IA 1SMKA 4Y0VA 3SKVA 1WX1A 5MDHA 2O5CA 4TRRA 1UEIA 1JIVA 1O9HA 1VB5A 1XJQA 1ZX1A 4G07A 2AUXA 1CS0B 3IVXA 3SYLA 5IW8A 1PW7A 4Y9DA 3RI3A 3M5WA 1IMOA 1WOMA 4GR4A 1OXTA 5C80A 2Z95A 3WLEA 5KOYA 3P5WA 4DBLE 1Q7EA 1ZSNA 4E5MA 1S8FA 1SQ5A 1VHTA 2JFYA 3AI1A 1AKRA 3SSNA 1Z35A 1NONA 3U3ZA 2RK3A 2PUFA 3UEOA 1TZMA 2EHDA 2WVJA 4L2IB 4KGDA 3PLNA 3ICEA 4QBBA 5DLYA 2NO4A 4FCVA 1ODSA 1W29A 3CMCO 1YVEI 2DCAA 4Q1BA 3O03A 3TNJA 5DE3A 4YXWD 4PE5B 3KK0A 5HJ5A 4LXGA 1ZU5A 2B2NA 3EDMA 2OWEA 3OQPA 3OFND 3G9XA 3EA5A 3FZEA 3P97A 2J1LA 1YK0A 4YJGB 2OFWA 3O73A 1G59A 4TYYA 4ZEXA 1KRHA 1PTJC 2GBCA 4FMCB 5A5GA 1DC8A 2QB5A 5A2QA 2HREA 1E9CA 1T9HA 2XCRB 2IE8A 1NBWB 4RWZA 3SC2B 1U63A 4BQEA 4JKOA 3EJ6A 1F2TA 2PYZA 2V5AA 3L7DA 3U7JA 1CERA 1DBQA 3ESBA 5ALSA 3HCEA 3TL3A 2OR3A 1HNZB 5BQPA 1E0KA 1PQPA 5COAA 1NXTA 2G67A 2JLVA 1AJEA 3A6JA 5DYWA 4A1FA 1R0ZA 2H17A 2OAQ1 4F8YA 1CD5A 4JUAA 3NB0A 1KF0A 2ZR9A 2FJUA 4TS3A 3JD3A 1J1UA 5BNIA 1AA6A 4DMFA 1STFE 4LC9A 3CLHA 5E2IA 4BGIA 1B26A 1HLFA 1R0XA 3GGDA 4JJEA 2AC2A 2HUPA 1GP2A 1SH7A 4PC7A 4Q7JB 2HD4A 3CU5A 2EBFX 5IC6A 1M2HA 3U3DA 3KQNA 5AKGA 1WPGA 1DBPA 2I1VB 2H4HA 2VN8A 4HWYA 1R5JA 4MVJA 3D5TA 2JVKA 4DDKA 3MMXA 1NLYA 1ZGHA 4G0NA 5CVEA 4CN9A 4DNQA 2Z5FA 3OUZA 5FV4A 1GPNA 1TA4A 4Y3UA 1JPJA 2OGUA 2BOVA 1YTLA 2JI7A 5K4AA 5JJBA 1YT7A 3NTVA 1TNDA 2LIVA 3C6KA 4JXKA 4CQLB 3KRTA 2QG9A 4O63O 1JEQA 4P6VF 1CK4A 5JQGF 2D2EA 1Y9AA 2NZVG 5ELXA 1CF4A 1NX9A 2Q3HA 1AE1A 3VV3A 1LCIA 2C5EA 1R6DA 1TC2A 3LT1A 3QWBA 4MUJA 2GXSA 2I55A 2CNWD 2QTGA 3FUWA 2ZIVB 1UWKA 3FB1A 2NW6A 4NESA 4F11A 4QODA 3WDLA 3N58A 1GN9A 4AJHA 1CB7A 1M2JA 1B0UA 2ERYA 1K8ZB 1Y7LA 3CW9A 3ORSA 4GOKA 4H9GA 2OHXA 2QAJA 4IMJB 4L8GA 2XUJA 4LRUA 5AI5A 3MHSA 1GPLA 2AQIA 3KJGA 3Q87B 4HFNA 1IBSA 3LD9A 4D9IA 4ZAGA 4IEEA 2B35A 5BSEA 3OLWA 2IYVA 1FDSA 1IM2A 5EP4A 5AW9A 1V9CA 3GG2A 4X64B 4DWWA 4ZVKA 4I8XA 3TUJC 5DLEA 4KWCA 3A06A 3WRXA 3B7WA 1Q14A 1PX0A 1WABA 3COYA 2R7AA 2EWWA 1AXRA 1V9SA 1CZUA 2OLKA 2OHIA 2XVZA 3CE6A 2QMEA 3PKJA 4YJDA 4Z9XA 4NP6A 1AGPA 1N2CA 1S8AA 2A92A 3A4TA 4I5FA 3S2SA 4JJ6A 1TTHA 4L8VA 4BNJA 3ZLTA 4ZAWA 2ON6A 3HBJA 4CM9D 1D7OA 1VIMA 4JI1B 2ZR0A 3S6JA 1YS6A 3M4NA 3DMPA 3TDMA 5JH7F 2AYNA 2MINA 3OO0A 3BXOA 4U7HA 4J1TA 4QPCA 1RWQA 1U7OA 4G84A 1XMVA 3HYTA 3U0VA 2R6NA 3T7AA 4NECA 4OQLA 1IIBA 2F17A 1IHYA 2IYNA 4OQMA 1J8DA 3FA2A 4YQFA 1AQNA 4GZ3A 1DTWA 3JRNA 3KD3A 3S2GA 1RQNA 2WMDA 2FFRA 3P52A 4S04A 2YWFA 2WQZA 2FG5A 2JJ8A 1SC3A 1YQDA 2W11A 1ID1A 2XCIA 2Y0DA 3AP1A 1Q2XA 3G0GA 1G16A 2XE4A 2Z4SA 4JLJA 4O2LA 5ALRA 3W6UA 4EMUA 4NJMA 3QY9A 2CV0A 3AKZA 1OWNA 3DMHA 2XYRA 3E4DA 3OTGA 4JA2A 3WL6A 4KSCA 4BLSA 4EJFA 3CF6R 2MHCA 2DJ5A 3GFGA 4KDEA 3NAMA 3S3QA 2NXJA 4C0KA 1TCBA 1M2GA 3L4KA 5CFPA 5DTJA 3GFQA 1F8YA 3LXRA 1OXUA 3UJHA 2FTDA 3JYOA 4EZBA 4B6PA 2JGAA 1T4CB 1Y3CE 1X7HA 3F6PA 4XYGA 2JJ2A 3QXCA 5EWLB 3MGBA 4ENTA 1S4VA 5KSOA 2AJTA 4G54A 2VJMB 3AUUA 1GGEA 4QREA 2ID4A 4P53A 4QEZA 2PWAA 4N41A 5KEIA 4L5JA 2JLBA 3GLVA 2V6GA 4ZVUA 1UBOS 4RD1A 3OZIA 1GU1A 5K8JB 1Q91A 3O31A 2KWIA 4CNBA 1MQSA 2ZWVA 2NM0A 3LQKA 4ZV4A 1O89A 1QCDA 4X44A 4B75A 2DGDA 4MKXA 4MV8A 3W9UA 2GR9A 4HNAA 1MQ9A 1VPTA 1G6KA 1RE1A 5KX5B 2QJWA 3KLOA 3FDFA 3CCCA 2O2IA 1JUDA 4MPTA 3CTMA 5E7MA 4UDNA 3GA7A 4MW0A 4WZAE 3VPXA 1YBHA 3D4IA 1MAWA 3E18A 1GEGA 2Y1XA 5EZSA 1L5SA 3DWEX 5D6OA 3L6OO 3UMRA 2QVLA 3LGAA 4HVAA 4G2TA 1GQOA 1U0NA 1E0SA 4BU0A 2AGVA 421PA 5C8YB 3NHFA 5AI4A 4HTFA 1HYGA 3BIOA 2QZ4A 3JRWA 1U99A 1UBUS 1CP2A 4RH3A 4FFLA 4GVLA 3TXYA 3OU6A 4V0NA 3BN3A 2YRWA 3D6JA 1ZL2A 4CIAA 3CLRC 1MU0A 2WKPA 3DWFA 4P32A 1BKYA 2J0UA 3L1KA 1DOZA 4R1OA 4TLBA 5KSPA 3B5IA 1BOFA 4XEUA 1XDWA 2FEAA 4KR7A 1X7YB 1R0KA 2GKGA 2PWBA 3BIWA 3H8WA 1PK8A 4DMLA 5H02A 3AF3A 3UPUA 5IN4A 5IX8A 1XMOB 5PADA 4URVR 3BWDD 3QVMA 4MW2A 4WECA 4JQZA 2WAMA 1M1YA 5G40A 2WFAA 3IBYA 2EGHA 4BZXA 3GDOA 2J9FB 5K3DA 2VXOA 2J31A 5CCBA 5ABPA 4QXPA 5EP3A 1LEHA 1TOAA 3R09A 1E3LA 1L2TA 1RWWA 2X23A 3A1CA 2BKAA 3EWIA 3IE1A 4TYPA 5KI6A 2EQBA 4O4JB 2VPWA 4PGGA 4B8YA 5HRAA 5I7FA 2RGRA 3IOYA 1CS8A 1K7EB 4DUGA 1TO6A 2V8OA 2C88A 1MDBA 2VAVA 4P7GA 1NDHA 1Z7EA 5LR6A 2VA9A 4ND8A 1U0GA 3MJHA 1SXQA 3ETLA 3HZRA 4KLNA 2V96A 4DV4B 4UNQA 4GZ6A 5DI9A 4ZD6A 1KU6A 3REQB 1M8FA 1T0IA 2R65A 3ZZNA 5AUOB 2C7BA 1S2LA 1EB9A 1Y0BA 3MT0A 4UXJA 2WINI 4QTYA 2G82A 2W43A 2VAPA 5LB2A 3HXMA 1TM3E 4LYGA 3LA8A 3T3EA 3QLTA 1NC3A 4KIGA 1A8QA 1OB5A 1N8SA 1YZFA 2VA8A 4V2IA 3EZYA 3OOEA 4RCZA 1A69A 1M66A 2FN8A 1Z9BA 2I7CA 3H3FA 4HMQA 4IIJF 5T8KC 4CT0A 1WMAA 3BJMA 4RJLA 4YWHA 3RGGA 3L18A 1XFDA 2WVHA 4OU5A 4GI3A 4N7MA 2EW1A 2PZLA 4XWTA 5IDXA 5KHLB 5IS2A 3VYTB 1I3OA 3OF8A 2J0QA 5ALJA 4INAA 1KY5A 3U7IA 3M83A 1AF4A 1FUUA 2P11A 1KI7A 4BNDA 1PZHA 1E6WA 4LC0A 3FCCA 2BR5A 3B20A 1YVBA 3GFTA 3DJYA 1HT2E 3VPGA 5DOVA 4URUR 2PJRA 2X14A 3VU3A 2MR6A 2CC2A 2EBWA 3JWPA 4X41A 4K6CA 1A9QA 3WQHA 2HWWA 1HE1C 3DSRA 3O9MA 4RJJA 3A2LA 2J9YB 2CJPA 1VG1A 1FFSA 4IIBA 4RVNA 3VKGA 2R86A 3E8MA 4IQ8A 4QRDA 5ALOA 1F29A 4CT4B 1N4DA 2FR8A 4L95C 4HH3C 4NNPA 3H42B 2DWUA 2H07A 4MTCA 1B3BA 4BAUA 3B36A 2MSDB 2YL2A 4URHA 2XWSA 2C04A 4RKYA 2G0TA 5BWLA 1UBSB 3VVCA 1RXVA 1N7GA 5I4BA 2EW8A 1USWA 2GESA 3HRHA 4TKZA 4V0RA 2DQKA 5JAMA 1TAQA 2AXQA 4KFCA 5REQA 1P2BA 3O8RA 3QFFA 2B6NA 3SC4A 1XYYA 3GXBA 1DGQA 3OBIA 3U4QA 3NDIA 2UU9B 3LSYA 2H1CA 3B70A 5FNVF 5A0FA 1O6GA 2FEOA 3R7WB 4B7XA 2WHYA 2DFLA 2AWNA 4A9AA 5F35A 3WHKA 4DCSA 5FLXA 2JASA 2FDRA 1RPNA 3EZNA 4R1PA 5AW0A 2IBIA 1T43A 3WAJA 1FU7A 2P9FA 2ZYDA 1QS0B 2ZSDA 1R50A 5JU6A 1SIOA 4HLQB 5F98A 1TJ5A 3OJFA 2FOLA 4MVJP 5H83A 4DYDA 4YCCA 4MCHA 1JTEA 1U3VA 4R01A 4UVHA 2G80A 2PMBA 2VP0A 3HKBB 3IAAA 1PFQA 3DMDA 1KJYA 3K1YA 1XEXA 2ONKA 4HFRA 3SIXA 1XALA 5AJVB 1GA4A 1GCIA 4CMAA 3UJ7A 2WJZB 4G25A 3TSOA 4E08A 3D0QA 1A88A 2CMHA 1QONA 2A6PA 1YGPA 3P2EA 1KORA 1R6XA 1U02A 3SC6A 2W71A 3P8ZA 4GW3A 4JL8A 4ECAA 2E55A 1B4DA 4FR0A 3RYCA 1JSCA 3KQQA 3PGKA 4GYYA 1E61A 4XDZA 2PUCA 2X9NA 1IE3A 2IHYA 4Q7QA 2X8BA 5F9MA 1SU8A 1HZJA 3COSA 5TQ0A 4AUMA 4CF3A 1QP0A 4ODIA 3CUKA 4PC2A 4BO4A 3QSGA 2H8GA 3O75A 3EIHA 2PPLA 4DR2B 3H5VA 2QUZA 2FHPA 5EE1A 2XWPA 3CN9A 2ZXFA 3OCVA 4YACA 1MO6A 4YMWA 2QJFA 4HDQB 1RRKA 2JHAA 4MWTA 3KPYA 4LF6B 2DVMA 3GLIE 1KP3A 2VYQA 3IHLA 4GLOA 1ISIA 1CUZA 2O4CA 5J4YA 3F5FA 3RU3A 3PQEA 2TSYB 2WFMA 2GN4A 3S2IA 2WMNB 4R9VA 4XVHA 3T7KA 1NOKA 3VA7A 4CIVA 2Y0BA 1SHZA 3VZCA 1NZDA 1VCIA 4LDRA 3SFTA 2XT9A 1ZVQA 1QMGA 4CUKA 4DLWA 2ZIFA 3CUWA 3NW9A 1YZVA 2P62A 3NUQA 4U4AA 3U4AA 5M5BA 2HR1A 3ZXUB 1WF3A 3HY6A 3WGJA 1Z5VA 4I8IA 1SPXA 2IS1A 3GLHB 2O59A 4AP5A 1SHKA 1NG1A 1TX4B 2MYTA 1Z7YA 4RAOA 2JB9A 2CL7X 4BTEA 4N7JA 4DILA 1O6FA 5EKTA 2Z2IA 3O9VA 4E2FA 2VQDA 3F75A 5H68A 4G0MA 1NJ8A 2VJPA 5K8LA 3VZBA 1J56A 1LJUA 5CEJA 3BERA 1TI7A 3C6QA 3RRXA 4AKEA 3WXMA 5BNFA 3K53A 4DLTA 4YUWA 2ZU6A 2C57A 1TCCA 1K8QA 2GTHA 2OQRA 4ENQA 1GYRA 1RRMA 2P1ZA 3OMLA 3WNVA 3UK7A 1VGQA 2H6EA 2H54A 3O8CA 3E5MA 2IBSA 1PNOA 4ZQGA 2FUEA 2L0XA 2B36A 2EOAA 1QYRA 3DM9B 3DMYA 3MILA 4UM9D 1CR2A 2JFWA 3H2JA 3ZWXA 4ON9A 4NEGA 2WPNA 5BRJA 1TQHA 4MYSA 3ZLBA 4D6XA 2CV2A 3W5BA 1IAQA 2AA3A 2RHHA 2VQFB 2AHOA 3PCTA 5T3YA 4ND6A 1P77A 1GQYA 2JHCA 2IYRA 3GDGA 3WO0A 3C3XA 3LG2A 1GLOA 2VJOA 3MEQA 1SQSA 3JX9A 5H59A 4Q12A 4B5KA 2GVZC 3WYGA 2IIVA 4AJIA 3IDSA 3LLUA 2H16A 7MDHA 5TXGA 1CUWA 1VIAA 5DYTA 4BFWA 1KSHA 1Z68A 4WIAA 2CLHB 4FQ5A 4FZ3A 3OG9A 3JALB 1SKMA 1J23A 1N9GB 4NAUA 1AGRA 3MXTA 1GRCA 1QGYA 1IJFA 1VHLA 2H2IA 2W2PA 1ZXBA 4B2LA 1D04A 1SCIA 4K9KA 2HRZA 4ZCPA 2L69A 3PW3A 4N76A 3RH0A 5JJLA 1IATA 1K2WA 1PR2A 3ILHA 1H8HA 4WUTA 5BSWA 4L0MA 5CDFA 3V4VB 1EG7A 1QR2A 3HUFA 3SYMA 3FMFA 1OLUA 2G3YA 4ACAA 5D87A 5JH3A 1GGNA 1ZMXA 4ZVRA 2VEDA 2VZEA 4O4HF 4F93B 4WA8A 1T8RA 3I64A 3ITKA 1GTL1 1MIRA 3RHSA 2ZREA 1TLTA 3QEMB 1U3UA 3GJ6A 2ZOSA 1JI0A 1XZ8A 2HMTA 3FVRA 5MGBA 1L7EA 2IZ6A 5BN5A 3HM2A 4EPRA 2KI5A 4POOA 5MGNA 3U16A 2DZYA 2LUOA 2OZPA 3MBIA 1Y8AA 4YAEA 5DSXA 3WBKA 3AEUA 2OULA 2F3RA 4MRMA 2I54A 2IEBA 4NL4H 3RS7A 4ZO4A 1G291 2WWFA 2FHSA 4EGCB 1KEKA 4F5DA 3INNA 4J49A 4DNOA 4QU9A 2OVFA 4OREX 2CB5A 3JZDA 5KQGA 1FBNA 1GV0A 2QI9F 4DLBA 3KHSA 4D7AA 4IINA 1G5PA 1E3WA 3DFUA 5KZMB 3JQBA 3J81A 2R9OA 4C6SA 3HP7A 4OX9Y 1ODTC 1EP1B 1V3QE 2D0OB 2FTKE 1NYRA 2VZ0A 2X4LA 3I9NA 4HYTA 4R5MA 5IP5A 4CT5A 1EIZA 3ITNA 3S2ZA 3V3KA 1PDVA 1M1NA 4QPJC 4E5PA 3KSAC 4BNTA 1SCDA 1J0DA 2PLAA 1NQAO 1O96B 5HRUA 5ALVA 3ZC3A 2WSSD 1L7AA 4JQOA 5BXQC 1PEAA 1G5IA 2EXXA 2QZZA 4L9AA 3K6SA 1X1BA 3R74A 3PJFA 2Z8XA 5CB8A 3RT9A 4TQAA 3F98A 2Q6OA 1BDJA 1ODKA 2ZS8A 3KR9A 4P4GA 1E2PA 1Q74A 2AEMA 5CGQB 4BNNA 1PK7A 1X1TA 4Q01A 4W4UA 1Q92A 1TB4A 5I7HA 4Z3KA 2ATXA 2B4QA 2NU8A 3BC1A 4UPDA 1HBJA 3SOZA 3WXEA 2RHBA 3G8CA 1E6KA 4M2LA 3DLBA 3BMQA 2AKEA 1MG5A 1N77A 2GN6A 2NSHA 3TTSA 5I51A 3VR3A 4JBLA 1S4QA 3V00A 4NK5A 4PO9A 1E3QA 3DMGA 5DBGA 4D79A 4YV0A 2WNIA 4HGPA 2WE7A 1NNSA 4I19A 5SYNA 2DEUA 2R9NA 2NXWA 1AS0A 4KWTA 4C5CA 4KN5A 1Q7RA 1X2EA 3RTGA 1GY8A 4QGSA 5GPBA 4DC9A 1IOZA 1FYDA 3TQQA 2ODEA 2XKAA 2OBNA 1KVQA 2WLSA 3QWHA 4XVRA 1KJWA 3N3AC 4D0NA 1FXWA 1GLGA 2J48A 2ZIWB 1NVVR 2REQB 4G3XA 1CUVA 1T8WA 3KLMX 3O1HB 5ADHA 1L7PA 1MB3A 4FYKA 4GOXA 4ZT5A 4Z0NA 3WL5A 2VHJA 1ODCA 2QL9A 2ZBVA 4CKBA 3G7SA 1ZGZA 5BYKA 4X00A 1D6NA 4GX0A 1U0HC 3A3YA 1KJNA 3VR2D 4O8ZA 5ICSA 5JYDA 4PV7A 3EXFB 3SLKA 3WKEA 2A4MA 2VL7A 4G89A 1IK6A 2XGGA 3ICWA 2JBAB 2D5LA 4JX8A 4JH0A 3I52A 3AVQA 5LP6C 2VQ6A 2EEPA 2O4UX 3N8HA 4WACA 1QRAA 1VSTA 1ATZA 2NXCA 3AL2A 3EGDA 3KPUA 1ODLA 4WVFA 4X7MA 1AH2A 4KWIA 3LSTA 4UBKA 1Z6ZA 4AMBA 1X1QA 1K3BB 4G1EB 4PG8A 3ZD8A 3TOCA 1I01A 2DQYA 2FWIA 2P4UA 1GCUA 2NTNA 4FJ0A 5IK2A 1KO1A 1WP4A 2A1IA 3BE8A 3C1TA 4GBJA 4ZO8A 3TQOA 2B94A 2X2PA 3OJEA 1F5SA 3QTTA 1RHKA 4HWKA 5HMMA 5KVQA 4HVLA 4QUAA 1D0SA 4BNZA 4OP2A 5B58C 4XM2A 3CYFA 5ENVA 3L2OB 5TT0A 2PX8A 5KNLA 2YV2A 3QE0A 4TWJA 3JS5A 3SGLA 3DL0A 3W05A 1EQUA 3UC5A 1P0CA 2DKNA 4JLBA 4B74A 1JHMA 3UMMA 3OY2A 4RFLA 3V8VA 4TZKA 1ADGA 4D0GA 1GVNB 3IT3A 3UJ9A 4KGXA 1KZYC 5EZ5A 1Y8ZA 2CDBA 3QWFA 2Q5EA 3L6RA 4MV5A 3ZWMA 1Y8QB 4MVYA 3Q7SA 4NOMA 5AJYA 5I01A 1U9VA 2OK7A 3R23A 1OVGA 2HB6A 3SOPA 3SYTA 1OBCA 2GA8A 4YYSA 1MGOA 5JRJA 1P4RA 2ZJ8A 3OE4A 1IY9A 4LXYA 5JRZA 1R37A 1U04A 3GVHA 1X3LA 1UXGA 2CCKA 4ZU1X 3OQJA 2FCAA 3GG9A 2H2HA 2EKLA 3OPYI 4DAOA 2R5FA 2XSZD 4JY7A 1RPZA 2WWYA 2FP3A 3T7EA 2GM4A 1YMUA 2PUWA 3OOWA 4WKOA 3VPSA 1R0WA 4LTNA 2QAGA 3QLJA 3VU8A 3ZYCA 4A5SA 1L1QA 5IKXA 1SAYA 1V47A 1YTUA 3K1AB 2X0FA 2Z8YA 3AINA 4TWRA 1FMLA 2V0NA 4OLHA 2EDCA 2XV1A 3QFCA 5JLJA 4M8SA 1E1RD 2A88A 1FQWA 1E9AA 2C0CA 3Q9NA 4AYTA 4HCJA 5A4AA 1VPLA 2ZAOA 3OC6A 1X3SA 2P7HA 4ZT7A 1UOQA 2FW1A 3KUXA 5EFZA 4OHFA 4CV0A 1R10A 3QTBA 3AW8A 4RMNA 3NZEA 3CRVA 4I1OA 4U2EA 3LKVA 3K09A 3QLVA 4HDKB 3N6VA 4X9XA 4F1JA 1ZN8A 2XHZA 2QW0X 2F7SA 3Q9SA 4BJ5A 4OKSA 3CB4A 2Q5LA 4IO1A 2KM1A 5DBFA 5ECDA 3ZGNA 4BC0A 1V26A 1B6GA 1DQYA 2HF8A 4YI3A 1P5HA 1D2HA 1I0LA 3AWDA 4N7BA 5CR9A 3UAXA 2PRYA 3ZNHA 2ORYA 2XCOA 4LJYA 1KMCA 1P1BA 2JNWA 4YFVA 2HRBA 3EWNA 1FSZA 3HACA 1MJHA 4QQNA 5LYYA 5TS2A 4DY6A 5B7QA 5AKIA 2ZM6B 4OUDB 2M2IA 4M22A 4RK1A 4ZV9A 3LTEA 4MA5A 5DRYA 2VHFA 2YNMA 3HBAA 4CTMA 3KYCB 4XAQA 2QJRA 4NXMB 2E02A 2PNSA 3N9IA 1O6CA 4YJ3F 4UPEA 1NMSA 2V6BA 1PV1A 2JF0A 4XQCA 5LL6P 2ACEA 4GVPA 4X8HA 4ZAFA 1DAOA 4IO0A 1UK9A 4NFYA 3IELA 3RJ5A 2I9PA 2ICAA 2JCGA 4DPMA 4Y7DA 5CLFA 1B3RA 2HK8A 5HUHA 5JJKA 4QATA 3QSDA 3WLQA 3VISA 4URFA 5FYDA 5E8JA 2ZJ0A 3A3NA 1HSZA 2IOQA 3KD2A 3FTNA 5AI9A 4MS3A 2XMPA 5HUQA 2W2LA 1I2CA 1W4RA 1BHO1 3N4CA 4WFKA 1WU7A 4RF0A 2QK4A 2C7OA 2Z56A 4R3NA 4X93A 3QELA 4JR1A 3BKWA 1G8FA 1NL3A 1T8TA 2XOXA 3PQ3A 5GV8A 3TK1A 1EVZA 2WKQA 5LIPA 3L1VA 5A4KA 4KDCA 5EZYA 2GZDA 5IUNC 2R4QA 4MYCA 2X0RA 3N59A 4EHBA 1S1CA 2H48A 1KK3A 4LYFA 1VPVA 2I71A 3EXHA 4ZYWA 3IGFA 1ADBA 1E7QA 1LBIA 3T5MA 4QU8A 2P86A 4L85A 4WFJA 2ATCA 3TIVA 4BE4A 1JDSA 2FG7C 4HSGA 5T67A 1QYWA 4RM2A 3SNHA 2FF7A 4NFSA 5KNBH 2VH5R 2ZBFA 3DKVA 4BO8A 3TTYA 1PNRA 3ND5A 5DCWA 1NQXA 3AVTA 3H4MA 3F78A 1ECLA 1R5BA 3PRKE 4G37A 1YI1A 4BNUA 1PZNA 3JARB 5CA1A 1FRZA 3PVZA 1NXOA 1XKLA 2G72A 3SZGA 3DOUA 4YMVA 1MTZA 5JUWA 1KWGA 4N8WA 1OV4A 3AETA 3TNXA 3PHIA 1E1QD 4Q4JA 5BSRA 4DJDC 1Y1LA 2QUAA 3EPKA 4DSOA 3RQSA 2Y8EA 4I66A 3R7LA 2IWRA 3P9SA 3RJTA 3ZWAA 4EJ6A 2GWHA 2F8TA 1YQEA 2BAGA 3NH9A 2VT3A 4WKGA 5TJ9A 4A8JC 4CEHB 3SU8A 4HZUA 1PP4A 1G7CA 1JL3A 1JHYA 5K8TA 5DRTA 2ZJ2A 4P4TA 1P5JA 2XUKA 1UC4B 4UZEA 2C5HA 4B09A 5G4LA 2N47A 4Z7OB 4PQEA 4FILA 3FF4A 1GL6A 3RTCA 2G83A 2XAUA 2E4WA 4ZCTA 1VLJA 4DGQA 1M1ZA 4YBZA 3FYSA 3OP4A 4FBGA 3ZNPA 1AKNA 4XM1A 1FYXA 1GNVA 2ILTA 1HG1A 1VG9B 4ZIRB 2KW5A 4OFWA 4IG9A 1ECGA 4AY3A 1DV1A 5KBYA 1SUBA 2KBEA 2RHTA 1X1CA 1Z0JA 3EPPA 2FPOA 3G8YA 2H4XA 4JEUA 4JBXA 4P4SA 1UZMA 1E1YA 3RQIA 2ID7A 4P0PB 3SQMA 4QLOA 2HFJA 4N0QA 1N0WA 3ZZ1A 3KKZA 4CUJA 1JAIA 4RVGA 3X1YA 1BU8A 3KUUA 1D5WA 3TAHA 3QEJA 1M6HA 4GRDA 4PG6A 4JI2B 1A3CA 2FRXA 2PZAA 3IHKA 4HQFA 3QENA 1N1EA 2FMFA 5EE3A 5EXDA 1E9EA 1CT9A 2IITA 3NTRA 4I3GA 4UHKA 4DWVA 4RZQA 3IDQA 3OZAA 2RDMA 3W4JA 3PLAE 2ZYHA 4PYRA 4X84A 4UC0A 4QO8A 2DBRA 4JI5B 1TVMA 5IYZF 5ED0A 4CTJA 2A8YA 5L3VA 3BGVA 1XAJA 2JD1A 5EP1A 4JYBA 2DSTA 4GMHA 3WOVA 3T5AA 1SOAA 2X8LA 5ESWA 1YB5A 1BTOA 3VH2A 4BP8A 1WG8A 2FN9A 5CAEA 5IJ9B 3BXEA 5GGXA 1IWBB 2HNKA 3E58A 4GXQA 1YA8A 5MN4A 3SS7X 3O2QB 2KLHA 3W7AA 3PXXA 4PAGA 1M3SA 3N5KA 4CTNA 5HS6A 3B6MA 4B43A 3ZDBA 1UDWA 1Z3CA 3WWZA 1PNTA 3EQ2A 4PLZA 2A3NA 2H29A 3K4HA 4L5CA 1VJVA 1QHFA 1RJEA 4JL6A 3TSWA 2HEIA 3NX4A 4HWPA 4BJ6A 4BMXA 4QJ5A 2AK3A 1KPGA 4R7TA 1BQIA 4ERNA 2DRIA 1DEAA 2KHZA 4A6DA 1Y4HA 6CHYA 1BX3A 1NY6A 1X6VA 3WX0A 4Q3EA 3N2EA 2GNPA 4RETA 1Y89A 3MIZA 2UXCB 3CX8A 1RADA 4BCDA 1KVTA 4AX8A 3FSJX 1EZ4A 1P5FA 1XJ0A 2ZP1A 3HJUA 4PG7A 4J0EA 3OZ7A 4LOLA 3F3MA 2CMGA 2B9VA 4PSKA 3O4JA 2J41A 4GWGA 1EFAA 1DUIA 1JLLB 3TEMA 2P9BA 3WHPA 3L8HA 4I4NA 1CRPA 3BBAA 3C9EA 3VU9B 1WPRA 1ZFNA 4DLPA 1J9EA 4YJFA 5JY1A 3FCEA 3IPAA 2HO4A 4M89A 2OP1A 3GN1A 5EY5B 5HIIA 9LDTA 4H3VA 2AEEA 4FNOA 5G0TA 3WRYA 5TMPA 2A5FA 4HAZA 2RHRA 4NBWA 3ZS9A 1A77A 3Q7IA 1TLFA 4DSAA 1F8UA 5FL3A 5C5IA 5FOXA 2J7QC 1W75A 3AEYA 2WK1A 3N3GA 2FQ9A 3IIIA 4F56A 4MGYR 1V2HE 4YCSA 1G98A 4BX9A 2KYRA 1CFZA 2IZOA 4NARA 5KTKA 2PFKA 3BTUA 3W5JA 2CCGA 4AWBA 2Q6KA 4CU2A 4R7GA 5C32A 3TZLA 5LQNA 1QTNA 5CNIA 1S3SA 5FV7A 2YJ5A 5CK5A 4LFBB 2CLFB 1U94A 2OBMA 1RQLA 1RE0A 1ZUNA 3Q7RA 4NS4A 1K4KA 1FRFS 2VYNA 2ISCA 1L9XA 3HEMA 2ZRDA 4DADA 3IIMA 4EKYA 1J6UA 3EVZA 3G1UA 2WIAA 5LNK1 1ZGJA 1EUCA 2DF8A 3ER6A 5IMBA 3TOVA 3VR4A 1G21E 3O8BA 3DL2A 3M1LA 1S8NA 4D3DA 1T5BA 4E2XA 4QLBA 2NV0A 2BM1A 1PT8A 2BE9A 3ZHXA 5AW2A 4BV2A 3PZRA 1XU9A 4WOJA 4F4JA 3L1IA 3U31A 3ASZA 3NM6B 2CXUA 3ANMA 4OL0A 2O3QA 3I73A 4P82A 1NHGA 4D81A 5L3QA 1Z5OA 4J1TC 4PY2A 3L0CA 2OENG 2Q1SA 3EXEA 4CKEB 1SXGA 4MULA 4ALKA 1YR1A 3CZ4A 3EZ6A 4A92A 4RD2A 1UKEA 2YBDA 3BWXA 4BLPA 4M3NA 1LDYA 4AY6A 3BMNB 3N8DA 1T2CA 4RGQA 4IIYA 1TXGA 5J63A 5CFQA 3T52A 1O97D 3JQ8A 3PHHA 3RIMA 1FBTA 3MCUA 4RBNA 3TLGB 5CFLA 3DOHA 4HLUA 5AVKA 3WKBA 1K1EA 1WJGA 4EHLA 5ES4B 2DHRA 2PCLA 2YJ9A 4OQDA 2JVJA 1Z6YA 3HHIA 3IMGA 3V6LA 1CUXA 1NA5A 2EVWX 4L7QA 5IUKC 2GCEA 1YRQA 1CQIB 3D64A 1OXVA 4MB0A 3JQPA 3M0EA 1H2HA 2DCUA 2GUGA 4O5AA 4R1SA 3TGLA 1CB5A 3KJZA 5FR2A 4GZLA 4IYJA 4F4HA 1V2GA 4F72A 2PO5A 3D1JA 2IA5A 1KI6A 1P2SA 4X54A 4CV3A 5E3HA 2ZDGA 1RFGE 3AIMA 3DEAA 2SKDA 4C4OA 4UHDA 2LBPA 1R0BA 1LLFA 4G1FA 5GJWC 5K3AA 4Z5XA 1H9CA 2GTPA 1HYBA 3A1SA 4IVRA 4P33A 2NO0A 4DQVA 2WJJA 2QOEA 3J81k 1O87A 4LCEA 3BWVA 1W6RA 3IAM6 1TYBE 2VZLA 3KZOA 3CR3C 2FUCA 2VTEA 3NHZA 1ZGAA 3W4IA 3WS7A 5JFTA 2C4KA 4DJTA 3FTCA 1NI4A 4RSGA 1Z73A 2NYUA 2QD5A 5H3LA 3ND8A 3F47A 3KZKA 4YAJA 3UOGA 2VDJA 3FYUB 3SS9X 4DNXA 1UP4A 4WURA 2IYFA 4IJMA 2LXNA 5H16A 3THSA 4EBFA 1HUCB 3OWOA 3QMPA 2B8TA 3QFTA 4IHJB 5GWXA 3WWEA 1SBCA 5KTYA 2PLNA 4BN0A 3GLSA 5KOJB 1Q2UA 1Y4DE 5IAOA 1L5RA 2O2CA 3AKEA 3GRVA 3JWHA 3E3AA 3CIFA 3TQIA 3HVJA 3GDWA 1Y9DA 4RCVA 4RS3A 5DISB 3TLCA 1ZD3A 3ZE2B 2AC7A 3DF0A 3BGWA 3B9RA 3GELA 4EHHA 4YTEA 1FSGA 5I7VA 4OLAA 1FFXA 2P4SA 4AP9A 4L02A 1F2AA 1AKVA 4FYXA 4UCWA 4DKJA 4BFUA 1A7JA 1OXXK 1Y4UA 2C4WA 2O20A 2CEKA 4IJUA 2P6UA 2QRVB 2W42A 4KXWA 5E6SB 4ZQCB 2PKRA 2X40A 1NN0A 3B60A 3OPXA 5FQNA 1GVHA 4QQRA 3IOBA 1TPZA 3B51X 4HAVA 3OTOB 5LMNB 2X0DA 3EDCA 3GR6A 3K16A 2QX6A 2Z6VA 1JB9A 3BUSA 1JJFA 3L01A 4ICIA 4IY1A 4NV0A 2XUFA 3HO1A 4G4SP 3ORYA 2IODA 1DIRA 3DQPA 4M0KA 4S2EA 4BYMA 3MAAC 4WKBA 1JMYA 1LLUA 3OZWA 5ALQA 4KYIB 4X1IA 4EG6A 2P3QA 1KFXL 2PRJA 3D6NB 1GL3A 1TMKA 2YFQA 3K15A 4H6VA 4OYRA 2D0IA 2IEYA 4C0AC 1B43A 1JVNA 3Q6NA 5CIYA 4R2KA 3PFGA 1O94A 2FW6A 4MWSA 4CUZA 2G8EA 3O0DA 1EHCA 2WNHA 2HQSA 3KT8A 3Q7EA 5FF9A 3HDYA 5JSUA 2NUTB 2ZTSA 3OX1A 2BM8A 5ITSA 4KE6A 1SELA 2GYVA 2EZ8A 1P2TA 2IXEA 1EFKA 1MT0A 4CF7A 1U2GA 1KC3A 5KWSA 4BNGA 3OX4A 2EATA 2V3VA 2NYVA 3L9WA 4DMXA 1IOVA 1YS7A 3EIWA 4N3NA 4HXYA 1SXIA 1XTQA 4QVGA 3IDFA 1DDIA 1W8IA 3PA8A 3GDFA 5EL0A 1XZGA 2YTZA 5G2OA 4D02A 1G5TA 3H8VA 2NVUA 2NQTA 5F3DA 4DCPA 4CIYA 2P77A 4YRFA 3STYA 3SS8A 2FFHA 2PKWA 2R0QC 1ILWA 4RHFA 5LWHA 5E1DA 3J7AC 3D2CA 3STHA 5IBQA 4OSPA 3I4FA 4LXQA 5F5NA 4KACA 1P5ZB 5J4KA 1ESNA 2AH5A 5EJ5A 3LBNA 5LDDC 4A15A 1T1IA 4A3SA 5E7QA 4A27A 5BWBA 4EP1A 1VSQA 2P2ZA 3ESZA 4WINA 1RAFA 2PKQO 2VJNA 3IVAA 4BBAA 1OH5A 3MYRA 4N47A 3E7PA 3ZDFA 1XVTA 1KZ4A 1N6NA 2AFIB 3L0YA 3OEHD 1JRLA 2ORVA 5JSFA 1JHPA 1N6OA 3ONDA 3C8MA 2CNNA 4KPUB 4NV3A 3W78A 4EJ2A 2JLWA 3B21A 2HPAA 3GO4A 4OSEA 1FJHA 3DEJA 5JSHA 3IQFA 4QBFA 4K9QA 2JLRA 1CJVC 4FDUA 5EXTA 5GONA 4F60A 2QM3A 2BGNA 4MQUA 3TMKA 1XVUA 4RK5A 4RIFA 3AUKA 5I9IA 3RADC 5FWDA 1EE2A 2J5RA 2VLIA 3UJCA 3ZJ4A 4IIHA 1DUVG 3DULA 1Z28A 4FUTA 5EKXA 1YKSA 3L0OA 1PVOA 1RYNA 2FR1A 3FPEA 4L9RA 3KCNA 1CQXA 4OK6A 3TQRA 4I5IA 5KKAA 4BE9A 3AHFA 2Z4TA 2I2CA 4KN6A 4PPNA 3ZY4A 4HNVA 1IZZA 1LWOA 1INLA 1GUZA 1ACJA 3NLLA 3IEIA 1ICIA 1BY8A 4GDMA 3K30A 4OHKA 2FWPA 3RSFA 2PADA 1KVUA 1HSOA 1V16A 2XVXA 1MT3A 3RR2A 5C9ZA 5PGMA 3S27A 1SXJA 3GJXC 3HL0A 4AJPA 3V32A 1AB6A 1F6BA 1AYVA 1QAOA 1WB6A 3AF6A 1KOJA 3R5FA 5TQJA 1LFDB 2CJXA 3ONNA 1L3CA 5E9AA 3ILSA 3LDAA 1SEPA 1LSOA 1UXJA 3NCHA 2JCVA 1DP4A 2R48A 3FKSD 3OUTA 3DKKA 5DIZA 2BGMA 4KAFA 1XPRA 4CZWA 4EVIA 1B73A 2PZKA 5AHWA 5LLTA 1S96A 4C14A 2X41A 4JBWA 4YP5A 3NMUF 4C06A 1NJGA 3EBPA 4EY8A 1I3NA 3HLTA 1UKBA 2FSSA 2HD5A 4E2ZA 1ZCBA 2VP2A 3JQ7B 3VYVA 3MIIA 1URPA 3OAAA 3SYRA 3Q12A 4S2UA 3W2HA 3LBAA 2HJWA 3QW2A 4MPRA 5J2TA 1EFTA 3U49A 1R7RA 3U9SA 2VP4A 3RSGA 4KVZA 3T5DA 1K9VF 1SZPA 5F2OA 1NDQA 1Z7WA 2O3UA 4LY6A 1J97A 2V7WA 3NJ4A 4IUDS 4EECA 3T1QA 1EZZA 5CFOA 2VTBA 1Q16A 3AU8A 2AI2A 3GK3A 3PUHA 3E4CA 1DXYA 2PA0A 3CPHA 4C05A 1F17A 2WAXA 5FPYA 4CZ2A 3ZBTA 4BQNA 5I4CA 3FDXA 4H6PA 4DCUA 5CHVA 2P40A 2CUZA 3DZCA 5C34B 4Z2YA 3AVVA 5H9VA 4KAXA 2QTNA 1TUBB 2YRFA 1J1IA 1ZG3A 3G17A 4EAAA 4XZXA 5DT2A 3MCZA 1FSFA 1PVJA 1T0BA 5CJJA 2Q6TA 2YW2A 2ZRNA 3IAEA 4B4OA 2GO7A 2PD3A 3N8GA 3PQ5A 4KR2A 3HG7A 1KEVA 2R60A 1II0A 4Q3AA 5A3RA 4YJ2B 1XN1A 5L4NA 3BD7A 1SVIA 2H00A 4XDGA 2YIJA 4UUMA 2O1SA 3F6BX 2WILA 3P9ZA 5CXSA 3I2HA 4OJQA 5T4EA 5IZCA 1XLUA 2GM9A 3R3HA 1Q1ZA 1D0VA 2E87A 4WBNA 4Z1OA 3AERA 3MJSA 4FN5A 3KYIB 3CNQS 1TAUA 3I42A 4OB6A 3UUWA 2UVDA 4AYXA 2B99A 3V7FA 3ZHCA 3T3DA 4IIVA 1SU6A 4PVDA 5B64A 1CE8B 1DAFA 1RXIA 2HA6A 2QU7A 1J2TA 3K0CC 5FXMA 1OF1A 2OHOA 3JR3A 4CL8A 1C0EA 1ZY2A 4GG1A 1M34A 4EJSB 2L18A 4MR9A 3IBGA 1RMTA 1C7JA 2I4IA 3L0SA 5JROA 5CVMA 1AZTA 3OT1A 2WIGA 4RD6A 3HVHA 1F7VA 4Y98A 1WXEA 3OICA 4C2UA 1R0YA 1UJ4A 1X13A 1DKUA 4F3CA 1VRCA 2Q3MA 4LF5B 1YK1A 3TLEA 2F62A 1UPAA 2AVNA 3U60B 1RRCA 4DQ0A 3TLAA 5L7TA 2G5PA 1FLAA 2HV8A 4HNRA 4IIDA 4QOJA 1Q1NA 4N8EA 4Q8HA 2SHKA 2X2FA 1UP7A 3FWHA 4II2A 5K0ZA 2I4OA 2Q2QA 2WV9A 5AKKA 4YRAA 4LVNA 4JUBA 4LRXA 1U8UA 1TAHA 1XC7A 4D80A 2WF8A 4RTPA 2J7PA 2DBYA 3U3OA 4ZYYA 1B6SA 2YVUA 3FCUB 5CCDA 4F5EA 3DPSA 2DBQA 2HU7A 3H65A 3ZV5A 4YCBA 2A1TR 4GXTA 3KLPX 5A3SA 1CZKA 3BPFA 3I6MA 5HQ3B 2JLYA 3HCAA 4P5PA 1SO8A 1CSEE 2GZ1A 2EIXA 2HM7A 3CWCA 3WYAA 3N6XA 3X44A 4F12A 5LZ4A 2H65A 4ZEOA 1C8KA 1VFNA 4K0KB 3HDHA 4OAPA 2AW3A 2IX3A 3IBFA 1FVHA 3LLMA 3KAKA 3DBLA 3Q3JB 4M37A 3K8ZA 3MCWA 5JPCA 2A30A 3ELDA 1C2TA 1K92A 1IXKA 4MQBA 4MS4A 4B6OA 2VHSA 3QWAA 2BCEA 4WSOA 3FMPB 1H1LA 4DA0A 1AU9A 4GPIB 3CRZA 4LX0A 3MK31 3KQLA 1AUPA 2ZULA 3IAUA 3OOJA 2EV9A 4J7CA 1A0OA 1G18A 3ZWPA 3WRWA 2FJ0A 1V1JA 3FNGA 3LW8A 1CZRA 3HUDA 3LZ6A 3RTBA 4TUYF 3TRIA 4EEXA 5CDSA 5A4DA 2H4YA 3KWLA 4YT4A 2R6GA 4Q4AA 1XZKA 3TBFA 5J3JA 2PNFA 5FAKA 3MMNA 3JAKA 2KE5A 4J3FA 1NRJB 3MERA 1JFFA 3AIKA 3UA4A 3CTPA 3IC5A 4KNWA 1JYFA 5IXSA 1RHRA 1AKTA 4MWEA 1C3VA 4QYXA 3R2JA 4OYHA 4HFJA 4UTZA 3OIGA 2E5FA 3CG4A 3G5TA 2FOXA 1UQUA 2HW8A 4RA6A 2D5AA 1GDHA 2YHIB 1DZIA 1NQVA 2QVXX 5AQEA 1HF3A 1JVSA 5EJ9A 1RC1A 4BGEA 4H35A 1RYFA 4DRYA 1U0BB 1HTWA 1O5IA 4JYCA 1VE6A 4JYPA 4LSWA 4U0KA 1YZ3A 3CIOA 3L4SO 4CJXA 4GZ5A 4ZAYA 2RHJA 2O07A 4NPAA 3ZCSA 4AFNA 2H1LA 4K7JA 1CEYA 1GT91 1PJCA 1O57A 1ZH2A 2YFHA 4J16C 4ARZA 4YR7A 5CURA 2GD2A 5GVRA 1R6VA 3L7BA 2DC9A 3H2IA 1VFPA 1Y5NA 4JOSA 4OXXA 1I2BA 2PBRA 4IOMA 1NFFA 2R9FA 4ZPJA 3TSCA 3G0IA 4B8WA 1SRQA 2OB1A 2XITA 3I8XA 3R44A 2H92A 3DZIA 1YI0A 4I4TB 4LV5B 4Q9JA 2MCFA 3STWA 1MQAA 2C1ZA 4ZT3A 1QFZA 2YXBA 2V3WA 3AR5A 2WHXA 2XKKA 4P81A 5JNRA 2GOYA 4PNZA 1NFRA 5SY6A 2P2NA 4EEKA 4ZV7A 3LBFA 1U5CA 3ZH2A 3HB9A 4BUJA 1C3JA 2CD7A 5AXAA 4JXJA 5CVUA 3GLFB 2WIFA 1YFJA 2IP2A 1OYOA 3MN1A 4BLVA 2G06A 1DQSA 1OZFA 1XTRA 2O2JA 3B2NA 3ISVA 3M6IA 4NZ9A 5EJFA 3S5UA 1FJXA 2E5LB 1NP7A 5HKLA 3S1LA 1E18A 3HFGA 3OZTA 2QEQA 5C1PA 2LW7A 4D3FA 4GOND 5IABA 3TFOA 4NBTA 4K2HA 2YYSA 1QFSA 4G5RA 1D6JA 1Z38A 4MWCA 4PZAA 2GXQA 1Z6GA 3EDYA 3R5HA 1QKJA 3FCXA 5DM60 3OPVA 2IGBA 3WHIA 5DX1A 3RBAA 1GITA 2TRSB 4AJ1A 2Z6UA 1Y1TA 3WGLA 4AQ7A 2OFOA 3N76A 5T6BA 1S6YA 1WNFA 5AK0A 3TAUA 1TKBA 3LM8A 5BV2P 1S2DA 4CR8A 4DSNA 1GRQA 4EHKA 1TZCA 4BEJA 4CQMA 3L5OA 4ARSA 4RKRA 5KU7A 4TYWA 2GHQA 2XA9A 3CEPB 2WRZA 1LJ8A 1FYVA 4G5GA 2W6ZA 3L6EA 1JDVA 1NXSA 1ZMBA 2H1OA 2HTEA 2Z9CA 1LC0A 1YFKA 3P9RA 4N18A 2IXDA 1R8JA 1H2RS 1TF2A 3D6SA 1NJ1A 4UE6A 4IIEA 4X24A 1KKLA 1PJLA 2WU0A 3GFRA 3TNLA 2IDJA 2J32A 5SZHB 4YYRA 1PHPA 1Z0SA 2NVBA 1K2VN 3B13B 4IGKA 4NX2A 4UU7A 1FQJA 3BBLA 4X92A 5D3ZA 3UC9A 2WTNA 3AQ4A 2ATEA 3OJCA 1SM4A 5EP2A 3UN1A 5ELLA 2JIZD 2MINB 2WWIA 3D7RA 4PLGA 2DTEA 4PLYA 1ZHHA 1JJAA 4Q1AA 3M5CA 5JQGA 1GDTA 1NBHA 3K24A 1ESDA 4PR3A 2AKYA 1NHWA 2WR8A 4O3MA 3ZHTA 4LZLA 3SK0A 3EGXA 4KODA 2O8EA 3D6VA 1E9FA 3BWMA 3E3MA 4JSTA 1JLHA 2GD0A 4NU6A 4KIWA 3X1WA 4CMIB 2Z6AA 1KYVA 4IH4A 1E7YA 3ZU5A 3UGTA 1XRNA 3R4VA 3Q0IA 3HYRA 4M46A 4IGFA 3HXTA 2Q4OA 4LVCA 1N5IA 5JG7A 4ZYZA 3DTVD 3O8OB 2ZTVA 3PF9A 1T3ZA 4ZCLA 1UEXC 2G9VA 3N07A 4X20B 2G4CA 3KHTA 3RFCA 4URXR 1PFUA 4CQJA 5K6RA 2CBXA 4KK4A 2IKSA 4JSRA 2X1HA 1W5BA 4UUNA 3EAGA 3W5HA 1BDHA 1QCCA 1HGXA 2QLMA 1W6UA 3GJYA 2H63A 2YS6A 4FGZA 4KLBA 3CLTD 3F5SA 1L4UA 3LOPA 1GFWA 1YC2A 2XMRA 3H0CA 3K7EA 4MCIA 1FFCA 2P67A 521PA 2JFXA 3NP9A 3GCXA 1CUGA 2Q9BA 2IEZA 2NIPA 2X19A 3AH8A 4PTYA 4Q3KA 5B53A 4F7WA 1IPEA 4LVOA 3S8EA 3EAFA 1BE6A 2O2ZA 4KLCA 4TS1A 5CHTA 4QYIA 3BMOB 1GPMA 3UK6A 2G63A 4HS9A 1LNZA 1F0PA 1XUOA 2XUGA 3DBHA 1ADJA 4K1LA 4Y6OA 4B3TB 3ZD6A 4IM7A 2QAGC 5JH7A 4M0WA 2F90A 3RVKA 1JDUA 3ZBQA 1JAXA 1WB9A 3IV2A 1SCJA 2GCGA 3LVFO 2FPIA 1SQ6A 2F00A 3BXGA 1G20B 3EVTA 3L0PA 4K9OA 4Q1EA 5DX0A 4Y1RA 2F59A 2FW7A 1UMDA 2AV6A 1T2NA 3LCJA 2G8JA 2QJOA 1KZ6A 1PTKA 1VPEA 3BE4A 3FG9A 1N2OA 3N2IA 1C3EA 1N3LA 1TEXA 3L0ZA 3V1NA 2WF7A 3HJBA 1SBZA 3A6ZA 4I4CA 5EC8A 1RYMA 3ZDZB 5M7EA 5EVJA 4PI3A 1RR6A 3QT4A 4KO2S 1BEUB 3G49A 3OPYA 3QLVC 1JJ7A 4FYMA 3L4BA 5TJHA 4DJAA 5JVDF 4RJ2A 1QXSA 4XX0B 3TYXA 1AUOA 2J3LA 4Z99A 4M76B 2DAPA 5BQFA 3E35A 1Q95A 3BICA 2AMVA 1HUQA 1SPBS 3ENVA 3L7OA 4DBVO 3JAWA 4CCYA 4MUKA 2BFFA 2H52A 4HTFB 4FJ1A 4ER5A 4QUKA 3I05A 3QVXA 5BSHA 4PHTA 1LW6E 1UDRA 4XGRA 2QZPA 2WTUA 4KLZA 3GAZA 2VDWA 4CDMA 5I7OA 1W59A 4BOQA 1TRHA 3DE1X 1QH9A 2YNMC 2BKUA 3VO2A 1M72A 4EO9A 2VTKA 3QBJA 3HVKA 4BB5A 4EHNA 3RFUA 4EUKA 3FVVA 2PQ6A 3WK7A 5CTAA 4F45A 3U3KA 5GZ3A 4OI0A 2IK8A 2PH1A 3GCZA 5JDCA 3QYAA 4Y9SA 4GKBA 3ES9A 2R7MA 5LA6F 2UZIR 4OYLA 1FYFA 2DXIA 2IXGA 2COUA 4EG0A 4L07A 2A1UA 4MEBA 3R3XA 3I9MA 5B6JA 2PV7A 4ECEA 2UZ3A 4Z54A 4GMXA 2FEMA 2EZUA 4Q7LA 4TT3D 4ZJYA 4ZDJA 4BV3A 4IIFA 4ND8B 4BS5A 2IYXA 2M1ZA 3EK2A 2FG6C 4NMXB 1PE6A 4EX6A 4MUIA 3PYXA 4FEAA 4OFBA 3KETA 1SC4A 4EY3A 4OW0A 2NXNA 2I6TA 2DFDA 2P6MA 1QTRA 2R44A 3ZGYA 2OC4A 2EFEB 3OZDA 3HCRA 2HMAA 1EJ2A 3I9V6 3KS9A 4KXXA 2C0PA 2VSOA 1DAGA 3E6AA 3SFZA 3EXHC 4DB4A 1QH8B 3MJ5A 4JLUA 4OAQA 4BO1A 4J9UE 5HQJA 2VCYA 3CF4G 3M7IA 3K9BA 4FKZA 4W9RA 4GH5A 4ZQEA 4CMCA 3VXKA 1DO0A 5LJIA 1CRLA 1P9LA 5B3JA 1IDOA 4K40A 2B7CA 2I4LA 1O6BA 2E3JA 3Q0TA 4GAEA 4BOYA 2QQGA 3RS4A 5LZ9A 5HM8A 3EXG2 2Y5BA 4B3XA 1DHTA 1WMFA 1O95D 1PFKA 4M9ZA 1DRWA 3DLCA 3M1AA 2IV2X 4AURA 1XYVA 5CLHA 1XCGB 1XNJA 3Q5DA 4BNDB 1WLYA 2NPIA 1LPBB 1BYIA 4DG9A 3MAGA 2QX7A 2VPYA 4EG3A 5KTRA 2J6BA 3G6WA 3M70A 4WXHA 1N36B 1YVUA 3LT4A 4I5DA 2CNOA 2YVAA 4Z0TA 1U3FA 2WAAA 3INGA 2H0RA 1FRQA 3F5DA 4MI7A 2ZB4A 2QR3A 2YJTD 2D59A 1XLVA 4ILKA 5AKHA 4C7OA 1N6LA 2C29D 3QBTA 3U40A 1HT1E 3H97A 4YGYA 3DHYA 3WSVA 2ZWPA 3ITEA 3V34A 3SHOA 4PSUA 3W31A 1DOHA 1W9MA 3PC8A 3U3JA 4XGKA 1AS3A 4K6OA 1FP1D 3VX4A 1EPUA 3Q10A 1Y1QA 2RGEA 4RWEA 3HKCA 3DNFA 1MEEA 1P80A 3MVEA 1NDUA 4GM1A 4ZUXU 4IIJA 1RKBA 2R6FA 1KHHA 3IPCA 3UA3A 4BP3A 2XA2A 1OBHA 2QX8A 3AUAA 1J5XA 3F7TA 4DTIA 3PBKA 2XVAA 4Z6KA 4YRLA 3EVBA 5IEJA 1YR3A 5TE9A 4OQFA 3T3OA 3RVWA 3KAJA 5JISA 1EX6A 3SVZA 1MNQA 4J7AA 1PYGA 4Q4CA 2NZUG 2QM8A 3VRHA 4F06A 4NG4A 1C81A 2QMZA 4W82A 3L40A 2AD1A 5TSDA 5FDFA 1KE2A 2UUCB 2UYGA 1A96A 3CJQA 2OORA 2ESRA 4I1RA 4KFTA 2WF5A 1NBME 4U5QA 4BNMA 2FPMA 1ZNWA 3DLIA 4E0BA 3DT9A 4LISA 3GC6A 3N70A 4ZZ3A 3B12A 2H1RA 1QOZA 1YASA 1TQ2A 4ZCSA 4B40A 3UWSA 3MS7A 1YUNA 1R00A 2YWCA 3IAXA 3ZWVA 3R6DA 1GNLA 1TJPB 1Z4IA 1Z4QA 3MM4A 2D2FA 4YRCA 1DRJA 4C4PA 2FDCA 2RGWA 3RO7A 3HFRA 1YS9A 1U6JA 4DNPA 4NE2A 1HLPA 3KFLA 3UXYA 1NXXA 3L8DA 3KYDA 3ZU3A 2OHJA 1GADO 5DLPA 5FL7A 5K9ZA 5DF1A 4I3HA 2A7QA 4W6ZA 1KJ9A 1R5OA 1EK2A 1QH0A 3L43A 3R76A 4B3RB 2G1AA 4HPWA 1RQRA 3CO0S 3PVSA 1WTCA 3G2LA 3D1VA 3ZPXA 1BKDR 3QKRA 4QEDA 4E12A 4I1SA 2ECPA 5DTEA 4FHFA 3F4KA 1LPPA 1XTIA 1SCBA 3M6VA 3NFRA 3KSRA 4X61A 4I50F 5FNVA 1MRZA 1RJFA 2CXRA 2VJCA 3AHGA 2XYVA 3ESXA 4Y2TA 5IVHA 2XXAB 5EPOA 1H5UA 1EXWA 4BZZA 4CWAA 5JALA 5LUAA 1XA0A 4IJKA 3VR5A 1KL7A 4ZPXA 2WICA 3IB6A 1E77A 3AHEA 5TNXA 2ZZNA 1BROA 2OGWA 3U37A 2CYBA 2QT9A 4JVLA 3C3KA 4REQB 4TPKA 3CW8X 3FBTA 3L9XA 1P2DA 2JI9A 3UXEA 5IAKA 2BISA 4HH4A 4I3FA 5I4IA 6ABPA 4F6RA 2IYQA 1AK1A 2OZ2A 3VR6H 4NE7A 1DJPA 4R8SA 4HWOA 4RVDA 3GFOA 2VJAA 2ZYGA 3GCGA 1C9DB 4GOMD 3WKDA 4LE0A 4RTKA 2PSEA 2R8YA 5C52B 3BHJA 3KZMA 4G56A 1KJJA 4LBVA 4L3VA 5ALFA 3TSAA 16PKA 3GEPA 4HWSA 3RTEA 2GJKA 5HW0A 3PRMA 5CW1A 5D3QA 4AN4A 2GN9A 1PL6A 1HNXB 3ANYB 2V6IA 5LVAA 5EOVA 4BXOB 1KEZA 4PAOA 1HOXA 1P44A 2Z5GA 3GGCA 2HH5A 2JIQA 2IV7A 5FBWB 1ZKDA 1IONA 1YRAA 3PGVA 4W5CA 1V5EA 5D3KA 3K3PA 5JC8A 3C45A 1MB9A 2Y93A 1F2UB 3VSBA 1XQVA 3MGKA 1FB5A 2GPAA 4NFLA 1SK8A 4OLJA 5JEDA 1HQDA 1SJ9A 3SLGA 1NVXQ 2VHEA 4TKMA 3C3YA 3ZK7A 4B80A 3TMPA 3TZBA 2EJWA 2IHTA 3UQYS 1HWYA 3UYLA 3GARA 4DA7A 5K03A 3F7MA 3RKUA 5FOVA 2QSYA 4QVKA 1ZJ4A 2ONJA 1T3SA 4LDAA 1VP3A 1Y9EA 4DG5A 3ZCXA 5BVGA 5C18A 3OE5A 5CB4B 3FLBA 3MTGA 3NYWA 4KQCA 1CSBB 4HD8A 3GLGB 1AIMA 2CE7A 3DUWA 3B9BA 3A70A 1DAIA 1G5HA 1X0XA 3CZCA 5IRCD 2W22A 3DE0X 3PXAA 4GE0A 4AZ3A 1GAEO 1L7VC 2OAEA 4LMBA 2PUDA 3GT4A 1RJWA 2ZUDA 2ZSHA 4CMKA 1ZOIA 1ML3A 1PV2A 3DQZA 2LRHA 3F1KA 4F2DA 3GFFA 4RTNA 2IZ0A 2JH8A 2ZI7A 4KV7A 1VHQA 4BFLA 1N5JA 4PRKA 3TIGA 2LNDA 1OAAA 4HDNA 4JBNA 3HGMA 4ZQIA 1WXWA 3KBOA 3Q3GE 5CPBA 3DOFA 1SD1A 1U0FA 1XHLA 1I4WA 5I8ZA 4E94A 1ZKMA 2JFVA 2ADOA 4TYQA 4ARBA 4EL5A 2KMLA 1TU4A 1U9WA 3IQDB 4C0XA 1FTSA 3SHQA 2BTQB 1AKEA 4OK3A 1ATKA 1N25A 4WDRA 2DX7A 2IHBA 3NONA 4B33A 4CODB 4P31A 1BMTA 1KS2A 1QV7A 2Y1EA 3IEUA 4FDLA 4FSDA 2YXLA 1RZRD 1OH6A 5F33A 2PXXA 3BRQA 2X3YA 2WD8A 4JL5A 4C6RA 5CDGA 2BW0A 2X8WA 1CR1A 4YS6A 5HBGA 1AGNA 2P69A 5JO0A 5B1HA 3L06A 1ZSYA 3NVMB 3G2IA 4HEJA 5HTOA 4B85A 3B2QA 1ZIOA 4J4TA 2H2GA 2R6DA 4LGYA 4WJLA 2HWYA 2WSYB 2X4DA 1JP7A 4TTVA 4C30A 1RXWA 2V03A 1U9CA 1X94A 3AEUB 3TUIC 3QY0A 2AN9A 4RHUA 4PXSA 2XTNA 4MRMB 4E11A 2OYCA 1X7DA 4ZU3A 5B2ZA 5DHSA 3D6UA 4Z8YA 3R7DA 3K6KA 2HXYA 4PNPA 4U7TB 3RC9A 3BJRA 4FOSA 2EP7A 2XB9A 2FMUA 5HGJA 1KMHB 4MJ3A 1JFVA 4BVHA 3TNDA 1J49A 3IRUA 1OX4A 1G4AE 2OESA 3FFBA 3O3NB 2FZCA 3TTUA 4YLYA 3VC3A 2YJBA 1J9GA 5JCOC 1E2HA 4BBJA 3KQUA 4RD4A 3CXRA 4L3OA 2NQAA 5KYNA 1N0IA 3TR6A 1C7QA 2QD2A 4L4ZA 4QG3A 3K6SB 2IJGX 4FKBA 4LF7B 2DC7A 1WPXA 3GNTA 2QRGA 3KJIA 2OC9A 3DF9A 2O57A 4W9NA 1AXGA 2HLNA 5DYYA 1UPTA 2R4UA 2RAVA 3DOCA 4UDYX 3TLMA 3V4RA 4O4HA 1VKOA 2V9ZA 4OHCA 3DP9A 4PRYA 4L5AA 1RU3A 1XTPA 4OJKA 4Q05A 4RL6A 3RU9A 2WJPA 3VV2A 4FWTA 3Q8MA 1D1PA 2VK4A 4MTLA 2ZJZA 2VHVA 3K6RA 5LP6F 2C2GA 5JXJA 3GMSA 4FXOA 2NU8B 4DUZB 1ZK1A 1P2FA 1ZJZA 2HN9A 2ZE6A 1MS6A 2YV5A 5JSZA 4LYYA 1QCZA 3BMQB 1NJSA 2A35A 1O94C 1X14A 4RZXA 3T1OA 5J94A 4TXHA 4AO6A 2X5OA 3PR2B 1DQNA 4MQLA 2XUOA 2WABA 3R40A 2PUEA 3KQWA 1K8XB 2BFDA 1XAIA 5EI5A 1Q1QA 1SA0A 2FN3A 2J67A 3QE3A 1VYVA 4ZMSA 3FPKA 3HBFA 1JIQA 1RYYA 2IU3A 5TQ0B 3AC0A 2WYIA 1JQDA 1GT6A 1WKVA 5EHQA 2B7BA 2B8JA 1T6BY 3K2IA 2YZ2A 3AJEA 3CC8A 1PGJA 2XUZA 3Q2OA 2VHWA 5DP1A 3FGOA 2HLDD 4TLAA 5EIHA 4EMTA 3ENQA 4BGDA 3ZYZA 2ZS7A 3NTXA 2WTXA 1W36C 3MW8A 1H85A 2VRCA 4K5QA 2RARA 3ZOKA 3QHPA 1TM5E 5F23A 5KJCA 3IVMA 3FWPA 3N2GA 3UUFA 4HQ0A 4H1WA 3ETGA 3G68A 3EGDB 4BNKA 2RH5A 3CHYA 3E1SA 1FH0A 4OI2A 4MWOA 3VJRA 1E3DA 3CH3X 4HWTA 2HJSA 3NAGA 3E9NA 4YDHB 3NWEA 1YOBA 2C78A 3HBMA 1YQUA 3TRKA 1NBMD 3ZHYA 1DBVO 2C4MA 3T0GA 4BQQA 4CPDA 4ZN6A 3M4JA 3Q7PA 3QI7A 1R15A 5LQJA 3HABA 1L3IA 3DO5A 3I92A 5EIAA 5IT0A 1BMQA 5CW2A 4S1WA 3W6NA 3WIVA 3TH5A 2W2OA 1CHDA 2W93A 4MUBA 5KQRA 1II8A 4WK0B 3EPLA 1NM5A 4LHYA 1FA9A 8GPBA 4DUYB 3RFVA 1OHHD 4LSMA 1K6JA 4ENRA 2XU4A 2EG9A 4B46A 1SVWA 3ZV3A 4HJXA 4PZ9A 3ZLUA 1PDOA 3BL5A 1LQTA 4AZ0B 1AQLA 3KSMA 4O2AF 1E5LA 5IDWA 1I4DD 5D3MA 3DMRA 1CQPA 1KAGA 4FFMA 1KEWA 3GN2A 4GX1A 4O33A 4E13A 2WF6A 4EUEA 2IYWA 4TMFA 3HPRA 1AHHA 4FN4A 4M55A 3AT1A 3C1AA 1UBHS 1NR5A 3FYCA 3R1IA 3V1MA 3GP3A 3KLBA 1SUFA 1YQTA 2A4KA 2V7QA 3O94A 5DV9A 2FWAA 5P21A 2HDNB 2JIPA 3RIHA 2OCYC 5BSMA 3ZEAA 2WFLA 3FIJA 4N49A 3BXFA 4PGAA 3WSWA 1TU6A 2FUG6 1SXJC 1DFGA 3M5DA 5LBUA 3QVOA 5GGYA 1ZONA 3P0JA 3G8AA 1D2AA 2VHQA 2V6FA 4LY0A 5TQVA 2JHFA 1YIAA 2J3MA 3C98A 4HS4A 4CIDA 3PXEA 5KCZA 1MJ5A 1HQYE 3S81A 3SM3A 4CDDB 3NRCA 2W6IA 1E2BA 3DAFA 3O4FA 3B38A 4O4IB 2ZUEA 2DQZA 4TXLA 1SC6A 4G0OA 4RF1A 2PGAA 4OY3A 3SM9A 2R2AA 8AT1A 2ZRMA 2DOSA 3DAYA 2W6QA 4PX2A 4B6RA 1UDBA 2NO5A 2W4QA 5I7AA 3DFIA 3K1TA 4QTUB 4D43A 3G9UA 4V1CA 3PU6A 3PX3A 4OXIA 1QGUB 5IKPA 2P41A 2YYYA 2DLNA 2ISSD 2YN2A 5B2FA 4D3ZA 1COZA 3FI0A 5HK9A 3D4BA 3H5RA 3X1KA 4I9NA 3LLSA 2ZJYA 1O8BA 1UC9A 1XMPA 4YHHB 1WO8A 3EVEA 1GUDA 2R79A 3BC3A 4Q1DA 5CT9A 4M0DA 1TC1A 2BR4A 3PVCA 4WW0A 3F6EX 4BAZA 3PA6A 2ZI5A 1P9NA 2CLOB 1QOQB 3SG0A 1MO5A 3CISA 2FZVA 1WPQA 1UDCA 4FD3A 4JELA 4ZEWA 4F4CA 2BBOA 4MRAA 2HK7A 3TW8B 1RXYA 4JLOA 1AN9A 4LBYA 2VAXA 1YRYE 2AJDA 3NUGA 3M99A 3AF1A 3GZJA 4KPGA 4WZBB 3HN2A 5HZKA 4L6IA 2XOEA 3D54D 4IIUA 1SB8A 4KUHA 3D3QA 1QBGA 2IKQA 4YP6A 4JJ8A 1SZJG 1NN3A 1O5TA 4X60A 2F1GA 1J39A 2FFQA 4MJLA 2WHRA 3OFJA 3PC4A 1QTQA 4RJTA 1IY8A 1GZHB 1C80A 1MVLA 4JNKA 1F60A 5ES3A 2P0YA 3QKSB 1KK1A 1TQDA 2CDRA 4JUCA 5GM2A 4GPZA 4ZI2A 4MS3B 4U00A 4Q93A 4XQ0A 4EPTA 1M2FA 4PRZA 1PJSA 3SX0A 3BWCA 5BR1A 2DJIA 4K1XA 1DAEA 1LPAB 1V4BA 4MV1A 4MW7A 4O2RA 2JFGA 2OB2A 4EDHA 2O2GA 3I04M 3UNXA 4C20A 2O50A 3P2KA 4BWGA 1WHSA 4CMJA 1J7JA 1B6TA 4EO7A 1Z0FA 2CKDA 5H3CA 5LQCA 1PG0A 3OCXA 1V3UA 3DWIA 3VGPA 1EAYA 4Q4LA 1OIXA 4B2PA 1GLNA 4BQFA 1CVZA 1JWBB 2JZCA 4J9VA 1R8XA 5AOVA 3IL2A 4DOMA 1KBQA 3ESDA 2HYIC 1B8UA 1EFDN 4GMKA 4F8EA 5IJWA 1MEOA 4D2IA 3L7AA 4YJ3A 1Z5ZA 1KY4A 1XU4A 2PRZA 1OX5A 2CXHA 3AZPA 4G0YA 3VNBA 4PQGA 4CTKA 1X7WA 1ZVJA 4NCKA 3AETB 3SP1A 4PG4A 2IBMA 2GZHA 2P0RA 3CO5A 1XEWX 3DAGA 4G5XA 3IESA 4INOA 5HZHA 3L4EA 4KI7A 1SXHA 2GCOB 2VJYA 4EM6A 2F1OA 2I2WA 2VJBA 5D00A 4Y6RA 1VL5A 1Q0ZA 1XP5A 4HVTA 1EESA 2AYOA 2HF7A 4UREA 5HG0A 3R5SA 4CKCA 3GRUA 1X1RA 1UOPA 3RRJA 1RACA 2PU5A 1X7ZA 1RAHA 2UUOA 3VDMA 3P2MA 3SMQA 5BORA 4MMYB 4FS8A 2C99A 4S35A 5E9JA 2C98A 4I99A 5IYZA 1VKZA 1OJLA 2X15A 4EJSC 1E3IA 1OBOA 1Z8NA 4RKQA 3WMFA 5JFGA 1F7UA 3UMVA 3QXHA 5MFPA 3AONB 1ZK2A 2FWNA 4JN6B 4WXYB