5EZQA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Non-structural Protein 2 Cysteine Protease
publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
total genus 110
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezqA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezqA01
1P1CA 4ER0A 5FA8A 5BW4A 2AOUA 3HCFA 2OPBA 4GUAA 2JJQA 3OFJA 4RVFA 3G89A 4GBED 1JTFA 3CC8A 3EVDA 5FA5A 4CTKA 3MTIA 1SUIA 2AOUB 4CWAA 4RTJA 3BT7A 4FZVA 2XYQA 3E05A 2Z6QA 3G8BA 3SGLA 3A25A 2EG5A 2ZBPA 3A7EA 3ANXA 2YXEA 3HM2A 3GGDA 5CVEA 4RTQA 5KS2A 5K03A 3RODA 1BKYA 2ONYA 3B3FA 2ZULA 2O0LA 4POOA 3SMQA 1G60A 4E2WA 3F4KA 2NXEA 4MHTA 1EAMA 1KHHA 1KYWA 1D2HA 1XXLA 4QVKA 1ZQ9A 4AZWA 5K0EA 3OFKA 3LDGA 5HILA 2EJTA 3NVMB 2C7RA 1PJZA 3ELDA 2YVLA 1AQIA 1KPIA 3NWBA 1BOOA 5HIJA 3P2IA 3L8DA 1T43A 4CKEA 3SVZA 1IM8A 2AOVA 3IV6A 2ZLBA 3UJ7A 2G71A 4QTTB 4BLVA 5EOVA 3TR6A 4CTJA 1JSZA 3REOA 4LWOA 3TOSA 3EEOA 2ZIEA 2I6GA 1KP9A 2AS0A 2G1PA 3HVKA 2ERCA 5HIMA 1NW5A 5C9ZA 1QANA 3EMBA 2HTEA 2OXTA 2R3SA 1UFKA 3B3GA 3PFHA 4FSDA 4P7JA 4F85A 1DCTA 2IDJA 4RTLA 1NW6A 4OX9Y 2XYVA 4OBXA 5EQJB 5CD1A 1I1NA 1G8AA 1FP2A 4P7KA 1I4WA 3FUTA 3UBTA 3DUWA 3KQQA 2XYRA 3P9NA 4ER6A 4YMHA 3HCBA 4DKJA 4X1OA 3DXXA 3Q7EA 3GRZA 2OBFA 5EG5A 3SXJA 2ZZKA 2ZCJA 3BKXA 3UJ8A 9MHTA 2GB4A 2P7HA 1F38A 3DXYA 3IYLW 4PYJA 5LQJA 4AZVA 2PGXA 3QOWA 4CKCA 3GIWA 4LWPA 1NW3A 2Y1XA 3NMUF 3BWCA 1N7JA 3JWIA 5MHTA 3OZSA 2YXLA 4IV8A 1FP1D 1YFJA 3BKWA 3KQOA 5EIWA 1FJXA 4WVLA 5CVVA 3BXOA 3KPWA 3CBGA 3MAGA 2JHCA 5GM2A 3KPJA 5DSXA 3P2EA 4RTOA 1O54A 3EGVA 2EFJA 4GOND 4OA5A 3NTVA 2NXJA 3KQTA 3LHDA 4AX8A 4BLUA 5BW5A 3OZRA 5K0GA 3BGIA 4R6WA 5E1DA 2I9KA 2PBFA 2IIPA 1EJ6A 3MB5A 3MGGA 3EEYA 2G8NA 5ICCA 3PTAA 2C7PA 4IKPA 3M4XA 4R05A 2P8JA 3C6KA 1VBFA 1WXXA 2VDUE 2ZFUA 3FPHA 3UZUA 2PWPA 4EQZA 3M6XA 4MTLA 4BP3A 5GINE 1IXKA 3ELWA 4FSXA 5P8WA 4F86A 4PYKA 3H2BA 4P58A 3G88A 2ORED 1MHTA 2AN3A 2OO3A 3P8ZA 3MQ2A 5DX1A 2ZW9A 4DMGA 1EQAA 1QYRA 2P3OA 4AZSA 1L9KA 4GQBA 2CMHA 5E1MA 1H1DA 3K6RA 1YZ3A 3PVCA 2HNKA 2B78A 5FWAA 2P41A 5EHGA 5EKUA 4DCGA 2BZGA 5BP7A 2Z6AA 3G8AA 3GRUA 2LD4A 3HNRA 4MWZA 4M7RA 2PJDA 1NBIA 4YUYA 1RJDA 3LPMA 5DM2A 2PXCA 5FTWA 2ZZMA 3KHKA 1UIRA 2P3LA 2YX1A 2ZBRA 3ELYA 3FRIA 3KPYA 5E8JA 5CCXA 5DM4A 2GA9A 3CJTA 4QDJA 2YQZA 3T7SA 3FYDA 4YUZA 3AWIA 4GF5A 3FPGA 3JWHA 3SSMA 5K8VA 3KQWA 1G8SA 1G55A 2ZSUA 4PONA 2DPMA 3BWBA 3FRHA 3SX0A 2FYTA 3TMAA 4E2YA 2C7QA 3R9XB 1R8YA 1ZGJA 3UFBA 5T64A 4HTFA 5DT2A 2GS9A 2OB1A 1R6AA 4PIMA 2IH2A 1XJ5A 4YUVA 1YFLA 3ER8A 4ISCA 1YUBA 2I7CA 4HTFB 3KU1A 2AVNA 3FUWA 1NKVA 5IKMA 1RJGA 3LKDA 3B7PA 4IWNA 3HP7A 1NW7A 3O4FA 3FTDA 1VE3A 2PKWA 4RTSA 4PGHA 2CMGA 2FHPA 3BWMA 1XDUA 2PLWA 4KW7A 3TLJA 1EIZA 1WXWA 1O9GA 1L3IA 3C0KA 3P9IA 5U4XA 2PXXA 4XCXA 4YUWA 3DP7A 3KPUA 3M70A 2HR1A 3E8SA 3MTEA 5KQRA 4KIGA 1KPHA 4RTPA 2XVAA 5K0FA 2GAFA 2AN4A 1ZG3A 4PYMA 1RJFA 2YR0A 3LX6A 2ZBQA 2PV0A 1EJ0A 1ORIA 3EVFA 3BUSA 3P2KA 1NV9A 3I58A 3LCUA 2NYUA 4P7GA 4E2XA 2NP6A 2HMYB 1F3LA 4KRGA 3OE4A 5ICEA 5IH3A 1KPGA 1U2ZA 3EGEA 1RI2A 3OPNA 5K0LA 5LR6A 5EPEA 2NP7A 5ICGA 3K0BA 3TM5A 3G2OA 3T7TA 3P71T 5KQSA 3EVGA 4L7VA 4C03A 2O07A 2FK7A 3DMGA 4R8SA 4ATNA 3HA3A 5EEGA 3A4TA 5DXAA 4FR0A 3AY0A 1SQGA 2CKDA 4ER7A 4RTNA 1P91A 1NV8A 1DUSA 1TW2A 3PX2A 4G56A 4QPPA 4B17A 2UYHA 1EG2A 2E5WA 2FRXA 2ZVJA 1JQEA 2VS1A 3ME5A 1PRYA 4QPNA 1TPYA 4DA4A 4E33A 5BXYA 5CCBA 1INLA 2KW5A 4C07A 1YB2A 4PCLA 4QTUB 2JHPA 2Q41A 3HCCA 4JXJA 4XUCA 1JG1A 1G38A 3EVCA 2K4MA 4V0RA 1SVUA 3AXTA 3FUVA 3VSEA 5K0JA 1HMYA 5DX0A 4CKBA 3FTEA 3LKZA 5T6BA 3FZGA 2IFTA 3I64A 1QAOA 5C1IA 3O31A 5LQCA 1SG9A 4WXHA 3QOXA 2XVMA 2IH4A 1TW3A 2V7EA 2BR5A 4K6MA 5E2BA 1B42A 5FWDA 2VDVE 4Y2HA 1R8XA 1SQFA 3BGDA 4IV0A 3C6MA 3GNLA 3WSTA 1FPQA 3GRYA 4H0NA 1XCJA 2GPYA 1VP9A 1ZKDA 2IDKA 1G6Q1 3HVIA 3M6WA 4V0QA 3P9KA 2FPOA 5DPMA 5E9JA 5K09A 1Z3CA 3GRVA 3NJRA 4GC9A 5DXJA 5K0BA 2YXDA 5EZSA 2OYRA 3TM4A 3A27A 2WA2A 2NNWB 3LBFA 5E8RA 5K01A 5G02A 2P3QA 5K0NA 5LQRA 2O05A 4RSRA 3BGVA 7MHTA 2JG3A 3BZBA 3T0IA 2Y1WA 5C0OE 1XTPA 2ZWVA 3HCDA 3SR4A 3GXOA 1UWVA 1L3BA 3NVKI 4F84A 4GEKA 5GM1A 1VL5A 4BLWA 3KR9A 3ELUA 5CIYA 1M0EA 3DMFA 3DLIA 2PWYA 3KPVA 4PYQA 1QAQA 5EKXA 5FHQA 5GP1A 8MHTA 3FUUA 3M33A 2H00A 4M38A 4GOLD 3I9FA 1Q0TA 2O57A 1RJEA 2IPXA 3G7UA 3LBYA 3R3HA 5FULA 3KR0A 2P7IA 1KYZA 4FT2A 4QQKA 3MCTA 1KXZA 3ER9A 2H11A 2P1DA 5DTQA 3X0DA 2ADMA 2EX4A 3G2PA 3JWGA 3HTXA 2FK8A 3B3JA 3OU6A 3B89A 3EVBA 5T67A 4C05A 4A6EA 4E31A 1L3CA 3OCJA 4KIFA 5DX8A 3SSOA 4DZRA 3HA7A 4EK9A 1AQJA 5HIIA 2VP3A 4KWCA 3B5IA 3M6VA 4PYLA 3V8VA 4DCMA 2UYCA 3PFGA 3OZTA 1RI5A 3TPZA 5FQOA 1XVAA 3A26A 1NW8A 3AJDA 3HCAA 4KVZA 4X60A 4FT4A 3TKYA 2AVDA 3PLAE 3UWPA 4OBWA 1RI3A 3GU3A 4HRAA 3C3PA 4UOEA 2YTZA 3NDIA 2B25A 3RIEA 4GOOD 3MHTA 2IH5A 4EVIA 2IBSA 4DF3A 2VDWA 3G2MA 3PT9A 4PWYA 3I5UA 2P40A 3C3YA 1M6YA 2JH9A 5FUBA 1RI1A 2G70A 5F2NA 5DRYA 2GH1A 5B1SA 4RTRA 2OKCA 2C7OA 4RTMA 3FTFA 3TFWA 2QRVA 2BM8A 1VPTA 2HWKA 1O9HA 4KDCA 1QAMA 4PCAA 3MERA 1JTEA 5DTRA 3PS9A 4YV1A 4E32A 4PYOA 3KR1A 2QRVB 4ER3A 2AN5A 5E9QA 1JSXA 2ZWAA 5KVAA 1SUSA 2PSSA 3DMHA 5EHIA 3UJ6A 3UJCA 5E2AA 2B9EA 2OZVA 4HC4A 2PXAA 4R6XA 2A14A 1X1DA 2AR0A 2YUIA 3E23A 4X63A 2Z6UA 3KR2A 5EIFA 5ERGB 1M6EX 3LCCA 4ZTBA 3SSNA 1HNNA 5LQNA 3CKKA 2VZ9A 3UA4A 4LECA 3FYCA 4ER5A 2G72A 3DXZA 1DL5A 4BY9E 1Y8CA 2HV9A 4A6DA 1VQ1A 3DLCA 5LQUA 4E70A 1XDZA 1AF7A 3A7DA 2AZTA 2CWWA 4M36A 1X1AA 2ZTHA 4PYIA 4X41A 4E30A 2NXCA 1X1CA 1XCLA 3KQMA 4RWZA 2F8LA 3ID6C 3HEMA 2PT9A 2PX5A 4DM3A 1YF3A 4GOMD 4HG2A 2B3TA 3CCFA 3KQYA 4Y30A 4C4AA 4PNEA 2DULA 2B2CA 5EMMA 4CXMA 3NW9A 5D1HA 4U7PB 5FQNA 3VYWA 3DH0A 1WS6A 2ONZA 1XDSA 4OA8A 4YV0A 5LQAA 1WY7A 4PIPA 1BHJA 4EKIA 1I9GA 3EPPA 4M37A 5GIPE 5DWQA 3IHTA 5K0CA 3THRA 5E1BA 3O7WA 2BR3A 2O06A 2R6ZA 3PX3A 5HEKA 1VLMA 3I53A 2JHAA 1P1BA 3QV2A 4BP1A 4LG1A 1SKMA 1X1BA 4FGZA 4FS8A 2UZ4A 5EMKA 4OQEA 3V97A 4HSGA 4R8RA 5DTMA 2ZIGA 2V74B 4EMSA 4NECA 3PB3A 4RVHA 1NT2A 2NXNA 4PGGA 3HVJA 5CM2Z 3CGGA 3DR5A 3DULA 5EC8A 5K05A 2AOXA 2N47A 5CVDA 1RI4A 2QE6A 3BWYA 3U81A 5GOZA 3GO4A 5H02A 3RW9A 2PX8A 4HH4A 1ZHFA 2WK1A 3R6TA 4PYNA 4C08A 3EVZA 3LECA 3LDUA 1Q0SA 2IGTA 3TRKA 1JG3A 1NBHA 1QZZA 5HFJA 5CUQA 3GWZA 3EMDA 3LGAA 4RVGA 2PY6A 4RYLA 3HVHA 3KQVA 1KIAA 2OY0A 5LSAA 10MHA 2OB2A 4C04A 2BM9A 5JUWA 5CVJA 2XBMA 1JG4A 2UYQA 3NDJA 4RX1A 1X19A 1R00A 2ESRA 3GJYA 3OU2A 3OU7A 3G5TA 3Q87B 3EGIA 4PINA 1JQ3A 4YMGA 1AV6A 3THSA 2AOTA 3LDFA 2JH8A 5EVJA 3GRRA 3ORHA 5JR3A 1NE2A 2BR4A 1ZGAA 4EKGA 3FUXA 1L1EA 3T7RA 2BH2A 2PX2A 2QM3A 5M5BA 2AOTB 4HGYA 4QQNA 5F2KA 3FTCA 4OQDA 4AZTA 1KR5A 5EEHA 3HA5A 5HOQA 1VP3A 3LSTA 1VIDA 3ERCA 4C06A 2ZZNA 3TQSA 5FHRA 4XUDA 4X61A 1P39A 1WZNA 3P97A 3G5LA 3VC1A 5FADA 1R18A 3FPJA 1IY9A 4HGZA 1N2XA 3E7PA 3GDHA 3CJQA 1OR8A 3SM3A 5HZMA 1ORHA 4O29A 3UJAA 2IP2A 3HCEA 2IBTA 3D2LA 3R0QA 3S68A 2EJUA 4MQ4A 5EMLA 3NWEA 3M6UA 2UYOA 5DSTA 5DRTA 1MJFA 3OE5A 5CVUA 5GIOE 4FP9A 4U7TB 2WA1A 1D2CA 1YZHA 4RV9A 3CJRA 5ICFA 3CVOA 3P9CA 3UJDA 4KDRA 4QVGA 5F2OA 3FPFA 3UJBA 4Z2YA 2H1RA 3VC2A 3EVEA 2PVCA 3GCZA 3KKZA 3UA3A 1WG8A 1BC5A 3FPEA 3AXSA 2QY6A 3IEIA 2I62A 2ZIFA 1JG2A 4GC5A 5E1OA 4AUKA 1R74A 2QYOA 5DM0A 3JWJA 1JR4A 4RTKA 5DM1A 5EGSA 2P35A 2FCAA 3KQSA 3KQPA 2CL5A 4QDKA 3G2QA 2AOWA 5FCDA 5DLYA 1FBNA 3DTNA 4DQ0A 3R24A 1N7IA 1V39A 3MCZA 1JQDA 3DOUA 3LCVB 5EMJA 3TKAA 5HIKA 3UJ9A 4RVDA 4P7FA 4MIKA 5LQKA 4E2ZA 5E9WA 3LL7A 5D1NA 4YUXA 5GWXA 2GLUA 4XUEA 3EVAA 4YV2A 5KYGA 2PX4A 5EZQA 1D2GA 2PT6A
chains in the Genus database with same CATH superfamily
1XK7A 5H68A 2WUGA 1G5PA 2QN2A 4OXIA 1Y8AA 1V7PC 2ZRAA 2WOJA 1GSAA 3F9IA 4JC4A 4ZAWA 3D64A 4ZICA 3CLUC 5EFZA 5DNUA 4ID3A 2ZXUA 4XA8A 3ZJUA 1IN1A 3BSSA 1L5RA 1TLLA 4LIPD 3WLMA 1I3NA 1ZCBA 3LHIA 4BV3A 5BV1A 2O2ZA 3NO4A 1E9SA 3PWSA 3AF3A 5H70A 2EERA 1PR5A 2JDID 2UYYA 2HCFA 3IPYA 5J58A 2PJZA 2WFMA 5EP3A 2XB6A 1EUCA 4KMMA 3GVHA 2R2GA 4M1YA 1V47A 3MWDA 5H81A 4PZ0A 5DGIA 5ALKA 4GXQA 3A2MA 1NBEA 4X7BA 1IN8A 4XCQA 3CV3A 1T43A 2A4MA 3A3NA 4LA4A 5IJ9A 1I6KA 4RH3A 1TGYA 3IOCA 4Q1FA 1JEAA 1QGZA 2V96A 1O2DA 3TR6A 4OK6A 3AKZA 2YRXA 2UV8A 1EH5A 1JLKA 1SUEA 4MPDA 5CH3A 3REOA 2DJGB 3AUXA 3Q9NA 3DZDA 5B1HA 2G1PA 3S2UA 1JAIA 3L3BA 4YI3A 3ZLJA 3B2QA 4RVUA 1E0SA 2R5FA 4Y6RA 3ZH2A 1K68A 4DLRA 2GPSA 1LBHA 4RK7A 2PS9A 5C8YB 1KS2A 4V3BA 3MWGA 5FUQA 4BBJA 3Q9SA 5BW6B 1KO5A 4OAOA 2VHUA 3IMCA 3R3YA 2VEOA 1G5TA 2ZWPA 3L7NA 5HM8A 1EWQA 4E5DA 1I4WA 1DG3A 2OILA 5AESA 4XJVA 3KYCB 3R3UA 4N5MA 3KJHA 4LF4B 4DCVA 2DH6A 1FFXA 2FWRA 2Z09A 4JJZA 4PLGA 5LOVA 3SXJA 4YCCA 4C0XA 4CEHA 1CJUC 3BRSA 1AQUA 3NIBA 3JQQA 4ZDKA 5JROA 3FH0A 4OK5A 4LHYA 2JGAA 2EBHX 4YNBA 1KZHA 4B4WA 4AKHA 1YKFA 1XRNA 2GKSA 4XIYA 3ZK9A 4AS1A 4HJRA 5BUSA 1AUQA 1YS9A 2WY2D 1MT3A 3STWA 2HLHA 4C5AA 5BURA 1FP1D 4FGLA 1YQUA 4QUKA 3NTUA 2EQAA 4IEFB 3BKWA 5CP8A 4DUYB 2R9NA 3W6PA 3LT1A 4I1IA 4ZI7A 1WXFA 1A3CA 2BFFB 1OGIA 3F8TA 4PC2A 4R98A 4JIMA 3ZHUA 1DJLA 1JIXA 1Z36A 2EFYA 2E4YA 4UNRA 2ZJ0A 1Y80A 4UUOA 3MWEB 4JP8A 2YDXA 2QXTA 1ZN9A 1HUQA 2V0NA 1V5EA 1M33A 3FSGA 4OMDA 1CS0A 2C96A 3ICVA 4FEGA 2JAOA 1NE7A 5AM3A 5ICMA 3PTAA 3K8QA 3RT7A 4YEDA 2G17A 5ALMA 3ANTA 4BAZA 3FPHA 1HSZA 4Q3LA 2BZ0A 3M6XA 3DTYA 4L5CA 3V32A 1L7BA 4PYKA 2OESA 1X80B 2WF6A 1KETA 3G88A 4W8OA 4YXWA 1NULA 4WUVA 3TD9A 3ZJ5A 1DQZA 4A4DA 2HQBA 3T5CA 4LYAA 1IJEA 2XIQA 4GKBA 4P82A 3TVTA 5FDFA 3F9RA 1E2KA 2RGUA 4Z2AA 1FSFA 1QO0D 2PBRA 4ZQIA 5EJFA 2PGNA 4Q3CA 5A4FS 2PX6A 4IP3A 1P9WA 3EDMA 3JPWA 1W44A 1OX5A 1RW4A 1OFUX 5EN4A 3UWMA 1GZVA 2O3RA 5DF1A 5THQA 4DNQA 4CG1A 1N6NA 1PKXA 4XYLA 3IJEB 2VT7A 2P78A 5L3QB 1UKAA 3DOOA 1TZCA 4IJ5A 4JBNA 3TUIC 1H4SA 2VC2B 2XTZA 3P0HA 4CDCB 5F5NA 3W5HA 5TPWA 3CUYA 4HPWA 3TRJA 4HQ0A 4CQMA 4EPWA 1HLGA 4UBLA 3A31A 4DJDC 4EEKA 3CH6A 3ZY3A 1GKLA 3KKKA 4OU5A 1V16B 3ZH9B 3G6WA 4Z4GA 5SYAA 3LT4A 1U90A 1S0UA 2PCJA 2O8CA 5F7XA 1AG9A 2BUBA 1YIAA 4LC1A 1ZD2P 4HTFB 3PHUA 1CUHA 2H2DA 3PC6A 1S2MA 4B6SA 2HT1A 3GCDA 1SBYA 4BOQA 1BH2A 1RCTE 1W5EA 4AF7A 4ZJPA 1FMFA 2R11A 1A2KC 2R6NA 2WSBA 1RLIA 2NIPA 4GLJA 2BEJA 4N0DA 3H75A 4QFDA 4D6PA 2G8JA 1UMCA 3G0CA 1RVV1 4XCXA 1L4HA 5AT1A 3I9MA 2W8BA 3TTVA 1NKTA 2ZQYA 1Z4IA 3IO5A 2QL9A 4Z9AA 1G98A 4MS1B 2OZLB 4N49A 3K2EA 2XVAA 2JLVA 1VE7A 3W4IA 3PQEA 1K6XA 4PC6A 2KSQA 5EZYB 5FPTA 3ZWMA 2VSYA 2YR0A 5BPFA 1ORIA 5TT0A 2CF5A 3C7DB 3FHTA 3OT5A 3P2KA 1UOOA 2ZB2A 2NYUA 3I58A 1X9GA 1VJ5A 2UUBB 1CYEA 2BKLA 3UWSA 2JGRA 4UC0A 3EGEA 1DT5A 5K0LA 2ZBGA 1NJFA 3QVOA 3PJEA 4YALA 3QYFA 4TTIA 5G0TA 2X0DA 5AVVA 3AMVA 4LFBB 3F47A 2ONJA 4OHZA 5BMVA 3E8MA 1H69A 2NQAA 3WKDA 3VBEA 1O7JA 3X1XA 1PGQA 3E3MA 4TKUA 2BDLA 4HDKA 2JVIA 2XVXA 5DO9A 2ZSKA 1JXAA 2QMUA 4EX6A 1PRYA 1LDGA 4J7AA 3ETJA 3GA5A 4JT8A 4NX2A 3EWNA 4BS6A 1CV2A 2BFOA 2IUYA 3N1UA 3AG5A 4W5QA 4L95C 3DVLA 4MSUA 4QTUB 3OM0A 1V7CA 2H4WA 2OCXA 4TSFA 3VNSA 5C2JB 1I2AA 1MAAA 1SKUA 1THZA 3ONWA 1JMVA 2B6NA 1IZZA 4G5GA 3TXXA 1OA1A 5HJ5A 3HLYA 5JCPA 3W5DA 2BONA 1Z8FA 1K89A 3DT9A 3JAKB 4O4HA 3M1IA 4HJXA 2IY8A 2CXTA 3HA2A 2QTZA 5T6BA 1WUYA 3T9AA 5A06A 4L9WA 3R0VA 2CYCA 2V3VA 3G49A 4HQFA 4DLVA 5LQCA 2HHHB 4ARVA 1O58A 2JFZA 4JUIA 1E0DA 1TIKA 1BS1A 2CJWA 4XPIB 1CSBB 3PFWO 4IGIA 2OD7A 1SXQA 5CHEA 2IJGX 1YS6A 2O20A 3K8OE 5BO5A 4CDDB 4UBIA 1P5JA 3OJ0A 5KNLA 4CIWA 5K0ZA 4TUYB 3D0OA 4JLPA 3V4RA 1ZKDA 1G6Q1 2X7XA 3LQ2A 2FPMA 4BE4A 3IE1A 1NQCA 4R8VA 1D9XA 3P9KA 4BATA 3V4PB 4U7JA 1ZR4A 4N76A 1JH8A 3GLVA 4RF0A 3L7IA 1ICEA 4W8GA 2XRZA 5T8KA 3AEYA 4OKNA 2WABA 4I8XA 1CLEA 4R5HA 4Y9DA 1D6SA 5DI9A 3GP5A 4YDQA 3R6DA 4OQ4A 2Z4RA 4FD3A 5K0NA 5KSZA 2AG5A 2GUWA 4B34A 2CXRA 2F3TA 2HU2A 3EDCA 2XWBF 1PL8A 4BNKA 4O2BF 2OCYC 1PBNA 1V11B 4JSTA 4OXYA 3SHVA 4IUYA 3AVYA 2XA9A 2RGYA 4LGYA 4DR4B 2FN4A 2IDZA 3MHHA 5LZ8A 3JSAA 1NNLA 1U9IC 3UN1A 3TX6A 1CR1A 5HXAA 4IFTA 4UUPA 3FCYA 4GOLD 3A6FA 1XZIA 1HG0A 2HHCA 3N2LA 5FPQA 2RK4A 1NVKA 2XDYA 4FT2A 1Q7CA 3ZU5A 1S9DA 1AXEA 2P79A 2ZIZA 2O8EA 1TL9A 1KVSA 4RVFA 3LXSA 3CVWA 3B3JA 3L49A 3ZLBA 4BX3A 4PN7A 4RCZA 3SEQA 4WZZA 3VA7A 1IZ7A 1QQ5A 4PT5A 2QVCA 4KIFA 3ZU6A 4KIWA 4TZ0A 2RAFA 1VLHA 2Z2ZA 1EB8A 1L5OA 1W8DA 4X64B 5JXGA 4DTCA 3CNHA 2IRWA 1GGJA 5E9AA 4F8YA 2F9LA 1W7AA 3H9GA 3QUQA 2PIAA 2H65A 5E95A 1GDHA 1JXMA 3A26A 4JKYA 1N33B 4LI3X 2O8VA 3WRWA 2LTAA 5HGJA 1DPGA 1JDVA 2YTZA 5C31A 1IM2A 1P3JA 3K70D 1BGXT 1NIJA 5DGHA 4YP6A 1P7WA 3SFVA 4RNCA 2AJLI 1A6RA 5JH7F 1PZFA 1Q0PA 4L27A 4PWYA 3UB2A 1CX9B 3WE7A 4DCSA 2EJCA 3DAGA 3H5RA 5KO3A 1ZM7A 1BMFD 4LXHA 3I2KA 1P7PA 1SBQA 4TTRA 4X6XA 3TLCA 1WXDA 3COZA 1IY1A 4RTMA 4KL8S 3KVVA 1CJMA 3OT1A 4N7JA 1RDFA 5JAHA 3VV3A 4BTEA 1KGDA 4QUJA 3DE6X 1KYQA 1IM5A 3HI6A 3ISTA 4Y6OA 3BRWA 5KSPA 3BFPA 1UQUA 3UJCA 5K3EA 2QE7A 5DKFA 3I8OA 1E1NA 1C7EA 3KAJA 4R6XA 2FOXA 2QM7A 1U5IA 3F49S 4DNOA 4K7CA 4G9BA 3TSYA 3T99A 5CB4F 4CDRA 1T9BA 2HEGA 1JR3D 1CHNA 3AHHA 1S2DA 3COVA 4QULA 1KO8A 4X1IB 4X91A 3TD6A 5KINB 4IXMA 3CKKA 2J59A 3CX6A 4K40A 3RUAA 2PUEA 4LECA 3O73A 1DKIA 2A59A 3OJCA 2CD7A 1DIRA 1U5CA 2DAPA 2H18A 2X5NA 1GT91 4H7PA 4IIHA 3M49A 5NLLA 1KJJA 5EXSA 3A7DA 3FIUA 4MWOA 4E70A 1I7LA 1MLDA 2AZTA 4L75A 1ZUD1 2K87A 1CFZA 1Z17A 4GFDA 4IM7A 2O14A 4JLDA 2WAMA 2JASA 2UVPA 3KQMA 4MVJH 4PYIA 1ZA2A 2C1XA 1CEQA 3DZKA 4ZO9A 1ZVMA 3G23A 1CZOA 2AMFA 4X3CA 4X7MA 1QHIA 2Q3HA 2ODBA 3V2GA 5L4NA 3U5TA 3HCRA 4RGQA 4EGQA 4BMDA 1UKFA 2W70A 2C1ZA 3A8TA 2DHQA 4NCHA 5F3DA 1Y37A 3LIPA 2FEWB 4MDHA 1IOVA 1CY1A 2FEOA 4F8EA 4YX9A 1I9GA 1R6VA 2GI4A 2J9FA 3WTCA 4F3YA 5JA7A 2A9FA 4DYDA 3AERB 3F74A 4MAFA 3NAMA 1TKAA 13PKA 2FZCA 1CQIB 1ZXXA 4FMCF 4QNRA 3RAFC 3HO1A 1SOMA 3LVQE 5DTIA 3F8SA 5HCIA 1WKVA 2ZQ5A 5AHOA 2JKYA 2PANA 1JSLA 3SJCA 1JEEA 1B93A 5HYVA 3UAGA 5KOYA 3R0ZA 3AFMA 4O0LA 2IZ0A 1ZPDA 2WJAA 2QDKA 1PEYA 1U3VA 1V25A 2H7YA 3DMNA 4RLSA 4HR7A 2ZYRA 4P6VF 1NNSA 1HQKA 1U9ZA 2FSUA 1JMYA 3K9HA 3GJRA 1NX6A 1OZGA 1DHTA 3AEQA 4UDOA 5H4HA 3UAXA 2OAGA 3U5ZB 3DP9A 3QU2A 5TPZA 2OHIA 4KXUA 3MPOA 1B2RA 2X5KO 5AI5A 3D02A 4ZFNA 5B1EA 2HSJA 5CB0A 1L5YA 2LNDA 2MINA 1EGMB 2Q3JA 3GWZA 1NVAA 4TQAA 5FV7A 3BPMA 2JVJA 1HYBA 3UICA 2EJWA 5AKJA 4Z8YA 5TY0A 1HE8B 3EYAA 2IYZA 3ZDAA 4QYWA 4RX1A 1CC1S 2QG6A 3OJOA 1WMAA 2GOYA 3PVSA 1H65A 4TZKA 3T3DA 1SVNA 4NV1A 4A16A 4D74A 5C7YA 2A8YA 4B40A 3OQIB 2RHDA 1BQEA 3LLCA 2HWUA 4ENPA 5EY5B 5BSEA 1GR1A 1E3WB 1OHHA 3ETHA 3IIMA 3QITA 1H9BA 2GZ3A 4IHJF 4JNKA 2NT4A 3CZCA 1E3JA 3K9MA 2BCEA 3CG0A 5JI3E 4M9QA 1L7PA 3HL0A 4IIFA 3KOZA 4DV3B 1OD6A 4BMZA 1T3SA 1K5PA 1LK5A 2P9ZA 4X6LA 4DIUA 5KJ6A 4HGZA 1X13A 5FNVA 4BKPA 4PV7A 3VU3A 2X8BA 1Z0DA 3N7UA 2Q3DA 3TNDA 3KXDA 4RLFA 5KHLB 5L53A 2V0CA 3ANLA 1ZS9A 3ONDA 2QVXX 4L76A 2PVPA 3FVVA 2DJIA 3TW8B 1JVBA 4J0EA 3TNJA 1SFRA 2HK9A 5I7OA 2DM6A 2DC1A 4OYRA 2XUDA 4O25A 3OJLA 4Z7OB 1PR2A 2G28A 1FRQA 5J2TB 1QG6A 3WXMA 4KDRA 2B83A 1DZ3A 1NWHA 3IB6A 3EZGA 3KOWA 3MTBA 1KMHA 2JK0A 4OQXA 5E6RA 3T7AA 3FPEA 1M10A 3DZGA 4MKRA 2P3SA 4Q4HA 5AM2A 4EDFA 2D59A 1WO8A 4H9GA 4RUKA 5IAOA 3NKVA 5CEFA 1JR4A 2HFKA 2IXTA 4MO9A 2NZVG 3L1HA 4YJGB 3IQXA 3H9EO 4X1YA 1ZMOA 3QA3E 2RAUA 3VTAA 2XNSA 4LYGA 3KQSA 3WL8A 2JAPA 3TOVA 2BHSA 4RIGA 2XQFA 1T8SA 2BH9A 3A6ZA 1FBNA 1POWA 4MRPA 4ZV4A 3U7GA 1DKPA 1F8FA 5FOWA 1KRHA 2GEVA 2IZZA 1Z7WA 3OZIA 1ECCA 5LYJF 4P0PB 4DQUA 3BDIA 2ZU0C 1LH0A 1S1CA 3DKVA 1H05A 3MWYW 3PA8A 4K5QA 5E9WA 4E2ZA 2LUOA 3CSDA 1ZSYA 4TLCA 3EVAA 4BV9A 3X43A 2F4NA 4GX2A 1BCSB 2ECPA 5KYWB 3O91A 1NMSA 3O8BA 5BVHA 4WA8A 1BDHA 1WXGA 1XV5A 4PHCA 5CM9C 1PFWA 2C61A 1PL0A 3H5WA 3KJFA 3P2OA 1AE1A 2OFWA 4LJYA 1EVYA 1VC2A 1A8UA 3QLUA 4GBED 5C53B 2Q6KA 4CM5A 3ZIUA 5KYUB 1U0TA 4RD3A 4F5YA 1M2WA 4PC7A 3OUTA 5I6DA 5J4VA 2J4FA 2RARA 1BWQA 1YQQA 2RGAA 2EG5A 5FPPA 4INPA 4F11A 5CVEA 1ZZGA 1OMOA 2YJ8A 2PMDA 4QRGA 4KE8A 4NOKA 4E2WA 4EG4A 5JADA 2I8LA 3SIPA 3U16A 1D1TA 3G17A 1B8PA 1XXLA 2VIIA 1GPNA 1QYVA 1C4KA 1S96A 3MLAA 4RGVA 3F9CA 3SZGA 2ZCUA 1A9ZA 4CKEA 3KFQA 4FD2A 3ZXUB 1JHUA 4JSRA 4A0RA 2QUKA 2OV3A 3I83A 1SK9A 4CTJA 5TIIA 1UC4B 2XSZA 4D3YA 4TV9B 3GJ5A 1N3IA 2AS0A 3FR8A 3L84A 1L7AA 3NBQA 1RRVA 4JHXA 1O1YA 4LK3A 3ZDXB 1I2BA 4LHVA 3WGVA 4ED9A 1L7QA 2JIRA 2ZRHA 2XQIA 4TWAA 2HTEA 3RJMA 4P7JA 4LGVA 4XXHA 3I5XA 1E4OA 1G6HA 2O3UA 4OBXA 4TTPA 5EQJB 5JRDS 1UQTA 1GXSB 5CLGA 4S05A 3DUWA 3VZRA 3ZDRA 2FTKE 4G01B 3DM5A 1MG5A 3AW8A 3JATB 2IUUA 3B8HA 4BWGA 5KTTA 1UBCA 1ZSVA 3B20A 4KGVA 4IDNA 4YJ2F 2V65A 4N6NA 4QQRA 2ZCJA 2J0SA 2OE2A 2EGGA 4WGGA 5LXTF 1M0SA 2ODWA 4UUQA 4BMSA 3BMOA 1BJKA 5H3HA 1E5TA 4DYVA 2VJBA 2ILTA 5G1OA 4I5GA 3ZVLA 4EDHA 4EY4A 5GPBA 4R5MA 2P7UA 1YFJA 1FPMA 3OD1A 5BSHA 5HFNA 5LQMA 5IRCD 2BAGA 2ZIXB 1QTRA 1SBTA 3WGOA 2QYTA 4EJ6A 4F96A 2H0QA 2VF8A 2KLBA 1ZI8A 2HRQA 3IMGA 1C4WA 3LUDA 4P33A 5FL3A 1DXHA 2VQ3A 2ZRMA 1KERA 1A27A 2ZRIA 4M1EA 3H8VA 5JTTA 2IELA 1J21A 4R6WA 1T5IA 1ZZEA 2XDQB 4GRIA 4YN3A 5E1DA 3FFTA 4I66A 4A91A 3VPFA 4B7ZA 3VAYA 4HB4A 2BDZA 4D4KA 1YZYA 3EF0A 5F4BA 1LV8A 3DO8A 1C0PA 2QMZA 4LNHA 4KO8A 3LU1A 1P8JA 5FL7A 5FTKA 3M4XA 2YMQA 5DEOA 2QZ9A 1GYPA 1MEEA 4HDNB 5GINE 3F46A 4KU4A 4RHYA 3ELWA 1F4LA 4RJIA 3DMYA 3EH2A 1UUFA 4NH0A 2ZRDA 4M49A 4OTZA 2H29A 4I4IA 1RTKA 2V1XA 5FIUA 2O6XA 1H6CA 4GYYA 3I6ZA 2PFGA 2WYVA 4K9RA 3WMWA 1EGAA 1QV7A 1TMYA 3S8YA 4U6SA 4AULA 1M2HA 2CUNA 1ZCZA 4GPBA 4AMVA 1T9KA 5BWBA 5CA0B 4NG5A 3VSDA 4YECA 4CW7A 4DIKA 3QG5A 4M55A 1MX9A 1YRBA 3DVSX 3R3XA 4ZDIA 3GRUA 1OX4B 3R40A 3KZXA 4N54A 4RA9A 1OI3A 4XTCS 5K2OA 2QD4A 4F38A 2PXCA 1UK9A 2YX1A 4Q21A 3VHQA 2C83A 3QUCA 3TX2A 4B6QA 3TEJA 1NI5A 2P6RA 4XX0B 5FOUA 4GKKB 2JBWA 3B6IA 4IIJB 4YUZA 2XMZA 1UBKS 1Y6QA 2XWQA 2XXBA 3JWHA 3U4HA 3UXEA 1MH9A 4CZ2A 2O4UX 3L4EA 3QUSA 4MNTA 3O82A 3TMAA 4M1KA 3UVEA 5KTOA 4PHTA 4OKSA 1O96A 1Q6KA 2IH2A 5FR2A 2HKIA 3E0XA 1GFIA 4TXLA 2NAPA 1FJHA 1FXSA 1RYEA 2E37A 3WNCA 3OIUA 4NMLA 1KC3A 1Z12A 4ISCA 3B2NA 3OOWA 2FZ4A 3VC7A 5IKMA 1JQJC 4RJTA 1FJGB 1DZIA 2FPWA 4D25A 4GMXA 1NONA 1UXIA 1IBKB 4X3OA 3CR7A 3MJ4A 1K6EA 2FHPA 1RYYA 1W4AA 4JLBA 3NIFB 4P22A 3X3HA 1A71A 3NEJA 5AOVA 1GPBA 4EGFA 3EZXA 4MB0A 1BA2A 1LZKA 2BKUA 2FN3A 1JHPA 4EOGA 1Q2UA 3K09A 3ACBA 3ET4A 5IUNC 1AMNA 3GEBA 4WGFA 3KPUA 2F55A 1FVFA 2X58A 1XDBA 2GM5A 4HXFB 4TXNA 1I01A 4XIGS 5J5VA 1XAHA 1PL7A 1P1HA 1VKOA 2WSYB 4HDQB 1VIAA 5FOVA 2OQVA 5FLEX 1SU4A 2GEBA 1ZINA 3CN7A 1QCDA 3LX6A 1P2TA 4RPGA 4TLEA 4X93A 4CQNA 4RQAA 1Y8QB 4J2HA 2PNFA 4LRWA 1G42A 3WLSA 4D3DA 4Z51A 1MNAA 5F02A 3G9QA 1H66A 2F1IA 5IH3A 1O77A 1JFFA 3DZ8A 5CCDA 2MIIA 3WL7A 3P4UA 4ZGGA 3B9PA 3BTOA 1FFSA 5JO9A 4PCUA 2XWJI 5AI9A 3S99A 2PUTA 4V0OA 2O07A 2OXRA 3BMNB 3U4QA 1ZUHA 1SQGA 1D2RA 1ATIA 1R0SA 1G7CA 2VJMA 1MABB 2JFOA 2XF2A 3RV3A 4KX5A 4D9CA 1IDN1 1N34B 3I1YA 3ZQ6A 2XUZA 1PSWA 1DKQA 1ZK3A 1Y4SA 2W11A 2WIJA 1YB2A 4WXMA 3QJGA 2BBOA 3C4JA 4GPD1 1E6KA 2YV5A 2FLKA 2P0YA 1Y1SA 3FPBA 3K15A 1E7YA 1W30A 5EINA 3KXIA 2VG8A 2R1VB 5KHAA 4BQQA 1JG1A 3VH4A 1YK1A 4J0CA 3FI0A 4IGKA 2XOEA 2OZ2A 4FK8A 4L4UA 4O2AB 3QQ5A 1SXJE 2G09A 2O7RA 2PGDA 4UOQA 3ZLTA 1OU0A 3BJZA 2OLEA 1KAOA 4AECA 4JP3A 2P9FA 1HZJA 1DOHA 3K9LA 4QDUA 2Z3ZA 1ZSNA 4CF4A 1CVRA 1Z62A 1NQXA 2IXBA 1SXGA 5HJ2A 4EEZA 4F4UA 1Z4MA 1SC3A 1QHHA 1U8EA 5EKDA 3DBVO 1BFKA 1SQFA 1WTCA 2AFHB 3NYRA 3MILA 4MV9A 2GWRA 1SCJA 2ZQZA 3QTBA 4QIHA 4Y9UA 5TQ2B 4C20A 2QTHA 4QKQA 3S3RA 1TTQB 2GPYA 1XRRA 3J80A 1GM5A 4KXQA 4PO8A 3A70A 4RZHA 4CCYB 3E27A 4ILKA 5GTDA 2FPOA 2TS1A 2XTAA 1Y89A 2PU7A 3GRVA 1CJKC 1VL0A 5IANA 3I5YA 1V8PA 3L93A 3PFNA 3SYTA 3WLPA 1UPBA 4ZOLA 4LSZA 4MYDA 4CT5A 5CITA 4QEZA 2MTBA 2HWXA 2ATOA 1DAIA 4F6RA 3NRJA 5JSYA 1VA4A 2V7VA 4X1KA 2QN7A 2FW7A 4QGHA 4QJ5A 3RHZA 4NCAA 3BZBA 4CHTA 2WJIA 4XFJA 5C0OE 1XNJA 3JY6A 3B6ZA 3KAQA 4IIYA 2O7QA 1D1QA 4F84A 3F5SA 3L8MA 3KR9A 2XKBA 5BUQA 1MIOB 1X7WA 3M3DA 1KIMA 1LFAA 1T3ZA 4J0KA 4PYQA 5FPSA 3WAJA 3QKIA 4DDWA 1IBCA 3E7FA 1GGNA 4OH7A 1KARA 3OKPA 2G67A 521PA 3B1FA 1RQLA 3LBYA 2ID7A 2EFEB 3LUKA 4ASUD 4C4OA 4PS0A 3R2JA 1X92A 3WKBA 1R4NA 1E2QA 2AV6A 3CUVA 2IYUA 2I4LA 1V7QA 3KKNA 1ILEA 3JWGA 3AL2A 1Z5WA 3WMXA 4E1BA 1J5EB 3Q2IA 3X1ZA 2CBXA 4QWMA 2UU9B 3I12A 4CF5A 2OV8A 2OCLA 2A1TR 3MUEA 3OPXA 4L8FA 3OCJA 2B7BA 1Z9BA 1I8TA 4LRYA 3AFNA 4Y6LA 5HE9A 3TG2A 2VWPA 1AU3A 4PYLA 3OZTA 4MPTA 5SV2A 1QOZA 4HMPA 1ULAA 3DTVD 2RGNA 1J0XO 2JLSA 2JFXA 4MEJA 2AVDA 3N8DA 4Q01A 3TQOA 3GNSA 1JDBB 4IVPA 2POQX 4W7IA 2HAEA 2JFUA 3UW3A 1G21B 1MA0A 1ICFA 4GOOD 2ZYHA 3TVDA 3DF9A 1LS1A 2BTWB 1YE5A 1TTPB 1ZGCA 4HCJA 4I50F 1MP0A 5AW5A 1XO1A 4BQRA 5K20A 1N2IA 2GH1A 5E8RA 3N8IA 3I0NA 4DMMA 4LOLA 4A1OA 3I9LA 2DU8A 4L1KA 3V8RA 4WBNA 2HWKA 1TX4B 4H1UA 4RA6A 2X76A 4HNRA 1LB1B 2Q4TA 4KX3A 2XXJA 3PHXA 2WUVA 1NY6A 1RKQA 1VMEA 4NV3A 1R1DA 4PEVA 2X0NA 3N05A 4B8YA 2OV6A 3IKJA 2ZWAA 5T4HA 5EHIA 3AJ8A 3CVUA 4C2UA 4M1QA 4GVPA 2Y2UA 4AMYA 1YRLA 4B0OA 1J1ZA 2IIQA 2O54A 2AG8A 1WBJB 2FVYA 3AESB 2NQDB 4NAVA 4CLRA 2BISA 1Y9JA 4G9EA 4JQCA 2J6CA 4BO4A 1X7GA 2Q4BA 2WMYA 2XJ9A 3CW8X 2Z1DA 1OWNA 4R84A 1L2TA 1KRWA 1J6UA 2J3KA 5CA1F 3DXZA 1VFNA 3I9OA 1NN0A 4UXHA 1YL5A 4WNIA 4IIVA 5K4GA 3AYZB 1H2FA 3AL3A 3IDZA 5INTA 5LMCA 1C1XA 2PWAA 2WSSD 1CUAA 2G04A 4TRJA 1YVPA 3GA7A 4X41A 1R4AA 3KUKA 1B1CA 2VZ0A 4HVLA 1HNZB 3ZE8A 3D59A 4QVIA 1Z5PA 3G1UA 3HEMA 5J5AA 2IHBA 3H9JA 5TVGA 3IAFA 1NJ5A 2AJ8A 3H1EA 5EUQB 1JI3A 1KE1A 5KX5A 4FTWA 1YD7A 3N8KA 4NP6A 4O1MA 4OP2A 1KEVA 3R7AA 4EENA 1P5FA 2QI9F 4MUGA 1NXTA 5D1HA 2M98A 3TECE 5JNRA 4L9AA 5CK5A 2NVUA 4CKWB 2BE9A 2J30A 1JLRA 5GIPE 1SVWA 2JFPA 3W79A 1XPUA 3WK7A 3WS7A 1NP7A 4I14A 2V8BA 1GNRA 4DDUA 1R4MA 3E0QA 2Q9UA 4KBFA 1M2KA 1WCIB 3W3AA 4LYYA 3I53A 5DBIA 3RAPR 5HRUA 2D6FA 4I7EA 5EJIA 4FGZA 4NXMB 2QM8A 1KZYC 1HLDA 2OXFA 1DFGA 2H1SA 1E0JA 2VDMB 2ZJ3A 4HSGA 2WWGA 3ZIAA 2QIOA 2R9OA 4JITA 5WRFA 2CE7A 1E1LA 3Q40A 2X9LA 3QEMB 4LC9A 3OZWA 1B0AA 4NG4A 4RHFA 4F60A 2D13A 1C8VB 4R01A 2JIQA 3W7BA 3ORRA 2CUZA 3TLGB 1ZFNA 5DHTA 3U81A 3UXYA 4IJ6A 1BNCA 1I0ZA 3HN6A 4BMCA 3DDCA 3G6KA 5F51A 3K05A 2IGTA 3DUFB 1Z68A 4FZ5A 3QKRB 4HBGA 3GEGA 5TV2A 2YV1A 1FXWF 1Y1TA 1R0LA 2YFKA 2WHPB 5JDCA 3UB3A 4TV8B 2BL4A 1A9PA 1VXOA 2Z1NA 3AILA 3A4VA 3JASA 4Y6PA 1TVKA 4OHCA 3W6ZA 5HZGA 2I4RA 2PUVA 4KH0A 3U6KA 1O94A 4GYJA 2RAVA 5EVJA 2BMDA 5BV2P 2BR4A 2BH2A 4BP8A 3JQ7B 4U2CA 2PX2A 3T61A 4DIFA 3GLGA 1XKQA 5L3ZA 1MVOA 4EGJA 1E9RA 2V6GA 4OQDA 1VJVA 1PR9A 2XBLA 5FYQA 1XEXB 4CU5A 3EFEA 1F9EA 1LJ8A 3LJKA 4QOSA 3RS2A 1UDAA 2PH1A 1JDBC 2AQIA 4MUJA 3S1LA 3OG9A 1FUKA 1KKUA 2QTGA 1PJAA 1Z6YA 5EKSA 1M73E 2Z9DA 1QQ6A 1DUVG 1WZNA 2W58A 3KFXA 4MYSA 3SIWA 3A1FA 2D7CA 4BVJA 4JLMA 2PAFA 2ZBEA 4P4GA 1YR1A 2HX1A 1NLFA 2QX4A 2ZJ8A 4GNRA 4L78A 1ECGA 3DGEC 3LWDA 4ZP1A 4U7DA 1ORHA 2ATXA 2P69A 1PJSA 4BMPB 2A1UB 2QZ4A 3QFCA 2ZUUA 2VDLB 2WF7A 3R0IA 3TD2A 4LHZA 4QGAA 3TOCA 3QPCA 3B9RA 3CLKA 4E46A 1FSZA 4UHDA 4XJTA 1RC1A 1HO3A 5J3JA 2ZWIA 5CVUA 4C05A 1US8B 3A2LA 1QHEA 2QMYA 5JIBA 2JNWA 4E7OA 2CLDX 5E7JA 1DQSA 1TF5A 2Q27A 3QUTA 1W46A 4H3VA 5F7ZA 3IAHA 1JAZA 2PRYA 2YJGA 4BNUA 3KKQA 2R4QA 4BO6A 4LZNA 4EL5A 3G1WA 1C3EA 2QTBA 2XITA 3CE6A 4CVNA 4TT3D 4D44A 4IICA 5DOZA 3CH3X 1GNQA 3NKFA 2DWQA 2VN8A 5KB3A 2I62A 3PCRB 5CTAA 1P0MA 4UVGA 1PJRA 1BE1A 2JJ2D 2AG6A 1LVHA 1WLYA 1N0IA 5KOHB 5DM1A 5TJHA 3C3XA 2AZXA 2IKQA 1J24A 3P96A 4GM0A 2G4VA 2XKJE 4M8SA 5ALWA 4E5MA 3RGGA 4P98A 4MM3B 4CM4A 2GEKA 3WZ2A 5ALIA 2GM4A 3ZKWB 4XM2A 3M6FA 4GR5A 3PFIA 1CVLA 2IPNA 2AK2A 1THGA 1ZD9A 1WUHS 1L8OA 3BILA 4RIIA 4AYWA 4YJFB 4W5BA 4NWIA 3TKAA 4ZKDA 2PU5A 4LE1A 1FFCA 4N18A 1QFJA 2NU9B 1DRKA 1ODSA 2IYNA 1VJDA 2GLUA 2WVGA 1SQ0A 3QY0A 2AC7A 4K05A 3HRKA 3CINA 3SMQA 2F62A 2DHRA 3OBBA 3KKPA 4BVLA 4KYVA 1JKJB 3O2NA 3AVWA 3BCNA 4HV4A 4PRYA 4ZVQA 4TKVB 2QYSA 3GJ6A 2QRUA 1A1SA 3PQ5A 1V95A 1YZLA 4K0RA 4OB8A 4CWAA 3TIGA 3H4IA 2ZS8A 4IX9A 1WCWA 5IT4A 4RPLA 3B78A 1ADGA 1T9DA 1UZAA 4CM9A 1R0BA 2V6JA 2Y99A 4UW9A 4YCSA 2YXEA 4D02A 2VDOB 3PRPA 1HDCA 4GWLA 2EFCB 4ZT2A 4F5DA 1JAYA 1QYCA 3JV7A 3EZFA 5CNIA 3W1VA 4ZT6A 4W5RA 1RC8A 2ATCA 4P4LA 4D3ZA 4ZK2A 2E89A 3PIDA 1PZXA 1RWMA 2AWOA 2B9VA 3JXEA 3LXUX 2NPOA 1G20E 2UKDA 3P9SA 4HN9A 5F1YA 5FRDA 2OP3A 1Q6YA 2L2QA 3MLBA 2B61A 5K9ZA 3GT4A 1W4BA 3OD5A 5CJJA 1UFVA 3RU3A 5KC9A 2F43A 4J76A 4ZPJA 3UJ7A 3SVTA 1CUUA 1FU8A 5K16A 4P5EA 3PC7A 1JSZA 4U7FA 1LPNA 5JV5A 1GMYA 3NHRA 4ZCSA 1V3VA 3HUUA 4HEA1 4YJHB 2UDPA 3FCXA 5CURA 3ECCA 3M83A 2Z2YA 2WHYA 3AUKA 3C5HA 5AVJA 4CU2A 4G0VA 1A95A 3MJTA 4GW3A 3QFHA 4AWAA 4MUEA 3A4IA 1SA0A 2IDJA 3G9TA 1SBIA 2VJOA 3I2HA 4NZPA 2BTEA 4RNDB 1OHHD 2W83A 3Q2KA 4P34A 1ZNZA 1DCFA 3RFXA 3FMFA 1FC0A 2F1HA 2VA8A 1BXRB 3SN6A 2HADA 2F3RA 2OBFA 1E2FA 1FYFA 3B9BA 4C14A 4TYQA 4TPKA 3TSAA 1SG6A 9MHTA 2IW3A 1E7SA 3NT4A 4DWVA 2TYSB 3SC2B 1GFSA 4AZVA 3KFLA 3U56A 3LPCA 1FLVA 2ORIA 2Y1XA 3DEIA 3ORSA 4FE3A 1HR0B 1REQB 4G0MA 2FJ0A 4X62B 3MRXA 4X92A 2YXLA 3FDZA 4H7JA 1W48A 3AKCA 4RPCA 2P2SA 3UENA 3R5HA 5BNWA 2JKZA 1C9EA 5CVVA 4D8YA 3SYKA 1ZVJA 2JHCA 2W6QA 4K86A 4LXTA 4LXYA 1NP3A 2ADOA 1N4DA 3QBDA 1YKSA 4AP5A 3ZS9A 3RVMA 1VMIA 2XQVA 3ZEAA 1V41E 4EMTA 2XEDA 3A6GA 4AX8A 3EC1A 3QIVA 4HAOA 3ZD9A 4AU1A 2C84A 1KO7A 2B4AA 2ARKA 2AN9A 1MAVA 5IWCA 3GC6A 3KQKA 4Y6SA 2XWPA 1PG5A 1SWWA 2ASVA 3HFGA 3KVOA 3LLVA 3Q6MA 2P5SA 4N8SA 1VIMA 2L19A 4ZRDA 1KOJA 5EHXA 3MHSA 3QEOA 2BFMA 1WRBA 2B1RA 3DG9A 4IKPA 3C7TA 4JWKA 1IOWA 2W6ID 3PHJA 1Q91A 2CL7X 3B52X 4GP6A 5H9VA 2ZBFA 4BNVA 1QQAA 3H2BA 4O4LA 2IITA 3MHPA 2VPQA 3CT6A 1JDUA 2C9OA 4AZSA 4DJTA 5B1YA 4G0WA 3OJXA 2J7PA 1MPTA 1TC2A 4DSAA 5EIBD 1CRZA 5E1MA 5E2IA 3U48A 5AVUA 4IXDA 2XUJA 1MW8X 3KSUA 3KW9A 1QVZA 2Q5IA 1UBGA 4XARA 1XDWA 2GKGA 2O2XA 5GAJA 3W4JA 1A8HA 1Z7GA 5JAMA 2Z6AA 3CLRD 3DBOB 2NMVA 1JEOA 1B6SA 1C7JA 1RJDA 4QLAA 4QARA 5AOCA 4XR9A 5JY1A 5KJCA 1Z22A 2C59A 2PDAA 4YR9A 2M32A 4BMXA 2HMAA 2Q0HA 1JKMA 3KEFA 3EPLA 2VYND 3SD7A 3H0KA 4XE5A 2EKQA 2FDXA 5JSKA 4M8NE 2ZITA 1BXGA 4OMFG 1E62A 4FGUA 5KYXB 5BSTA 3ZOKA 1VGQA 4F12A 1KAMA 4R9RA 1BFUA 1V96A 2PQ6A 3C3EA 3P9QA 4MKXA 3Q8XB 1DJMA 1Q22A 2PVSA 1M6VB 3U4AA 1V48A 3GLQA 3TJZA 3K1JA 1FMJA 2W6NA 3VKWA 4G4JA 2O9JA 1Z47A 2VAXA 4XIJA 5JCOA 2PKWA 4FBGA 1J9ZA 3M9XA 4PLCA 5JPDA 3O47A 4S1OA 1RAIA 2SNIE 5DHUA 1XDUA 2X0KA 3SY8A 1M8GA 1YDHA 5EZ6B 2WYHA 4MH0R 4PQGA 5IFLA 5DBOA 4WOJA 3RVNA 4PN3A 3Q3CA 2FI1A 2OAP1 2IKSA 2HR1A 1QYWA 3E8SA 4M98A 4NH4A 2WG1A 2A5YB 3U44A 2YOGA 3JSXA 4K6GA 3VU8A 2PR7A 3NORA 1ZJ6A 4KQXA 1J2TA 3WZMA 1TAGA 3EW9A 4LPKA 1ESNA 2IT1A 3KKUA 3WMRA 1NV9A 4K9NA 3SSAA 4C22A 2IV2X 1YZKA 4M53A 3QW2A 4UNSA 4BLTA 1JG6A 2DE0X 4ZO8A 5BWNA 3BPFA 4NARA 5A5GA 4HNAA 5ICGA 2G77B 3Q3JB 2R7KA 3IXMA 3NS7A 1OILA 3P71T 5JNWA 4CV1A 4IVNA 3WQHA 1H2AS 4JI1B 4A8JB 2BP7B 2DETA 4TLDA 4I3GA 4RPJA 2LPMA 1J90A 3A4TA 3LGSA 4F9TA 1AK2A 2BJVA 4BN4A 4NE9A 3FB4A 4RL4A 1DEKA 1UKBA 4WK0B 5LA6B 3SOZA 4F3RA 3HVUA 5C46F 3RYHA 2PK3A 3HY6A 4HO1X 1A5SB 1B00A 1Y48E 4FN5A 1M54A 1ZNXA 2DUUA 4OYLA 4RKEA 4HFNA 1XP8A 3NYWA 2FZLA 4U2FA 3JQ9A 4UEOA 5DMHA 3REQB 4B3RB 4REZA 2R0QC 2CWDA 1U3UA 2R7MA 3AXTA 3FUVA 1B26A 4CKBA 3HJUA 4D2IA 1OXTA 3LKZA 1C9KA 4NDZA 4P8RA 1O5TA 4JEUA 4DMRA 7GPBA 3A3YA 5IPFA 3VR2D 5K2MA 1J8DA 1GAEO 4KLNA 3FM9A 3ZHXA 5LP6F 2F9FA 5KTPA 1EQUA 5G1NA 4F91B 3L8GA 4NCXA 3HXMA 4WESB 2RGEA 4UTRA 4Q7MB 1QG4A 2W0MA 2WU3A 3PITA 2HIMA 3CH2X 3DT6A 4YGYA 1SU8A 3HYTA 4HH1A 1BWRA 4QQFA 5CW1A 2ZAGA 3DDSA 3EIUA 5ALOA 4V0QA 2J85A 2IEBA 2ZI6A 5LMUB 3M99A 1R27A 5CFPA 4O4JF 1ODJA 2NU8A 4O1HA 3B1XA 2I2BA 3T41A 1TXGA 4ENWA 1JTVA 2WM9B 2NNWB 1F3OA 2PSJA 2WFLA 3LBFA 3LNTA 3QA9A 1K92A 1EP9A 4YTEA 5IJXA 5LQRA 2A35A 3RASA 1PE0A 3Q10A 3M3PA 3DZHA 5AHRA 4QC2A 4EPRA 1N2JA 1YCFA 1GZUA 2H2AA 2JJ1A 4D4IA 3MQFA 2B69A 3WA6A 5JWOA 5CGZA 1Z5ZA 1VI2A 3QG1A 4AL4A 4AY3A 4O08A 2Q50A 1K6JA 3O4HA 2HU8A 2BHNA 3P0EA 4CI0B 1ZITA 1P0IA 2CDAA 3VPAA 5JYDA 2G7YA 3OEEA 3PEEA 5K3FB 4R71A 4I2VA 3MT0A 4HAXA 4QEKA 3AQ4A 4UHKA 1D03A 2SECE 2UUOA 4HN4B 1L4MA 4HN2A 3JAWB 4I1OA 3KT6A 4EGCB 3O3CA 2C2KA 3ND8A 3PEYA 1XWWA 3GARA 2EX4A 3OIWA 1LLCA 3FFAA 5DGCA 2C2BA 3Q3IA 1Z7YA 2AB0A 4YFYA 4EZIA 1VKRA 3OQOA 2QRJA 1M3SA 1MS6A 3DSRA 5IBCA 1ZOPA 1I3OA 1V4VA 1N5MA 1OXBB 2EL7A 4EBFA 1AU4A 4C1BA 5DU2A 1VDMA 5I47A 1QGUA 2XVYA 3H8WA 1ISSA 4KRYA 4DY6A 5LWHA 1E1CA 1T5DX 3FBTA 3I04M 5AVOA 5IT9A 3RT1A 4KDFA 4K1XA 2ZUTA 1B8OA 2GBIA 4C4SA 3WSVA 1W52X 2AJCA 4ARUA 4CT4B 3AM1A 3AJ9A 2V6FA 4RO0A 1JHXA 2RHTA 4F56A 3RKRA 4K26A 3PD7A 3TXYA 2VDWA 3VR1A 1EHCA 2VTDA 1X87A 1YK8A 3QXHA 3JARB 5KTNA 4JYBA 1LD3A 1YR7A 3DE2X 4ETIA 3IP9A 4CQLB 3ZXYA 1J42A 2XODA 2WV7A 3OJFA 1VPTA 1NJSA 3G8CA 3P0IA 5BN4A 5I01A 3UMGA 4LF5B 2REXB 2W2LA 2YV2A 2XZTA 1P75A 2W71A 2YZKA 3R3WA 1Q50A 4XUIA 1ECFA 1TT5B 5HKKD 1AQYA 4L3WA 2AI2A 4NPHA 1OOEA 4Y2UA 1GV0A 4A8JC 3PIRA 5J4HA 2GDZA 3GRFA 4OK3A 3M82A 4RKQA 2GD1O 3N2GB 1O6GA 2GPAA 3ZGOA 5JZ9A 2AR0A 3UPDA 2WNHA 2DSTA 1OY1A 3EUAA 2O2YA 4HQOA 1RCFA 4AUNA 4FI3F 4CM3A 1N36B 3CKYA 4QRHA 4MOWA 5T5QA 1DQYA 2RHBA 3TIFA 3VXKA 5AK5A 3NM5A 4JVMA 1T2FA 5CIQA 4D9JA 4EGSA 2JQGR 1ZBDA 3KB6A 3L4BA 3TG8A 1F8GA 1SC4A 4IQ8A 2MYTA 4DMLA 5KMGB 1QP8A 1F5SA 1Z35A 1ZH4A 4X6YA 3EOZA 4F1KA 1UJMA 2YYYA 4M36A 1JJFA 1AMOA 3PJFA 5DHPA 5JZEA 3TQFA 1OWMA 4WCFB 2DT5A 4UARA 2PT9A 4WLFA 5TQ0B 4KRFA 3F5VA 3JQCA 2BVNA 2V4UA 1T2AA 1TYBE 1UBHS 2Q45A 3IBGA 4IINA 4OSPA 1H8HD 3AY6A 3EAFA 4AG3A 4CXMA 2ADFA 3ADOA 4L72A 3GVIA 1PPPA 3N2IA 3DH0A 5DHRA 4DS3A 3CRNA 3I9KA 1GNVA 3ICEA 4XWKA 3OF5A 4KQKA 2Z30A 1NDHA 3N5CA 5LQAA 4PR3A 4BMVA 4O3MA 3TTXA 2IYWA 3ON5A 2BKVA 4DZZA 1H4QA 1VLLA 2EXXA 2FRVA 4WK2B 2QVLA 5HDBB 4PVDA 1ODFA 1VRWA 3BHIA 5B58C 2DWOA 3R20A 4L6AA 2BR3A 4BUZA 3PX3A 3GGSA 3L06A 1T1GA 4NYJR 4W7SA 1IJBA 4KJZA 4LZPA 4M9XA 4XQEA 3WAKA 5JYCA 4R2XA 2J7QA 4NNJA 1EFVB 1U9JA 3VO2A 2Q3MA 3QLJA 5JVDA 1D7OA 1V8FA 1JR3E 1LEHA 4S1TA 4R7TA 4I9HA 4ISBA 1N6LA 5IM4F 4QHTA 1RM0A 2ECKA 3CR3C 1UPUA 5DHFA 3O8CA 1OROA 1H2WA 4QBBA 1XD9A 3H19A 5DVZA 3AR5A 5AW3A 1XZLA 1Y3BE 2HXZA 5KVQA 4B35A 3CUSA 1JG3A 2JI9A 5P21A 3FDFA 3R5KA 3U6BA 4P16A 5M7EA 4LNUB 3KKMA 3DKIA 3NXSA 1PKEA 3QXJA 4D9IA 4D8UA 3BWKA 3V55A 1FX0B 3T3EA 3OMXA 3ZWPA 2HMVA 2INGX 5AWFC 4V2UA 2YIDA 1V5WA 1RXSA 3Q87B 4TWIA 3C70A 3G5TA 4OOEA 5BR4A 1F0NA 1OWOA 2AOTA 3MWFA 3SFZA 2CXXA 4AF8A 2YYZA 3IIJA 4JB0A 1D4ZA 1SVOA 4N3NA 1PSDA 4RBNA 2OC9A 1SCBA 1BJTA 2OCAA 3NH6A 1KR5A 4TGLA 1ISHA 1HKUA 2AJDA 3ZWWA 5EYPA 3TTSA 4BS5A 1EUQA 4GVXA 3MELA 4G0NA 8ABPA 4R2LA 3EGDA 4TKZA 2VJDA 4XUDA 4JUCA 2VF4X 3OETA 1G9SA 5CDFA 4IIGA 4X61A 2ZUVA 4BRZA 1MEMA 3C9EA 1WUIS 1RWNA 3G5LA 5HQ3A 2Y2VA 1WZEA 5L6LB 1J23A 4JUDX 3VU9A 3EXHB 1M9NA 1MDWA 4XM0A 5GY7A 1BEEA 4R9SA 4KWTA 5KYYB 5JAPA 1T8PA 1YI8A 1Y4UA 2ZSDA 3L18A 2YXPX 3R0QA 4X5OA 2X0FA 4F3CA 2NGRA 4AZ0B 2RONA 1IVNA 2UYOA 3IRVA 5IZCC 5DRTA 1UZUA 3PC2A 4HEHA 1WTAA 2G80A 3EH1A 3KDPA 4DR1B 2R9CA 3SS7X 2FGJA 3JQPA 2WB2A 3BGWA 4JYPA 1MQAA 5ER6A 3NDBB 1KXRA 4JEHA 4N79A 4WN9B 4IVQA 2ZSJA 1KFJB 1Z3IX 2PLAA 4D9FA 1E1RD 1BAPA 3SVLA 2JRLA 3IFUA 4AUKA 1DJPA 1C14A 1XI2A 4E5PA 2FEPA 4L2IA 4AMUA 1UP7A 2ZKIA 2CD9A 4ZJUA 1M8KA 4UTNA 2I76A 3AY7A 2AKYA 4JX9A 4QRIA 4REMA 1AKVA 2CHQA 2BFBA 4LRQA 3R8FA 3QKSB 2E4WA 1Z4QA 1CY0A 2HQOA 1SBZA 2WZQA 2MJLA 5IN5A 3V2HA 3SLGA 1U3CA 4JUAA 1R8QA 3H83A 4DCTA 4JI7B 1HX7A 3DOUA 5FEUA 1NL6A 2KMLA 3DWEX 3FNBA 3MJRA 2VNJA 4HAWA 1QIHA 3P4XA 4JL5A 4P7FA 1A4XA 2V7XA 4WCFC 4AJKA 1E5XA 1Q1ZA 4GZ5A 3T3MB 5K8CA 1QU2A 3FNGA 3RJTA 5EF4A 2XD9A 4KO3S 2KBFA 1FLAA 4AM8A 2PX4A 4BEJA 1VL6A 2AH5A 4EI9A 2Y4OA 3GLIE 2CFSA 3IL2A 3K70C 1IZYA 3CE9A 3FGPA 1MHPA 2X0IA 4LF9B 3W3AD 5L51A 4ZGWA 4ZZ3A 3RTEA 2VSOA 4MVJA 5CCEA 3NASA 4P6GA 4BOUA 2FWIA 3V1NA 2AI3A 1EGHA 1W4LA 1A8SA 2XYQA 2Y8EA 3CY6A 3I76A 4RM2A 3SIXA 1Z34A 3ZKAA 2IP1A 3ANXA 2Z56A 4JYCA 4MS4A 1U7HA 2H4YA 3KUUA 1QRSA 5K03A 3RRZA 3RNOA 1BKYA 1KI7A 1P73A 2EF1A 2KBEA 2ONYA 3OFSA 1O0SA 4MZSA 3CU5A 1EWRA 3HV0A 3JQFA 4FFVA 5AW7A 2AR7A 2DR2A 1ZQ9A 3FKJA 3CNLA 4KB5A 4TL6A 3BH7A 4XFDA 3ZVKA 2AGAA 3UFXA 4NDNE 5HIJA 1DEXA 1ZN7A 4QBIA 5HS6A 4QNMA 2DUNA 2HSEA 2ZPAA 3W1WA 1VHTA 4MUNA 4Z7NB 2I3GA 4BLVA 3AIOA 3OT4A 2E3JA 5FV4A 3K4PA 3G02A 2IXDA 3VQTA 1C81A 1CJVC 2ZIEA 5D5HA 1G8YA 2JFNA 8AT1A 4KITB 1O94D 1VJ1A 2I2FA 1Z73A 4FQ7A 3BB4A 1TZMA 2P6PA 4QXRA 3CNNA 5E6UA 3BHNA 3KLBA 8PCHA 3IALA 2Q9BA 1POXA 5SZKB 1RYDA 3L7YA 1E61A 3BBAA 2XYRA 4UNPA 5KVSA 5E38A 4GI5A 5DYGA 2PBZA 4P36A 2P5UA 1M1YE 3W4KA 1VE5A 1G66A 1W93A 3R7BA 3O95A 1EUDB 1JW9B 1FY2A 1VLQA 4KQJA 4G37A 3TZCA 2ZUEA 2CNWA 3T52A 2BGLA 2A5GA 2R1TA 3E9YA 2P4QA 3GFPA 1TC1A 1U28A 4CKCA 1RRPA 5IASA 1M1YB 2E9SA 5KTRA 4A5UA 4KRXA 3RVRA 3B1JA 2HA2A 1PK7A 2QDXA 3EXHC 1XHEA 2VPXA 3A05A 4X1IA 1MVLA 3WB2A 2YXNA 3UUEA 4MUXA 1AO0A 1J0BA 1J7KA 2XF8A 3FFWA 5D3MA 3EGVA 3HZRA 5LZ7A 2Q2QA 3MQ4A 4A7PA 1C4OA 1LUAA 1PEAA 1RQ7A 2FEMA 3F78A 3RRMA 2JGEA 2CDCA 2CMDA 1AUOA 2ETXA 1Q19A 2Y6VA 3QPBA 3PGJA 3EIHA 1H5UA 4Q0MA 5CYPA 2Z58A 1EJ6A 1P29A 2Y1DA 4URFA 3RH0A 2BGGA 4ZI7F 3VPXA 1QJ4A 2DWUA 2HUNA 2YS7A 4NZZA 4MI7A 1KDZA 3OMWA 1RHRA 2VQFB 1J8MF 5F98A 3BB7A 1J2EA 1OFTA 2X3YA 3ZCUA 1YRQA 4WZAE 1DE0A 2G83A 4R83A 4YJ3F 3HGTA 3IOYA 2FLVA 1RXWA 1MHTA 1QWSA 1CQDA 4QJ4A 4C0KA 1PFKA 4W99A 4M60A 4Y1GA 4X97A 4EGAA 1KXJA 4IOKA 4P08A 1FFEA 4YPFA 4BWVA 4DWOA 4H6XA 5DBFA 5KAPA 5IJWA 4ZDWA 4JOCA 2Q62A 2LDXA 1TVEA 1XCMA 4PAQA 2HL6A 1JQLB 1ONBA 2FX2A 3PQ4A 5IVPA 3BC3A 3JW8A 3HNRA 2KQUA 3W34A 1U9YA 1ESEA 1M7BA 2YNMD 4HDSB 1CF2O 2JCYA 3P7MA 4MGIR 5JS6A 4WFIA 3RV4A 5FYDA 3L7LA 3BYZA 3ELYA 2DKFA 2GHTA 2RJ3A 4RZXA 3RNVA 2VUSA 1B6GA 1BRTA 4KMSA 2P2LA 1JGTA 1WAMA 2WAOA 4K9KA 4QDJA 4BGIA 4JIGA 1UJ4A 5H82A 3QEAZ 1S2GA 4M8KA 5DHSA 3BWBA 3NX4A 1RLUA 2PFSA 1OB2A 4AFNA 4GMGA 1AN0A 2H16A 5FI5A 3V4ZA 3LZ6A 3MFQA 2WIAA 4MDFA 3CRW1 1NVVR 2I7CA 1KJZA 1OT3A 1PFYA 1OWLA 3EG5A 2BD0A 3FOAA 3KU1A 4I5FA 4JC0A 1KTIA 1BYUA 2C3YA 3NAGA 2GO7A 1DAKA 4PPGA 3B5EA 2GHQA 3O4FA 1PNRA 4OQZA 1CCWA 3HDHA 4PGHA 1D8TA 2QLJA 3O8DA 5FPYA 1S8AA 2YY7A 3JPYA 4OBBA 1CS8A 1NBAA 1WXWA 3G8YA 1KJYA 1GKIA 1I1OA 2RIRA 1E2IA 4H6WA 2VF7A 4KSCA 3M70A 3MTEA 1PX0A 1J5XA 2EP7A 3IJ5A 1Z33A 4RMIA 4U2KA 1HEIA 4UEWA 1TGVA 3LW7A 5LCXA 4BBPA 1RZRA 1TFUA 1VGVA 3THWA 1L5FA 1LNZA 1NUAA 2R6GA 4JOQA 3Q8WA 1RZ3A 4PU0A 4ZOQI 4HWKA 3GJ4A 1XE3A 5IC6A 5BSUA 1NUSA 3OE4A 1FVXA 4MVXA 1A72A 4MINA 2AFIE 1D4AA 4RANA 3ORYA 4HFMA 5LR6A 5AM1A 3K0BA 1PJBA 1PQ4A 4RJJA 1XEAA 4BO9A 3EQ7A 2PFKA 1DXQA 4P31A 2QTMA 4RK0A 2A5FA 1OAKA 4R8SA 4N3CA 2VJAA 5IJAA 1NUHA 1WSDA 2HYIC 1X3SA 4ER7A 1T8TA 2J08A 3GPCA 3LUCA 1H9CA 2L17A 3Q7PA 4WOCA 3S0JA 1UFOA 3V8MA 4DABA 4XZ3A 5AD1A 5JW6A 3JWEA 1EXVA 3U9SA 1I2CA 2A58A 2JD0A 3VZQA 1HF3A 4Q4LA 2O23A 3RC1A 2JBAA 3KOOA 3OTQA 1KQ3A 4AMZA 4DWWA 1AC5A 2EX1A 2DQYA 3IAS6 2H5EA 2LW7A 3VH3A 4BIMA 5IBPA 4BFWA 1II8A 2JIBA 1GVNB 1T2NA 3NAZA 4GH5A 2ZSAA 2Q4OA 4G1CA 3SHFA 5U4QA 5H3CA 2QXYA 1PLLA 1Q14A 1SRRA 2PZMA 4QELA 2CCJA 2HK7A 3MRVA 4QNNA 1Z45A 3BEDA 1BHO1 1LBSA 1T4MA 2UYGA 1D4FA 3EMKA 4LZAA 2IHUA 4Q9KA 2FU5C 3GCXA 4XD2A 1IQ0A 1H1LA 5FWDA 2ENUA 3VR6D 1OBFO 2J3EA 3ELBA 2C7GA 3NLLA 4J0GA 1AKTA 1HFWA 3OVXA 2ICAA 3V1MA 5C18A 2G88A 3KZVA 3PF8A 4Q66C 4UDYX 4XJXA 5I9SA 3SF8B 3WDLA 1GR0A 2Q6IA 1N5RA 4YRLA 4FYVA 1HDGO 1HM5A 3G2LA 3IPAA 4U63A 1E0AA 2RGWA 3MCAA 2G4CA 2J7PD 3I6IA 4UZSA 1WDKA 4ETWA 2ZM6B 5JG7A 1MHWA 1Q0HA 4FKZA 3LTEA 3EJWA 3LQRA 4YT2A 4O2BB 3PUXA 2BTQA 5IUKC 5FOTA 3HB0A 3DDUA 1A8PA 2OAQ1 3KWFA 3QXSA 2HEIA 2ZT6A 2FFBA 4IQFA 3EXAA 4MW7A 2R96A 4KQ9A 4WFQA 3RWMB 4D57A 1MJGM 1SB8A 1HDEA 1RXEA 1X7XB 1QBKC 1OFGA 4C4TA 5DGDA 5C7OO 2GD6A 2H7XA 4OY3A 2FTDA 4HP8A 3QLVA 5DP2A 5J47A 3CRVA 4I8IA 3EAGA 3ELUA 1GD1O 3DL2A 3KPVA 3ISVA 1G3MA 2JL1A 3FUUA 4QUBA 5F12A 2G06A 3U7RA 3W2EA 3ES9A 4XVHA 1RYBA 1RABA 2W00A 3FVRA 5ENDA 3KSBC 3U3RA 4MRVA 1T0UA 2QLFA 2F8MA 4YRDA 1QRDA 2FPKA 4B79A 2JD1A 4BC1A 3MS4A 3HRHA 4XEUA 2CV0A 1E2MA 1CUFA 3JR3A 2OHVA 4G97A 1TUBB 1U9IA 4FDVA 1Y4ZA 2GK4A 4OQNA 4W1RA 5AI6A 5KVCA 4C29A 3OJEA 1VCHA 4KQCA 4JD5A 4FX5A 4GG1A 1E2EA 4P4SA 2A94A 2C92A 1ODTC 4FFDA 5JH7B 5DYTA 1VFPA 3NBXX 4NZOA 5SZJA 3TKYA 5BWMA 1O57A 4YYRA 3QUAA 3THXA 3X2FA 2A3NA 5CM8B 2EIHA 3Q41A 2QL6A 3WIEA 2P67A 3A6KA 3FNFA 4DRZA 3Q6IA 3WYDA 3G59A 2FUG6 3RG8A 1QUEA 4Z49A 2HYDA 2QPAA 3O5AA 2FOLA 3PQ3A 5AHWA 5TXGA 621PA 4GSKA 3IQDB 2OKCA 2X9NA 1F2TA 3VX4A 1GG9A 3OM9A 4N65A 1RYHA 1VG0B 1ZMXA 2B8EA 3PPIA 4R1OA 5T4FA 1W0KD 4AK9A 4Q3AA 4QO8A 5DTRA 1GEEA 3BRQA 3S44A 3PDHA 5C32A 4X95A 3L1JA 3C6XA 2PM8A 4PFQA 3RKSA 4QGGA 5CEJA 5AVXA 4Q1CA 2VA9A 2BHRA 1BU8A 1ZIVA 1W1IA 4JASB 4J94A 2N46A 3AETB 2NO7A 3CH5A 1FS6A 1YUMA 2JGJA 1GPMA 2OZVA 3NDPA 3DNMA 1IZ9A 1VCIA 3ER9A 3LC7O 2YUIA 1BQ4A 4XLLA 3SP1A 1XN4A 3ZZMA 4BKMA 5AQ1A 1T8YA 2JI4A 2E00A 2WHQA 2RB4A 2YHUA 2A9QA 4IS2A 2I1WA 4CLOA 3PDFA 2CNLA 1SHKA 1UIMA 2FPPB 4QECA 4REOA 4C7VA 1XYGA 5PADA 5T4BA 4RCYA 4KQ6A 3CRMA 4AAYA 2I2AA 1FSGA 1YONA 5L40A 1LV7A 1XDZA 1YR3A 4ZRNA 5KNBD 3HYCA 1E7RA 4M1WA 3RSZA 5LB4A 1E9BA 2I6TA 4L3OA 1ISRA 1F29A 1TECE 1YA8A 1ADBA 4HWSA 4G5QA 2DFDA 4GOMD 4DJEC 5B2ZA 2F1JA 2XU3A 2AW3A 2B3TA 3OEHD 4C4AA 4PNEA 3W2TA 3L0PA 5JE8A 1MO4A 1N1MA 3GEMA 1BN6A 1NL3A 3D1JA 4UTOA 5FQNA 4FMCB 2C4NA 1YJBA 5B12A 3RRBA 1RU3A 3UK1A 2XMGA 3NV9A 4PIPA 4Y9SA 3ZXIA 3IULA 3ZWVA 5DN9A 1AH2A 1R0RE 1VKZA 2I9PA 1PJCA 1Y7LA 2QA5A 1N6IA 1V3UA 1IRXA 3JYQA 4ROSA 3V1UA 5BNZA 5ECDA 5B58T 2A7XA 5JAOA 1RC0A 3RSOA 1K3FA 4PF1A 4F6CA 3AFIA 3K2BA 3QV2A 4D3SA 3N07A 1UWCA 4Z0PA 4G8JA 4CR8A 2JTCA 1W1UA 1JDSA 1SQ5A 4II7A 5JJCA 1X1EA 4L5JA 2GQ0A 1N7HA 1SKQA 3DR5A 4BJHB 2ZJZA 3P26A 4X90A 3RJ9A 3GH3A 3QKTA 4NOLA 1CTQA 3M2PA 3ZD6A 3HJTA 5GOZA 2IS6A 3URMA 3PRJA 5C8YF 4ZEOA 4HH4A 1EBUA 3WQQA 3IUSA 4E2FA 4KK3A 3H0EA 1PUXA 3KYBA 4TVOA 3SJBA 4FWTA 1NBHA 1WF6A 2F3QA 1P1IA 5LZ9A 4DV1B 1E2UA 5I4BA 3FOCA 3CZPA 3P32A 4QRXA 2YWRA 4NSNA 2APJA 1KI1A 1ULZA 1XWIA 2ZR0A 3UMRA 5JUWA 2EVWX 1NMYA 1G9XA 2BRUA 2QT0A 5AXAA 3VX3A 1EHYA 1GSIA 1SCKA 2WMDA 4M0DA 1DC4A 4IHJB 2JH8A 4IJVA 1JA1A 2HBQA 2JFBA 5M2QA 1CJTC 1ZGAA 4YYEA 2IYVA 3G7SA 1YCHA 2GLTA 1CNEA 2AGVA 4DCOA 2KE5A 1KI4A 2A84A 2ERXA 2DFPA 4GWGA 1VP3A 3LSTA 4NU8X 4QQ8A 1PK9A 3GAMA 2YJNA 3GJ3A 3NHAA 1QF6A 4CIDA 1FNBA 4UFOA 1ZGHA 2EW8A 2BEUB 2G82A 3I34X 3U3XA 1A7UA 1ZXBA 3NYIA 3JD2A 3P97A 3TAHA 1TEHA 2RSLA 5IULC 3GGJA 5DBEX 2MSNA 3A4LA 4CEIA 1N2XA 2Z8YM 3SM3A 3HJCA 3W7AA 1QGOA 1UMDB 4PW0A 1TO2E 1P44A 1GCGA 1J56A 1SVSA 2OBLA 2Z4TA 4WZ6A 5BQOA 3S68A 4PPNA 1VBKA 2BGKA 1VRCA 1FZQA 1JFRA 1GPKA 1JHDA 2JEOA 2PKQO 2YHSA 5IG2A 4ES6A 1Z2EA 5IK2D 1KP3A 5GIOE 1SXIA 4PTLA 4BNXA 1YT7A 4BB5A 1QMYA 4R41A 4YA6A 3UPTA 1NR7A 3MNFA 4OSEA 5D87A 4A2QA 2D0OB 3HZHA 1I3KA 1HDYA 4MGYR 1G64A 1YALA 4DDTA 4RJLA 4Q5IA 4HNTA 4FUQA 1V9SA 1SBHA 4PTYA 2FPXA 4K2HA 2EKPA 1I5EA 4BEBA 1OFVA 4WWHA 4XGKA 5ULLA 3BD8A 1F12A 2XH8A 1TE2A 2D3WA 1JG2A 2ZIFA 3QKWA 4TVBA 5DK4A 5DN6D 1SOUA 1BX3A 2RHOA 5U1PA 4PGMA 1C7QA 3QY9A 1EGVB 2EKDA 2ISCA 2VUHB 4MVJI 4UAUA 5LYJB 3KQPA 4EF4A 2GPTA 2O2CA 4B74A 4G25A 5DLYA 4KYTA 4EJ2A 1TKRA 4IH4A 1JPNA 4O2RA 5EJ4A 4KXFB 3FD8A 5C8XA 1Z0AA 2B2NA 3I09A 2Z4SA 2EX0A 4CMEA 2QNIA 4IWXA 4MR7B 4PC3A 5CRIA 5J63A 5L6MB 3PUJA 2RCNA 2NPFA 2WKQA 3GFTA 2HF8A 2G5PA 3E2MA 2FJPA 4X6HA 4HQ6A 4MQMA 2WILA 4NEGA 2QZPA 2EGHA 4JLOA 3ZCXA 3QPVA 3R7FA 2IU0A 2P9CA 1IK6A 1N2CB 2AOUA 2C5HA 2H07A 2Q29A 3OFJA 2A6PA 4LY0A 3FUCA 5JBIA 1MB3A 1UOPA 2AT1A 4R2MA 1I4DD 4TROA 3HMQA 4ETMA 2JAXA 5CT8A 1PR3A 4BNDA 4FZVA 4ZYWA 1FFYA 3T5MA 4K9QA 4MQ6A 5D3ZA 5AM4A 4DNFA 4LUCA 2Z6QA 1UAYA 4NU5A 2GVZC 1J25A 4DQVA 4BUCA 3GWGA 1B74A 4L8YA 3PV0A 2VP9A 1H6DA 2O0LA 4POOA 1NZFA 2D5CA 1Z8HA 2UUAB 1T13A 2ZDGA 3MXOA 2NXEA 5MDHA 1HORA 2CZGA 2JEYA 3LDGA 2IV7A 3P0RA 4OJTA 3NBUA 2C4TA 3RTAA 3UNXA 4BNIA 1Z6TA 3J7TA 3M7IA 1UPCA 1XQVA 2GRJA 4FFSA 2DHDA 3F2IA 1QNLA 3IV6A 3NTXA 4G2TA 4I0WB 4M0KA 5IARA 3VYSB 3ZUGA 2ZAIA 2ZJBA 6REQB 5ALTA 4LWOA 3TOSA 3WJ2A 2XADA 1IZ0A 3SKYA 5JCJD 2AHRA 4X7RA 4DLXA 3A1CA 2X4GA 4EO4A 3CH7A 1QANA 3KSDO 4NBSA 1JEJA 4OREX 5AJYA 4F5EA 5CVNB 1JFLA 2R3SA 5A6SA 4C1NA 2IS1A 4PGFA 1RQXA 1NW6A 1R7RA 4YCNA 2VBGA 4YJ2B 2D2FA 3QP9A 3BG5A 3HJBA 4IRXA 4WXRA 3BTVA 3WC4A 3BQMB 3LFHA 5JSQA 3ZS8A 1XZQA 1BEUB 4JI5B 5K8IA 4H4EA 3H5IA 2AU1A 1TU3A 1X0XA 3X2EA 1ZIOA 3SWWA 4R8LA 3P4YA 1JWAB 4WJKB 5HTOA 3LG2A 2R62A 1DOAA 3FZEA 4XI9A 3V7WA 3OE7A 1FMTA 3COPA 4G5XA 1QHYA 1TU6A 3IAM6 1MXFA 1HEUA 4Z0NA 5EIWA 1FJXA 2EBUA 2F48A 3CBGA 1T25A 5ALUA 1IUOA 1LQUA 4Q4AA 3HV2A 4JQSA 2HNAA 3PYMA 3OPYB 3SG0A 3KQTA 2GTPA 4BLUA 4FMDF 5I7EA 4QU0A 3LPDA 4BN0A 4B3SB 2CFCA 1NLUA 2O0MA 1YC2A 5BQ5A 1LWNA 4FW8A 4P6EA 4ZA2A 1EQ2A 4ITUA 4PQEA 3KL2A 3BH0A 5D6NA 1F1JA 4MGKR 3BMCB 1PYGA 2X8AA 2OVFA 5JO0A 1HOTA 3E7WA 1S2NA 1V8DA 3DFFA 2QAJA 2PWZA 2P91A 1VOTA 1N25A 2MOKA 3LQKA 3HB7A 1DQRA 3SR0A 2O8DA 1NBWB 2XXAB 3E5RA 1CDEA 2OO3A 3GNTA 5GV7A 3ZGVA 3AF6A 3DCIA 3AHGA 2ZS7A 3ZY2A 4OLJA 2Y3IA 4P3NA 5I7FA 4MR9A 3GDOA 3KAPA 4BNJA 1H1DA 2VQ6A 2QLLA 2NUAB 4BBAA 1WPQA 1CTEA 2REQB 2QP3A 1LCIA 1DBIA 1TLTA 1EFLA 2PLNA 3K0FB 4XQCA 2O3TA 4E6EA 4P7GA 4QOIA 2WFAA 3O93A 4FYPA 3KNZA 4S12A 4ND4A 1UBEA 4BX2A 3TGWA 1PGJA 2P6MA 4A0HA 4ARAA 4O02B 3GXBA 5BSMA 3NOVA 2PREA 3AL0C 3BXEA 3HXOA 3VAZA 4UHFA 3RC3A 5KNDD 1O8BA 2EKZA 2N75A 1UAAA 1NI4A 3NCTA 3CO5A 1PLJA 3H2YA 2YQZA 3Q8KA 2O1WA 1GZ6A 1QVRA 3AF0A 3R9XA 1L5MA 4BU1A 4E09A 2AC4A