5EZSA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease inhibited by e64d
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural Protein 2 Cysteine Protease
publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase/hydrolase inhibitor
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezsA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezsA01
4EMSA 4YUVA 2YR0A 1D2CA 8MHTA 3EPPA 1INLA 4GOLD 1JTFA 1XJ5A 1SUIA 2B25A 2BM9A 4PYOA 5DM0A 5FTWA 3MGGA 4ER3A 3GCZA 3OE5A 2P35A 2FYTA 4HSGA 5DM1A 4Z2YA 3SX0A 2DULA 1RI1A 3VYWA 5BP7A 3B5IA 1I4WA 3OU6A 1RJFA 1SVUA 3TFWA 1EQAA 1R6AA 5DSTA 2Q41A 4X41A 1SUSA 3K0BA 3AXSA 2ZZKA 3DMFA 3NVKI 4RVHA 1FP2A 3PLAE 3BWCA 3G2MA 3LGAA 3P9NA 2CMHA 3PT9A 5GIOE 3LX6A 3G5TA 3M6VA 4M38A 3DTNA 4AZTA 2G70A 3AWIA 2ZLBA 3LDFA 4FZVA 4HTFB 4KDCA 5HIKA 1ZQ9A 1I9GA 2HNKA 3DP7A 2AOVA 3DH0A 3MQ2A 4PCLA 3M33A 5HZMA 3HCAA 5FQNA 3T7TA 4BLUA 4DZRA 3LKZA 4X63A 3LSTA 1P91A 2DPMA 2ZIEA 2HV9A 2AR0A 2XVAA 4PIPA 3UWPA 5CD1A 5K0GA 2ZZNA 3LCVB 4QQNA 5EIWA 2HR1A 2NP6A 5EZSA 1RJEA 5GOZA 1VE3A 3G8AA 4QQKA 3SVZA 3KKZA 3EMDA 3SSOA 1JTEA 2PWPA 5HIIA 3UJ6A 1JG2A 3TMAA 4RTLA 3TR6A 4C08A 5D1HA 4DMGA 2XYRA 3HCFA 2O06A 4CTJA 5FWAA 3UBTA 1F3LA 3G89A 3C6KA 1D2HA 1NKVA 3BUSA 3HM2A 1FJXA 5FHQA 4DA4A 3FTFA 3C0KA 2CMGA 2IFTA 4CTKA 4PGHA 3SMQA 3I58A 4PYJA 4OQEA 3EGVA 3MTIA 2ZBPA 2CL5A 5E1MA 5DM2A 5F2OA 2I6GA 1VBFA 3HP7A 2NYUA 3LHDA 5K0BA 4GEKA 3I64A 1AQJA 4RSRA 2B78A 3DLIA 4P7JA 3ERCA 2BR3A 1X1BA 2R6ZA 5ICEA 4GOOD 1VL5A 2G8NA 2H11A 2UYQA 3TRKA 2P7IA 1FP1D 4AUKA 3E05A 1Q0TA 2NXJA 5T64A 4RTSA 5H02A 3IHTA 3X0DA 4QDKA 1YZ3A 3M6XA 1KR5A 1ORHA 3MHTA 1BHJA 3TLJA 3WSTA 3BKXA 3DOUA 2AOXA 3EEYA 3KQQA 4PYKA 1KPIA 3A7EA 4CKEA 3NWBA 4YMGA 5KQSA 2PX5A 3FPGA 2ZTHA 4PYLA 4YUXA 5U4XA 4GC5A 2ZVJA 3KQOA 5EPEA 2Y1XA 2AN3A 4IV0A 1I1NA 3A4TA 4QPPA 5HIJA 5HILA 3B89A 1L3CA 1B42A 3BGDA 4C04A 3G5LA 1NV9A 3GDHA 4QPNA 4M7RA 4KIGA 2QRVB 3OZRA 3P2EA 2I9KA 2ZW9A 2K4MA 4IKPA 3UA3A 2FRXA 2VP3A 1EG2A 3H2BA 4HC4A 4HGZA 4CKCA 3AJDA 4E2WA 2FCAA 1R18A 2Z6AA 3FTCA 4MTLA 4OA8A 3A27A 3T0IA 1WY7A 3ELYA 5EMKA 1G6Q1 3FUWA 4R05A 3KQSA 2KW5A 2C7OA 5F2NA 5DTRA 4E32A 5LQUA 3ELUA 4X1OA 1AQIA 1NBHA 5E9JA 3FPJA 3ID6C 5ICCA 4EQZA 3KR1A 3CCFA 3EMBA 4AZVA 5GINE 2IH4A 3CC8A 4BP1A 2AOTB 5ICGA 4X60A 3REOA 3SSMA 3KQPA 3TOSA 3BGVA 4M37A 4DCMA 4YUWA 3S68A 3LCUA 3HCDA 1XXLA 3A26A 4DCGA 4YUZA 10MHA 3SXJA 5EHIA 1G8SA 3MB5A 2HTEA 2ONYA 2NXEA 3BWMA 3NDIA 4EK9A 1SKMA 4RVGA 2O05A 2OKCA 2JHAA 2P1DA 4GF5A 4GOMD 3RIEA 3P9KA 5F2KA 3DXYA 2V74B 4MWZA 1R00A 3TQSA 2P7HA 3PTAA 4CWAA 3G8BA 5DX8A 2JHPA 3UJCA 2HMYB 4PONA 2PGXA 5EKXA 2VZ9A 3FRHA 1QAOA 1ZG3A 3EGIA 3KR2A 2YTZA 2VDWA 4HTFA 3AY0A 4R6XA 3LCCA 3B3FA 3E7PA 5DX1A 4RV9A 3HNRA 2C7QA 4RTRA 1NBIA 3G2PA 4EKIA 1V39A 3PB3A 2FK8A 3EVDA 4FT4A 2JJQA 4QTUB 5DTMA 4DKJA 5MHTA 4BY9E 5E8RA 5K0CA 4F84A 2NXNA 4DQ0A 5EGSA 2P3QA 4ER6A 4LG1A 1DL5A 4M36A 2GPYA 1NW6A 5B1SA 4ER5A 2ESRA 3P9CA 1BC5A 5EHGA 2FHPA 1TPYA 4YV2A 2LD4A 2OY0A 5CCBA 2NNWB 3O4FA 3KQWA 3K6RA 4E2YA 2GAFA 3DLCA 4X61A 5EG5A 4GBED 5IKMA 2EJTA 2EJUA 5GM1A 1JG4A 4LECA 1NW8A 2WA2A 4JXJA 2IPXA 3JWGA 5EKUA 3OE4A 4MQ4A 4R8SA 5GWXA 5ICFA 1BKYA 5HFJA 1UWVA 2AOUA 3KR9A 3OU2A 5KS2A 5JR3A 2GS9A 2ZULA 5E9QA 1UIRA 2AN5A 2IIPA 4KRGA 5EIFA 4P7FA 3IV6A 4E2ZA 2ERCA 4QVKA 3UFBA 4RYLA 1IM8A 2ZBQA 4P7GA 4XUCA 4PNEA 1G38A 4LWOA 2PBFA 1P1CA 4RVDA 5E9WA 2IBSA 2OBFA 3KHKA 2AOUB 3EVFA 2EX4A 5KQRA 3FPHA 3HVHA 5P8WA 2ZSUA 3UJDA 3M6WA 3V8VA 5GIPE 4KWCA 4FSDA 3G2QA 3R24A 3GIWA 1EJ6A 1WS6A 5LQKA 5K01A 1KPGA 2O0LA 3SM3A 2QM3A 1D2GA 1PRYA 3UJAA 2UZ4A 4AZSA 5CVEA 7MHTA 3ANXA 3FTEA 4HRAA 2PX4A 3KQYA 1QAQA 1AF7A 1JSXA 2CWWA 4MHTA 3DUWA 2IDKA 5LR6A 2QRVA 1YUBA 3KQMA 4HH4A 4KW7A 3BZBA 4UOEA 3FPEA 3GRZA 1XTPA 5K8VA 5GP1A 4R6WA 1JQEA 1RJDA 3BGIA 4DM3A 1WZNA 2B9EA 3L8DA 3NWEA 3CJQA 4ATNA 3SGLA 2R3SA 5DT2A 1P39A 3NJRA 4RTJA 4V0QA 2JH8A 2EG5A 5EVJA 5DSXA 2C7PA 1JR4A 3DULA 3P2IA 3FYCA 4KDRA 4RWZA 3ELDA 4RX1A 4YUYA 2HWKA 3IEIA 5K0FA 2YUIA 5DXJA 5EMJA 3A7DA 1G55A 4HGYA 3TKYA 2AOTA 5CCXA 3JWJA 1M6EX 2XYVA 2PVCA 4XUDA 3DMHA 4PYMA 4POOA 2IH5A 2IGTA 3ORHA 1KYZA 1P1BA 2ONZA 3FPFA 5LSAA 5EZQA 2UYHA 5K0NA 2JH9A 3FUUA 3FTDA 2BM8A 4XCXA 5K03A 3JWHA 2A14A 4E70A 1QZZA 5K0LA 3GRYA 4OBWA 1MHTA 4AX8A 2G1PA 1VIDA 2O57A 4HG2A 4EVIA 3KQTA 3LBFA 2YVLA 3GGDA 5CM2Z 3SR4A 2BR4A 4FS8A 3C3PA 1EJ0A 1ZGJA 2PX2A 1RI2A 3QOWA 4PCAA 1NW7A 3T7SA 3R3HA 4CKBA 5BW4A 5GM2A 3FUTA 1ZHFA 3C6MA 1X1AA 3FRIA 3NW9A 2NP7A 4FT2A 1XVAA 2JHCA 2YX1A 5FADA 1YFLA 5DTQA 5K05A 3DXXA 3MAGA 3EVZA 2OXTA 2BZGA 1FPQA 3R9XB 1AV6A 5EMLA 2P8JA 3OFJA 4RTOA 2OO3A 1EIZA 2PXCA 1N2XA 1RJGA 2ZWAA 3GJYA 5CVUA 4A6DA 4Y30A 1YF3A 2PT6A 3KPWA 3RODA 1KYWA 2FK7A 3TKAA 4FP9A 4C4AA 3CKKA 5DX0A 4F86A 4P7KA 2H1RA 3KQVA 4IV8A 3THSA 3DXZA 1X1DA 4U7PB 2PLWA 3BXOA 4C07A 4H0NA 1G60A 1R8XA 3PFHA 1YB2A 3EVEA 1L3IA 3P9IA 4RTQA 2PT9A 1EAMA 5EQJB 5CVDA 1O54A 1XDUA 3LPMA 1KIAA 4FSXA 3GWZA 2PXAA 3GU3A 1DUSA 1SQFA 2QE6A 4OBXA 5FWDA 3R6TA 2IH2A 3ER9A 4PGGA 5G02A 2AS0A 2PXXA 3VC1A 1U2ZA 3DMGA 2AN4A 4L7VA 2ADMA 4NECA 5DLYA 2IBTA 2AZTA 1XCJA 5ERGB 3U81A 3UJ7A 2B2CA 1ZKDA 2G72A 2XYQA 1WXWA 4BLWA 3EVBA 3V97A 1JQ3A 3ER8A 4IWNA 2PKWA 3HCCA 3AXTA 4BP3A 5E2BA 1O9GA 3D2LA 1ZGAA 4LWPA 3TM5A 1XDZA 1JG1A 2ZWVA 3HCBA 1XDSA 4R8RA 5FCDA 3OZTA 5C9ZA 2BH2A 4G56A 3FUVA 3KR0A 1VP9A 3EEOA 5LQJA 1VQ1A 5CIYA 3BT7A 1FBNA 2CKDA 4P58A 2OZVA 4E33A 3OCJA 3LL7A 4ZTBA 5CVJA 3M70A 3HA5A 3UA4A 1QYRA 1L9KA 2ZBRA 1KHHA 2ZIFA 2ZIGA 1UFKA 4AZWA 2AVNA 3ME5A 3DR5A 4K6MA 4GC9A 9MHTA 1HNNA 2YXDA 2I62A 3PX2A 2AOWA 2QYOA 1F38A 2Y1WA 3FUXA 2N47A 3UJBA 1KXZA 1JQDA 3GXOA 3UJ8A 1X1CA 3TPZA 3A25A 5KYGA 3KU1A 1WG8A 5CUQA 1T43A 5E1DA 1Z3CA 4C06A 3NVMB 4GQBA 1N7JA 3HA7A 2NXCA 3GO4A 3LDUA 2XVMA 3THRA 2ORED 4PYNA 2VS1A 3Q7EA 4Y2HA 5FA8A 5T6BA 5C1IA 3KPYA 3I53A 5CVVA 5EOVA 4E2XA 3OU7A 3KPVA 5T67A 2QY6A 3QV2A 1NW5A 4PIMA 4QVGA 4RTPA 3P71T 1OR8A 2VDUE 3CVOA 3HVKA 3MCZA 5FA5A 5BW5A 4GUAA 5DPMA 2V7EA 3EGEA 4O29A 2GH1A 3I9FA 5JUWA 4WVLA 5FUBA 2EFJA 2PJDA 3F4KA 3TM4A 2IP2A 3OZSA 4ER0A 3NMUF 3LDGA 1WXXA 5DRYA 4RTKA 2YXEA 3CBGA 3IYLW 5DWQA 2ZZMA 2P41A 1HMYA 3CJRA 4DF3A 3BKWA 5K0JA 5EEHA 1RI4A 1IY9A 1NT2A 5C0OE 2Z6UA 2XBMA 1N7IA 1MJFA 3E8SA 3E23A 3P8ZA 1IXKA 1L1EA 1JSZA 1KPHA 2C7RA 2ZCJA 5LQCA 1VLMA 3GRUA 4YV1A 4OX9Y 2O07A 1QANA 1JG3A 2AVDA 3MERA 4MIKA 3EVAA 4V0RA 4CXMA 1NW3A 4ISCA 4WXHA 4RTNA 4QDJA 5LQRA 4PYQA 5E2AA 4GOND 3T7RA 5D1NA 3HA3A 3KPUA 4PYIA 3M4XA 3HVJA 3HVIA 3Q87B 2H00A 2PX8A 3JWIA 1ORIA 4FR0A 2VDVE 5FHRA 3NTVA 5K09A 5KVAA 2I7CA 1SQGA 1R8YA 3GRRA 1G8AA 2PV0A 2PSSA 3EVGA 3HCEA 5FULA 5K0EA 4XUEA 3PFGA 5E8JA 3VC2A 2B3TA 2PWYA 3BWBA 3SSNA 3CJTA 3FYDA 4KVZA 4C03A 1Y8CA 2Z6QA 3HTXA 3C3YA 1TW3A 2OYRA 4E31A 3UJ9A 2GLUA 2GA9A 3KPJA 1H1DA 2YQZA 2P40A 3VSEA 1VP3A 3LKDA 2E5WA 5HEKA 3G88A 1X19A 4ER7A 4C05A 1NE2A 3LECA 4FGZA 3GRVA 3RW9A 5HOQA 2G71A 5LQNA 1L3BA 2BR5A 2FPOA 3OPNA 2P3LA 3LBYA 1YZHA 2GB4A 3BWYA 3O31A 3PX3A 4OA5A 1O9HA 4RVFA 5LQAA 4YV0A 3B3JA 1DCTA 2WK1A 1KP9A 4RTMA 5IH3A 3EVCA 3HEMA 3UZUA 3OFKA 2OB2A 3CGGA 2F8LA 5DM4A 3P2KA 1RI5A 4KIFA 3FZGA 2UYCA 1M0EA 3NDJA 3PVCA 4YMHA 3ELWA 1PJZA 4OQDA 5EMMA 1Q0SA 3G7UA 4PINA 4U7TB 2JG3A 5EEGA 4B17A 4A6EA 5FQOA 5M5BA 1TW2A 2OB1A 1SG9A 1XCLA 2OPBA 3GNLA 3MCTA 5E1BA 1BOOA 2PY6A 4E30A 4EKGA 3B3GA 2IDJA 2WA1A 3B7PA 3PS9A 5DRTA 2UYOA 1M6YA 5EC8A 4PWYA 5HIMA 4QTTB 5DXAA 5E1OA 2ZFUA 1YFJA 3O7WA 3I5UA 1QAMA 1RI3A 3M6UA 3MTEA 5BXYA 2P3OA 4F85A 1VPTA 1NV8A 2YXLA 3G2OA 4BLVA 3P97A 3R0QA 1R74A 3QOXA
chains in the Genus database with same CATH superfamily
1H42A 5EE5B 2DPGA 3MWEA 3T99A 1IIBA 2VXYA 3GVIA 2XQKA 4F8JA 2IK8A 3G9UA 4GOLD 3CB2A 3BS4A 4G0PA 3SX0A 2WFAA 2Z4SA 3T61A 3VR5H 3ZGVA 4ZVMA 5IDXA 1D5WA 2Q27A 4TZTA 2G4LA 1T2UA 5LIPA 5HNKA 2A6PA 1U3FA 4KITB 4HLQB 1KYIA 1Y8QA 1DUIA 1R6AA 1XF9A 4OAQA 2E4YA 2FZVA 2R4TA 4U2FA 3WLQA 1KC1A 3IESA 4CL2A 1ZM7A 2HSGA 1K7EB 4RE5A 3BRCA 1Q0LA 1TU3A 5GIOE 4WTOA 3LX6A 3DKIA 3IRUA 3O92A 2ODEA 1KSHA 1OU4A 3FE2A 2B92A 3W8NA 5A6SA 5TPZA 4V1CB 1C3LA 3MQFA 4E1BA 1AO0A 4CEIB 3N05A 4NYJQ 3QWBA 3IKVA 3GA5A 4LE2A 1IY2A 5LPNA 1SIUA 2ZRJA 3ZLTA 1KIFA 1UBRS 2PUWA 5ILQA 3EULA 1DKQA 1HFEL 4O4IA 2ZPTX 4L08A 3HXPA 4QWMA 1M7BA 4XQ0A 2R7NA 3QE0A 3VI3B 2DPMA 4UCQA 1F9EA 3B3AA 3C43A 2AW5A 2YIJA 5E3IA 1JPVA 1QG4A 1M1XB 5L7YA 1T0PA 2NUBA 1L4HA 3V4RA 1CR0A 3IA2A 3JQDA 1QC5A 1IHYA 1L7VC 4CTJA 1NVDA 4EM6A 1DCKA 2RHOA 1IY1A 1SD2A 4W1PA 3WO0A 3P5WA 2VBFA 5CXXA 4DBZA 3V1UA 3RC2A 3WB2A 1HE8B 4HN2A 3PSHA 2R11A 2HWWA 1GPMA 3DEJA 3FLMA 4JXKA 3AUFA 5JMTA 1BDIA 3G7SA 5E1MA 4N7BA 3OO0A 3LPDA 4EX6A 3K20A 3HHEA 3W5CA 3DUFB 3LHDA 1CPYA 3N3BC 2R68A 4KXVA 3FR8A 1IN7A 3WL3A 1W5TA 4NHEA 1TEVA 3E9RA 1R9MA 3EAGA 3H1FA 4IVQA 3W6UA 4EHBA 1KWKA 1WVGA 2NQIA 4FUTA 2PT7A 5ICEA 3P9RA 2UYQA 4FE7A 4N0EA 2FRDC 4LGYA 1XJWA 4C2TA 1KTIA 4CMKA 2O8DA 3CG4A 2ZRIA 4OL9A 4D82A 2NXJA 4A7PA 3H5VA 3CR7A 1QF7A 1BX0A 1YZ3A 2GYWA 3A9CA 4PADA 4Y6QA 4CQMA 1G5QA 4DG8A 4MEJA 3WSTA 1M2VA 4ASUD 3H3XA 3D7NA 4Y9UA 1DADA 3F5SA 2PX5A 1RRKA 5BVGB 2GPTA 1UXOA 3X44A 1VMIA 1J1ZA 3IPCA 5BSMA 5LYJB 5KO3A 2CNWD 1KOFA 1JAYA 1H1LB 1NYLA 2PKRA 4ID9A 4CN8A 4PZEA 1PGJA 2UU9B 3GJTA 1D8AA 2WSLA 4DT1A 4ZVPA 5A06A 2ZRPA 2ZM5A 1NE7A 1WOYA 2YYSA 3PVSA 1ZMXA 1XKTA 4X95A 5TSDA 1W19A 1E59A 4X5OA 2C31A 2BJWA 4EA7A 2O8EA 3J81A 2PL1A 3DTTA 3DZHA 4DMLA 4WOPA 4CKEB 3P26A 1PO7A 1V1MA 1SC6A 1W52X 2W8ZA 3MF4A 3NWOA 4NNOA 4Q4AB 3BTVA 3WFIA 2WDZA 4OA8A 1CG6A 3CF4G 3AHCA 3K9NA 4GM0A 3OPVA 1ISIA 4BC0A 4I1UA 5FWYB 4FYYA 4LDQA 1QIEA 2X8WA 1AUPA 3WO1A 3C5VA 3GUHA 3U3KA 1PVDA 3MUFA 5E7QA 3ELUA 3CURA 1OFVA 4UU7A 3W3ZB 2DERA 5INTA 2RMKA 3M2PA 5AVXA 3OF8A 4C30A 2AUZA 1FYXA 3TPFA 2C20A 1T4BA 4YXFA 2X1VA 1C50A 3ZE1B 1X7WA 5KOIA 4PHTA 2FPXA 2A5FA 4M9UA 4R1MA 1E18A 4NWIA 2JBWA 2H4WA 1G8SA 2KSQA 3IV7A 1OROA 3DPSA 1VC2A 3OZDA 1PADA 1KBQA 4RQUA 1NLYA 2V7PA 2HT6A 4FYJA 4J1QA 4GMHA 4FYMA 1PTKA 4QGGA 4F3YA 2E02A 3NR2A 2O05A 1O6CA 5HCUA 1JEQA 3IUYA 4JT4A 1XDBA 3L0DA 3RIEA 3ZXYA 3P9KA 4LF4B 3KG2A 4P38A 3KWBX 4UCWA 4JBWA 3LUKA 4Y8VA 4Y0VA 3G8BA 5DGIA 5ABPA 2X77A 4GX0A 3X1YA 4WVFA 3G13A 3HJHA 1GL6A 4QECA 1P18A 2K2WA 3QEJA 4HUJA 1AZWA 2XCQA 3PSAA 1YE5A 3VI4B 3LP5A 2LDXA 1EFPA 2QU7A 4XOIA 4RJKA 1G66A 2EDAA 3ZWVA 1ENYA 1EZ4A 6REQA 3QQPA 4PZZA 1V39A 1JDSA 2FK8A 2OORA 3NNNA 3CVWA 1Y6GA 1QE3A 2VT2A 4HDSA 4BLPA 2H06A 4D8EA 2Z08A 3JSAA 3K1YA 1LA2A 1RTTA 2J9YB 2PGNA 3AB7A 1XL1A 2DCDA 3BVPA 4MUHA 2X86A 5EGSA 5FBLB 4KXLA 3VRHA 1BOFA 2DKNA 3JRNA 4LG1A 2H1LA 5AJWA 5TXGA 5IZCA 2ESRA 5EHGA 1P72A 3KAJA 3BWVA 4DDMA 2Z2KA 1P6UA 4MR9B 4BOQA 2F1KA 1O08A 1N2CB 2EJTA 4RHTA 1SXQA 2PNSA 2JJ1D 1R8SA 4WUVA 4I6EA 3DO8A 4G0ZA 4QEZA 3CF6R 1H6AA 1JIIA 5I9SA 3JTEA 4DCTA 1P7YA 2FWNA 4WCFC 5BV8A 3IUTA 1IZZA 1VKNA 3JQBA 4ARZB 1OH5A 1ZIPA 1TCVA 4HZUB 4DMRA 1XRRA 2D1RA 4HT3B 1QQTA 2XDAA 4I6JA 2BE7A 5K4GA 1N8SA 3I2GA 1J6UA 1UBOS 1L5FA 4BMOB 4BP9A 4EPXA 3SEFA 2AX3A 1GFWA 3TWOA 4AUNA 4I4CA 4C6RA 4Y98A 1PGQA 2AFRA 1EQ2A 3BL6A 3H83A 2VSQA 2DAPA 1V6CA 2ZUBA 4RH0A 2LE0A 3RU7A 4M4SA 4R2KA 5P8WA 2FUDA 3V8VA 2AFIA 4QA9A 2JLQA 3MEQA 1XD2B 2Y4OA 1DBQA 3I6ZA 1KVTA 5JU6A 3GVHA 3CY6A 3W31A 4NICA 2JFFA 3DPUA 2BGMA 4RVOA 3U3OA 4MLCA 4ND2A 1YHNA 3I3SR 4UD2A 5ADVA 2UVPB 1C3JA 2JA1A 4ASUA 3QSDA 2FYEA 3KQMA 4HH4A 1G5HA 3DMDA 4ZI7A 5CCEA 3LHSA 5FUWA 3TVDA 3W2HA 2IA5A 2JI9A 2WKPA 3IEPA 4WZZA 3EW9A 4PQRA 4FNOA 3UGQA 2CNWA 2B94A 4JLBA 1CUWA 2QT9A 5CVTA 4IXWA 4G6ZA 4Z8YA 3NWEA 4ATNA 1MAUA 5BWOA 4QGFA 5I7SA 3NJRA 3P20A 4IVRA 4NNJA 5JQGB 4UTNA 5DSXA 1NVEA 3LHFA 1J1UA 4XFDA 4CETA 2EKZA 1EWKA 1GILA 1KFBB 2J9ZB 2PQ0A 1SHUX 4NZ9A 3T1VA 2DCCA 2FUCA 2WWWA 2WC1A 3FNEA 1IHOA 2VP5A 4TROA 4HDOB 4OMCA 5J9FA 2HUPA 2IBMA 3SQNA 2YV5A 4CUJA 4B6RA 2EGUA 1W96A 5LDHA 2R9CA 2G9VA 5A3JA 1K92A 4AX8A 4LSZA 3BPMA 1UL1X 4XKJA 3F5QA 4Q3CA 4RY2A 1KQNA 1FNBA 2ZIUB 4I9UA 4I2NA 1QCDA 4LOJA 2OXEA 2V1UA 1RHRA 1SXJC 2DOSA 1JWBB 4ML3A 1LBHA 4CV3A 3T1YB 4MM3B 3PNOA 1V3QE 1TKCA 1U2RA 4YAOA 4B46A 2ZSAA 1QONA 1FVOA 4JUDX 2GKOA 4P8RA 5ALFA 5FTNA 4CQNA 3DTVD 4V0MA 1YH3A 4NOLA 1PR5A 2PTHA 3THYB 2ZJ0A 2V58A 1YA6A 4WOKA 3L7LA 1EIZA 1N2XA 4HB0A 1K6IA 3U7RA 2ZWAA 5DBOA 2UVDA 4OMDA 2JIPA 5K6AC 4RETA 4FZJA 3UPTA 1C29B 4BOYA 1Y08A 3B7GA 4EB6B 4EBFA 4BWYA 4DR1B 1R8XA 1GKUB 4X3CA 3VVCA 4BKOA 4FDMA 1T13A 1RPTA 2QL7A 4N47A 3V42A 2PR7A 2P65A 1F14A 4WZ6A 5B53A 2PM8A 5F1YA 1O54A 2ZR7A 1XDUA 1BMQA 3DL4A 3QG5A 5JCOC 4TRNA 5IULC 2CDCA 1THZA 3HMQA 1FLNA 4RWEA 4NCJA 5AVVA 5C37A 3WGNA 1MH9A 3TNJA 1QH0A 2PWZA 1CRPA 4F7DA 3QVMA 2FSSA 3U80A 5LKAA 1E6CA 3MGBA 3R5TA 1RQPA 2GARA 1XRPA 1TJ3A 3WXMA 3KVOA 4H3SA 3A2KA 1K63A 3D2LA 1NMYA 1D1QA 4DIEA 1QMPA 1Y6JA 2O2GA 2ZWVA 1RW4A 2HHJA 2ST1A 2DBQA 3ZE2B 3AEUA 3EDMA 1U2DC 2EZUA 2JJ1A 3HDYA 4XYGA 3R7LA 1I7SB 3EEOA 2EX1A 1ODIA 1VLJA 3PFNA 3COYA 3CT4A 2XWBF 4B7ZA 1Z8NA 2TMDA 3GNQA 4QLAA 3O47A 5HW0A 4O0LA 1QQAA 3UA4A 3W90A 2Q3HA 2PFSA 2Z8YM 3LIIA 4JP1A 4TKMA 2IBIA 4IP0A 1UADA 2ZIGA 3I9LA 2IHYA 4XD7D 1VG8A 1PEAA 5I7RA 1Y5NA 1OH6A 1XZPA 1WBBA 2AOWA 2WE8A 3OJWA 4BS6A 2N47A 2VWHA 5F35A 3IELA 2YV3A 5F2EA 3LTNC 1G8JA 4YVAA 1UOQA 4NPHA 4TS9A 1HLDA 3N70A 2HDOA 3QFSA 3A1UA 3GFFA 5EE9A 4QXQA 5A1TA 3N6XA 2CXOA 3JW8A 4OQPA 4AI6A 1U9QX 3F1LA 3O7MA 2I6UA 2W70A 2AKEA 3DE4X 1WHTB 3KYJB 4GDMA 2REOA 3NDBB 1OWNA 2BGRA 1G6HA 3W9BA 5T6MA 3TZKA 3U7FB 3THXB 1VI2A 1GCIA 4RQBA 5EOVA 2H63A 2X9NA 3QELA 2ODNA 3CEHA 2ZCVA 1TU4A 3NKFA 2FV8A 4QVGA 2O0HA 1TADA 1XZQA 3GEBA 4ZDWA 4FN4A 3H9BA 5C7LO 1ZYUA 5FEMA 2YVUA 4M49A 1GYQA 2AEFA 3MCZA 4KBGA 1B43A 3QNWA 4F97A 4BOUA 1ZWKA 2C92A 1UBTS 4PTZA 3ZQKA 1P8JA 4BNJA 4IFEA 2H7JA 3MT7A 3NT2A 1UJ5A 4L0QA 5DGCA 4XI9A 4H1WA 3LDGA 2IYVA 1WMSA 2QN6A 3TZHA 4P16A 5CJ2A 3U13A 2FAXA 3SXUA 3COVA 4IJ5A 3BRSA 2QNRA 3D02A 4XM0A 4J0IA 1Y7PA 2ZWPA 4LYGA 1IY9A 3L4SO 2IUYA 1TE2A 5C0OE 1QDUA 1WB9A 3RRBA 4CEJA 4DPMA 2JANA 2O48X 4RL6A 3EA4A 4IIEA 3NEJA 3KZMA 2BFDB 4TWZA 2F3TA 1BA3A 2H52A 3I6YA 3C8MA 3PT5A 1HQYE 1K7XB 1Q1EA 2TS1A 4R7ZA 3INYA 5EHQA 2GCNA 2HCJB 1XTVA 2XH8A 3Q9SA 1P5JA 1J99A 2HX1A 2Y71A 4DABA 2YJZA 2JB9A 2IYZA 2Q6TA 3O3MB 4J7CA 4DL9A 2B1QA 4FR0A 4F93B 4Y2PA 3RS7A 1R8YA 4A1OA 1SQSA 1R2QA 4DAOA 2WUFA 3VR5D 4Q34A 4TKVB 3LC2O 4JLKA 4NBLA 4NEGA 4K6GA 3VPCA 5BN4B 2VQSA 1DKMA 3LZDA 2Y92A 3W5IA 1QK3A 2G09A 3DDHA 3E3OA 4MV0A 2OLJA 5ENDA 2GHQA 4XJXA 3LKDA 4MS4B 3DTVA 1JG6A 4K6KA 3WJ1A 3IIJA 5A4JA 1G98A 5H0IA 5HOQA 1A5SB 2E85A 5CH5A 3RIYA 4IEEA 3R9WA 3KE9A 1Q3HA 3NTQA 2H3HA 2B4AA 3D7MA 2I2DA 3DFIA 1K3UB 2PR2A 2RCYA 1DCTA 3AUUA 2W2MA 3O90A 1WDTA 5A04A 3ORQA 5LZ7A 1Q0ZA 1V4NA 3CGGA 2XUPA 4Q9DA 3X1KA 1EWVA 3ZU6A 4AJJA 3R09A 4B80A 1F2VA 2ACKA 4KIFA 5D7NA 1HLFA 4CKWB 1FNMA 1X2EA 3MUEA 5JNSA 1QGED 2Q4BA 4NENA 5BSEA 1ACMA 3IILA 1ESCA 1Q0SA 2FWIA 3PNVA 1UKZA 4R7TA 4JBXA 1DO0A 5CCXA 4DCPA 3FF4A 1M2EA 3L7IA 1A8UA 4NR0A 4GI1A 1DX4A 1Y3FE 2JIMA 4LNUA 1OJLA 4MUBA 4RSHA 2ZDQA 5F5LA 1XU7A 2IDJA 1GNPA 2NVUA 4GP6A 2C0PA 5HKAA 5KVVA 2YS6A 4JVMA 1ISGA 1L4GA 1ZK0A 1T6BY 3CNQS 4B81A 5AVKA 2RIRA 3RKSA 5CA1F 4IHJA 4F85A 1NV8A 4MQ6A 1ECJA 4EHHA 3TSZA 3EMVA 1HDEA 1DX9A 1R74A 4DBLE 4ER3A 8LDHA 2FSVC 3QKRA 4P22A 5AXBA 2F55A 3AINA 5B5SA 1UBEA 3G23A 3VU8A 1S1MA 2F43B 4UAGA 2NXWA 5FTWA 5CURA 1M72A 4ED9A 2GJ9A 3FLEA 4HSGA 3EZYA 4ON9A 1KMCA 1LC0A 1L7RA 2W8BB 2YYAA 3EA0A 4MVJG 4UJ3A 2O6HA 4IJWA 4WBXC 1MW8X 1C4KA 2PX0A 2VPQA 4IWXA 4XD7A 4QSHA 2POCA 3BD7A 3A4VA 5A4MS 3RTBA 3UMRA 5BUQA 5KOJB 4DV3B 1O87A 2WD9A 4KC0A 4OB6A 4ZYUA 3ZNHA 5KTTA 2FR8A 4X41A 5JXJA 4Q9KA 1RIFA 2AA3A 2ZZKA 3MOGA 4NZPA 4BO0A 3IBSA 4IFIA 5KHOC 3P9NA 3LGAA 3WMWA 3SDSA 2P67A 2JLRA 3DTNA 1NF9A 4ES6A 5M34A 3AWIA 4LBYA 2PLFA 2JD0A 2ZLBA 5AI8A 4RKRA 1G3UA 3KW9A 2O52A 2QN3A 2OCLA 2ZAOA 3OH8A 2ZKIA 4ME6A 1OY1A 3BTOA 2HNKA 4LY3A 4MQEA 1Y3AA 4BV2A 5ITVA 1SP4B 2DFKB 1UPAA 2G4CA 2R62A 1R3UA 1Z26A 3QRWA 3M33A 1DWQA 3BIXA 4OJTA 5EA2A 3LY5A 4XRGA 5KYNA 4HNHA 3QKWA 4BVHA 4DRXA 1R4NB 5AHKA 2X1HA 3O2QB 4B3RB 4BNTA 2VUTA 2P77A 2QUIA 4QQNA 4WKCA 5GV8A 5HKLA 2HR1A 3MP2A 1SOAA 3TAHA 3G6KA 4L8VA 1PVJA 4W4UA 1RXSA 2QRZA 1H4TA 1KAGA 2P2YA 3PI6A 4GQIA 2IPMA 4GICA 4IM7A 4JVOA 4U2BA 1SO8A 1C8BA 1U99A 3TMAA 1G19A 4DLRA 2XYRA 3TZCA 1GL3A 1F3LA 1XA4A 3UBTA 4U63A 4PFSA 1UUFA 4BFYA 1CY8A 3GJ6A 1ZQ1A 3HM2A 5EJ4A 2OYSA 4ITRC 4XPZA 1AU0A 1LEHA 4PHHA 5FHQA 4IXMA 3A37A 1E9VA 4P2BA 2QV7A 2Z5FA 3JZAA 3BOSA 4I4IA 3NBAA 3LQ2A 5JADA 5HBGA 4MP6A 2Q1XA 3AVQA 3HP7A 3KXPA 2ZVQX 1F5SA 3M2TA 4UNPA 3S2ZA 5K0BA 3ZC3A 1L5SA 4OGKA 3C6ZA 1K75A 5BSRA 2YZMA 3IUSA 3MWKA 2YJ2A 4FI3C 2P0EA 4ACAA 3BH7A 3SZ3A 3IBYA 1VHJA 1X1BA 1A50B 4PG5A 1ZESA 2ZANA 3GUCA 4R1SA 1UPTA 2CLSA 3F6RA 4QASA 5NULA 4E5UA 2ACTA 2G28A 2QY9A 3CNNA 4MLZA 1CQJA 4AUKA 3PXCX 2VLIA 4B34A 3ZD7A 3DE0X 1Q0TA 1C9NA 2Z8XA 4B6EA 2AUXA 2OKGA 4PAOA 1Q15A 4BS9A 5BV7A 5JALA 2VCHA 2VTBB 3R0VA 4KE6A 2WVAA 5C81A 4S24A 3VR5A 2BFPA 3TLJA 3USCS 5JJKA 1DQNA 3EIHA 4DDUA 1OHHD 1PFUA 1YBAA 1YDMA 4P3XA 4Q48A 3VVMA 1CE8B 1WSDA 2AIRA 4YUXA 4HL6A 3LLSA 4IV0A 1YCHA 4QPPA 5T4HA 5SY4A 3WIBA 5JRDS 3B89A 4H1VA 4CR7A 2WM2A 4P31A 4M7PA 5FI0B 2DUWA 1PIWA 4Z53A 1EGMB 2B9VA 2B61A 3PUJA 3ADDA 3QW2A 4CF3A 3L4EA 4IJKA 5KU7A 3D31A 3P2EA 4R4JA 5AJYA 4CG2A 3RU2A 4EGJA 4G25A 2XU5A 1IE3A 5AW4A 3MMPA 3PRJA 3V8MA 2OXIA 1YFKA 4AAYA 1V6SA 2H6EA 1EFKA 4J3FA 3U3MA 3W9SA 4NK4A 3V4PB 4C43A 2A3RA 1QH9A 1Y98A 2G9NA 3QSYA 1VFNA 1GPWB 4XUGB 4AYTA 4E5PA 3GGCA 1CS8A 5LZ9A 3UATA 4P80A 3ZWXA 4DV2B 3UAVA 3TNFA 3G2NA 2WF7A 3EZ2A 4HDNB 3HXOA 2FUNB 4AUMA 5LLDA 4JMLA 2ZETA 4LJSA 1JEAA 1ITZA 5ICGA 4O6VA 5E7JA 3SSMA 3TOSA 1BW9B 1JHAA 3VUEA 4BEJA 4C14A 1UKVY 1DO2A 1UBLS 5H81A 1KBOA 4JAVC 1ZSNA 2GBLC 5LB2A 2JEYA 2V6GA 3UJ3X 5KDOA 1AXGA 2YN0A 4KACA 4N8WA 2GD1O 1V47A 1ZISA 4B2YA 5DU2A 3WG9A 3WHPA 2OCXA 2R8OA 2XF8A 3BFJA 1YR7A 4TXLA 5TQ0B 2OKCA 4V0NA 3SZOA 3VJMA 1JR3D 2G1JA 2QTWB 4AZ0B 4DXDA 2V74B 3WWYA 4PZPA 1WXQA 4J0HA 4HNTA 1S02A 5EL0A 1EUCB 4HAYA 3D7KA 4OHZA 2O2HA 3PTZA 2XB9A 1E2GA 4LZLA 4UXIA 4LPSA 2OYCA 1OH7A 1E1CB 1JA9A 1Z28A 4I1RA 3GL9A 3AY0A 3EF1A 3JZFA 1LPMA 1JHVA 2OGUA 4J0CA 4LHYA 1Z36A 3HA2A 2IUTA 1A76A 3DOEA 4YRFA 1HDGO 4EJSB 3WK4A 2A9FA 2GK4A 3KSRA 4ZKDA 2FO5A 2NYAA 2RGYA 1A1SA 5AQEA 4BY9E 2HRCA 3EIOA 1WSAA 3WGTA 5KX5A 4F84A 4J7AA 3FYSA 4GPIB 4HLNA 4YJ3F 4BCDA 3H5NA 1GSOA 2B1RA 5ARCA 2WYIA 4NZNA 3D3NA 4YROA 2BFFB 1NW6A 3L3BA 4E3ZA 4YV2A 4IIHA 1XKXA 5F78A 2FHSA 2QR5A 2GTPA 3COWA 4TUYA 1EK1A 3R4CA 4UUQA 4MI7A 3I6IA 4M9XA 4G0WA 3ICCA 4MI9A 4E88A 5A6VA 1VIMA 5DHUA 3OLXA 2MCFA 4EY5A 3QPDA 4B33A 2PWBA 3OE4A 5AW1A 4HMOA 4GS5A 2JLWA 1MX9A 1JFFB 4LYEA 3RABA 3U4AA 3VZQA 4E4TA 1G9TA 1BA2A 2XVXA 5HKOA 2M1ZA 3I76A 5B1DA 1OREA 2OD7A 1CHNA 1L8LA 1P77A 2XCLA 3EEBA 1PZMA 2GKGA 5IBPA 2OL4A 3ZUAA 1QFMA 2FG7C 3VKWA 1ZKMA 2FMKA 2IHKA 2M98A 3HSYA 4QNRA 1SOMA 4E14A 3B12A 3P0EA 1MRSA 4OI2A 4YB8A 4CT4B 4EUEA 1TUBB 1KEUA 3GLIE 4MDYA 1JHXA 4HPJB 4NFLA 1QJ4A 4EGAA 2WV7A 4B3TB 3SICE 3ROTA 5KTYA 1ENZA 2IYFA 3NM4A 4S1TA 4TT3A 2IUSA 4MV5A 4U2GA 2W37A 1BQIA 4K26A 2ZSUA 4BB6A 3M6WA 5I6DA 2HKIA 4YCAA 2NWQA 5HKKA 1ICIA 4KWCA 2NU8B 1EFHA 4PLYA 2WKWA 2PANA 4LOIA 3WQBA 5J4VA 3KFQA 2H59A 1G6OA 2XUAA 3L9WA 4KXQA 1XIVA 4OXRA 4YI5A 3UJAA 1N8TA 1QRUA 4JNCA 1QE5A 4U3JB 2W6PA 1D6JA 2DHCA 4DLYA 5GJBA 1WBJB 4WV3A 4I4NA 5JOQA 4TTRA 5EY5B 4KO3S 4U0JA 4PG8A 5GY7A 3V6CA 3FH0A 2I67A 3RF6A 1U0FA 4L15A 2C5BA 1TMKA 2WHQA 1OHHA 4Y9RA 4FCVA 3WLMA 4XGIA 1FDOA 3VNSA 1G21B 1MQ8B 2YWRA 4MK4A 3T3DA 3ZWMA 4DLAA 3FMIA 5I8ZA 3PKIA 1COZA 1ZD2P 1OILA 3N76A 3KT3A 3VHQA 2A58A 2Q8PA 1ZUNB 1XTJA 4RYDA 4DM3A 4ETWA 2W0SA 4YT5A 3ZJ4A 2QX9A 3H5RA 1RP7A 3IAFA 2E2WA 1OVGA 4NXMB 4K9KA 5B2FA 4EMBA 3JQQA 1UBNA 2IUFA 3OFVA 4G0OA 4H15A 1KNXA 3ELDA 2HWKA 2I29A 1EEHA 1KH3A 5FO1A 5A3QA 3KSEA 4RJIA 1K7CA 1ZNZA 4CTNA 4JWTA 4UNIA 1LQ2A 1OKKD 3BSSA 1N3LA 3N2GB 4US0R 3QUQA 2JCXA 4PYMA 4R41A 1DCFA 1X1SA 3RTEA 4CLRB 2PVSA 2JGRA 4JHXA 5F51A 3UJNA 1KFEB 4DPLA 1ATIA 1T10A 1XHEA 2WB4A 2JH9A 3L8ZA 1W76A 2JAPA 5K03A 3QVLA 4D80A 1KVSA 2SCUB 3M3HA 1HG0A 5K0LA 1W7AA 2A1TS 2H16A 2JKYA 4D0RA 3OPYB 1GP2A 1H9BA 4F4DA 2BSAA 1KMNA 2F7SA 3EPRA 3G02A 5IM5A 3C3PA 1ZGJA 3B7WA 4OM7A 3WMGA 2JAQA 2X9LA 2V6FA 3WYDA 3C6MA 3M6LA 4UNQA 1OYVA 1EF7A 3BMNB 3MAAC 1DJQA 2Q46A 2CB0A 1JR3A 1U1GA 2R5WA 1PR3A 3MGCA 1DE0A 3WBJA 1Y1RA 5K3OA 1C7FA 4NDZA 5F64A 4RTOA 1FDRA 2WYVA 4RZIA 5B3AA 3TF5A 1MEOA 2X0JA 1P80A 4B43A 4UVHA 1QH8B 2CVZA 2FDRA 3GP3A 4MKHA 4QG3A 5MDHA 1KHQA 4NI5A 2G5CA 3TBKA 5KIAA 1T1IA 4I8DA 5KJCA 4MX8A 1C30B 3ZWOA 3F78A 2JHGA 1G60A 2XRYA 2ZXUA 1BJKA 1B6GA 2XB4A 3HG7A 4RORA 3EVEA 1YZBA 3G6WA 5FLYA 5TX7A 1S8NA 2PL3A 2QVYX 1SXHA 1ZOPA 3KEOA 5FWNA 2VDQB 3T5DA 2HCTA 2HBZA 4DMYA 3GNSA 3COZA 3LVFO 5FWDA 1W47A 2QROA 2R8PA 5A4FS 1QS0B 5G4LA 1VG0B 4NECA 5IAJA 2YRXA 4YQZA 4BZQA 4LZNA 4TL7A 3N2KA 1EX9A 4H7HA 2BOVA 3MILA 3VAAA 3ER8A 4MOWA 4ZVTA 4NBTA 1JEYB 5AI6A 1R0WA 2OGZA 5AW9A 4PVCA 1L2TA 3FNRA 2ZR0A 2EERA 2XUOA 3IOBA 4OUDB 5CG2A 1V8BA 4FE4A 4HK4A 1J90A 3ZIAD 4GL4A 4Z4QA 3UT6A 2GN8A 2VJCA 4ZQCB 4HFMA 2ZUTA 2HCBA 5KWEA 1VQ1A 1BIFA 1KMHA 1UJ4A 1FBNA 2VEOA 4N3CA 2OZVA 2NQ2C 4PPYA 5AOCA 4ZXPA 2HB6A 2WSYB 2ZSHA 3SJ7A 3AVVA 1P1RA 4AICA 3QVVA 4ZAGA 3HACA 3E58A 1XCMA 2WU0A 3DYBA 4UARA 7MDHA 3ME5A 4K6MA 4GQAA 5K20A 3QEBZ 1M2OA 3TOXA 3FNHA 3GN1A 3QKIA 3RUPA 3TNLA 4H31A 4EYEA 5CFRA 1RAAA 4Y0AA 1YOBA 4LTNA 3TPZA 2CUTA 4KTVE 1D0SA 3Q6NA 3FPCA 1R1DA 2IY9A 2WF9A 4KR0A 5ALNA 5BSHA 1P7VA 2F1OA 4DY4A 3THWA 4NXNB 1T43A 2NYVA 2R7LA 1Z3CA 5KVCA 5JE8A 4G5QA 4JQZA 5BV1A 3ZY3A 2JZNA 4PYNA 1G3IA 5ALOA 1QZ3A 4Y2HA 4P83A 4M8IA 1BDBA 3E8MA 1X6VA 1N4AA 2WD8A 1WB6A 3KYBA 1WL8A 3T4PA 2NU6B 6CHYA 4ND4A 4K9SA 1KC3A 1RWMA 3P71T 2J0UA 3HDJA 3HVKA 2JJ2D 3LQYA 1Z6ZA 3GUZA 3R0JA 4MUGA 3V7WA 1T8SA 2ZK7A 1DTEA 3F90A 5KNLA 3F3KA 2PJDA 3GOHA 4BMCA 4EYOA 2AR9A 3AI1A 1ZRHA 1H2BA 4EHFA 1M8JA 1ZD5A 3ZKWA 2AKYA 3X2SA 4GX1A 1VPLA 1XEXA 4YIKA 3GLGB 4WQMA 3SG0A 5LXTF 3FCAA 3KXKA 2O0MA 2GAOA 2SKDA 3OZBA 4AN1A 4DF3A 5K0JA 2PZAA 2FW9A 3D8TA 1S6YA 4H6PA 3QVWA 1Z38A 3E23A 5JS7A 3P8ZA 2MSLA 3H2GA 1OKKA 4DDKA 1M1NA 3AESA 4YV1A 1BWPA 1T6NA 1M8FA 1JG3A 2O07A 3CLSC 3IR5A 4M0CA 4TKUA 5JATA 1D2EA 1NW3A 3T7JA 1NBME 3KBOA 2CNNA 3DCYA 1T8RA 2GF0A 3HDGA 1V43A 3P0JA 4PYQA 2IS2A 3Q9LA 3L4KA 1FS4A 3EFHA 2NQDB 1GA1A 2HLNA 3R8FA 3GRRA 2FN9A 3EDCA 1RWKA 3WB1A 3K1ZA 2FPGB 5CTAA 5JFTA 3AIIA 1FVFA 2WPDD 3VV2A 3HSKA 4K3VA 3HTXA 5H16A 4URXR 3TVYA 3CVYA 3QBVA 4RA9A 3DQQA 2HA7A 3H2ZA 3IAS6 4YECA 1RU3A 4KK4A 2B98A 3TUIC 4Y1FA 3QA3E 5KVSA 1H1DA 2XOEA 5FB3A 2GWRA 3QIAA 1G1MA 4L4RA 5CDTA 4MJ7A 1GLGA 3QU4A 4D5EA 1U81A 1UAGA 1YDFA 2WZBA 3OO1A 5LQNA 4OMFG 5LIRA 3DVAB 1AU4A 2YVKA 1B00A 1NN5A 4HX2A 3RTAA 4AP9A 4LVNA 1E92A 2BE9A 2Q8NA 3KRTA 4KSYA 4N18A 4ZYWA 3RSFA 1NQUA 1XTUA 3MT0A 3OFKA 1IULA 4PU0A 3RRJA 3OIWA 2EFCB 5G2OA 3DMPA 3I23A 2X1MA 2CBZA 1J7JA 2Q21A 5F1OA 2CVPA 5AUNB 5J1SB 1FBTA 3O3NB 2D0PB 3RS5A 4OQDA 1HDZA 1VG9B 3DWFA 4WBSA 4B2PA 3H97A 4C89A 1X7ZB 1FU4A 1U0RA 5FF9A 2UXDB 3ZU4A 4EAAA 4QUJA 5E1BA 3DAHA 3AW8A 4WN3A 2O9JA 2XWJI 3ASZA 3C3DA 3L6BA 3N2ZB 5TARA 5G3YA 3TE7A 3H6KA 3K0SA 2Y1EA 4JA2A 4NJEB 4DLBA 3OISA 1YRLA 3OQJA 3U4QA 3OLQA 1ZU4A 2JJYA 1DQSA 2VFAA 4MQUA 4AL4A 2GRAA 2J3JA 1SHTX 2QRMA 3GDGA 1O77A 5U9CA 4PSAA 4XIFA 3CZCA 1DAEA 2WAMA 3ZIAA 1IEVA 3H5WA 2GYVA 1GG5A 1EEXB 3EXG1 2EJWA 4P4UA 3STVA 2GSDA 4YMGA 5BORA 1Z9BA 3O8CA 2VUSA 3GMIA 1EAYA 4OXKA 5KQLA 1B8VA 1XL0A 1SHLA 1UZNA 2Y1KA 3D2BA 3DDOA 3EC7A 2A9OA 2KI5A 1I13A 1VCHA 2TMYA 4HCJA 4QFCA 4DUPA 3WKEA 2BHNA 5A0VA 2HAEA 2J7QC 1CS0A 1UAAA 1KDOA 5CAEB 4KOEC 3QUBA 4G0XA 1CY0A 1HE3A 2WFZA 5CB0A 3BWCA 3RFCA 5HQ3B 4J7UA 3ZTWA 2CNOA 4O2BF 2PNFA 2IQ5A 2GZSA 4MQFB 1OBVA 1VJ1A 2YQ4A 4CLXA 2CZCA 5DHTA 2CYBA 3SSAA 3GLIB 1J8FA 3PNRA 4NLLA 5L6MB 3U5TA 4P0QB 1LPNA 1L5GB 1EP3B 1BSVA 2Q5IA 4HO1X 5K8IA 2GK7A 1P8AA 2H31A 4CKXA 2V3CC 3BY4A 1VLZA 2XMPA 3OTGA 1PL0A 4D4JA 3KKLA 5FQNA 2QZJA 4OHUA 1C4XA 4PIPA 1GCGA 4IRMA 4BVJA 3X1JA 1EXWA 2B20A 2EIHA 1M7HA 3GH1A 1TTQB 2F3QA 4ZZ1A 2J3QA 5DWVA 1Y9AA 1IRIA 3SVZA 2FUKA 1Q57A 1YZLA 2JJ2A 2TSYB 3EMDA 3SQXA 3R76A 3A05A 3IERA 3VR2D 4DCOA 1KK2A 5HGXA 3KELA 4BVEA 3FAZA 3UXEA 4RTLA 3L8EA 4FMCB 1E4EB 2QLTA 4K5QA 3USES 1IL0A 2JGLA 2O06A 4G67A 1EWYA 1NMSA 1UP7A 5FWAA 3F96A 1F7VA 2DKOA 2V0CA 3W2TA 4N01A 4OFWA 3BYZA 2GPBA 3QUSA 4HPXB 4K9NA 4P35A 2VCEA 3TLAA 4F6CA 3OTOB 1FJXA 1UXKA 4PWZA 2ZIZA 4F5EA 2YJ6A 3PWZA 1C9KA 3GG9A 4OQEA 4UAVA 4D8UA 4MIEA 4CDFB 5CMLA 3SQDA 4XQGA 2AEEA 2XUHA 3BL8A 1WWKA 2WKRA 1URPA 4EFNA 4K0KB 4GEKA 1UJCA 1VKZA 1NZDA 5JZVA 3RC7A 5BRAA 2A5GA 4RSRA 5EJIA 3U39A 3IP6A 1OXTA 3AJRA 2C94A 5EQFA 3H4IA 4Q9LA 1CUHA 1XD8A 3FCSB 5F33A 4OHPA 3WFZA 1CJMA 5D5PA 4JYZA 1RAEA 4W1RA 4D8XA 1W4BA 2V9PA 5G0UA 5T3YA 3MRVA 3TTVA 1EWQA 4DUYB 1E1MA 1HE4A 4V2UA 1T1SA 1BHJA 2P8SA 1PJ4A 5B2EA 1JIVA 2OK7A 3KEGA 4B09A 2E89A 1RADA 1ZD8A 2PMKA 2V54A 3C7CB 5CYPA 2WAAA 3TSWA 2CXQA 1FX0A 2XB8A 4F2HA 2BU3A 3RGGA 2QSUA 2XW6A 1TK2A 4B3FX 2OBNA 1PVVA 1LNSA 1ZD3A 2BJVA 2RC5A 3N0RA 3R0ZA 3SF8A 4AECA 3SC2A 4AJ2A 2IT1A 4AWAA 3ZVMA 2OFPA 4JCOA 4C04A 3FIUA 2A0XA 4RM3A 1ECCA 5D51S 1D2NA 4FINA 5FNVA 3D6FA 2Q07A 5DZSA 1J0XO 4D8WA 4AY6A 3OZRA 3DJFA 1VSVA 4HWOA 2H9AA 3ZCTA 3CFYA 3PQ4A 2IRWA 1IM2A 1P4HA 4RMJA 4D57A 1E3IA 1GNSA 2QRHA 3H2BA 3KVNA 2AQ8A 4RPKA 5D8DA 1KDYA 1N1MA 3IQDB 1NXTA 4N3AA 1V26A 1ZVKA 1GTRA 2VF5X 3T0IA 3W9YA 4X6JA 2O7RA 4OHYA 1QP0A 2P0YA 3BA6A 1XNHA 3CZ4A 1M5RA 1BY8A 5K3BA 4OATA 2JI6A 1PP4A 1W44A 5B1YA 2F62A 1KI2A 2UXBB 2AN9A 1JE0A 2QN8A 3EMBA 4AZVA 3QU7A 2B8JA 1ZS9A 3EODA 2O14A 3R7WB 1EFTA 1GEEA 4KQGA 1E7RA 1TVEA 5AIBA 3GWGA 1M1YB 3NANA 1I2CA 4BGUA 2OZ2A 1CDOA 4CKCB 1HNZB 3IEMA 2W7TA 3D3WA 4RK7A 4RJ2A 2RI1A 2EC5A 1EU1A 5ALVA 2XMRA 4G0UA 3KAKA 2BGKA 2P9EA 4ENUA 2BY4A 2FE8A 3R1IA 4HQOA 1E3QA 5L53A 4TL8A 2PJRA 1W6RA 2F3UA 3OZCA 3MJCA 4PANA 1SVIA 5AM1A 4CM8B 4QFMA 1I7PA 2PS1A 1Z29A 2CFCA 3HUTA 2O3SA 4INAA 1NDUA 1NMZA 4IICA 4YPOA 2JHPA 2HMYB 1VA4A 2I4RA 4WBNB 3VTAA 2RGEA 5GMOA 1NIPA 2X8JA 3DDNA 1CS4C 1LBIA 1ZX1A 2F59A 3K96A 3NDPA 4GMKA 5KTOA 3SBOA 3GAZA 3QMPA 3BXHA 4AN4A 1UBGA 4L6IA 4YUAA 2D1FA 1VMDA 4MVJE 4YAEA 1CYDA 3NIGB 2AFVA 3FYUB 4EBBA 1QYWA 3AEKA 3DYIA 3BCSA 1A7KA 4QSMA 2WSBA 3TZLA 1W25A 1VJVA 1QVWA 2H7VA 2ZJZA 4H0FA 4KUHA 5H7XA 4BO7A 4HVLA 1FFCA 4X7PA 5GONB 3UWOA 1YMVA 5KTPA 2O8FB 3EXEA 1NI5A 2Y3IA 1K27A 1QIIA 4EHIA 1PLJA 3R4VA 1A5TA 3W8DA 4KFTA 4BE4A 3VOAA 1V16B 2HXYA 1BC5A 1HNXB 5ARDA 1SKQA 4R2IA 1SBCA 4C2AA 1TO6A 3MINB 3BB7A 2JAWA 3TN7A 2ZQ5A 4Q3DA 3KLOA 3GCXA 1UOEA 1Z4IA 1DKPA 1MTZA 1ORVA 4C0AC 3K0FB 1DAKA 4TM8A 1FUYB 4PZDA 2W4IA 1J24A 1XMSA 1Y5IA 3M5WA 3PL5A 2IPXA 4Y6RA 3T3HA 3ZDCA 4I4TA 1IN4A 4QUHA 5ICFA 3VR2A 3ZN2A 4C3ZA 4DLWA 4PN7A 3ZHTA 3P0RA 2IYTA 3AOEA 1QLJA 1VZ3A 4E5DA 4HXDB 1HURA 5DSZA 4HAWA 4BUJA 3PE3A 5FBWB 3THOA 3OA2A 4Q05A 1NQCA 3KX1A 4HBGA 2ZPUA 4JB0A 3QVGB 4D9MA 1FFYA 1QHNA 4RKXA 3EG9B 2IZ1A 4HEA6 1IJEA 2M9MA 3FKSD 4W5CA 3SJBA 3ZCRA 1NVUQ 2G17A 1E9BA 4LXQA 4ZPXA 3Q8LA 1ARZA 4JYAB 2I54A 1QHHA 1YB7A 4UE3S 2QVGA 5D01A 3D8UA 3NHKA 2XB2A 3K09C 3WLIA 4XFKA 1Z08A 2DWPA 3JCZA 3RYIA 1AZTA 3NUZA 5EP4A 1ODTC 1L5VA 2O8BB 1NBWB 1U5BA 3PLRA 2QMUA 4BO3A 3O8QB 4D92A 3L5KA 1NWCA 4MV8A 4RW0A 4B85A 5JV5A 3CX4A 3AUTA 5HG0A 1MBZA 3BGSA 1U8ZA 1XR3A 1XOIA 3VXKA 3HO1A 3ANXA 4YCBA 4NFSA 2AIMA 3UT5A 4KQKA 1GLVA 2H08A 4JKYA 4DNXA 4FGLA 1DX6A 1N9GA 2ZXEA 1JHRA 1UWLA 2DT5A 1NXSA 3DAPA 1LLCA 2P9YA 3FCYA 3K2BA 3KXLA 3L79A 4WLEA 5K8VA 3L4JA 5IHPA 1FFAA 4ZVKA 1CB5A 4XDHA 4B4VA 4Q37A 3UOWA 3BA1A 2WJAA 3OEHD 4A15A 4FB5A 4UQPA 4MGHA 5DT2A 2LGJA 5AHRA 1K3FA 2VXOA 1Z33A 1K8YB 1RJ9A 4ZKEA 2BGTA 1XMXA 4JP3A 3CSSA 3LHIA 1X7XB 3A7DA 4MCJA 4GMFA 4L2IA 4AO8A 4CF7A 1MLDA 1Z13A 3NWPA 1NPZA 1J9GA 4XEHA 1QR6A 2I2AA 3HZRA 4MQ5A 3TBFA 4AJ9A 1L5LA 4V0OA 5EZQA 5LSAA 3S3TA 4B31A 5JJCA 2ZUCA 2DE0X 4XX0A 3FUUA 3FOFC 4MZSA 1HE1C 1PR9A 4C76A 4J2OA 2OO5C 4CI9A 3PUZA 1NQTA 2VA9A 4OBWA 1S4QA 3SP1A 2F4VB 1Y3IA 3LD9A 4ID3A 1V3VA 4KMRA 4PE5B 2AG5A 3U37A 1YDWA 1BFKA 2N42A 4X54A 1KYQA 5JS6A 5JH3A 3CRRA 2HF2A 1U5AA 3LE8A 5G4KB 4J0DA 1KO1A 1A9XB 1C2TA 4YP1A 4K7CA 3RJ5A 4AS2A 1QOPB 2IPLA 2R9VA 5LMNB 3WMEA 1VL8A 4O1IA 4J1SA 1Y6QA 2PKYX 3GFTA 3RIHA 9ABPA 5K16A 1YRAA 1QRRA 3PKJA 4UVGA 1I94B 1AV6A 3V6EA 3OFJA 5THXA 3LA6A 4BB9A 1XTTA 3R5FA 2CT8A 1X3LA 1E3MA 1E77A 3GFSA 2QRNA 2E7ZA 2QTCA 4GLLA 3ASYA 3QJ5A 4XWOA 3T9BA 3LK6A 3W6OA 1ZRNA 4EMSA 3QBEA 1I4OA 3PFIA 3GDOA 4LMBA 3KYCA 3WDSA 3EGWA 3AL3A 4BE7B 1U8XX 1MFPA 3LNCA 4HAIA 4M46A 1KJJA 3OC6A 1ULHA 1S4MA 2HH5A 1NJFA 3ILHA 3VKUA 3KQUA 1KRWA 1WMFA 1XMIA 4GLJA 2IH2A 1TVMA 3NNSA 1KSFX 1WPXA 3BDVA 4B6QA 5C51B 3ER9A 4OVZB 4WCVA 1HK7A 1JLHA 3AVWA 2HF9A 2IXGA 2WUWE 1F4LA 4ZO7A 1WXWA 1Y1PA 3OZFA 3PIDA 4Q3BA 2RH4A 1NATA 2Y9PB 2EZ4A 2GZMA 4HDRA 1J23A 4JBHA 4YA6A 3AVXA 3UIEA 2OM6A 4BRWA 4NEQA 3DZGA 3MNFA 3Q0TA 4Z3KA 5MN6A 1AYVA 3AEZA 1X7DA 3U48A 1A88A 4UBMA 1TLOA 5IMSA 1EP1B 5JC1A 1BGVA 2ZT8A 4Y6OA 2M6KA 1UFKA 1YR9A 4KIWA 4CCSA 3HM9A 3LFYA 9MHTA 4BJ5A 1HNNA 4ZP1A 2VJPA 2Y1WA 1MA0A 1ML3A 2N9UA 4A36A 3FKSA 1VHTA 4FCTA 5F52A 3UJ8A 2X7HA 3C6QA 3MWDA 1A69A 2WT9A 1OLUB 3D3EA 3H5IA 4OGWA 3C6BA 3B82A 5K6RA 3RC8A 5FA6A 4RMGA 5FKJA 3T7AA 1M8GA 1WDMA 4HNSA 4DVJA 2GCIA 2JLAA 4O2AA 3O21A 1RLOA 4PZLA 3W3AH 5AW8A 4HWYA 1GRNA 3BL5A 3LZCA 1N36B 4BVAA 2VS1A 2OUIA 1WNFA 2AMYA 1S2OA 4X85A 4YRRA 4JXZA 1N2ZA 5CIQA 1KHTA 2I0FA 2WJJA 3K6KA 2FRDA 3AILA 4QDXA 4YH1A 4CIVA 4KH1A 4Y2YA 1VSBA 5FL7D 2R96A 4DHEA 4EHAA 5JQWA 4OF4A 3RFVA 3AT1A 1XJQA 2HXGA 2QMYA 1U6JA 3NM6B 2PAFA 4CNQA 4M22A 3ESCA 2PLNA 1WZIA 2FPIB 4L3WA 2J7KA 5E4TA 5AVQA 5JUWA 2UZJA 3QHAA 3JQRA 4FB4A 4KXMA 3PNYA 1GO2A 1QV7A 3A6DA 3PUVA 3DCNA 3OZSA 1IVYA 4RESA 3CCCA 3WLOA 3S2FA 1ZK2A 4F3KA 1WCYA 1ZEMA 4JMPA 5E6UA 2AC4A 3LWZA 5G0WA 3DFMA 2AZMA 3PVZA 4NESA 1VGVA 5CRIA 3TIGA 3MOIA 2P0AA 1NUUA 2O7QA 4QT4A 2OP0A 2W0MA 2Y1CA 2I4MA 1Q2XA 4BKUA 3WAGA 2C03A 4Q16A 1PNTA 1CUJA 2F4NA 4ISCA 4RTNA 3GLRA 4R1LA 3L5OA 1DKNA 4QDJA 4QDUA 3AETA 3A28A 1YR3A 5KJ6A 1JILA 2JIZA 3M5DA 2E4ZA 1TEHA 3GMTA 4PG4A 4D3XA 2PX8A 5LLSA 4CF6A 2BEWB 1AKTA 3BC1A 4CGZA 4EYGA 2GN9A 3PNMA 3SYKA 3SQWA 2NPFA 3M4YA 3VGJA 4UMFA 3BBAA 3FDZB 2B3TA 3L6EA 2YY6A 4KQXA 3WK6A 2ODWA 4KQMA 4AJLA 4EUHA 2Z6QA 5AT1A 3OCCA 3VNBA 4F3NA 4AIIA 1W1IA 3GJ0A 5P21A 2YWHA 4O4HB 4RXUA 1EFDN 4MI3A 4KGDA 2OYRA 1SXJD 5EPOA 2VK8A 3GLHA 2QYHA 3EGDB 4JGBA 4K81B 4K9MA 4RY0A 5CNKA 4D9BA 2CFTA 4B3MB 4HATA 4Z9XA 3UN1A 4B4OA 3AF5A 4Y2UA 4QE3A 4FD3A 1HEUA 3B6KA 3KUKA 4OA5A 4CM4A 1ANKA 3GEHA 1V1RB 2JIQA 2IP1A 4OGLA 5ICMA 2OMKA 1MOSA 3FFAA 1GNQA 1CVLA 2FWMX 1ZAKA 5IH3A 3ZK8A 5FOWA 4BQRA 4YMSA 3EZ7A 3RVXA 4LRQA 3EFEA 3MJTA 4R98A 4RY8A 2FZLA 3OOWA 5CFOA 2GGSA 2NVOA 2JD2A 3HJUA 4OHMA 1XB2A 5JXHA 3GC6A 4N8EA 4FHZA 4K9PA 3IX7A 2CMKA 4LZZA 3U17A 5DHPA 3PI7A 4GNKA 4PX3A 3R20A 5L95A 2YFHA 5CHYA 2CE2X 2OB1A 1N2OA 3N8HA 3O9MA 4CDNA 1ODJA 2G9RA 2XYPA 3KX2A 5REQA 1FMFA 3TTSA 1J39A 2FFBA 4DRZA 5HQTA 3AWDA 1Q7GA 4QFBA 4REQB 4EIWA 3BFXA 5I7AA 4IBOA 3KV3O 3QX9A 3I5UA 3OKAA 1RI3A 3PE6A 3ZGZA 4KK3A 3FHTA 1GCUA 5IT4A 1JJ7A 5TDHA 3AFGA 4NJMB 4A27A 2IC5A 4YAIA 2RDMA 3RRXA 2I1VB 2IYLD 3BILA 1SELA 1M6WA 1MU0A 2FMXA 1UJNA 2CXPA 2HCFA 5HZGA 1PV1A 3AR8A 4RKWA 5JTTA 3MGGA 5T57A 4B3SB 1LVGA 3I30X 5I48A 2G25A 3HWWA 3VYWA 2PSHA 4PC6A 3MFYA 1CR4A 2G6DA 4WCFA 1A9YA 1H2WA 1TD1A 3M1LA 4DA6A 2F8MA 1C9MA 5MGNA 2E3JA 3EEFA 4WI1A 3RHTA 3PLAE 2VJKA 4G81A 4PO3X 1SN7A 4C0SA 3HVRA 1ME4A 3JWEA 2UAGA 2HGZA 1C1YA 3AUXA 3GP5A 5H82A 4IGAA 1IWOA 5I9TA 5HKBA 3V6LA 1MC8A 5LP6B 1SCAA 2FN3A 3HR7A 2GHUA 2UUOA 1JI3A 3FIJA 3L7OA 3IQFA 5HFAA 1SG0A 1M75A 2OHFA 4Q3NA 5KYKA 4KR2A 4ND5A 4MQMA 4X3OA 2VSNA 4XJVA 4FGUA 5KWVA 3FOZA 3L1IA 5B6JA 3TLXA 3M82A 1DVRA 2Z58A 1P9RA 2XVAA 2OGSA 1LJUA 3VH1A 4MZOA 5FL7A 4B79A 1SCJA 4ZC8A 5K5EA 1R16A 3E5MA 4QQKA 1RYBA 5BR4A 3RYTC 1ME3A 1XDDA 4G97A 3HU3A 4MKXA 1YACA 3BMOB 4KYVA 4DLNA 5AUQA 1V3TA 4RCZA 2MMCA 3I3OA 1IH8A 4D8YA 2JQFR 3C4VA 1XCOA 3WGLA 4LJYA 4YEDA 4L8FA 4ZTZB 3BK7A 4MR8A 4AU1A 5LQDA 4P3KA 5I45A 1Z4PX 3D6NB 3LQRA 4PPGA 3OM1A 1UQRA 1J0CA 3LXSA 5EN4A 1CX9B 4BQNA 1P5RA 1AQJA 4QREA 1N78A 1PBTA 2QSZA 1X15A 1RC8A 1N6LA 4Q7LA 4U8GA 1SURA 3BJIC 3F74A 3STXA 4C0JA 5A9SA 2PKXA 4WA6A 1KRHA 1PFGA 4AY2A 5JY1A 2J3HA 4R1UA 5T8KC 4H7FA 4BV8A 2GAIA 1X0XA 5D2CA 3MMXA 3WYFA 3CO0S 4UUAA 4KO2S 5EWMA 1DV1A 3BKXA 4RU1A 2W5UA 4H4CA 1L4KA 4PYKA 1T25A 3QEOA 1L7AA 2GOYA 3UUWA 2NZYA 4M9CA 3Q8WA 2DXIA 4MRSA 1C0IA 1M0SA 3CXUA 5LBUA 3IMCA 3SYNA 2R8XA 2DFDA 3KOOA 1SXJA 3L1JA 4IH9A 1KI7A 3HR8A 4XCVA 4D6PA 3RK0A 3L77A 4IWYA 4EX7A 3H0CA 3E84A 1FXUA 2P2GA 3ZHRA 1QBGA 1GPUA 2Z9CA 4KE7A 3AR2A 4Q1FA 4RE6A 4KIGA 3AMVA 2QLMA 2A30A 2ZJOA 3CNLA 3PQDA 3N6VA 3QEAZ 4IKPA 1ES9A 2D59A 4INPA 4UVEA 1K6XA 3PNPA 3G82C 2HW8A 4QTZA 1DQYA 1MB3A 2PSJA 3AV3A 3DV0B 3HLYA 2Q5QA 3N5CA 5AJHA 3C14C 2ZBEA 3M83A 3DAOA 5K6AA 1XNQB 2P27A 4PT5A 1TU0A 4GDFA 4R05A 3A6EA 4YYVA 1DC6A 4H1TA 1W73A 5ALZA 4PGAA 1N0WA 3HKCA 1OTYA 3VZSA 4MRMA 4MUFA 4OXIA 4WIAA 4HNQA 4HLUC 4HUQA 4CQJA 4JU9A 2IOHA 2B83A 1LK0A 5JMPA 5TRTA 2A0YA 1LBEA 2D7JA 4QM7A 3KQPA 5JCOA 4YUWA 1IXYA 4JQCA 3S68A 2XUJA 1IBLB 3HCDA 2Y76A 1VHQA 4N0PA 3RBVA 5M04A 4YJGA 4GZ6A 3UENA 3KQNA 4DA8A 1OYYA 1E0AA 1D6SA 1W4CA 4M8NE 4DEXA 4AF7A 3BDAA 4G2TA 4EK9A 1H0HA 2D5AA 2CW5A 4JZYA 1ZGGA 1QOZA 3PGLA 4M1TA 4Q3KA 2P2SA 3PQ6A 4GOMD 2BEJA 5EIOA 3DXYA 5F2KA 1LC3A 4GU5A 3SKXA 3ESBA 4ALIA 5JPCA 1TC1A 5J58A 4L3OA 1A3CA 1R10A 3MWGA 4MP3A 4YAKA 3S1SA 3FCCA 3N8IA 4QDTA 1SUEA 3DVQX 4XWTA 1U2DA 4TXHA 3AVOA 1NYTA 4LOAA 2FDXA 3GCGA 3CWZA 3Q11A 1Z39A 1RRCA 2EFYA 4P0PB 3TXXA 5KEIA 5ALXA 4B5KA 5HX7A 3EF0A 5I7WA 2BHRA 2IUUA 3NWJA 4NG5A 3USZA 3AJAA 3SXPA 4G1EB 2V7VA 5BUSA 3LCCA 3K8QA 1DRUA 1EB8A 4RV9A 4ZAFA 1XHLA 4ZZ3A 1W5BA 1PAUA 2FPPB 3RD5A 5LU8A 5M2QA 4JSYA 3EFOB 2I2BA 3ICPA 4QICA 2FNAA 3P0FA 5IT9A 3PNQA 3EVDA 2A1UA 4BLOA 4B8YA 2XUDA 621PA 1YI1A 2DCUA 5JQGF 4R1OA 3LOQA 5CT6A 2HIHA 4TYQA 2NX2A 5B7NA 2DZZA 1H2FA 3KAPA 4TSFD 3K94A 3N0XA 4I9NA 2D4AA 4BBZA 1CXZA 2YWFA 5DULA 1GZ7A 1ECPA 2RIPA 4LF6B 4MIOA 3DVSX 3EUFA 5HS4A 3AIMA 5IKMA 1CRWG 1RFLA 2FE1A 4LS3A 3K9MA 4DJJA 2P62A 1A4XA 2RGNC 2XXJA 1XGKA 4II2A 1W1WA 2VP0A 3PG5A 3GLFA 1E4YA 1C3XA 1K0UA 2CHQA 2ZP1A 4UZFA 3WOHA 1X14A 4CM9D 2Y1LA 4S1OA 1UWVA 4WY8A 3COPA 1LPPA 1LBSA 3QYAA 4MO9A 1FP4A 1VBMA 1NPDA 4M0UA 1I0IA 4KRGA 4JI4B 2GEJA 1A9TA 3EXG2 4RLQA 4QLOA 1WLYA 3ENVA 4PRYA 3TB4A 3UG6A 4BC1A 5EE0A 2K6GA 4YRBA 4RK0A 3UHFA 3VSBA 4L3VA 5FUQA 4Q3OA 4XARA 3O0TA 4GPZA 1J5EB 2AE1A 1T2DA 1CKEA 3TQTA 2GYYA 4BVLA 5FT9A 5DTJA 3B6EA 4EW6A 3OCXA 3KHKA 3M6FA 1CP3A 2ID7A 3I6QA 1UMBA 3O4HA 3WJ2A 3LPLA 4MS1A 2H57A 5JH7A 2B2XA 2XGGA 1PWHA 1R5OA 1SQ6A 1JHYA 4RPGA 3SX2A 3DBHB 3OQOA 2CBXA 3MC1A 3HL0A 4N9WA 3RUFA 2HI0A 1NVVQ 2RJOA 3W1EA 4C0LA 5H4GA 2DUNA 1VCNA 2BVNA 3DMNA 3HDTA 5BMOA 3MRXA 4KYUA 1AT1A 2Q6VA 3CNHA 1JSXA 1KNQA 1VOTA 3B2QA 4IS2A 4K2HA 2QRVA 1C4WA 4XM1A 3JR3A 5C46F 4S04A 2FFQA 1PGPA 5DISB 5DN6D 5DB4A 4AJKA 2PZGA 4GT1A 4KQIA 3B6ZA 4KXYA 2J3IA 4TS3A 1G2PA 4U8HA 2BH9A 4WMLA 5D6OA 3R7NA 1QO7A 3I05A 3TMKA 4X62B 1OWPA 1PKXA 3SGLA 1W93A 2WILA 2R8YA 3NH9A 3OVZA 1VRWA 2Y99A 4M0PA 4P4SA 2HPHA 4Y2RA 2JRCA 1BTOA 1V8PA 1VE9A 3KAQA 3N2YA 1MQAA 4RFSB 4DN6A 4UMVA 3UCEA 3VPSA 5K0FA 2D1SA 3H9JA 1YB1A 1UFVA 3DFFA 4PNZA 2G9QA 1ULSA 4YREA 1KK1A 3C3CA 2Z95A 5BT9A 4QBGB 4BUCA 4GHWA 4IDHA 1Z7GA 2ZBFA 4HXYA 4AK9A 2IGTA 2HC9A 2JBAA 5A0TA 2QG6A 3GGOA 3KIPA 3MGKA 2UYHA 1QXPA 4CIWA 3DT6A 1CR1A 1L7EA 2C5HA 1IN6A 3TQIA 3FHLA 2A14A 3JWHA 1QZZA 1DIAA 5IBRA 3VJLA 2JLYA 4PZCA 3NQ41 1L5NA 1AU3A 1CJSA 4C4TA 4KXUA 4B4KA 2R84A 4TV9A 5DYIA 4D43A 3OJFA 4RHEA 4QRGA 2YVLA 3RVKA 1ZIVA 5CDUA 2I80A 2Q1YA 1O96B 5BRJA 3CYFA 5H59A 1CJCA 1GQYA 3E2PA 3UMFA 1E5TA 1RI2A 2CUKA 5JZEA 3T3EA 5JWRA 2PN1A 3H1PA 4NV3A 4UJ5A 3VPFA 3U9SA 1YBFA 1JB9A 3PHBE 2CD7A 1XVAA 2XMSA 3O3CA 4FE3A 4LQ4A 5DTQA 1V96A 2DECA 2C5FA 3FTPA 1SMKA 2D0OB 2DU8A 2QT1A 2HEGA 3A6LA 3EVZA 4TV8A 4ZT6A 2X0EA 5IWCA 5BSUA 3PE4A 3HCNA 2AYNA 4QBFA 5JZMA 2HHCA 2DB3A 2NUPB 2AMJA 5BW6B 3KPWA 721PA 4MUKA 3W3AD 3LYHA 3L0YA 4YYZA 2BEVB 2VZ0A 4UEJA 4R71A 3THSA 1LNQA 4KO1S 2O8CA 1T0UA 1P7CA 2PLWA 4MVJP 2IYEA 3PFHA 1TT5B 5C8DA 3ORYA 1Z7BA 5EP1A 1AGRA 4B6GA 2G9ZA 5EQJB 4DJFC 2P78A 3HCOA 4Z86A 1BWQA 4EO9A 3I2JA 2FX5A 2ZDGA 4XDGA 3OIYA 2ZYDA 1I8TA 5G02A 4RF4A 3RCBA 1M1UA 4OJNA 1BE0A 4UHJA 5KNBH 4AQYB 3HHAA 2D2EA 2OSBA 2O2YA 1XCJA 2E01A 2Y4NA 3IKJA 1H8ED 5I51A 4TSFA 3Q3CA 3TPCA 4OIFA 3FY4A 2H2WA 1J2JA 4RMHA 3QU9A 5LDGA 2I2FA 1YJ5A 1CIJA 1Z16A 2HMSA 3QWHA 1ZGAA 2ASEA 2P91A 2Q9AA 4WPGA 4LRWA 5CR9A 3GBVA 4GW3A 4I50B 4ZYYA 1WAMA 3ZGLA 2I9PA 2XQJA 4YLGA 1FFSA 2HADA 2APJA 3KJQA 4X90A 4P58A 4F2WA 1ADGA 2CLOB 4RS4A 3LZ6A 4CM9A 3C41J 1XD9A 1KBZA 2XNSA 3HA5A 4LJ6A 1Y9ZA 1E7MA 3HH8A 3ROXA 4HWKA 3HGTA 1CUAA 1OT5A 4OQYA 1X1RA 4RAOA 1MAVA 5CIWA 4UMDA 1MOQA 2NN3C 3ITKA 1THGA 1E9RA 3MFQA 2JFBA 4C5CA 5ICCA 4XGNA 2P86A 2ZB4A 3D8RA 4JBYA 1YQTA 4L74A 4MV6A 4LMAA 3AFNA 1XRMA 4LXHA 4EA9A 4OBBA 5LYJF 3RYCA 3LC7O 3O5AA 3UK0A 2OR3A 2PLRA 2VH1A 1QIMA 3QEKA 2SECE 2JEOA 2RCNA 3N2IA 2ERXA 3WNZA 3K1JA 5FFNA 4MLDA 1JHQA 3KUDA 3EAFA 3HWRA 3FCUB 1UDCA 1QLHA 2QKYA 1QXSA 2X3FA 2FMHA 2GN1A 2J5RA 5T6BA 3U3DA 2YJNA 1GUYA 1H2ZA 3AEXA 3K70B 2J59A 3VBCA 4HLDA 3O1LA 4Q4HB 4PIMA 5L3RA 3TLKA 1WBDA 5JECA 2XXAB 2R751 3L6UA 2WMDA 3G59A 1BCSB 3JASA 1VE5A 5AJVB 1WA5A 2VUUA 1PGNA 2JIRA 3REFA 2ZJ8A 5IAOA 5A4AA 3ED5A 3CKLA 1L5OA 1PZHA 2F3RA 4MITA 4YJ3A 1A9PA 1NVKA 2NG1A 1JJVA 1CUCA 4QQRA 2DUUA 3F4KA 1V9CA 3O75A 4R5MA 4E51A 1JVSA 1NDHA 2CJWA 3I9KA 3UAOA 3ZJYA 4DW8A 1VLVA 2CB9A 3R0XA 4WLFA 5DCLA 4BEBA 3RF7A 3QPBA 2P41A 3WV4A 4C4ZA 4YYWA 3CLRC 3EIUA 1MGPA 3ITEA 5FD8A 3P96A 2RAPA 4OHFA 3RVBA 2HK8A 3ETLA 3KOXA 4OQ4A 5CFNA 5IN4A 3HN2A 5G41A 2QVCA 4CDGA 3QP9A 1NY6A 3VHXB 1K88A 3L8CA 3NS7A 3ED1A 1YS4A 4B9EA 2ONJA 1FMLA 3IQZA 4I1VA 4WXHA 3OUUA 3OT1A 4RAQA 4A6XA 3T7RA 2ZI4A 4KPUB 1VRCA 4I8IA 4H7KA 1TGVA 2OZPA 3TZ6A 2WHYA 3GEEA 4C0HA 4MMXB 3A14A 5A3SA 4KL8S 5F76A 2F00A 1L4MA 4WKNA 1EM6A 1UK8A 4EG0A 1I2DA 1NL3A 3NRCA 2NPOA 2AFIE 3RV3A 4YYRA 3D54D 5KYWA 1J97A 1Z15A 2GBLA 2Q3FA 3CH6A 2GK6A 4EI2A 4L8GA 4ONEA 4KB5A 1TEXA 1Y42X 3LS2A 1NSFA 2EX0A 1QVVA 2QXUA 2R6DA 1WQ4A 2ZR8A 4KQ1A 4F06A 1R5NA 4IFBA 3ZVKA 1GA4A 3ILXA 4TTIA 5DGHA 2WK1A 3GHHA 4OK5A 5BN3B 2VHSA 2DR2A 1PTJC 3AF2A 1J8MF 3GLSA 3SY8A 2Y05A 5FLKA 3NHZA 1L8OA 1K98A 1DDIA 1KKUA 1ZP6A 2K7ZA 3NV9A 1L7MA 3DG9A 5FBQB 3S99A 3UK6A 1R88A 2VK2A 2CLKB 3EE6A 2NMVA 4AP6A 1O03A 3CH4B 2AW3A 3S1AB 1NRJB 1RQXA 3RWOA 4KR7A 2DY0A 5FWXA 3CISA 2JK1A 3AFOA 3G7UA 3P32A 5EMMA 2I91A 2ZYHA 2IIBA 1E5XA 4L5AA 5D3MA 1J0BA 2VPPA 3GNLA 1E6EA 1KEZA 4HF7A 5ADHA 5LU9A 2KPOA 4PC3A 2IU4A 2L82A 3B3GA 5HHTA 2OHIA 3B7PA 1QIDA 2FOLA 4QRIA 4Y6PA 13PKA 1M6YA 2P9HA 3HRHA 4PWYA 1H8EA 2ZFUA 4NX2A 1WULS 1J4AA 1Q1AA 3GJ4A 5IW8A 2P3OA 4B74A 2XEXA 4BWFB 1SEPA 5J4KA 5IVHA 2OQRA 3T1QA 2J9XB 4EI9A 2AZ4A 1UZMA 4GXTA 4WAUA 1AQ6A 4OAOA 5CU7A 4EJSC 1NXWA 3I1IA 4D99A 3NT4A 5ESDA 3RAJA 2C2OA 4MICA 2WB2A 3AUKA 4OYYA 1XQYA 5FOXA 5E6RA 1OT3A 5C9ZA 1Y3BE 4BNIA 2BRUA 3RVNA 5JJIA 4QFDA 2O20A 1U0JA 2DULA 3FKQA 4NKRA 3V8EA 4EMUA 3UYKA 2ACWA 5IF3A 4F4HA 2HD4A 1ZCAA 1RJFA 3B1VA 2RB5A 5CT4A 1QZUA 1KZHA 4CDDB 1BJTA 3AR9A 2NQGA 4G0QA 4OPMA 3QOFA 4PSDA 5BW8A 3K53A 5KQMA 1K8XB 3I5XA 2ZRKA 2PUAA 3ANMA 4YMVA 3SBEA 2GCOA 1QP4A 3BD6A 3MWEB 4MZXA 5L45A 2J1LA 4BN4A 3V1MA 1R8JA 5CK4A 4YV8A 2G70A 1XQVA 1D9XA 2IEBA 4HAUA 5FR1A 1PWEA 4ZA2A 5F1PA 1ZQ9A 4ENWA 3F7OA 4BV3A 2AOVA 2OQ2A 1SHKA 1AQYA 4U7HA 3VDMA 3ZNNA 2C2GA 2WWVD 3EB9A 3H9UA 4ZARA 1YVEI 4B3IA 4KNYA 4UM9B 5A5DA 5C34B 3PDFA 1TQHA 1KI6A 1T8PA 1P91A 3QM1A 4ILKA 2HQSA 2IY8A 1PJQA 3T5AA 4PICA 4I36A 4ZANA 2WIBA 3ONFA 2BI8A 2QUZA 2DTXA 4I08A 3GEIA 2JLVA 1CR6A 5JBIA 2AXPA 3CF2A 5TQVA 2NSHA 3EPJA 3UJ6A 4ETNA 1KQ3A 1C41A 4N40A 5KCMA 1UFQA 3WAKA 4DUZB 1MZPA 2CXSA 1M6VB 4D41A 3FD8A 1N0UA 4CM3A 3ABIA 1JW9B 3L7NA 3MJFA 1LW6E 4DA4A 1QBKC 2CMGA 1VJTA 2WM3A 4I3HA 3HKBB 3ZDEA 4KHPB 4K8RB 1O0CA 5I5GA 1M34A 1GITA 4RPCA 1DKOA 4RD4A 4DMHA 3GEPA 2AJ8A 2I6GA 3N9IA 1PWZA 4L75A 5IJXA 1OX5A 5BQPA 4R9NA 2XE8A 2ZRAA 1OFUX 1Q16A 3N07A 4XRRA 2EP7A 1ZNYA 1U11A 1QC5B 2GM5A 2JATA 3F9RA 3ILSA 1ZM2A 4FFMA 4P7JA 4UASA 1KRXA 2WABA 4CN9A 5JNRA 2ZI9A 1N75A 1VIAA 3QE2A 1A77A 4PFJA 5TMEA 1IY8A 3T7EA 4G85A 4ESVA 3OTQA 1I36A 2QGNA 2YICA 4IILA 4CW7A 1RQGA 3L41A 3KDPA 4FBMA 4Z51A 1BXGA 2R7MA 3NOVA 1GYRA 2JGAA 2YJCA 4HWRA 1DHRA 5LBTA 1KR5A 3W2FA 1N1DA 2QZSA 1RAFA 1J8VA 4GWLA 5DLPA 1T5DX 1II9A 4QHSA 5DWDA 4V2IA 1QK5A 1T8YA 3I28A 4PLTA 4U7WA 2C5AA 4JI1B 2O6LA 3I9NA 5J4YA 4HHEA 2BM1A 3A4TA 3QNMA 5FOVA 3KU4A 4Q9NA 2FXIA 3JVDA 3W4KA 2O8DB 1B42A 1XQWA 4JEUA 1FNSA 4Y2XA 3K0HA 1G8HA 2Q3EA 1R27A 6PADA 3LAWA 5AI5A 3RVLA 5I9IA 3SOPA 2K4MA 2QR2A 3DR3A 6PFKA 5HRAA 1NLUA 1EG2A 1M2VB 3FROA 4LBVA 1F8FA 2EVWX 2P6MA 3QZUA 5AFSA 1IQPA 1J20A 4FXPA 3KB6A 1HNWB 5KAPA 3ZEIA 1TAUA 4PV7A 3LF2A 2KW5A 1N0IA 3D0RA 3OC0A 5EIAA 5AUPB 1G17A 1NX6A 4W8GA 5AM5A 2CEAA 2D06A 3NHMA 2ID8A 4TXNA