5EZSA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease inhibited by e64d
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Non-structural Protein 2 Cysteine Protease
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezsA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezsA01
1YF3A 2IBSA 2B2CA 2QYOA 3EPPA 2V74B 3KQPA 4DF3A 4PINA 3EGVA 1IM8A 3MCZA 5HIJA 3T7SA 4QTTB 2KW5A 2Z6AA 3QV2A 3UJ8A 4QTUB 4OA5A 4QDKA 3GIWA 1G8AA 3VYWA 1JQ3A 3LX6A 1TPYA 4FT4A 4M7RA 2VDWA 4C03A 1JTEA 1NW8A 4HH4A 4IKPA 2Z6QA 1G38A 1SVUA 3G5LA 4PONA 3DMGA 5JUWA 1XDSA 5LQAA 2AOTB 3LBFA 3M33A 3CJTA 3M4XA 4R8RA 4GC9A 3TR6A 4ER3A 4QPNA 1R74A 3FTCA 2JHAA 4YMGA 2G71A 3PFHA 3KPUA 3I5UA 5FULA 3KPVA 4DZRA 5BXYA 4RV9A 3GRZA 3B7PA 4RVHA 3OZRA 4U7PB 2PX2A 4YV1A 4OX9Y 1F38A 3SSMA 1NKVA 3ID6C 2YVLA 1BC5A 3HP7A 2IH2A 1JG2A 5FWDA 5T64A 3UJDA 2I62A 1G6Q1 3PS9A 3KR0A 4FR0A 4GOLD 4E2XA 1O9GA 4GOND 1U2ZA 1ORHA 1QAMA 2FPOA 3PX2A 3OU2A 3UJCA 1YFLA 4BP1A 3KPYA 4PCLA 3EVBA 2G70A 4NECA 4PGGA 4YMHA 3UJAA 3DTNA 3CJQA 3UBTA 2I7CA 2XYQA 5FHRA 4RTJA 2E5WA 3DXYA 2YX1A 3KQQA 3DLIA 1D2CA 1WG8A 3L8DA 4X61A 2AVNA 4KDCA 1NW6A 4GOMD 3B89A 3MERA 4DMGA 3ME5A 4PGHA 1SG9A 3TFWA 5LSAA 2Q41A 3MCTA 2XBMA 3RODA 2PXAA 3MAGA 2I9KA 2GAFA 3GU3A 5HEKA 5DX0A 1L1EA 3G89A 1WXXA 5FUBA 5EZQA 3BXOA 3UZUA 3KHKA 4E31A 4E33A 2PX5A 3ELWA 2ORED 1N2XA 5EG5A 4PYQA 1YUBA 1JG3A 1R8XA 2GPYA 3E23A 4UOEA 3IYLW 4ZTBA 1QAQA 5EPEA 4AZWA 2H1RA 2P1DA 3P9KA 2XYVA 2QM3A 1JSZA 1RJGA 4RYLA 1IY9A 2F8LA 3DH0A 3B3FA 3BZBA 3ELDA 3IHTA 3OU6A 3P2KA 4P7FA 3DLCA 3C3PA 5GP1A 3VC1A 2DULA 4E2YA 4YUXA 5FHQA 5C9ZA 3Q7EA 2CMGA 2ONZA 2BR3A 3HEMA 4LG1A 2AN5A 3P97A 4P7GA 4AZVA 4LWPA 4C05A 1Q0TA 5FA5A 2PVCA 1FP2A 4V0QA 2JG3A 5HZMA 2B78A 4C07A 2IGTA 2YR0A 1PRYA 4WVLA 3G2MA 2ZZMA 4JXJA 4C06A 5KQRA 1EAMA 3BT7A 4F86A 7MHTA 5G02A 1RJDA 1INLA 1DCTA 1N7IA 2AVDA 5DM1A 1KPGA 4E2ZA 2PV0A 5ICFA 1NW5A 1Q0SA 3A7EA 5BW5A 5BW4A 4PYOA 3KPJA 5HILA 3TOSA 3FUXA 3HNRA 4FZVA 4MTLA 5BP7A 5LQJA 10MHA 3ER9A 3E05A 1WXWA 2P8JA 4KIGA 3JWGA 2ADMA 1L3BA 2ZSUA 3OE5A 3ANXA 4PYKA 3LCVB 1Z3CA 1RI5A 2NXCA 2PWYA 2ZBQA 2CKDA 2CWWA 2UYOA 3AWIA 3EMBA 4Y2HA 1KPIA 4OBXA 4RWZA 1JTFA 2OXTA 2O05A 4PYJA 3G2OA 1RI2A 4POOA 4X1OA 5K0JA 1V39A 2IDKA 2ZVJA 5K0CA 5FQNA 5DTQA 4XCXA 2ZTHA 5K09A 3MGGA 5FTWA 1KHHA 5LQNA 1L3CA 3F4KA 1PJZA 3REOA 1B42A 1R8YA 1X19A 2BM9A 2H00A 2OY0A 3EVCA 3CKKA 1YB2A 4KRGA 4PIPA 3CJRA 1WZNA 3G7UA 3QOWA 1XDZA 3LCCA 2GS9A 3NVMB 3TKAA 3HTXA 4EMSA 3EEOA 1RJFA 1P1BA 3OPNA 1KIAA 2IBTA 3GRRA 5DRTA 2I6GA 5CVDA 2ZCJA 4KDRA 5EEGA 1UIRA 4BLWA 3GRYA 3NVKI 1NW7A 2VZ9A 3UJ7A 2H11A 5EHGA 3HCEA 3KKZA 4E32A 5DT2A 2JHPA 5EZSA 1JG1A 3DMHA 5GM1A 3M6UA 2CMHA 5CCXA 5K01A 2C7PA 3HCDA 3OCJA 1H1DA 3FYDA 3NDJA 5DPMA 5F2NA 4GF5A 1AQIA 2IIPA 5E8JA 3FPFA 5T67A 4CXMA 2JHCA 1MJFA 3DP7A 3R6TA 3B5IA 5GWXA 2WA1A 4O29A 3VC2A 2R3SA 4XUEA 2G1PA 2OPBA 3KPWA 1SQFA 3R24A 5D1HA 1X1AA 4RTMA 1VBFA 2AOXA 1SUSA 5M5BA 2P7HA 3ER8A 4FS8A 3KQOA 2EJTA 2AOVA 1I9GA 1QZZA 1RI3A 5EOVA 3G88A 5E8RA 1G8SA 1VLMA 2UYQA 5LQRA 1NE2A 4HTFA 4GBED 1F3LA 2PGXA 2YXDA 1KXZA 2CL5A 2YXEA 1AF7A 2P40A 4Y30A 3OFKA 4PYLA 1JR4A 1VP3A 4HSGA 4F85A 2WA2A 1AQJA 1YFJA 1NV8A 4P58A 1Y8CA 2EJUA 4YUWA 3SVZA 4R6WA 5CVUA 5E9QA 5GIOE 3P2IA 3HA5A 2NNWB 4QQKA 4RTPA 3JWIA 2K4MA 8MHTA 3B3JA 1YZ3A 2O07A 2BR4A 2JH9A 3P8ZA 5DTMA 3EGEA 4FT2A 1QANA 5GINE 1VPTA 4HTFB 4RTNA 4IV0A 4X41A 4FP9A 3MTIA 2JH8A 5KS2A 3SSOA 2PWPA 3KR2A 1UFKA 3NDIA 4GQBA 5MHTA 1RI4A 5K05A 4E70A 2EFJA 4QPPA 2BR5A 2FYTA 2IDJA 2QE6A 3ELYA 3PB3A 5DXJA 1FP1D 4YV0A 3PLAE 3UJ9A 4AX8A 2PT9A 4M37A 3TM5A 1X1CA 1NBIA 2AOTA 1P1CA 2UYCA 2JJQA 1P39A 2NXJA 1AV6A 3O7WA 5E1BA 3JWJA 3BGDA 3E8SA 3GXOA 3OZSA 3PT9A 4LWOA 1ZG3A 2IH5A 2P3OA 3S68A 3LHDA 1RI1A 2O57A 2P35A 4EKGA 3BUSA 2PXXA 5EMLA 2IP2A 5EMKA 5ICEA 4DA4A 4A6DA 2C7RA 4QQNA 2PXCA 4OQDA 5CVJA 4C04A 1EQAA 4U7TB 1D2HA 2YQZA 4YUZA 4RX1A 4B17A 2HMYB 5IKMA 3FTFA 1L9KA 3O4FA 4HRAA 1JG4A 1JQDA 3BKXA 3PX3A 2C7QA 2ZZKA 2XVMA 4OBWA 1HNNA 3P9IA 5EEHA 4M38A 1VP9A 5EKUA 4CKCA 3SSNA 5ICCA 3R9XB 2NXNA 1R00A 4MIKA 2OYRA 4DCMA 3FPEA 3NMUF 2XVAA 4CWAA 1T43A 3MHTA 3SR4A 4BP3A 1NV9A 4HGZA 4C4AA 5C1IA 4QVKA 3C3YA 3SX0A 3KQWA 2HR1A 5B1SA 2Z6UA 2PY6A 5K0FA 2ZIFA 3A26A 2EX4A 4RVDA 3HVIA 3FPJA 5FCDA 4RTQA 2P41A 4LECA 1G60A 3FRHA 5LQKA 2IH4A 2OB2A 4X60A 4FSDA 5DSTA 1JSXA 3LDUA 5HOQA 3RW9A 3JWHA 1KR5A 1D2GA 5CVVA 1BOOA 5HFJA 3K0BA 5DRYA 5CD1A 3DXXA 3G5TA 1BHJA 3NJRA 3Q87B 3PVCA 3C6MA 3X0DA 4ER0A 4KVZA 4P7JA 5FWAA 2B25A 2ZULA 4DM3A 2YXLA 3KQYA 3LDFA 1M6EX 3LCUA 5LQUA 4H0NA 5EGSA 3GJYA 4FGZA 3EVZA 2AS0A 4G56A 4XUCA 3P2EA 1TW3A 2PLWA 3HVJA 4CKBA 3FTEA 1WS6A 5ERGB 5EKXA 2QY6A 2VP3A 3THRA 4BLVA 2NP6A 4MHTA 5EC8A 1DL5A 2PKWA 4RSRA 3GDHA 5K0GA 4RTOA 5C0OE 2AR0A 4E2WA 3HCCA 3I64A 1ORIA 3GNLA 3BWCA 4AUKA 2PBFA 2OBFA 1EG2A 3KQVA 5DLYA 1JQEA 2OKCA 3GRUA 2HWKA 4PYIA 3A27A 3VSEA 1HMYA 1WY7A 4HGYA 1XDUA 1XCJA 4MWZA 5DWQA 3G8AA 3EVGA 2EG5A 3GWZA 5CCBA 3ERCA 4R05A 1VE3A 3FUTA 4KW7A 4PYMA 4OA8A 3OZTA 3LECA 3T0IA 2N47A 1XVAA 5DM4A 5DM0A 5E9WA 1R18A 2Y1XA 1RJEA 5F2OA 3T7RA 4GEKA 3RIEA 2UZ4A 1OR8A 3LBYA 3DMFA 5FA8A 5IH3A 1M6YA 4BLUA 4RTSA 3LGAA 5K03A 3TPZA 4PCAA 5EIWA 3U81A 5KYGA 3CCFA 1O9HA 4P7KA 2QRVA 2ZIGA 3FUVA 3G2PA 3HM2A 2PT6A 2VS1A 1YZHA 3V8VA 2NP7A 5HIKA 3KR9A 4YV2A 3TQSA 3UJBA 3G2QA 3OU7A 3R3HA 3GGDA 4WXHA 1QAOA 2FK8A 4ER6A 3BGIA 3HCAA 3SM3A 3SXJA 4C08A 3V97A 3EVDA 3MQ2A 1UWVA 2ZWAA 4L7VA 3AXSA 2HNKA 3LKDA 5H02A 3SMQA 3BWYA 3ELUA 3GCZA 3IEIA 5E1MA 3H2BA 3CVOA 3MB5A 3TLJA 3DUWA 3HVHA 2PX4A 3GRVA 1SKMA 4QDJA 1EIZA 1ZGJA 5K0LA 1NW3A 1I4WA 3A25A 4RVGA 5DX1A 1VIDA 1ZGAA 5E2BA 3HCFA 4GUAA 3KQSA 4YUVA 4PIMA 5E9JA 3CBGA 3EMDA 3EGIA 3LKZA 4FSXA 4GC5A 2C7OA 3B3GA 4KIFA 2WK1A 4KWCA 4M36A 4K6MA 3BKWA 4F84A 5EVJA 1X1BA 2GH1A 3UWPA 4RTRA 4PNEA 5FADA 4CTKA 2PJDA 5GIPE 4HC4A 4EQZA 3TRKA 1KYZA 3IV6A 3A4TA 3SGLA 3K6RA 2AZTA 5HIMA 2G8NA 1DUSA 4IWNA 4EK9A 2UYHA 3DR5A 1XCLA 3BWBA 2G72A 2VDUE 3E7PA 3FTDA 3OE4A 3PFGA 3KQMA 4CKEA 5K0EA 1BKYA 5K0BA 3KQTA 5K8VA 2AN4A 2DPMA 3BWMA 5K0NA 3D2LA 3GO4A 2HV9A 3NW9A 5P8WA 2FK7A 5GM2A 4EKIA 1N7JA 5KQSA 5U4XA 2NXEA 3FRIA 3I58A 3TM4A 4E30A 2FRXA 2AOUB 1M0EA 2ZWVA 3BGVA 3PTAA 4OQEA 3HVKA 3DULA 2AOWA 1ZKDA 2OZVA 1VL5A 1VQ1A 2YTZA 2BZGA 4PYNA 3CGGA 4QVGA 5E1DA 2ONYA 5HIIA 3NWEA 3UA4A 5CIYA 3QOXA 2LD4A 1XXLA 2PSSA 1O54A 4R6XA 3TKYA 1FPQA 1XTPA 3P9CA 4CTJA 5EQJB 5EMJA 2QRVB 2IFTA 2ZIEA 3R0QA 3UFBA 1XJ5A 3KU1A 4DQ0A 5ICGA 4PWYA 2P7IA 1EJ0A 2AOUA 2GA9A 3T7TA 2GLUA 1FBNA 2OO3A 1KYWA 4EVIA 4R8SA 4Z2YA 1I1NA 5GOZA 2VDVE 2O06A 2ESRA 5CM2Z 3AJDA 1KPHA 3LL7A 5E2AA 3I53A 2V7EA 4RVFA 3DOUA 2Y1WA 3P71T 5DM2A 3HA7A 1SQGA 1EJ6A 1QYRA 1ZHFA 3FPGA 3TMAA 2P3QA 5LR6A 1L3IA 5DXAA 5JR3A 3CC8A 2ZW9A 4X63A 3FUUA 2GB4A 3M6WA 4IV8A 2AN3A 3HCBA 3EVFA 4V0RA 5DTRA 2HTEA 3M70A 4RTKA 2YUIA 4AZTA 1P91A 2FCAA 5E1OA 3A7DA 2ZBPA 5FQOA 2R6ZA 5DX8A 4YUYA 3FZGA 3LPMA 3FUWA 3FPHA 5CVEA 4DKJA 1KP9A 2BM8A 1X1DA 2IPXA 2ZBRA 3M6XA 1NT2A 5CUQA 1NBHA 3EVAA 4HG2A 1TW2A 4ISCA 5EMMA 4BY9E 5T6BA 3WSTA 3C0KA 3I9FA 3LDGA 3LSTA 5F2KA 2A14A 3EVEA 5EHIA 3UA3A 4ATNA 4ER5A 1G55A 4A6EA 5EIFA 2NYUA 2B3TA 2ZFUA 3M6VA 4GOOD 5D1NA 3G8BA 3EEYA 3NWBA 9MHTA 2ZZNA 4MQ4A 2XYRA 3C6KA 4AZSA 2OB1A 1IXKA 2ZLBA 3THSA 3ORHA 3O31A 3DXZA 1SUIA 2O0LA 3KR1A 2B9EA 3AY0A 4RTLA 2ERCA 3HA3A 1ZQ9A 4XUDA 2FHPA 1MHTA 5DSXA 2PX8A 3FYCA 1R6AA 3OFJA 5LQCA 4ER7A 2P3LA 1FJXA 3MTEA 3AXTA 5KVAA 3P9NA 3UJ6A 4DCGA 2BH2A 3NTVA
chains in the Genus database with same CATH superfamily
1K68A 2ZWOA 3O4VA 4F2HA 3A8TA 2X6QA 2V9ZA 3JATA 1HL3A 1N6HA 1N5RA 1NR1A 3AF3A 3DV0A 4IMJB 2JAOA 2VJQA 2CLKB 1JFFB 3FKSA 3PRJA 5CIWA 4LY9A 2DR3A 3CA8A 4YRQA 3KKUA 1Q1BA 2ODNA 2OGSA 2TMDA 4OHBA 4W4UA 4LWZA 5HCNA 1J21A 1ZXXA 3D8TA 3GA7A 3PUYA 4OGGA 3VYWA 3LDAA 3NHFA 3AR5A 3HXLA 5IS2A 3JQAA 3RTAA 3SP1A 2XDAA 2LTAA 1XI2A 2B4TO 1Y9EA 4DHWA 4JQCA 2J8ZA 2Q9BA 1J8FA 4GP9A 4D8XA 4PONA 4IDGA 1HY3A 4KX3A 1TYAE 2DOSA 2GNAA 2GHTA 3D6NB 3M33A 4A5OA 5GZ1A 2XVZA 2AJ8A 1SB8A 5PNTA 4ER3A 5K4AA 3THWB 3PDFA 5ELLA 1X7WB 1TLOA 3ICQB 4G1MB 4DSAA 5KYKA 4MQFA 5L4LA 2X3UA 3KPUA 1QQTA 2QV0A 4G25A 4HFJA 3UWOA 4X6UA 2CHFA 2VHWA 2WIBA 4MEAA 3TSAA 4X64B 3B7PA 4IICA 5AVQA 3CVJA 3E8MA 2QD5A 4JEMA 2YVLA 4HWKA 4ND8A 2RH5A 3RAJA 2QD4A 5T3UA 1C9MA 4PLCA 3UJDA 2I62A 3SC6A 3A4LA 4MR7B 1SEVA 1Y81A 2H17A 4GOND 4M49A 1I14A 1GZ6A 5AKZA 2NZXA 4GXNA 2GSWA 1X70A 3BOSA 1MRSA 4J03A 4GWKA 4LFCB 1AMOA 1K7XB 1MAUA 2QUZA 1LB1B 1TEVA 4NCJA 3W2IA 1NMQA 1Y80A 4QECA 5IH7A 1EFLA 1A7AA 2HH5A 4N4ZA 2XA1A 1I3CA 3C4JA 2NSHA 4LJSA 4E51A 4Z4GA 5KOHB 4W6QA 1Y1KE 4HDMB 2B20A 1W47A 1LVUA 4DAEA 3ROTA 1UQRA 3OZBA 5EPUA 2XOKD 3ASZA 1NJGA 3MAGA 3VKWA 5DX0A 1MB9A 3VPDA 5FUBA 1HT0A 1Z13A 5EZQA 3EQ8A 2WYHA 1FX1A 2ICAA 1Q22A 2X58A 4G5SA 2B4QA 4KBFA 4N5MA 3G9TA 4D43A 2B69A 2FRVA 2ORED 4WZBE 3LBHA 3TDKA 2QMZA 3VR6D 4PYQA 3SI7A 1P0MA 1U4OA 3NV9A 4YYVA 4JC5A 4R0NA 2IUUA 2NAPA 5EKTA 3B6MA 3O1LA 3C3JA 1XJWA 3EGOA 4CLHA 1WZEA 4CKEB 4F4JA 3SEZA 5CT8A 2BM0A 3OLWA 1I7DA 4GM4A 1J23A 4L9RA 3LL4A 5GTDA 1U81A 3KTAB 3N2IA 1RRPA 2JQGR 1ST3A 5BR1A 4YYQA 4ZK2A 4E2YA 3ETHA 4JB0A 1C80A 2V55B 1KO4A 3CFYA 3K7EA 4PLWA 1YBVA 2PAAA 1L1RA 5ICSA 5JSHA 3ROQA 1MGOA 2VKTA 4YCAA 4NG4A 3KD2A 4F6RB 1L5VA 2FWAA 3H3XA 5CLQA 3U3JA 3K9QO 4GX1A 4BZQA 3K32A 2JB9A 3KUKA 4YAJA 1M7GA 3NEYA 1JEQA 1TRKA 4R9UC 1Q0SA 1FP7A 3GELA 3F5QA 4AP5A 3L93A 3KPJA 3RRYA 5D5HA 2AIMA 4MTLA 1S2GA 3WE7A 3YASA 3OVMA 3SIRA 1Z0ZA 3T9BA 1YWGO 4B6EA 4KH1A 1JT9A 1Z8FA 2QZZA 2ZIAA 1JDBB 2DKOA 4JUAA 2C03A 2DF8A 4ITVA 1ECCA 4ACAA 1FIUA 1E32A 5T3YA 4EWLA 3C8ZA 1HX7A 5K0ZA 2CL6X 1V16A 2P2CA 2EEZA 5C7LO 2E18A 1ZK1A 5I7EA 5K0JA 1V39A 3O7MA 4W7IA 5AVZA 4LQLA 3WL5A 4AY3A 3EG9A 3LS2A 4IZOA 2X8JA 5PGMA 3VNQA 2FQYA 5IUKC 1XZCA 2B8WA 2Y1CA 2WJ6A 2VHCA 4BKQA 3O1IC 4ZGWA 4URHA 2E49A 1CPJA 4CLOA 1AZSC 1P0IA 2YWHA 4EMSA 3KOYA 5FBQB 1LD3A 3IL2A 3KFXA 1YIAA 5G3YA 5D86A 3RRMA 3V55A 3EXEA 3CVVA 1EKXA 5E95A 3DTYA 2JLAA 3W8EA 1ZUWA 3DONA 4K1LA 4F96A 3I61A 1I5RA 1SUAA 1BXKA 3MOSA 3OPYI 4LVUA 4MKZA 4RVSA 3ROEA 2JEZA 4Z9AA 5GM1A 4IDPA 4YO8A 4OY3A 5CCXA 3NB0A 3F7NA 4DJEC 4WSOA 4DSOA 2QVCA 1Q1AA 1AQIA 3SQXA 4PQRA 2VAMA 3ZVRA 4DV5B 3GMSA 3LDHA 1CVRA 1E2HA 4FJ0A 4PC1A 1ESMA 2ZVQX 1U3WA 1JPJA 1B8VA 3BMOA 2A88A 4PC2A 4XPZA 1DCFA 2AYYA 2OE2A 1T36A 2PEZA 4B3HA 5A0VA 3IOQA 3KFQA 4J6EA 3ND6A 2DLNA 2YZNA 3UCEA 1G9SA 3QBJA 1OXMA 1CQJA 4NYIQ 3R75A 4YFVA 4PAGA 4KSCA 5CJPA 1C30B 1ORWA 2IDMA 4PO1A 2G17A 2DZDA 1DXHA 4L8FA 2R0QC 3U48A 3RABA 1XFAA 3VYTB 4KMMA 5FWYA 1EGAA 4BB6A 4CR7A 4G85A 3L7CA 2IHNA 2ZAIA 2HREA 3HKDA 4LMPA 4KIJA 1W76A 2BN4A 3PENA 2AUNA 1V8ZA 1YB4A 2VHQA 4JC8A 1YR7A 3IAM6 3HDTA 3ZUAA 2JFZA 2HMAA 3M34A 1OH7A 3K9GA 1O87A 2K7ZA 1GNSA 4D9MA 1D9XA 1CQWA 4JVLA 3V9PA 2GNOA 4TRNA 3ZVMA 1ZD1A 2JH9A 3FDXA 1U0LA 4L28A 3UOAB 2F9MA 5BN1A 2OSVA 3O3CA 4IOMA 2A35A 5F9MA 3K9LA 3ZDZB 3KR2A 5CH3A 1T9ZA 4TS9A 5DYWA 4CIXA 4M1KA 1CUXA 5DBHX 4LY0A 3PB3A 5A1TA 2CB0A 3AHCA 3SOZA 4BNZA 2GZAA 2WTAA 1JPUA 2G6BA 4ARSA 1Z39A 2Y99A 1AMNA 4E7OA 2QRLA 2UV8A 3V4PB 1PIWA 5E1BA 3WK7A 3ZQKA 1T9GS 1YRHA 3QPDA 3D6HA 3OICA 3O3NB 3IQWA 5JXIA 4K0KB 3TD9A 1AO0A 1YZTA 2XWPA 1NJ6A 1VI2A 1II9A 1XL1A 3B53X 1DZ3A 3CURA 1Q0PA 3FLAA 4JLUA 4L9WA 3ZHZA 1KJ8A 3PCRB 4W1QA 5JADA 4R9SA 5AYVA 1TCVA 2EDCA 3B1WA 3RTDA 2NPOA 3SS9X 4EHIA 3FTFA 1GGJA 1OI7A 3C3XA 2WI8A 3QPAA 4HNQA 1KH2A 4Y1EA 1NXPA 5GY7A 4B4WA 4ZC8A 4ZI5A 2YJ8A 1MX9A 3SYMA 4ITUA 2R6GA 3L41A 1RRKA 2XVMA 1VP9A 1WUJS 1ZMOA 2C95A 4L8LA 8LDHA 5IJ0B 1P60A 3AG5A 2OYRA 3SJBA 3ZXXA 3NMUF 4HDRB 2XVAA 5CHVA 2YV3A 2BF4A 3QE9Y 1K8YB 2PD6A 4GH5A 4YP6A 3RTGA 1A9TA 1Y9JA 3ABQB 1EG7A 4Z1MD 1GQ2A 1V9LA 2FRDA 3SX0A 1XHFA 3OD1A 3PJFA 3AUFA 3DYIA 3KHUA 1H4SA 3K0HA 5MN6A 2VRWA 4HB3A 4WZ6A 2Y5BA 1VJGA 1DQSA 3R0ZA 1R3UA 4M76B 4BFUA 1KH1A 4BV3A 2XUKA 4BGEA 3BD6A 3CR3C 1JSXA 5D3KA 3AFGA 5ALKA 4RH0A 4ZTZB 4JZKA 4EBFA 2OVFA 4ND7A 4NFSA 5DNEA 3PUXA 3T7KA 2HHNA 1EFUA 2I8AA 5KSZA 2J0VA 3NUZA 3N3GA 3ANNA 1TLTA 2VQFB 3NT5A 2ODPA 3P0JA 4LQCA 3SR3A 3G2KA 4OFBA 1XJCA 2Q5QA 5MFZA 1KKMA 3FWHA 4FGSA 3I3SR 3R4VA 3LDFA 1BXGA 1ZVMA 4LZNA 4KC0A 2FUNB 2Z2IA 3QYFA 4OXRA 5KSYA 1KE2A 4CKBA 4XCQA 3LHIA 2Z3WA 2V1UA 4CDMA 1KDYA 3FGPA 3L18A 3NOOA 3WGMA 4D4KA 4GR9A 4B3BA 4PSDA 2CLLB 2OA0A 4PFJA 1B8NA 1P73A 1U0TA 4L5JA 5JFTA 4CM8B 1IL0A 5F4ZA 2Y2VA 2W22A 1C2TA 4H60A 3GBSA 3R3ZA 2D3WA 3F6PA 2V8OA 2ID4A 2QIOA 4X20A 1E63A 1KDPA 3OETA 3PRYA 4QXMA 3I9LA 1F6WA 3VI4B 5DLYA 5CXQA 2LP4Y 3ZWWA 5AQ1A 4M60A 1FMTA 4QU5A 3K35A 3FOBA 3ORSA 4WESB 5ALLA 4LF6B 3Q88A 3DGFC 3S4YA 1KFKB 3CLUD 3DHEA 3UXYA 3BL6A 3D02A 3IIEA 1TC2A 3LBNA 4MWZA 4Q02A 5DWQA 2FP3A 1EWOA 5GQSA 4QBTA 2IJGX 5AKIA 3STTA 3AW9A 3VPHA 1UP4A 4I4LA 3LMKA 3WNDA 5JD6A 2DT5A 4Z7QB 3W4KA 2VYNA 4MP3A 3LX4A 1QMPA 2AG1A 3CT4A 3LFTA 4IYRA 4CMKA 1V5FA 1JE1A 2XQVA 4D0LB 3W7BA 1X2EA 4KQIA 1PG5A 1ULHA 1MX1A 2B4AA 4HCJA 5E9WA 3ZS9A 4J4HA 4O63O 5A6VA 4GEKA 2ZU6A 4XSGA 3WA7A 5LFAA 5FBHA 2MYUA 3A31A 4AQDA 1U0JA 2ZG6A 4OQXA 5IBCA 2EZ8A 1M1YA 2HBYA 3RC7A 4QH6A 4L75A 1MO2A 3NBAA 2IBIA 1WX1A 3LQYA 2BGUA 4MMZB 4DYVA 4O8CA 3ISVA 3ORYA 1NJ5A 1Q84A 3GN1A 3GW8A 3QU7A 3HJRA 5L6LB 1Z0JA 1Z82A 3QMVA 5AJYA 1TPZA 4BZZA 4C08A 3O1GA 2CF6A 4WXEA 2HA4A 1KERA 2PGDA 3L0YA 1P2FA 1P7VA 2Q4BA 1K7SN 1BDJA 4JD5A 4WFKA 1AC5A 1UJ6A 1ZGCA 4H1HA 4DRXA 5JFGA 2ACWA 4NYJR 5CU7A 1G8YA 3W06A 2AS8A 3EE6A 3LPNA 5CDHA 1EU1A 2JRLA 3I0ZA 4FHGA 3B9RA 3HV2A 1BDIA 1FW6A 2PZMA 4YJDA 1XVLA 1ITZA 1HYBA 2CL7X 2R84A 1CDZA 3ZZUA 3BAZA 1I24A 1SIWA 1KFUL 4PIMA 1JQ5A 3AI7A 5CRIA 4CQMA 3EGIA 3PI7A 1DC5A 3HBFA 4QNRA 1WTAA 4ZV7A 4EY6A 2RHCA 3PG5A 1NHWA 5HF5A 1SQ0A 5JWHA 3ABZA 1BGWA 2GJKA 3BSSA 1HEUA 4LMRA 4M1EA 4MGEA 1T8PA 1XVUA 2XOXA 2VJAA 2GN0A 3KDPA 3H65A 4NJMA 3GDGA 2P2NA 5C1OA 3UAZA 4LVCA 4Y6QA 3RVSA 4AUEA 1NN5A 1V35A 4QO7A 4FHEA 5TMEA 3KJIA 3LT1A 2HLDD 1TO1E 4IVNA 3OWOA 4MA5A 4ZZ3A 2XCSB 2W42A 1Z47A 4BGDA 5K8VA 1IEXA 1PBNA 3RC9A 1AXEA 1K0UA 4IHQA 3IVGA 3N1UA 2ZJ1A 5P8WA 5CB4A 3EXFB 3CEMA 4RZUA 1L4FA 2AR7A 4NZYA 1EP1B 1YIDA 3AUUA 5IUNC 1FE8A 2VJYA 4H1VA 1BH2A 1ULTA 3INRA 3REFA 5CFOA 3KNZA 4FZ5A 2PR7A 4WD3A 1YMQA 4OSOA 3HFJA 4KO3S 3DAPA 2FOIA 5F64A 2UZ1A 1V6SA 4PT5A 2VJCA 3AIOA 4ZP1A 4L4ZA 1PDVA 2UU9B 3SJAA 4CTJA 4IGIA 4WADA 4HQ6A 2PV7A 4P3PA 1L4BA 3SZGA 1GA4A 1Y8QB 1WUIS 3IPAA 4Y3UA 5AW0A 3EC1A 1FJHA 1R6VA 3ICPA 5FIUA 4BLOA 4B3RB 1YI8A 3WGNA 1HDZA 2PN1A 1X13A 3HI6A 4DLBA 1Q1ZA 2ESRA 2QMEA 2PKYX 3M8KA 5CTAA 3RNVA 3TGPA 1KJNA 3I53A 4WJLA 2P4EA 2BISA 4BGVA 2QQ5A 3WRXA 1K8QA 3LC2O 2PMEA 4EP1A 1M2OB 3FUUA 3LUDA 4BQNA 4WFIA 1ZH4A 2GLXA 1Y98A 4RJKA 2GPSA 3TJRA 4RS4A 1ATZA 1SQ6A 2YC4C 3X1DA 5LNK6 1K9VF 3RTCA 3Q7SA 3M6XA 5I7RA 4DTIA 5CB6A 2QRJA 5F77A 1RQLA 4HG2A 3RK0A 4YJ3F 3FSGA 2F43A 1E60A 2IXBA 3M5WA 4O2AA 5AXAA 1B16A 1TJYA 3M9WA 1Z37A 1JYFA 2ETVA 4B09A 1H3NA 3M6VA 3KQUA 4GOOD 4MMXB 2IEZA 2Q8NA 4F5YA 4AZSA 5FBZA 1OXBB 1NF3A 1OFUA 1TCCA 4FIPA 4R5HA 4BMOB 1VHWA 1B74A 2BWJA 2WJAA 1QV9A 5G2OA 1FRVA 4M8IA 1IDOA 3V8RA 2Q6LA 1MHTA 2J5XA 2EQAA 3CLUC 3Q2KA 2GHQA 1CJLA 3L4JA 4XYLA 3TTVA 1HFKA 3C6XA 1HE1C 5JYBA 4DCGA 1L7EA 1TUBA 3EXG2 4TZTA 2IBSA 4H3VA 3L46A 2IYZA 4FU0A 1U3DA 1TAGA 4WJZA 4ZO8A 5AVWA 4OH1A 3KV3O 4HI0E 3HG7A 4C01A 2F3RA 4UBIA 1U8TA 2AV6A 4XA8A 1HZZA 4C7MA 3I1FA 1JTEA 5CFMA 3SC3A 1K97A 2VYQA 2YHIB 3QLVC 4D3SA 1TZKA 4RPKA 3QPVA 2OESA 5FUQA 4J94A 3JZFA 2HX1A 3EULA 2IW1A 5EYPA 1POXA 1U2PA 2ZAOA 5BSWA 2FZGA 2W2OA 4O4JF 2IT1A 3ZD9A 2ZUEA 3DDWA 4LCEA 4C7JA 3LJKA 4LNAA 1BD3A 2YINC 4WFQA 5SYMA 4B33A 4JYPA 5AVVA 2O8VA 4M8KA 2ZUFA 4V24A 3USES 1NKVA 1P1HA 2I8LA 1O97C 3C6BA 4ZJZA 3PQFA 5EWJA 3SBXA 5IFLA 3J81A 1Q7EA 5KHLB 2VHSA 4FFNA 2XUZA 4BZXA 4BJ5A 1CBUA 1RYEA 4Q47A 3BQ9A 1EP9A 2CVPA 3OU2A 3I39X 3PX2A 1UJCA 3VR3A 5KJCA 4KFTA 2TYSB 4EZBA 4CEJB 2H2WA 3FHLA 1NVWQ 5LBIA 1P81A 3KPYA 2H29A 5AK3A 4KQJA 4YMHA 3FSEA 1GCOA 3WG9A 1VSNA 4Q21A 1BWRA 4ZTUB 2H07A 1ADBA 1XSEA 2ZUTA 1Q1EA 4J0IA 2FUG6 4ZJPA 5B3JC 2X5XA 2YX1A 5FKJA 3RYCB 1U9VA 4WZAA 1CR2A 1ILEA 3DF0A 2P9CA 4NV3A 2EU8A 3DZBA 3JYNA 5JO9A 3IOMA 4GOMD 1GTJ1 1JSLA 1XKXA 3ANSA 3HBLA 1Z4PX 1SG9A 4IQGA 4NATA 2AEEA 5D2CA 3A4YA 4UVIA 2HXYA 3BE4A 1V8OA 4Y6OA 1IMOA 3IBTA 1D2AA 4NP6A 2PX5A 2WINI 3TRJA 2O9JA 3FHCB 4R8KA 7REQB 3PLRA 3PYMA 4Y0NA 4XXHA 1MG5A 5D01A 1UKCA 2EKPA 2JIRA 3LYHA 4LHVA 5G53C 4F4UA 3LLCA 3OG9A 3WBJA 5KNDH 5A2QA 1XNGA 1YR3A 4QX6A 1V45E 4H7DA 4NDNE 2XB6A 4U00A 5FUWA 1Q12A 5E6RB 4ZU1X 2AG0A 3ZQJA 5TQJA 5IVKA 1XZIA 2I2BA 3TK1A 2VHYA 2J7QC 3NNDA 3OU6A 4TT3D 4YONB 2PQ0A 5IABA 3QHQA 5UKDA 4AIRA 4F4CA 3K4QA 4XJTA 2BKLA 2YHBA 3OCWA 5G3ZA 3IIMA 2Q0XA 2QL6A 4A9AA 5LB4A 3PDHA 4OP3A 2BFOA 2HFJA 1S1MA 3QEMB 1E99A 1XEXB 3PDCA 2XGGA 4WVFA 1PEYA 4QYIA 4C07A 8ATCA 4N48A 3ZK8A 4RD6A 2ZB2A 3DBHA 1Z16A 2Z56A 1WUTA 4MQMA 4BE4A 2QSUA 4LOLA 3BILA 4ES6A 2QAIA 2PA0A 5JNRA 1ZM2A 3WKBA 2JRCA 2R48A 3D6JA 2X2EA 1HUCB 2YIMA 2WSMA 5ICFA 3RUEA 5FTJA 1BFDA 3CLRD 5F12A 3UIEA 1KDRA 3EOZA 5EJ8A 1AK1A 1FSGA 3VAZA 5LOVA 3S2UA 1ZEJA 2JLBA 1CQDA 3ND5A 1RLOA 2ADMA 1L3BA 4H3KB 4IDBA 3C45A 5FNVB 3HMKA 1YULA 2F1JA 4M22A 3QG1A 2HUPA 2W8BA 1QNLA 1XTSA 3FGNA 4KO2S 1IZ9A 1YDHA 2IYRA 3AWIA 4H7IA 5E7JA 1NF9A 1F4PA 4LJ7A 4FBGA 1JTFA 2O05A 2XUJA 2C57A 4PC6A 3VHQA 3I6MA 1M2EA 1T2AA 4GI3A 4O1HA 4POOA 3FJOA 4WCVA 4IXNA 2Z2XA 1FDUA 1U63A 4OQNA 1Y8AA 4Q19A 5DTQA 1PG0A 5AUPB 4Q1VA 1VA4A 3NGLA 4P34A 2Y27A 3LGXA 5LYJF 3D6UA 2HN9A 1SC6A 3PE6A 5HM8A 1XEXA 5LDGA 2FX2A 3CKKA 4HJXA 2VR1A 5ILGA 3UWKA 4CN8A 4ENQA 4Z49A 4PZUA 4TTRA 4H6WA 5AM0A 1LX6A 3E7DA 5K8CA 4TOIA 4LYGA 2GWHA 4N65A 3TOCA 1TL9A 2Z3VA 2XDYA 1URPA 4BO7A 1H85A 5EEGA 1YT5A 1GL9B 1OXUA 1BDBA 1PR2A 1IMJA 2E4VA 2IYUA 1IPEA 4PAQA 4TWRA 1SXJD 1HDGO 4GM1A 2A58A 3A2LA 3TQRA 4Y2JA 5KNBA 3SM9A 2XCIA 4ZEMA 2ONJA 1OILA 4H2DA 4RA6A 3DMHA 1IEWA 5TB5A 1V41E 2B1IA 3A70A 3SNHA 1H1DA 3ETNA 4GF5A 3BHMA 3DUFB 5FOXA 3QOFA 4MJ3A 1PUJA 3H9EO 5G4KB 2A0YA 1Z35A 2BZ1A 2TMKA 1U2QA 4RPGA 4OLBA 3R5SA 2WA1A 2WWVD 3BFPA 1MHWA 1O58A 1THZA 3M6MD 1GQOA 3ZBUA 2CLEB 2MYPA 4QDZA 1NMYA 1L8LA 2GYWA 4F6RA 4ZYXA 4ZVTA 3IHLA 5A7FA 3ZKAA 1J33A 3W0LB 2ZYDA 5JSFA 3K9BA 3RS9A 1I9GA 2YHUA 4Q3EA 1Z7WA 4B84A 5ELXA 1R7RA 1XYGA 1KEEB 1S3GA 1XXHA 2A5GA 1QK5A 2TECE 4GXRA 1YK8A 1AGXA 4C89A 2CL5A 1U8YA 2XVYA 3QMPA 2OILA 2ERYA 4EA8A 5LZ9A 3JAKA 1NVMB 1FUYB 2C2WA 4HSGA 4FVTA 2IQIA 1FYEA 3KTAA 4OEHA 4IX1A 3PE3A 3MHHA 3ZZ1A 1V2HE 4RNAA 1FFHA 6LDHA 4DR2B 2MSKA 2NNWB 4JN6B 1C7EA 4NE2A 2Y9MB 4IUDS 1BDMA 2BMFA 3WYFA 1GNVA 3GF4A 1N0IA 1TZCA 4CVNA 4LOIA 1QXPA 1OFTA 1QLWA 1GPDG 5IW8A 2FTKE 4YQYA 4N76A 4NS1A 1XRPA 1XRNA 1Y89A 1YRQA 3S81A 4M37A 4H18A 1QS0A 3LWBA 1OOEA 4HWGA 3R7FA 2B7CA 2YHIA 1M3SA 1HA3A 3E8SA 3O0DA 4HZUA 3ABOB 4B3XA 1XU9A 4J91A 5ICEA 1E20A 3ZZTA 2OQ2A 2EIHA 3IURA 4BZWA 4PAWA 2B4RO 4EL5A 3FVWA 1QRUA 4U7TB 1EGHA 4PBRA 3E3AA 4YUZA 1P61B 2I99A 4RZ3A 2G7YA 2GEKA 2VC2B 4ILEA 3ISTA 4JL8A 3C24A 3EXEB 5IBRA 4NABA 1VFPA 2ONKA 5EEHA 4X1YA 3HCOA 2JFBA 4K6KA 3F3YA 4BKPA 1VJCA 3ZI0A 3L7AA 1SY7A 2EGGA 1GPBA 1GU1A 2FKAA 2D7DA 4DLTA 4XM1A 1SG6A 1VMDA 3RSSA 2CNLA 5I7FA 2VA8A 5IAAA 2HHHB 4GECA 5AJWA 2BE9A 1UBUS 3QVTA 3OE7A 4RFVA 2Z6UA 2Z58A 1JEJA 2JF0A 4I4TF 5AR1A 1KJIA 1K3TA 3BFKA 4XX1A 3AINA 5DB4A 1MS6A 4RTQA 1KEKA 2EX0A 3KE9A 5KOYA 2DJFB 3RROA 2QS9A 2OV1A 4ICIA 2Q5OA 1KEZA 2PYIA 2NV2B 5JG7A 9GPBA 3I32A 4JWTA 3U19A 4QFCA 1KR5A 1PFWA 2C2YA 1EHYA 4EPWA 3I9JA 4EJSB 1SCUB 2PWAA 2J09A 2HPZA 1CUHA 3T3PB 2JI4A 3GEIA 3O74A 3X0DA 2LNDA 3Q0EA 4NBWA 4EA7A 4MZOA 2RGUA 3AVUA 3HHAA 1A9OA 2MDTA 2I2CA 1B4DA 2QJRA 2ZDGA 3NM6B 4FGZA 1C7IA 4HXGA 1MAWA 1GCIA 4ANFA 3QU2A 2P2ZA 5AW2A 2PE5A 1BEEA 1K4YA 1GLGA 2R4UA 2GQ0A 4YCNA 3U4AA 5JECA 4WZZA 2OCBA 4CYMA 4M8SA 1JKXA 5AHRA 4QOGA 2BGMA 3U61B 2GT1A 4R9NA 4MDFA 3K1YA 1DBSA 4GZLA 1WJGA 3OTGA 2BFDA 2CNWA 3QQPA 2VJOA 3BCHA 3K1AB 1KU0A 2WJWA 4MCIA 4UNQA 1U3GA 3KWFA 2GHIA 3G2IA 1H0KA 4Z3KA 1YCDA 1VKOA 1Y6FA 1G8JA 1Z4NA 2O5VA 4NMXB 2JA1A 4UHHA 1E96A 5JZSA 5BN3B 4UVEA 4JSTA 4RHFA 3DEIA 3UT0A 1E6EA 2ON6A 4LZPA 4EKNB 3NATA 4YCDA 1GA6A 2BRUA 3O4GA 1L4MA 4O4HF 2AG5A 4F4FA 3V6EA 3Q2IA 1X8KA 2EHJA 3WKCA 4JR1A 2NZYA 2QLMA 4K8RB 2Y1FA 2JD2A 4X6IA 2AIRA 3KJZA 1OXTA 1SPXA 3OY2A 5JATA 1J2RA 5EJGA 2H54A 3MD0A 2V7QD 1MHPA 3ZHXA 1JEYB 2O2HA 5LMUB 3USVA 1SBIA 1PJAA 1EX9A 4QPDA 3TB6A 4CDDB 5EE0A 1C9EA 2G6TA 5J4KA 3Q85A 2X5NA 1FMCA 3AI2A 1KVUA 2J3KA 2XXAA 2R6FA 4C0BA 1V2GA 4GP6A 3DZ8A 3M4YA 4MGIR 5BWBA 4PC3A 1BHO1 3A11A 2KLHA 3WRXC 1Q1GA 4PLTA 4D5EA 1EDDA 3NHSA 4QXPA 4RANA 4RF3A 3EVDA 3PBHA 4K6FA 3HCNA 1FFEA 1ODSA 1N2CE 1US8B 3A1EA 4UEWA 1DAHA 1YXMA 1QHHB 1GZHB 2BFNA 1JR2A 2GZ2A 4EA9A 4C30A 5E1MA 5IC5A 1Q19A 3EZFA 4C5CA 2C4WA 3D4NA 4OG2A 1WBBA 3KLBA 1G2PA 3VR6H 3BPMA 1XZHA 1I7LA 2B99A 1H9BA 1TMGE 1Z2OX 1W88B 2PL9A 3OM0A 3TGWA 2QHXA 3BK1A 4JLOA 3T3GA 2VWQA 5JDIA 4GUAA 3MJCA 8OHMA 3LKZA 4FE3A 2P6OA 5AKKA 3H1EA 3U3RA 4B1FA 1W1UA 2O2YA 5LQJA 3KDSE 4MYUA 3SIWA 3F6SA 2FAXA 3UWPA 2FPIB 4MVJF 4JUIA 4CTKA 4PZAA 4MS4A 4MS1B 4QYMA 4XD7A 4DN6A 2GEJA 1DQRA 3TRKA 3W9UA 4WY5A 3WISA 5HIMA 3WLMA 1LBEA 1NFQA 4CDNA 5HOEA 4C2BA 3BQNB 4G5GA 1C3LA 3R4CA 4L4UA 2QTTA 4GX0A 3FTDA 3MJ5A 2FHSA 2ZGVA 1QHSA 1J2UA 3K8YA 4J0QA 3IQZA 4AK9A 2JH3A 2F8MA 3NW9A 1Z0SA 4DZZA 2FK7A 3IS3A 4CKCB 1GAEO 2XWJI 2ZYUX 2XIJA 3DFKA 2VTBB 1J5EB 2P62A 3TQOA 3Q7RA 5H81A 1NHGA 3QQ5A 5CJ2A 1FFXB 3R9KA 4L8YA 1OJLA 2XPCA 4WESA 3KVYA 2NV0A 2F3PA 4N3GA 821PA 1I2AA 2A6PA 3DOCA 1GG5A 4LE0A 4OHXA 2CFRA 3WAKA 5JNUA 4MVJP 1B14A 1QPBA 1ZKDA 4PYNA 2J0QA 3Q12A 3FPCA 2BZGA 2O2JA 2V5UA 3TZBA 4MVWA 1JR6A 5A0TA 3NBUA 4BTEA 6ADHA 4FWBA 1NOJA 4HR7A 1WSDA 3V1KA 2RGNA 3ZI4A 1HO3A 4O4IA 1EXWA 1R6DA 5CK4A 2DCDA 2YJBA 1ZRMA 1S8FA 4HB2A 3U62A 2IC5A 2XCLA 3VTKA 3HLYA 1KYWA 4XUGB 1MH9A 4TSKA 3OMWA 4BFSA 2PX6A 3G2JA 2VTBA 1FL9A 2CLSA 3UMSA 1CF2O 1A5BB 4BP8A 4U6QA 3EQ9A 1U7HA 2GJ4A 3UTCA 2JHFA 4PSAA 4YYSA 5EWMB 2WVJA 3IVCA 1P5ZB 1RAHA 1LDMA 3P2YA 1TFUA 3O3OB 1EYZA 1O94A 2FZ4A 3BJEA 1KMHB 1E5DA 3SZLA 4RAQA 2WYUA 4C4ZA 3CRVA 3ZCTA 1MKYA 5LA6A 2A7QA 2AEJA 4MYSA 4V0RA 1QGUB 1T3HA 1VECA 3M70A 4D79A 1XTVA 3I0NA 1LY1A 3H9UA 1T6NA 2LKCA 3RJZA 1PNTA 4MS4B 4N47A 2P6NA 3EZ6A 1ZD9A 3DWFA 4IUYA 4XGRA 3VYVA 5FXMA 1X1DA 2IYYA 3S99A 3SVLA 2I29A 2VI5A 4WNAB 1UXHA 4JQYA 1AH2A 2ZPAA 3DHWC 4ISCA 1AS0A 4BY9E 4BVFA 4W5RA 3GEPA 2CZGA 2XYHA 4U6SA 4B40A 4ER5A 3EQ2A 1KEUA 1M7BA 2HA7A 3BJZA 3KKPA 5EIFA 3ZY4A 1JGTA 2NACA 3EZLA 1MXFA 4YDSA 1LNSA 1BGVA 2FUDA 2BGNA 2X8BA 5KYUA 1V7QA 2LXNA 3G1TA 3RM3A 5GVSA 1QIGA 3PQEA 1IHYA 2JAPA 2V9PA 2O8BA 3GFTA 2OO7A 1NDQA 4NJOA 2AJBA 1JEEA 2IL1A 2QRHA 4P83A 4S1PA 1BXRB 4TKLA 5A5EA 2Q0QA 4PRYA 1LJUA 5IDVA 5C8XA 2VDKB 1ZRHA 4FGWA 2CL0X 1EWLA 4H3SA 2VHEA 4EB0A 1BXRA 1YF3A 1WSAA 4E5UA 3KT3A 3O2NA 2IVZA 2P1ZA 3L5OA 3HE3A 4FTWA 5HA5A 1UXOA 3COVA 4PX2A 5EHQA 4AJOA 1GEGA 2AA3A 3FWPA 4Y2GA 4ZCPA 4WACA 2PCJA 1F1JA 3CLSC 1Q95A 1UAGA 3WV5A 5C8VA 3TTSA 2AG8A 3TTXA 3ZU6A 4MVYA 3JXEA 4K0RA 3SJCA 1TPYA 4E14A 3TLBA 4OM8A 3WSVA 2GTIA 3PFFA 4B6GA 5FAKA 1E2EA 3A3KA 2J6BA 2JJYA 4IKPA 1Y5RA 2JJ8A 3O4IA 4ESVA 4KPUA 2WHYA 4K9KA 1Z2NX 4AP9A 2GBLC 2JBAA 4H27A 1Q17A 4LQ4A 2BBWA 3I3OA 3CJTA 4H4CA 4HH3C 3M4XA 3E58A 1Y3IA 4TXMA 4PN7A 1CJKC 4AKHA 1DJMA 4DLSA 4YPVA 2QJTA 3ZVKA 1S02A 2GBCA 2HA5A 4GLOA 4YP0A 5J23A 5H82A 4HFNA 1MGPA 4M98A 4D9JA 1E7WA 5C35A 2X2OA 3OZRA 1R3DA 1KRWA 3RYHA 5EP2A 3Q7PA 1P1JA 3PDJA 1BJTA 1RJ9B 4JGBA 1DI0A 4BCCA 2IH2A 1MO6A 3ZZ0A 1V1MA 2X41A 3KR0A 1ZVQA 1J8YF 2IW3A 3VO2A 2YRXA 4TMKA 1V5WA 1UM9B 4H0CA 4PC7A 3LZCA 2O8NA 1I6LA 4Y1RB 4F0JA 1CS8A 1H2ZA 1K8RA 4OAPA 1OI2A 3MSCA 1Q0ZA 2DBRA 3HKDB 3KBBA 4I1RA 3AP2A 3BD9A 1Z18A 2QX6A 2XKBA 2PSEA 4EI2A 2QQFA 4AICA 5K3FA 3LC1O 2IU0A 3QHAA 3BN3A 4XFKA 5TPWA 1HDXA 5HBRA 1AUVA 1D2CA 1T5HX 2HCBA 3WMRA 2VK4A 4QBIA 4C4RA 4V1CI 3E9NA 1BVRA 1P4HA 2OLJA 2X42A 3AOEA 3BXHA 4X9XA 5KVSA 4ZAGA 4L3WA 1B73A 2QQEA 5FF9A 1LH0A 2GEBA 4MJXA 4YPFA 2XDWA 1O95D 1HF3A 4LNHA 4LFAB 2GK7A 3NBZC 1IVYA 1XR3A 4RH1A 3TR0A 3NHJA 5AM4A 2IU6A 3U60B 2EIXA 1PT8A 5HFNA 3T12A 1SUEA 3BORA 3IIIA 1O03A 1SBZA 2XMRA 4BU1A 2BFMA 1TZBA 2ZS8A 4LHXA 2I54A 2A5LA 3VR5D 5SYAA 5JQGB 1NVEA 1P2TA 1QPZA 1GA1A 1G20A 1AYWA 1DKOA 3W7VA 1DC8A 3IVXA 5IRCD 1ISRA 2JCVA 3ES9A 4D9FA 3BZBA 5JSYA 1N2JA 2PR2A 3WP1B 3W8RA 4Y9RA 3C3PA 2D5IA 2F2TA 2HWWA 3LF1A 1NL6A 2J87A 3JASA 1H2YA 2WB4A 1GQRA 3IXMA 4KEAA 4LG1A 5DJ5A 5HQ3A 1G21E 3BMCA 4FOTA 2GEFA 1NLUA 4P7GA 3MCVA 2G5CA 2X0NA 2BP7B 4JP3A 1FP2A 3E18A 4MWEA 5FA5A 2B35A 1VZ3A 1QH9A 1FEZA 4ZV9A 2XNHA 3BT7A 1IXYA 2RHLA 2C59A 3P27A 2W4QA 2VJNA 3FW1A 4N39A 5KB3A 1LFAA 1R66A 1RJDA 2QD2A 2UYYA 1A4RA 3GLHE 4KG7A 5BV2P 2G0NA 5EJIA 3OPXA 4N3BA 3IT3A 1T3TA 4DQDA 4EG3A 2JGEA 1CS0A 3SE7A 4YRKA 5DHTA 2YJ6A 3AVYA 3ZWDA 3OTWA 2OC4A 1TF5A 4AYWA 3L1UA 3V6MA 1NQWA 4G9EA 3BSYA 4Y2TA 2H1FA 3T7IA 1OXXK 1QYVA 3OAAA 3H83A 3NHMA 3NWOA 3K5HA 1UBCA 3MWEA 3UK6A 5K6RA 3P4YA 5LOVB 4OQLA 2JLRA 1SC9A 4I6JA 2KLBA 2DHRA 2PWYA 2QD1A 3AY6A 9LDTA 3I92A 4DV2B 2C0YA 4K7CA 1SCDA 4I4CA 5J3JA 2AMVA 4OBXA 4RWZA 4PYJA 4FOOA 4UE2A 1ONNA 3P1JA 2PFKA 4ODIA 2ZVJA 2FP4A 2QDKA 1E7SA 1SBCA 5BMVA 4LXYA 3K0CA 3CMMA 3GG2A 4HLCA 4OU4A 3V2HA 3NDBB 4LE1A 3UUGA 5HE9A 4AW9A 3AIKA 4CL8A 4RSHA 4ZT5A 2BM9A 3LQ2A 2HQRA 1IWPB 1NUAA 4RNDB 1GFSA 4FJCA 2IEIA 1T5LA 2VSYA 2DPHA 3MUOA 4P3OA 3TQIA 3QOWA 4XRGA 1QPGA 2Q8PA 1AB6A 1WB6A 4GPTA 2C5SA 4J29A 4W6ZA 1EFDN 1MV5A 2W0MA 1L5HA 3KJHA 4MVCA 3TX6A 1G9TA 4R0VA 5JBIA 2P67A 3A05A 4UTXA 4BMCA 1IBKB 4BLWA 3DE7X 2GJ8A 4BPVA 1TCBA 1NW7A 1JU3A 2B21A 3ICWA 4TWJA 5AM3A 1ISIA 2MSLA 3QFFA 3ZXSA 3KKZA 3H1TA 4HFMA 2WYOA 2FE8A 4HYEA 1XE3A 1UEJA 3MWEB 1QB8A 1ZN8A 3D1LA 5DPMA 1TX4B 4OXKA 3V00A 5EE9A 4YR7A 2QP9X 4Z4HA 2W2KA 2UXDB 4GDMA 4U6NA 2DHDA 3ET4A 4I36A 2D1SA 2HZ7A 3NDRA 1A97A 2YN2A 4GVPA 3IJEB 4FMPA 4AO7A 1E2BA 1UDBA 1S2LA 2BDEA 3W5HA 1W85A 3EF3A 1JXOA 2MR5A 4Q7LA 4GZ6A 4H9GA 3IMCA 1FQJA 1TJ3A 4RPHA 3WS7A 4DYDA 4E1VA 4XSVA 4GT1A 4MRMB 5DI3B 4UNPA 2BVNA 5D3ZA 1PYGA 2GPBA 4N8SA 4YP1A 4HLUC 4X3OA 4HTFA 2WPDA 4L4RA 4QBKA 2PZBA 3WDLA 1L4EA 2QNRA 4ZYUA 2IV7A 5EJEA 2FR0A 4A8JA 3KB2A 1P5RA 2NYAA 4MWOA 1FU8A 2VH1A 3ZU4A 4F85A 1T3SA 1Z68A 4WPGA 1DDOA 2WM9B 3DLAA 3WWYA 4BRWA 3AF6A 1NP7A 2BMJA 2YCLA 3OQBA 2HA2A 1CW2B 2MSCB 3AR2A 5CHYA 2K4MA 3WK9A 2LRHA 3HGMA 5E0OA 4A7PA 1O89A 1A5TA 3NRCA 2XIQA 5H3CA 4RADA 1CEXA 1KSHA 3RR2A 4KPEC 4LXUA 1RI4A 1JA9A 4UUOA 2XSZA 4I2NA 1A27A 4L4YA 2FYTA 2RCYA 4RH3A 3PUKA 1FP4A 5ALFA 2AI2A 5AUQA 4DEYA 5IKXA 1VL0A 1C1DA 3L7IA 1WXGA 1X1CA 2ZUUA 4I9UA 4AT1A 2H7VA 3DPIA 4M9SA 3IX7A 1PEKE 4XQ9A 4QC2A 1ZG3A 1ZK4A 3BK7A 3T3EA 2A1IA 3HMQA 2Z08A 1R6UA 2O57A 3BUSA 2PXXA 3QLEA 1A8QA 1K7CA 1R10A 2WBLC 3T95A 5ALYA 2QN2A 1VDMA 3TQFA 3ONEA 5FP0A 1NN1A 3NM5A 3SZMA 3DMYA 2ACEA 2Q9CA 2R8OA 1SXPA 4B31A 4GO1A 1DEOA 1ODKA 1L5NA 3T1QA 4ZANA 4IQ8A 1L9KA 3V6CA 1X77A 5A3VA 4U2DA 3ROGA 1ADCA 1JG4A 4W5BA 3ITNA 3AO0B 4X85A 1M8FA 1PK8A 4KYIB 1J9GA 2GTPA 1XAIA 4BMYA 2W93A 3MVEA 1XLTC 1T29A 3D7RA 1YCGA 4FLEA 4NZZA 1SKYB 1Z6YA 4JUFA 5EMNA 1E1QD 3GLIA 1EUQA 4X3CA 2BLNA 1SXQA 5IT4A 3R9XB 1YI0A 1STOA 2PYDA 1TU0A 4R69A 1UJ4A 4UU7A 3V8NA 5TARA 1EWYA 4B85A 4C0XA 2C31A 4A8TA 4FGKA 1E66A 1RABA 2PRYA 5IAGA 3EG9B 3X43A 3DFIA 4YIHA 1WDLA 2HBZA 5ETJA 4JY7A 3HEBA 3WLQA 2FMUA 4IUBS 1X7ZB 4ED9A 1FSZA 2ATXA 1SCKA 2WICA 1K7YA 1ZS9A 4ZEXA 4DRZA 5BUSA 2QL7A 2RB5A 1DO2A 1SBQA 1T4MA 3BD8A 2SKDA 3I4LA 5L7WA 4RMJA 2JFOA 5HCUA 4ZDJA 3UWSA 4S1NA 3A1DA 4EH1A 5FLXA 1P6XA 4EHLA 1MDFA 2J6IA 2GBGA 3EIOA 1HSOA 5HXAA 1E1KA 3MP2A 3LUFA 3SBDA 1H94A 2J9FB 3KJXA 2YQ5A 4FB5A 3BG5A 4FGUA 3C6MA 3ETJA 3FPAA 3LC0A 3FB4A 4RGYA 3TAXA 2WMDA 2HXSA 1OREA 1QB7A 2OCLA 3CB4A 1G4HA 3Q5GA 1N2ZA 5L6MB 1Q50A 3TVYA 1ZY2A 3KQYA 5FOVA 1PS8A 2JFHA 1XTTA 2YJ4A 1LTQA 3HUDA 3G13A 2VYVA 5F1KA 1H9CA 3K15A 3R1IA 4CUKA 1MUUA 4R54A 3AJRA 3CX4A 3AJEA 2QQ0A 4ZOEA 3EC2A 5I7HA 3FNBA 1GG9A 1GZ7A 3B52X 1IUOA 1C0IA 3THRA 2O8EB 3GLSA 3M1LA 1KJYA 4JOCA 1CUJA 1E1LA 3E3LA 4QRIA 4LYDA 2SKEA 3UTDA 3U3XA 2PUFA 1J56A 3WKDA 1CXZA 2V98A 3GUCA 5JPCA 2IHTA 1CE8A 2BEWA 1IQPA 1M8JA 1V4VA 2RC5A 3PDUA 2VQSA 1X7DA 4JLVA 3GNLA 4V2UA 3W34A 4ZHSA 3UHOA 3U4MA 1OHHD 1Z6PA 3B1FA 1KI6A 4DUGD 1KO7A 3V2GA 2GD0A 2QT9A 5AW4A 1DZIA 5KDOA 1SG0A 1G2IA 1N6RA 2Z1NA 3RS4A 3U3ZA 4PI3A 1NZFA 1ISMA 1VHJA 1NNUA 3DR3A 1ENOA 2WTXA 1K6XA 4S2EA 4CIDA 5KYTA 1HI9A 3L7MA 5AIBA 5LPNA 3WMGA 1E8DA 1D2NA 3T0FA 3OPMA 4TS3A 3GWZA 1P72A 5J4VA 2X19A 1VJ1A 4J9UE 5SZKB 5C1DA 3PWSA 1X6VA 5HE8A 4C6SA 3EFOB 2QJWA 3T0IA 1HG1A 1NJSA 2FZ5A 4B3JA 4ZHQA 1H1LA 5KMGA 1Y1LA 4HD8A 4XUIA 4AN0A 3FVVA 3KT0A 1U0NA 1RJEA 2A9FA 2WU1A 3O94A 3PKIA 4RM2A 3TXYA 4ON9A 5JZOA 3THWA 3HP4A 4ZEOA 1Q7TA 1V16B 4D9CA 3C1TA 1EWVA 2V96A 4V3CA 3GMTA 3LPLA 2DSNA 1PZHA 3P96A 4ML3A 5EIWA 3QUAA 4TQAA 3QBDA 4RA9B 3HHIA 2H5JA 4XQ0A 2YHSA 2AR9A 4NNOA 1Z83A 4C87A 5B7PA 2DR2A 2NP7A 2ZRQA 1RM4A 3IBGA 1JKJA 2NT4A 3KSRA 4INOA 3TQSA 3OU7A 3FOWA 5KHAA 2CV2A 1QAOA 1SWWA 1DBWA 3HCAA 3T1YB 3RUFA 3IEPA 4RL6A 4F2WA 1SD2A 3BIJA 4GKKB 2VPYA 5L4NA 2HNKA 2R7AA 1PD1A 3MELA 5E6UA 3FCEA 2O8DB 4BNNA 1JWBB 1Z0AA 1LDYA 2OP0A 2WJHA 3MWDB 4MRSA 1ZP6A 4RIFA 4EPXA 1JP7A 3OZVA 4QFBA 3I30X 5JA7A 2QPOA 1IY8A 4INZA 4KN5A 4EX7A 1YZUA 2PUDA 3ZGLA 4PPNA 1TF7A 4G5YA 2KBEA 4JLAA 5CT9A 3IJ5A 1VA5A 1KHQA 1LDEA 1LJ8A 2AX4A 2QP3A 4GD3Q 4LRSB 3R2JA 3OT5A 4IRUB 1P5JA 4X1IB 2X7HA 4J4TA 3D81A 4F84A 4NBLA 2WF8A 5FADA 1I2DA 4WK0B 4QOEA 4BLSA 4IILA 4JWKA 1P1IA 1P2GA 4UNNA 4A92A 4OP2A 5A1JA 2AJTA 2J0SA 3E03A 3G02A 3PF8A 3H1GA 4MWGA 1DUSA 2ZK7A 3DR5A 4AAYA 1JEDA 1NIJA 1Y4AE 3GLVA 1Q92A 3QT4A 1EA5A 2E1PA 5REQA 2DFLA 2Z6VA 3DEFA 1W9HA 5H4GA 2H2DA 4P3XA 3RRJA 3OF5A 3VTAA 1Z5WA 1N75A 2P6PA 1LBHA 5SY6A 3ACCA 4QM7A 3K05A 3KJGA 4BC0A 2VDRB 1CQIA 3IEMA 1J24A 3A3YA 4H77A 3VH2A 3O9VA 2I33A 4R2IA 2YWXA 3WGYA 3R7BA 2ZT7A 3D2BA 1G5HA 4M0PA 5KX5F 2WABA 2NW6A 5HIIA 3GP5A 1OROA 3CF0A 1JQAA 3F49S 4B46A 5CLFA 1JPVA 1ECPA 4U8GA 5A06A 2XXAB 2GERA 3CR7A 1VMKA 3G7SA 2G5GX 2I3AA 3I28A 5EQTA 3HJAA 3SZ3A 4JJ6A 2CWDA 1TMYA 1CX9B 1FTSA 4JMPA 3TVTA 1W94A 2WWTA 3MXTA 3UJHA 1PVOA 4H7PA 4L50A 3I62A 4JL5A 3CVWA 2O06A 2XVXA 4RFSB 5C53B 3UAOA 3U56A 1H5QA 1SZPA 1I3OA 1WUKS 4GSKA 1AD2A 2DOKA 4OV6B 5DBIA 3FKSD 2JAHA 3FOAA 1Q14A 5DXAA 4G5RA 3TSWA 3RSOA 1OAOC 4NBRA 4B2IA 1QUFA 1OKKD 3MFYA 4BX9A 1PX2A 1T1RA 3FJ1A 2QRQA 1L0BA 2YNMD 4US1R 1J49A 2ZBPA 4ND1A 1T91A 1L1QA 2AFIE 4FFDA 1FU4A 2Q1WA 4DKJA 2HO4A 2OSBA 2X0KA 1T15A 2EGUA 2XUIA 3AM1A 3HDYA 3BB7A 1CUUA 4MO2A 2ZYHA 2XKKA 4DMYA 4BN5A 2WHEA 5CA1F 1OFGA 1TYZA 2XMCA 5KJFA 2NSYA 1G59A 1LSSA 3GLGE 4BMZA 3AEXA 2ZFUA 3G8BA 2JBHA 2RSLA 1NQCA 2YS7A 3EFHA 4MLCA 1J2JA 5EFOA 3PR1A 4K2HA 4F8EA 3TZHA 1FFBA 1RWNA 5GJBA 3O31A 3DV9A 3T54A 4EYEA 1T1JA 3M89A 1DKQA 1Z5NA 2ABWA 1WEKA 2CJXA 4G01B 4O5AA 5DSXA 2YJZA 5DN6D 1CERA 5KOJB 2C2MA 4WINA 4ER7A 2AX3A 2P3LA 4H7HA 3A1SA 5HM6A 5IWAB 1K3BB 3PBKA 3ZVLA 2FZLA 2GHUA 1TVKB 4GZ5A 3MWDA 1XQ1A 4V0KA 4O2LA 2PNFA 3EDYA 3TMKA 4I5EA 1YQEA 3BXGA 1K4MA 2YQ4A 2R1VB 3KS9A 1WOYA 4D9NA 1M2HA 4NFYA 5A6SB 2UZIR 2VDPB 4ENPA 2CK3A 1Q21A 3BSWA 4EGCB 4F7DA 2BZSA 2VWHA 1L7DA 2W00A 3OX2A 4OA5A 3MCWA 4QDKA 4DLWA 1G8AA 1RD4A 3F5MA 3IEXA 2Z1MA 2X2PA 5AVKA 3BTOA 2M32A 3CM0A 4YQFA 2LGJA 1DJLA 1SVUA 1XOIA 3AM3A 1ZISA 3R7NA 2OENG 3LT5A 4D8TA 5BSGA 4S3MA 1QH1B 2UDPA 2YNMC 3N8GA 4M7PA 4YO7A 2AZXA 2H1WA 2I2DA 4QPNA 4HDKA 2PQMA 4F8YA 5B6JA 4BYGA 4GLFA 1DTWA 2A8YA 5K3OA 1KZ4A 2XGSA 5AOAA 2RHJA 4HMPA 3CPHA 1NDHA 4EHBA 3B1JA 3W6OA 3A6DA 1DQPA 4C7BA 4K9RA 4RVUA 3ID6C 3Q1KA 3CG4A 1ZQ1A 1JDBC 3KRTA 1CQZA 4CPDA 5CEFA 1GRNA 1G6Q1 2WD9A 2F67A 3HXPA 3T3IA 1HLPA 4WCFC 1GV1A 1UWCA 4HGQA 4HTAA 1YGPA 1WDKA 1N2SA 3E8XA 5DCWA 2HRDA 4EZIA 3WWDA 3ZW9A 1PUXA 2VXYA 5LB2A 2C5FA 3PRKE 4HQKA 3EVBA 5DULA 4ZAVA 3V4SA 1YBHA 4EMUA 4L4XA 2NO0A 3QSGA 4R1TA 1E1NA 3AGQA 4TTQA 3BJMA 1T2FA 4AG5A 3AV0B 2CD9A 4EEXA 1C0EA 3CV3A 1C30A 4JLPA 3UH0A 1OLUA 4YV8A 5FLEX 2G07A 2HJGA 1NBMA 2CJYA 4J2HA 4JLWA 4DADA 4FW9A 4F7WA 2WUWE 1YBAA 2P4HX 4P1ZA 2ATIA 3S2EA 4DJ5X 1UWKA 3T9DA 3HWX1 3ZHCA 3PNMA 4TWIA 2W8ZA 5HEKA 4BBZA 2EF0A 2R62A 4Q5IA 1AKRA 2C29D 1ZOOA 2FUCA 3VZBA 2GUGA 3AR7A 2CYBA 3ZV6A 1ZCZA 2Q4EA 2ZYTX 2GD1O 3DKPA 4HGPA 4OVZA 4Y6PA 3ZIDA 2ZM5A 4FFBA 2PUJA 3IP9A 4N6GA 4UHDA 3HB5X 3IHKA 4AJLA 1N3YA 4E1BA 1V1RA 1LW7A 1J00A 2F9FA 2Y0BA 3Q6NA 3MC1A 3QXJA 4WT7A 3TSCA 3EAGA 1ZU5A 3U9TA 2P1DA 5A3RA 4KLBA 4ARAA 1JAIA 4P6EA 3VNVA 2FSVC 1V1RB 4MW4A 1IY9A 3EBLA 3GRCA 4P80A 4P4NA 2PGIA 3N53A 4FD3A 5K1ZA 4A6PA 4BNMA 2CCJA 1OGJA 5TT0A 1B15A 2W4MA 2GNPA 3EHDA 4U0JA 4BKUA 4YNBA 3P97A 2FSGA 2FQ1A 4LCBA 4DJDC 3G9XA 4P3NA 4OHRA 5AJVB 1PG2A 2AL7A 3ZHRA 5CYFA 5ALXA 1PX0A 2P9BA 2XQGA 3G0IA 2QBYB 2ZRLA 2WVHA 3WTCA 3O73A 2PU5A 2H08A 2RHOA 2JLSA 1YQXA 1EWKA 1IJKA 3A7EA 4A8HA 1E9CA 1GU7A 3BXXA 1AUOA 1GGVA 2CVOA 3FUXA 2BI4A 1MO4A 1S3IA 2VXBA 3GH1A 1KI4A 5HKKD 1FDSA 3DW3X 1KMCA 3U4QA 4PYKA 1O6CA 5D7BA 3NHZA 4BGUA 1AKWA 1Z5ZA 1Z3CA 2NXCA 1IAVA 2VJPA 2RJOA 3MT8A 2O7QA 2X4LA 4DNXA 3ND9A 2UUBB 4M0WA 3QLJA 2VP5A 4PSCA 1LS1A 1QIFA 1GPNA 1SUDA 1FFAA 1ZNYA 3AR8A 2IV2X 5H5JA 3KYIB 2BD0A 3LY7A 4PQEA 4BN4A 1G8FA 3SHVA 1U0EA 4FI3C 4HGNA 1R2QA 3DB1A 1IH8A 1CJTC 4ZOLB 5ED0A 5CVMA 5FV7A 2W2PA 3D8BA 1X19A 2XOEA 1RM3A 3I9V6 3MWYW 1Q7RA 3RVOA 5FX2A 4G0VA 1WCV1 3EXHA 4KRGA 1LWOA 3Q8XB 4B4KA 5FWNA 3HJHA 3OTQA 1PPDA 3DFZA 4JFAA 2JBAB 1NGSA 2ZR7A 3NVMB 4EJMA 3GLFB 1QVVA 2DY0A 3VZQA 4K5QA 3R3UA 2GN9A 5K3EA 1MA0A 4J0HA 2AYXA 2OHVA 4X62B 1HDCA 4GPD1 4AY4A 3GCXA 2NU6B 4KQWA 5JTTA 2EFEB 3TSYA 1NN0A 4MUMA 2BKEA 4FN5A 2C5HA 2XQJA 4N0DA 4OHCA 4PZPA 4TMVA 3A1WA 5JFOA 1EK6A 2DRIA 1OB2A 1FTNA 4LDPA 5IYZF 3VU3A 1JG1A 4Q39A 5ERXA 3M6UA 3MJVA 4HN9A 3EZXA 3SKYA 1JHQA 2KS6A 3FDZB 3NDJA 4F5EA 3O84A 4MV0A 2QBYA 3FI0A 2E02A 4DXDA 1XA3A 1KFJB 3R23A 4WQMA 2ODWA 2WJVA 3FF4A 1VB5A 4Y6RA 3GLFE 1TC1A 3N8DA 2C96A 2O0JA 1R6BX 3ZV3A 5ALPA 4UDNA 1JA0A 1RYHA 1XT6A 4HLUA 3PIDA 2GBPA 3DUFA 1TE2A 1DKNA 4CMHA 1AK9A 2EJTA 1U9ZA 2O20A 3L0PA 5ECGC 3ZYCA 4FK5A 1MN6A 4IJ5A 2G6DA 1BJKA 2BP7A 1F3LA 3GR6A 4ZEWA 3F46A 1KWGA 4J0JA 1N3LA 1NXVA 2X8LA 3MEQA 4IWYA 3A9CA 3FDZA 3WVNA 1TCUA 1H4TA 2WJYA 3OFKA 2DC6A 4ZO9A 1QVWA 3OKCA 1AQJA 2IYPA 1D03A 4RLSA 2YMMA 4KK4A 1XKLA 4QTXA 4UEOA 3K24A 5IJZA 2EFYA 5GIOE 5KPJA 5HDBB 1TRHA 2WP8J 3OLQA 1QH8A 1NNSA 5DTMA 3LXXA 3TTUA 3VOBA 5BQFA 3ISJA 3TOZA 1SCQA 4IEEA 4JLBA 2D0PB 3GVIA 1PFGA 1ZIXA 1Z62A 3IUEA 4ZD6A 2V6GA 3TNDA 2DM6A 1TZ2A 2YY6A 3DQZA 4RELA 4XOUA 2P77A 4WH0A 4GR5A 3RUIA 4JOBA 1JG6A 2QE6A 3ELYA 3MAAC 3ZDXB 3IEVA 2P4SA 1CYDA 1SQ5A 1GEEA 3PC4A 2DERA 4I6GA 1TKRA 1OIVA 2OCKA 4KREA 1EHCA 2IXFA 2XMGA 4QDUA 2VUTA 4EJFA 3I23A 4KE9A 4MPDA 1MTOA 1X80A 2DWOA 3OEHD 4PFSA 3ICOA 3S68A 4D4GA 1RI1A 5TQVA 4RSMA 1TK3A 1LW6E 2B0CA 1G0OA 1I3MA 2WV7A 2ZUVA 1U94A 2ET6A 2RHDA 1BDHA 2VT6A 5K3FB 5KWJA 3GHYA 1SWVA 2Q3EA 1Y1RA 3AILA 4RX1A 4Y67A 4X45A 4X8HA 3D3JA 1NLMA 4TM8A 1XZQA 3WYNA 2VZLA 5F3RA 4HQOA 2JD1A 3PT5A 4NH0A 4UUNA 4WLOA 3B6IA 2HUNA 4AROA 4MUNA 1UFOA 4Y1RA 3OQMA 4ZAWA 3FPBA 4BQEA 1T35A 5K7SA 3IKVA 2BMDA 2EL9A 4WW0A 2SKCA 2V7WA 2WTNA 4QAJA 4XIJA 1I2CA 2ZT8A 2FCRA 4LHWA 4MUGA 1HURA 2OBXA 4DIMA 4FD2A 3E9EA 5I48A 1NV9A 1CG6A 1PZEA 4LY3A 2R5FA 4DLPA 3VSCA 4HGZA 1W96A 3UAVA 2O2XA 4IMPA 4JROA 4ZAFA 1F17A 2A5DA 1L5WA 3D3EA 5F52A 3DD5A 4N41A 1JLRA 2PGLA 4OFXA 5IBPA 2JAXA 3H9JA 1ZD4A 3OLYA 3ZY6A 3OP1A 3WB2A 1VHLA 4PSVA 5FCDA 4WKCA 2H0QA 3U26A 2BAGA 3V2UA 5BW8A 1RCFA 3FRHA 3DO6A 4WBXC 2WMOB 3UGJA 4TYNA 1NG9A 1GY8A 2C4TA 1W6UA 4WL0A 5JYDA 3LDUA 1ZNXA 3F9IA 1H8HA 4Y18A 2GN6A 3M2PA 1AZTA 4FINA 5HOQA 1NM5C 4KAJA 4F5DA 3C3CA 5BNWA 1ECJA 1NBME 2Q7XA 4GE3A 4NYJQ 3H8CA 1IRXA 1DAGA 2BGJA 2ZB4A 4Y1FA 1O2DA 4ZT6A 5F51A 3LA6A 2NZ8A 3WGKA 2IHUA 3TNLA 9LDBA 2HT6A 1MEEA 1TKAA 2M6KA 3OMLA 2QSJA 1RWPA 2VSOA 4I9NA 2EYUA 3RRXA 2NVUA 3EYAA 1M6EX 1UBEA 4TLAA 5EHNA 3CRNA 3N39C 4XZ3A 1TJ4A 2TSYB 4A6XA 2H57A 2AE2A 5KOHA 3SQLA 5H59A 3ZE1B 3IE1A 4FYXA 2R9NA 5KYXB 3GHHA 4A1OA 3U7FB 2YJNA 1Z4QA 3BH0A 3IC5A 3OJEA 3KFLA 5JI3E 1S4MA 2WV9A 3PGVA 4QELA 4RTOA 3E5MA 1Z56C 3HADA 5EZYF 4KITB 2OXCA 2EQ5A 3AEQB 3TEFA 4JB3A 2PBFA 1DG9A 4B35A 4KX5A 3JYHA 1Z8DA 3CNEA 3KQVA 2C9ZA 4OOFA 2B3DA 4HNSA 3C74A 4KQ6A 4P4LA 4AY2A 3SBEA 4AU1A 2VAPA 1J2EA 4MVJG 1MD9A 1U3VA 2VCEA 2H3HA 3EF0A 4LTDA 3AVOA 3HU5A 3PXDA 2CVZA 1RPNA 1B8UA 4FJ1A 1U5BA 2IDZA 2K2WA 3AI3A 3E5HA 4WK4B 3CRW1 4DJJA 2XB4A 1E94E 3BWVA 4C21A 3N8NA 3IAUA 1O5OA 2Q27A 3ZD7A 1Y37A 1FFDA 2LDBA 3OZTA 3LUPA 3PPIA 3DE1X 4IS2A 2N47A 3GDFA 2VNKA 2PBRA 5EJ4A 4P5DA 3EEIA 1P31A 2EATA 3PGXA 1KFXL 4IKOA 5L3SA 4RTSA 3ADKA 1D07A 2VZ8A 1FA9A 2NYRA 2YW9A 2NO5A 3ESYA 2ZTLA 2J46A 3TG2A 2NQAA 3CGWA 5HJ5A 2JVJA 3M1IA 4YAEA 3T1HB 5I9MA 1OH5A 1LTKA 1TTHA 1KF0A 1N25A 3BXZA 1YS4A 5E38A 1GTL1 4OXXA 5TV2A 4UTVA 2BI8A 1U7TA 4O1MA 3FTPA 3P9QA 3SXJA 1LPPA 1CDEA 2BSAA 3EISA 1WQ3A 1YJ8A 2YDXA 3MQ2A 3Q72A 1R9NA 4PIVA 4UM5A 3O1HB 3DAOA 5E4TA 3ZW8A 2P2LA 2HK7A 2H59A 1A2KC 4WLUA 5H02A 3F5VA 1DWPA 3DOIA 4LE2A 4BNDA 4AJNA 1UMDA 1K6MA 1OI4A 4BPBA 2ZS9A 4MNTA 2OL4A 3AFIA 3DBLB 2W58A 2BH9A 2X13A 3OO0A 1HLFA 3HXMA 3ICEA 1W0JD 3WB0A 5ISMA 5DX1A 1ZA1A 4KMOA 2XOKA 1BX1A 1YNSA 3GPLA 3ZJ4A 2O1EA 4GC5A 5JSQA 1EIWA 1BVYF 2CLIB 4LPSA 5F2EA 1RPJA 2OK7A 3HDJA 4GYWA 1TTPB 2BMEA 2C83A 1OV6A 4ZVNA 1RHRA 3IV2A 2N9UA 1V25A 1G3IA 4MV3A 4RD2A 3FNEA 5AW3A 1CZOA 3HB4X 3MTJA 4COOA 3DLTA 4EQZA 4QDOA 4AP6A 5CBPA 2AZTA 5JH7A 4OUDB 1S2OA 4L73A 5KREA 2PMFA 1AU0A 2D2VA 3FROA 5K5EA 2VNJA 3IOCA 2JIDA 3VV2A 5BSVA 5GZ3A 3AI1A 3DLHA 4P86A 2BLLA 2R4TA 1XTIA 1RXYA 3GO4A 5ALGA 2HV9A 2X5JO 3AEKB 5KZMB 2CW5A 3SC2A 3DKRA 3GGSA 4L8VA 3CUYA 5LM3A 1L7PA 1MLDA 5KQSA 2ZUWA 4DVJA 5P21A 3T9FA 3NVDA 1Y6QA 3EVTA 2AN9A 5BV7A 5JCXA 2ZIZA 4DG8A 3QA9A 1RCUA 4NLLA 3P5UA 5D6NA 3FMGA 5ICMA 1OT5A 4Q6BA 4RBNA 4I07A 3I01M 4RTKA 2X9GA 1VJ5A 3B1VA 4G65A 1EE9A 5I47A 4AQYB 2AKEA 2BTWA 1HYGA 2MSDB 2PGJA 3VPAA 5K0FA 5E2IA 1S3SA 3IE0A 3NYRA 4ZOCA 3AEZA 2VSNA 3GOQA 5JD4A 2E6KA 2W90A 3KU1A 2YN4A 1FFCA 3WO1A 1SMKA 1L7OA 4ENTA 2XLBA 1U9IC 3JZIA 5DNWA 2HNAA 1ITOA 1KS9A 4LISA 3D5EA 1Z7YA 3PQ6A 4MGYR 1E1MA 3CLSD 4ZALA 2OXIA 1Y3DE 2BF7A 1W5EA 4P2GA 4KPFC 4XWYA 3I1IA 3RREA 1SKBA 4ND8B 1T34A 5LR6A 4DBZA 3MJEA 3CC8A 1VG8A 1AG9A 2PS3A 1ZSYA 3TMPA 1XC7A 4RK4A 3DDOA 1AUQA 1XRRA 3MB8A 3PHIA 4TTVA 3PW3A 5CXSA 1RW4A 4LF4B 1HPLA 3LXUX 4QUJA 1O94C 5FQOA 4K40A 4X8OA 1QP4A 3C4QA 1O5IA 3K8ZA 1A95A 1EVJA 2AXEA 1EX6A 4XJXA 4Q9KA 2H1SA 5H8WA 3ZKWB 4FBLA 1GWNA 3Q0TA 3A6KA 5CPFA 5KC8A 3A6EA 1U7ZA 2XWQA 1HL7A 2GXQA 2ODEA 3I9FA 3LDGA 1NDUA 3AH8A 1MJHA 4GWLA 3EIHA 2JCGA 1U9YA 3DFUA 2JBWA 1X7ZA 2B3TA 2QLNA 3A1NA 3NGXA 4NCIA 1T9HA 3UW3A 5LKAA 1Y48E 1M2FA 1ZYUA 4KLCA 4Y9DA 3ST7A 4W9NA 2Q07A 5KU7A 5LBUA 4EABA 1UPUA 3MCUA 2CDNA 1UBSB 3E22B 4NC9A 1X2BA 2J4CA 1Z33A 1OXVA 1MT0A 1ETHA 3C98A 4PGFA 1SU7A 5EZYA 3DKVA 2BH2A 2GCOA 5HS4A 2JNWA 2ODQA 1XRMA 2WT4A 1SOUA 1T9KA 4G23A 4HS9A 4ARVA 5B36A 1M6HA 1YQGA 2DFKB 4PICA 3E4CA 4BBAA 3K70D 3L4SO 2GR9A 4WLFA 4IZHA 4YMVA 3V2IA 3H5AA 1Z26A 1SCNE 4KU4A 3DOOA 4R3UC 3ZV5A 3NHPA 1XDWA 5HIJA 1U99A 3DWEX 5SICE 4EL0A 2E85A 1SCUA 2P1RA 4KKXB 5DHQA 4Z86A 1CJBA 1TEZA 1GPAA 4FKBA 5FUYA 4CM9D 1C8LA 2RIPA 3K30A 4CM5A 4L9AA 4HH1A 4B75A 2WSSD 3HZRA 4HAZA 4US2R 3IVAA 4UU0A 3G5LA 4OEMA 3MUNA 4XIIA 2FPGB 1W5FA 3CZ5A 4UM8B 1XWIA 1HZZC 4BEVA 1T5TA 1Z7BA 3GJ8A 5LLTA 4GC9A 3ESCA 2X3YA 3PHHA 4RE5A 4BECA 3KO8A 3M4NA 5CDSA 4R1SA 2XTJA 1XIVA 5A4JA 3PFHA 4KXWA 4EHHA 5CB8A 4RPIA 4R2XA 5FULA 3DVLA 2HJRA 2A92A 3BL5A 3L7JA 4IM7A 4MVJI 4ZU6X 1PJSA 2YV5A 4S0XA 1JBKA 1DVRA 4RVHA 5FR1A 4OX9Y 5AHOA 3A4IA 5CW1A 1KBZA 1F6DA 1W25A 3DMRA 3HKEB 4I1VA 1EUDA 1BC5A 3WIOA 3ZU3A 1KBOA 3MXOA 1YVEI 5BSHA 4TYWA 1TB4A 3S8EA 4X00A 4YCMA 3QMWA 5GPBA 3ABSB 3OF3A 4XASA 5B3KA 2B5WA 4OI0A 1G6KA 3OFSA 3GFSA 3PUIA 4OMDA 3WL3A 3ITEA 1RQGA 4XAQA 2E2WA 4JSRA 2Q1SA 3GPDG 3KWJA 3DEAA 2VJBA 3RQSA 3L1VA 3CJQA 3IO5A 1JZSA 1UCFA 2YMPA 3KB6A 4OQMA 3AOEC 1XZFA 2PZGA 1OC2A 2X8AA 4IMRA 4RTJA 3OJFA 2G9ZA 1U28C 2VP6A 3BBPA 2QN6A 2VP2A 3NHWA 1FDVA 4XGNA 3S5UA 3ZLUA 4BFWA 1SOAA 5JY6A 1SBNE 2AFVA 4YQEA 1P7ZA 3H5WA 5DCYA 2GAAA 2PDAA 1XQXA 2BHNA 2PKEA 4OKNA 3RIMA 4DMGA 1ESZA 1M2JA 4IV5A 1QR2A 1STFE 3RV4A 3C5CA 2OWDA 1U5IA 2OV4A 3ESQA 3HVRA 3MJ4A 5LUBA 1UH5A 3GH3A 1C8KA 1UMBB 4TL8A 5LDHA 3S8YA 3T5DA 2O2IA 4MDEA 1E9RA 2JJ1D 1PL7A 2Q50A 4KDEA 2GZRA 4CDEB 1H5NA 2J59A 4O4LB 5HTKA 3SCZA 2P86A 3AR6A 1Q0HA 4BZPA 1R8XA 4CZ2A 4YS6A 2XUGA 4Z3DA 4F5WA 4UOEA 3LXSA 4FEAA 1ZN7A 1YT7A 1J0EA 2BKVA 2YJGA 4EVRA 5FUXA 2UVPA 3W30A 4O2BB 1FSFA 1HQCA 4YJKA 2ZIWB 1AT1A 1RWXA 4YECA 3AERB 1DCKA 3GUYA 3IJPA 3RIGA 4IIJB 3VR5H 3WL4A 3C41J 4WURA 3FSRA 3U4HA 4UHEA 5FHQA 5C31A 3FLEA 2C5EA 2H9YA 3BE8A 5CX1A 5GZ6A 5CFZA 4CLDA 2J07A 3BSFA 2XT9A 5T8KA 4AZVA 4C05A 5BPHA 1P9LA 4RF5A 1VI5A 3KXDA 4U2CA 4EB8A 1VKNA 4ARZA 2JLCA 3OIFA 4FDMA 4WZBB 1IXSB 3CYFA 5FJJA 5IBQA 5KQRA 1LS6A 1DWOA 3L6OO 3IVMA 2PREA 1P33A 3RSGA 4Q4AA 4CIVA 4E21A 1LU9A 1MQ9A 3LUJA 4YRTA 1VLZA 3EF1A 3S2YA 1L5SA