5EZSA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease inhibited by e64d
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Non-structural Protein 2 Cysteine Protease
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezsA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezsA01
3DLIA 4PGHA 3X0DA 3CJQA 3THRA 2EX4A 4XCXA 4LG1A 3G88A 2P3OA 1NV8A 5EHIA 3I58A 5FA8A 3TRKA 5M5BA 1AQJA 1NE2A 3AY0A 4EKIA 3CJTA 3T7SA 2AOTA 4PGGA 2ZBPA 3HA7A 1R18A 3LCVB 5HIKA 3IEIA 4EVIA 4CKBA 3A27A 3B89A 1XTPA 1X1AA 2FPOA 4R6WA 2G8NA 3WSTA 3VYWA 2ORED 1N2XA 1T43A 5DSXA 4CTJA 3P97A 2I62A 1VIDA 1P39A 3P2EA 3HVKA 2PSSA 5DSTA 1XCJA 5HIMA 3MAGA 3NWBA 5E9JA 5T6BA 2HNKA 2PX5A 4KW7A 3KR9A 1SG9A 2CMGA 4F84A 3KQYA 3DP7A 5LSAA 5E1DA 5K0EA 3C6MA 4KVZA 4O29A 5GP1A 3FTCA 4WVLA 3KR2A 1O54A 5GM1A 3RW9A 2HV9A 3KQMA 1FJXA 1VLMA 1FP2A 3HCCA 3ANXA 4A6EA 3KHKA 5K8VA 1YFJA 2PWYA 2AS0A 3HVJA 4QPPA 1JG3A 1G6Q1 2OYRA 3FYDA 3KQSA 3EGIA 4V0RA 2OY0A 4ATNA 3PFHA 4RSRA 5E2BA 3KU1A 1VP3A 2ZFUA 4R05A 5ICEA 2GPYA 5EIWA 3EVDA 2G71A 2V74B 1UIRA 4ZTBA 4POOA 5GIPE 3CGGA 5CVVA 5K0NA 4GQBA 3PT9A 5DTQA 1XJ5A 3EGEA 1I9GA 4E2XA 4OA5A 3GNLA 1DUSA 2FK7A 2YQZA 4Y2HA 5E1MA 5E8JA 1RJEA 1Y8CA 3UA4A 1WS6A 5HFJA 4PYMA 5DM1A 3SMQA 2QRVA 4LECA 3V8VA 4MHTA 5LQJA 5BW5A 2P7IA 3M6VA 4GOLD 1NW8A 3UJAA 2IH2A 1WZNA 3GGDA 3E7PA 3NVMB 5HIIA 4DQ0A 2AOUB 4KDRA 1SUIA 3SM3A 1TW3A 3KPVA 2YR0A 5EOVA 3JWHA 1NBIA 4QPNA 3PB3A 5EZSA 4G56A 3UWPA 1TW2A 1YFLA 3KR1A 3U81A 4C07A 3M33A 3DH0A 1FP1D 4KRGA 1I4WA 4QDJA 4DKJA 5K01A 4B17A 5KQSA 10MHA 2QM3A 4PYIA 2UYHA 4AZTA 2ZZKA 4QVGA 3BGDA 3CVOA 3HA3A 2NYUA 3ORHA 5DX1A 4RTLA 4X61A 3OU6A 2UYOA 3DTNA 2IIPA 3LCCA 3OFJA 2UZ4A 2P3LA 3TFWA 3DOUA 1KYWA 3REOA 4UOEA 4CTKA 3TLJA 4ER5A 3HCBA 1JG2A 1P1BA 3KQVA 1JQEA 1YUBA 2ZWVA 2JHAA 4ER7A 1RI4A 5DTMA 5GIOE 2Z6QA 4XUEA 3SSNA 2IH5A 4HTFA 3C3PA 1EIZA 2FYTA 3G5TA 5K0CA 2QRVB 4YV2A 3EVCA 1L3BA 2AVDA 3LBFA 4PINA 4RTKA 2YUIA 4PYJA 1HMYA 2GLUA 1BOOA 1JG4A 3HM2A 1JSZA 5ICCA 4HGZA 5E1OA 1RI5A 1VPTA 4OBWA 4K6MA 5F2NA 5HOQA 1B42A 4IV8A 3CCFA 4QVKA 3GWZA 5U4XA 4GEKA 3EMBA 4KDCA 4RTJA 3G2QA 3HCFA 3MTEA 2F8LA 4MIKA 3C6KA 2PVCA 3OFKA 5GM2A 1R8YA 4E32A 1NKVA 3B3FA 5C1IA 3TQSA 3UJCA 4RTMA 1EJ0A 4RVFA 5EZQA 2PXAA 2ZZMA 5LQRA 5CM2Z 2UYQA 5P8WA 3G89A 1SKMA 2Z6AA 2AN5A 2YVLA 4P7GA 3UJ8A 3LCUA 3T7RA 3CKKA 1WG8A 2HWKA 3BWCA 2YX1A 4HC4A 3NWEA 3DMGA 2IPXA 3EMDA 3M6WA 2JHPA 5DRYA 3TM4A 4BLVA 4HG2A 3OZTA 2P8JA 3S68A 3TKYA 3UZUA 3BGVA 3KQWA 3UFBA 5ICFA 4PYNA 3AXTA 2YXDA 3SVZA 3ELYA 1MJFA 5LQNA 4E2WA 4C06A 5HILA 3ELDA 2P41A 2YXEA 1XXLA 3ELUA 4QQKA 2XVMA 5B1SA 1BHJA 4P58A 3FTFA 4P7JA 1D2HA 1IY9A 2ZTHA 5EIFA 2GB4A 5IH3A 2B9EA 3B3GA 3LDGA 3L8DA 4FZVA 2Y1WA 5CVUA 1F38A 3ER8A 3JWGA 2EG5A 3DULA 3P8ZA 3KQPA 3EVFA 3M70A 2C7QA 4F85A 5EPEA 4IWNA 3UBTA 2WK1A 1TPYA 3B7PA 5CVEA 3LDUA 1FPQA 5DRTA 3MQ2A 5LQUA 5FADA 3FPEA 2IGTA 4GOOD 2DULA 3GO4A 4FSDA 5DX8A 3DXZA 5E8RA 2BR3A 3ID6C 3R24A 3GRZA 2ZIFA 5EMMA 5FA5A 4DCGA 2GS9A 5T64A 2ONYA 3TPZA 4ER6A 3HCAA 1ZQ9A 4PYOA 2O0LA 4OBXA 3OCJA 1VE3A 5FQNA 3PTAA 3NW9A 5D1NA 4BLUA 2IH4A 4HRAA 2EJUA 3FUWA 1ZKDA 2AOWA 1YB2A 2IP2A 2XYVA 4GC5A 2FHPA 2HMYB 3FPJA 3P71T 2I9KA 3GIWA 4YUVA 4F86A 1RJGA 3F4KA 3MHTA 1L3IA 1O9HA 4MQ4A 4PYKA 5FULA 4C04A 4YMGA 5E1BA 1M0EA 2AOUA 2OZVA 1XCLA 3P9IA 5FHQA 2G1PA 2JHCA 3TR6A 1R6AA 2OXTA 3PLAE 1NBHA 5LQCA 2WA2A 5GINE 3DUWA 4YUXA 4JXJA 3E05A 3UA3A 3M4XA 1OR8A 4QTUB 4FT4A 4GUAA 3FPGA 4FR0A 1G8AA 3RIEA 2BR5A 3FPHA 5EEGA 1R8XA 3JWIA 3B3JA 3UJ6A 5LQAA 5EMJA 2CMHA 3HCEA 3RODA 1QAOA 1Q0TA 2JG3A 3LBYA 3G5LA 2AR0A 3LHDA 4Y30A 2HTEA 1NW3A 5H02A 5CIYA 1SUSA 3A26A 5FQOA 2I6GA 4YMHA 4C08A 4E2YA 5GOZA 3AWIA 3P9KA 1O9GA 3PX2A 1R74A 5FCDA 2P35A 3BWMA 3BXOA 2R3SA 2NXNA 2IDJA 4L7VA 4LWPA 4GOMD 4R8RA 4RV9A 3JWJA 5E2AA 1V39A 1Q0SA 1AV6A 4HTFB 1NW6A 5K0LA 1IM8A 2OB1A 1QAMA 3GXOA 3EVZA 3MB5A 4DZRA 5LR6A 1XDZA 1NT2A 1UWVA 5DWQA 4RTPA 2NP6A 2AVNA 1P1CA 3BKXA 5EHGA 2Q41A 2PGXA 5GWXA 3CC8A 2ZULA 2FK8A 4FGZA 1JTFA 4ER0A 5C9ZA 5CVDA 4X41A 1KHHA 2NNWB 3G2OA 4FSXA 1RI3A 2FRXA 2NXEA 1U2ZA 3I9FA 3KPJA 4PYLA 5EGSA 3G8BA 2PT9A 3FZGA 3PVCA 4C03A 4EMSA 2ZSUA 3G2PA 3G8AA 4M36A 3NTVA 5DTRA 1QZZA 1X1BA 3GJYA 4R6XA 5FWDA 4AUKA 2QE6A 5HZMA 4OQEA 3V97A 4RTQA 3TMAA 3GRRA 4KIFA 4LWOA 5FWAA 4PONA 4YV1A 3KQOA 4FT2A 1HNNA 2AOTB 5JR3A 1JQDA 1M6YA 1WXXA 3NVKI 2A14A 2N47A 2BZGA 4ISCA 2VDVE 5G02A 3UJ9A 1KPIA 2PWPA 4KWCA 3HP7A 3BKWA 1G38A 3PX3A 2EJTA 5DM0A 5K03A 4HSGA 3BZBA 2P3QA 1KXZA 2PLWA 2BH2A 2YXLA 4E2ZA 2NP7A 3IYLW 3LDFA 2VZ9A 5DT2A 4ER3A 4IV0A 5DLYA 5CD1A 2WA1A 3DR5A 2I7CA 4KIGA 2IFTA 7MHTA 5HEKA 3FRHA 5FHRA 5KVAA 2GAFA 1YF3A 3ME5A 3HA5A 3C3YA 2XVAA 2Z6UA 3AJDA 3HVIA 2ZVJA 1JQ3A 2OBFA 5T67A 3UJBA 2FCAA 5FUBA 2QY6A 1N7IA 3EVBA 1JG1A 2AOVA 3FRIA 2VP3A 4CWAA 2O05A 4GOND 5DPMA 1BKYA 4U7TB 4X63A 4CKEA 3CBGA 4V0QA 1RI1A 3P9CA 2B3TA 1QYRA 1EJ6A 2XYQA 3O4FA 3O7WA 5DXAA 5EMLA 4M7RA 5F2KA 1R00A 3SXJA 4BP3A 3TKAA 3BWBA 3EEOA 2B78A 3ERCA 4AZVA 2ZZNA 3P9NA 3BWYA 3SR4A 5FTWA 4X1OA 2PV0A 3UJ7A 2C7OA 1JSXA 5K09A 3SGLA 2PXCA 3GRYA 4U7PB 1KR5A 4OA8A 1BC5A 4PCAA 1KP9A 4R8SA 3KPUA 4P7KA 3UJDA 5CCBA 1IXKA 3I64A 4YUYA 1SQFA 2PX8A 3QOWA 2PBFA 4AX8A 5CVJA 4EQZA 9MHTA 3MCTA 2PY6A 3GCZA 3A25A 3VSEA 3OU2A 1DL5A 8MHTA 3HNRA 3BUSA 3OZSA 2BM8A 3B5IA 3MCZA 3Q87B 2VDUE 4EKGA 5LQKA 3FYCA 4MTLA 4CKCA 3PS9A 3QV2A 5DM4A 4HGYA 5EVJA 1MHTA 4MWZA 1P91A 2C7RA 2OB2A 3NMUF 2XYRA 1KIAA 5DM2A 2Y1XA 2EFJA 4PIMA 4E33A 3E23A 3K0BA 2QYOA 3OE5A 2H00A 1L9KA 3LGAA 4DA4A 5DX0A 4YV0A 3FUUA 3I53A 4DCMA 2ERCA 2ONZA 3KKZA 4PIPA 3CJRA 3HEMA 3IHTA 5EMKA 5K05A 5EC8A 2XBMA 4A6DA 1VL5A 1D2CA 5E9WA 4E70A 4E30A 4DMGA 5ICGA 2O07A 2R6ZA 3M6XA 3THSA 2GA9A 2H1RA 2ZWAA 1INLA 4M38A 2ADMA 1XDSA 1YZHA 3GRUA 4IKPA 2PXXA 1RJFA 2P40A 2ZIEA 2B25A 2ESRA 3LX6A 1ZGJA 1UFKA 2YTZA 2ZLBA 3I5UA 4PYQA 2BM9A 3DXXA 4RYLA 4M37A 1EG2A 3K6RA 3VC1A 1NV9A 4RWZA 1ORIA 5EG5A 3BT7A 5BXYA 4OX9Y 4C4AA 1ORHA 2CL5A 1VBFA 1M6EX 3FPFA 1NW7A 2AN4A 4RX1A 3GDHA 5E9QA 1DCTA 1L1EA 4XUDA 1X1DA 1QANA 1SVUA 1VQ1A 2E5WA 2JH8A 1KPHA 1X19A 3GRVA 3FUVA 3LKDA 4RTSA 3T7TA 2G70A 4QQNA 5BP7A 3IV6A 5ERGB 2UYCA 2V7EA 2PJDA 5KQRA 1G55A 4H0NA 5KS2A 3EVEA 3KQQA 2H11A 1EAMA 3OE4A 3DLCA 3P2IA 4P7FA 4E31A 2NXJA 3P2KA 4CXMA 4RTNA 4HH4A 2AOXA 3EGVA 4BP1A 1AF7A 1KYZA 3G2MA 3SSMA 5KYGA 3ER9A 2OO3A 3LKZA 5EKUA 5C0OE 1XVAA 4EK9A 3O31A 4RTRA 5K0JA 3A7DA 3FTDA 5F2OA 3OPNA 2ZBQA 1JR4A 1N7JA 2PT6A 3D2LA 3NDJA 4XUCA 5HIJA 1XDUA 3R9XB 1KPGA 1NW5A 4FP9A 2PX2A 5EKXA 2DPMA 3KPWA 5EQJB 5CCXA 3ELWA 2PKWA 3KR0A 4AZWA 4YUZA 3PFGA 3LECA 2P7HA 2BR4A 3R0QA 2IDKA 5CUQA 2P1DA 4PCLA 4RTOA 2C7PA 4PWYA 4PNEA 1ZGAA 3NDIA 1I1NA 5BW4A 3DXYA 3HTXA 3E8SA 3LL7A 4WXHA 1X1CA 3LSTA 3FUXA 5JUWA 4QTTB 1AQIA 2LD4A 2K4MA 3DMFA 3HCDA 2JJQA 2AZTA 3DMHA 3G7UA 3MERA 3GU3A 2ZIGA 3H2BA 4DF3A 4GC9A 5IKMA 1F3LA 2VS1A 4QDKA 3QOXA 3KPYA 5K0GA 1WY7A 4Z2YA 4AZSA 1EQAA 3MGGA 3EVAA 2OKCA 2OPBA 2CKDA 2ZW9A 1PJZA 1VP9A 2AN3A 3KQTA 3LPMA 3R6TA 3Q7EA 4GBED 3SSOA 3EVGA 3EPPA 5DXJA 4BLWA 4DM3A 4NECA 1YZ3A 1ZHFA 2KW5A 4RVDA 3R3HA 4RVGA 3A4TA 4OQDA 3OU7A 4X60A 3EEYA 3OZRA 3MTIA 2NXCA 3TOSA 3VC2A 3A7EA 4C05A 5MHTA 1QAQA 4BY9E 2IBSA 1D2GA 3M6UA 2G72A 1PRYA 2O57A 1FBNA 1Z3CA 1G60A 2B2CA 1JTEA 3NJRA 2CWWA 4FS8A 5D1HA 2ZBRA 2VDWA 2O06A 2PX4A 1RI2A 3HVHA 3T0IA 2JH9A 1ZG3A 4RVHA 3AXSA 2IBTA 3FUTA 3SX0A 2HR1A 3TM5A 3BGIA 1SQGA 5EEHA 1WXWA 1G8SA 5K0BA 2ZCJA 4GF5A 4YUWA 1RJDA 3FTEA 1L3CA 1H1DA 5K0FA 3C0KA 2GH1A
chains in the Genus database with same CATH superfamily
3NIGB 3IURA 1PBTA 1U3TA 1GPDG 3ZV5A 1MP0A 2E85A 5GJWC 2CNOA 3H1PA 4HAIA 1YJQA 2P1RA 1ME4A 4C0QC 1S7GA 5J4LA 3QVWA 2GERA 4HZUA 1VGVA 2B8NA 2CMFA 2R5WA 4RF3A 1J9GA 3I32A 2EZUA 3VX4A 3UAVA 4OXRA 4B2IA 3HA7A 4CUJA 1ILWA 1XCGB 2N46A 3IEIA 5JTTA 4BMYA 1S3FA 4US0R 1W4ZA 4A1OA 1CJKC 2OHGA 2HJRA 1PUXA 2XV1A 3OP4A 4J2TA 2YBEA 2BVNA 2Q3DA 3L18A 4MLCA 1QE3A 4N0PA 4NATA 4RZQA 3HS3A 4JH0A 2OCKA 2P4QA 1APBA 1JAIA 2MINA 4PPNA 5JYCA 5ALUA 4O5AA 3KJFA 2HV8A 1G5TA 4B82A 4TTSA 5FP0A 1J8MF 3Q98A 5CA0F 2YMMA 2D2VA 3LOUA 3RYFA 1MEJA 1XFAA 1Z2NX 4IRUB 1SHUX 4WT7A 1E64A 2P9TA 2VP5A 3ITDA 2C5FA 3H5LA 1KWGA 1BXRB 1XVIA 2H59A 1QMPA 3AR3A 1OFVA 1VZ2A 4K6HA 4X7RA 3WL4A 4C14A 2HV9A 2IEZA 1S8AA 3S5JA 2Y0CA 3F8WA 5TV2A 1JG3A 1M0TA 3C7CB 3N28A 2GCEA 3DFKA 3KQSA 2OYRA 4BMXA 4D4KA 2UZJA 1L7AA 3VV3A 5CH3A 3G2KA 3DKRA 3LLUA 4CZ2A 5EIWA 2IPNA 1R6UA 3OZWA 3VNQA 1UEJA 1YO6A 4XB1A 1FA9A 3N0WA 1A4UA 3WMRA 2M1XA 3QA3E 1RMTA 3RARA 3W5UA 4G0VA 4B8WA 4NTZA 1VG1A 4I1RA 4Z2AA 4DCNA 1B41A 1MAAA 4D0RA 2JGNA 5M7EA 5JCJD 2YNMD 4LECA 4OH1A 5G40A 4FNOA 4BTLA 3WP1B 2Q45A 1IZYA 4C6SA 5JAOA 3WXFA 1D0VA 1QRRA 5JZVA 5I4KA 2A5FA 3I83A 2XCTB 4RIGA 4KREA 3UHFA 1O03A 1ZN8A 2F00A 2X0DA 3DXFA 3GC6A 1XRRA 3CNQS 3DDNA 4BO5A 4D92A 5E4YA 5JI2E 4ALIA 3BZWA 1QF9A 3GN1A 1SUPA 2HGZA 2I5PO 4NJEB 4D9FA 2GFOA 5C37A 3ZIAA 1FP4B 1RPNA 2QTTA 2B7CA 3DH0A 2KS6A 3BRQA 3SYKA 5FI5A 1HZZA 4YCDA 2PGLA 4FFOA 3EUWA 4ISBA 4M60A 4KE8A 1QYIA 1CUBA 2R6CA 4MLZA 4ZZ3A 2I7TA 1VIVA 4NCJA 1KEEA 1KE2A 4ARAA 4CODB 2G8JA 1PN3A 3SC3A 1YRYE 4W1RA 4AQ7A 4MKHA 3U4IA 1CY2A 3EZ6A 4QLBA 3VO1A 3WNCA 3RAPR 4BNGA 2UZ4A 1PPDA 4CF3A 5A9SA 2F1IA 1TEXA 1MOSA 2BMVA 2VN8A 4F1WA 2BGMA 4LZNA 4BLTA 2R00A 4KK3A 3EZXA 3JQ6A 4JCCA 3RYIA 3QLUC 3QPVA 4V24A 1WCIA 2HXYA 1I2ZA 1EGQA 1EDEA 1MH1A 3O93A 3D2CA 2WKPA 2P9ZA 3MILA 4HN9A 4F46A 1EWLA 2BDUA 1UBSB 3FFTA 3TUIC 2PLRA 4QUBA 5L95A 1OXXK 1T0UA 3T9BA 1DJPA 3GVCA 4D4JA 5KB3A 1PQUA 5KOIA 3ZNNA 4RIEA 1MXFA 3K6KA 2GGSA 1EFLA 2VJNA 2P67A 1ZOOA 4IVQA 5E1OA 3INGA 3WWZA 1Q1AA 4BYGA 3JQRA 5EJIA 2R751 3R5FA 1SOVA 3EIWA 3FGOA 4G6ZA 1DAIA 1XCBA 4X94A 2PBRA 1CQZA 2Q2QA 2BYTA 2N9UA 3BFXA 2B6HA 1RMQA 3HFSA 1EJ0A 2HXSA 4PFSA 2SNIE 2AI1A 3C16C 4KIUA 4YMVA 1F29A 4JT2A 3OIVA 5E6UA 1M1UA 4YP9A 3N8DA 2ANBA 3DVLA 5J2TA 2VK1A 2JHPA 4H3VA 2W42A 4E3ZA 2A1TR 3EIOA 4PY2A 3IULA 3V8RA 4GXNA 4F60A 2A9KA 4ZDWA 4R1NA 1RXCA 3F6PA 5AJVB 7ABPA 2ZVPX 5HZHA 4GR9A 3AT1A 1A82A 1EEHA 5CGZA 1WDWB 4MQEB 1MJFA 1NQVA 3QEMB 4B6QA 2BKEA 4ZCMA 2VZEA 2FEKA 2WEKA 4D8XA 3IT1A 2DUNA 2Q5HA 4ALKA 1F2TA 2A4KA 1ZR4A 3ZBPA 2ZTHA 4B4KA 4M1ZA 2Q50A 2FUCA 3HC7A 1HE4A 1FCJA 3BCNA 3ZX4A 1YDMA 2W8BA 2I4RA 2YJ3A 3P8ZA 4Q1FA 1IJBA 1G2OA 3V00A 3SX2A 3ZE0B 4A2PA 1C3OA 1L7OA 2DBZA 3ZU6A 5D01A 1V25A 4Q4AB 2FG5A 4NMXB 4C2TA 1FPQA 3BFPA 3SFZA 2AH5A 5BUCA 5IULC 3EWSA 2PK3A 5BURA 5IXJA 1EVYA 4IOKA 4NBTA 2BGTA 3QQ5A 3HQ4O 3MZ0A 4YRJA 1SUWA 2HJVA 1VMDA 3K8YA 1ISIA 4XQCA 4YIKA 4B45A 4DSNA 4CT0A 3CH5A 4YCNA 2NU9B 3REQB 3RIGA 1DO8A 2PMWB 5HK8A 2VFAA 2Z3WA 1KNQA 2D5AA 1L5YA 4KSCA 1I6MA 3UOAB 4CNBA 1F4PA 2IP2A 2VKQA 2KLBA 3GAAA 4BJ3A 2B1RA 4PZ9A 4AMGA 3GIWA 1MRNA 1HE5A 1RQPA 1T8WA 3DNMA 3F4KA 5HKKA 1IN4A 2CCKA 5FNVF 2QN7A 3T5MA 5FWXB 1XNQB 4UM9D 3T3IA 1L4FA 3TL3A 1VLVA 4HFMA 1T5SA 2GHQA 1WCWA 2IYRA 3DJFA 4RZUA 5B2EA 1UKAA 1MO6A 1DZIA 1X2EA 2HRRA 4AL4A 4LWZA 1L4BA 2PEZA 3DUWA 1P7WA 4H77A 4YMSA 4BO2A 3M4XA 1F1BA 3ZCXA 3K1TA 4FR0A 3DE2X 1U8TA 2R8ZA 3EVTA 4X92A 2HSDA 1MDFA 2FJPA 1ZH0A 3D5QA 3MGCA 3JATB 2VAXA 4UD6A 5JFGA 1AKEA 3O4IA 1SXJE 2EP5A 1VDZA 2HTEA 4KH0A 2JLRA 2B2NA 4LV8B 1YZKA 4EDHA 3AJRA 1D2NA 1JQBA 3M3PA 3P5BA 4C08A 3FGPA 2X0KA 2CSUA 1GG5A 4OOFA 4K3VA 2WBLC 1T10A 1T6BY 4GOMD 1LW6E 1PZFA 1CUGA 2GEBA 2NVUB 2Z09A 4D8UA 1WUHS 1OVMA 3BGSA 4IVNA 3RYIB 1E1CA 4RVNA 3O03A 5LOVF 4XJXA 2RSLA 4LQDA 1PJ2A 3KO8A 3MRTA 4M0MA 3AHFA 3WQHA 1UWVA 3DFFA 5CVNB 4A23A 4RTPA 3HI6A 2YW9A 4HS4A 4JELA 1X80A 5DMHA 4D5GA 1UMDA 3OC0A 3RIMA 2ZULA 3FHJA 1DLJA 4FJCA 3AKEA 4LQCA 4H6WA 1C3JA 4EB3A 4MI7A 1SC3A 3TSZA 1IHYA 2EOAA 4HMPA 2NXEA 5LQDA 2EL9A 5EGSA 2J7QA 1PZGA 3SQDA 5AYVA 3TX2A 1WR8A 3F49S 3KOUA 3PFNA 2CF6A 4ZC8A 1HUCB 2EKZA 2ICAA 4MDEA 1P4HA 2BE7A 4JKIA 4Y2YA 3R0ZA 4ON9A 4U6NA 3I1IA 4B48A 3P5WA 1U0OC 3GRRA 1S89A 1QM5A 3SR0A 1S8NA 3ZHTA 4TWAA 4D8IA 1R9GA 4PCVA 3DBIA 5GVSA 3I1JA 2QUBA 3IJRA 3H4TA 1XVTA 1T24A 2IVZA 1B0UA 1Q50A 2RG7A 4MPJA 3U31A 2V4ZA 2R1VA 1ZU5A 3SWWA 3SZOA 2CL7X 3WB9A 3C5VA 1IQ0A 2L19A 3FZQA 4MMYB 3VU9A 1LRJA 1EFPB 1AHHA 4X97A 4PZZA 3SF8B 5A62A 4YUYA 4OXIA 4U0JA 1Z5VA 4QWMA 1GD1O 3RTEA 1JIXA 4Q19A 1UWCA 2J6HA 4TL6A 5CLHA 5DGTA 2ASEA 1FIUA 1Z5UA 4CWAA 4M89A 4NZOA 1K89A 3PFWO 2C8KA 3IUBA 4X63A 4YBZA 2J0UB 4ZGBA 4ZCRA 3AGPA 1JYFA 1MAVA 1O95C 2QIOA 4Z4IA 5DI3A 5CLFA 3T3GA 4JC0A 4BFCA 1PSWA 3K1JA 3O4FA 3H2KA 1O87A 5A7GA 3U4GA 3WGVA 4DLAA 3HD3A 3HLTA 3TKAA 1XPJA 3R5SA 4R16A 4UHHA 2V3WA 2R9OA 3E1SA 3P9NA 2BFAA 3DDWA 1XWWA 3H75A 3IPYA 4KC0A 4RL4A 4X1OA 5IDYA 3V33A 2J9RA 3KT3A 3OOEA 2K2WA 3FNQA 1DHTA 2G1KA 2DH5A 3KDAA 4FCTA 4OJMX 2MWMA 4TVBA 3NTOA 1CJSA 2CDRA 2IYOA 3DYVA 4W5QA 2A5LA 1DDOA 5F7XA 5J58A 3P9QA 4Z0NA 4PC7A 5CG2A 1YOVB 2PY6A 2Z9CA 3GCZA 3T12A 4TSFA 4EJSB 3BUSA 2F43A 4KB5A 3GAZA 3R8XA 2NG1A 3I3SR 3WRVA 3KWBX 1R0YA 2TECE 4MTLA 2G6DA 3CZ5A 3IT3A 1C3XA 1D3AA 2CVQA 6LDHA 3K1AA 1N9GA 1H6CA 1P91A 1KKLA 3WO0A 4CQMB 1CS4C 2OP0A 2R97A 2J87A 4FMPA 4WTOA 1BFKA 2EFJA 4PIMA 4XLTA 3CGWA 2IUUA 4B31A 5BR4A 2BHRA 1RPJA 3NHRA 2QVBA 3AQIA 4GIBA 4B6PA 2HMUA 3VU3A 2XEDA 2EL7A 4EYEA 4CDDB 5LLTA 3RUEA 1PEAA 4TXJA 4BNMA 3KKZA 1GKIA 8AT1A 4ITUA 1N6KA 1YQXA 4H1TA 3CVWA 3VI4B 4Y6QA 1XOIA 2DBQA 3Q41A 1AGXA 4CG0A 1OU4A 5IDVA 3P96A 3QPDA 4LHSA 2EFGA 2ZWPA 5ALFA 2QAGB 4AC9A 4F71A 2ATOA 2ZBEA 2DBRA 1GPYA 4QELA 2R96A 2ZIEA 3V2UA 3TGLA 5IJZA 5ER6A 5HJ2A 1ARZA 3DE1X 5C1DA 5E7JA 4MJLA 3DAHA 2DC1A 2QMOA 3HB1A 4FOOA 4WUVA 4BQOA 4C76A 5KYXA 4JLKA 3I2HA 4JLMA 1KI8A 3EGOA 3GCXA 3NOOA 4G1BA 4J0GA 1JXQA 1U3FA 5F12A 3ZW8A 2FUKA 1S8FA 2GVDC 3LQRA 4MQ5A 1DCTA 5EPUA 2X9QA 1D07A 5DISB 3ECCA 3M1AA 4FM9A 1ULHA 5JYEA 7PCKA 5HCIA 1SVUA 2HO4A 3LUJA 4NE9A 2XE4A 4NBWA 1D6SA 2BFEB 1X8JA 1NPDA 2RKWA 5BSWA 1EDDA 4YBRA 4Q9JA 4YPVA 1LPSA 1WXQA 4DMCA 2PWAA 2RFLA 1J9EA 2N1BA 4JB0A 4BKMA 1KBOA 1XDBA 2QTLA 4QX6A 4D74A 3ETEA 3HN2A 4NBKA 3HJGA 3GOQA 3K73O 4JT9A 5C3MA 1QQ7A 3NHLA 1G9SA 2VSNA 3PYMA 1E6WA 3K53A 1PJQA 4G84A 4RKFA 5G0TA 2FZWA 5LKRA 2WJZB 2XBLA 4ZGWA 3OMXA 3RF6A 3TL2A 5I3ZA 5KUTA 3UV3A 3VVLA 1TZMA 1UPBA 1UPAA 1YZQA 2QGFA 3NR2A 5EKXA 1HE8B 4G5FA 2C42A 4RCYA 4YCAA 3ZY4A 3BE5A 2I78A 1GO2A 4CHTA 1NXSA 2YV4A 2JBWA 2E4WA 2PKWA 2NQTA 2NSYA 3HXPA 4QASA 4MRVA 4Y6SA 4EG3A 4R0NA 4ZYZA 4TKUA 3CFYA 5TQ2B 3T5DA 2V55B 1P4RA 1YDWA 1KNXA 5AP9A 1CPJA 2FXVA 3AP3A 3IODA 4IDFA 1U9IC 3BBAA 3QFTA 5CP8A 5DNCA 3DXYA 4I8DA 3A1NA 3V4ZA 4DUGA 1PJ4A 4OUDB 3WB0A 3FSEA 1AQIA 5IASA 4YHBA 1ULUA 1YKSA 2HRZA 2W11A 4KQKA 4NFHA 3RSOA 2RHDA 4CV3A 3F5VA 2FXIA 2Q9AA 2HU8A 1VSVA 2XLBA 4JI2B 2VF2A 5EA2A 1H6AA 1F3LA 2VNKA 1RS0A 3EEFA 4BWYA 5AQ1A 1ZL0A 3NKFA 1Z0SA 2J1LA 2J5BA 4RJIA 9ATCA 1SXGA 4NDNE 3B1WA 3FCSB 3ENZA 4TQUS 5F7ZA 1DTEA 3PQ7A 3RRFA 1BA2A 4J0FA 2EBHX 1SP4B 1KFEB 3FYHA 3HVUA 4DSOA 2IXAA 2UYYA 3UWSA 1TI7A 2VPPA 2XX3A 3FRJA 2PKCA 4OXNA 2RGUA 1HA3A 4ND8A 1EA7A 4UE6A 3H7IA 2YICA 1GTRA 2FO5A 1CB7A 2XB8A 2CVHA 5JS2A 4BVLA 2L42A 4M46A 3FWKA 3V1MA 3KT6A 4KH1A 4UMDA 1CQDA 5U1PA 2G72A 4MWEA 1U8UA 2D7CA 3GRKA 3ZHZA 1XZBA 4BBPA 4BX8A 1JJBA 1J06A 1EUDB 2UZ1B 1TQ8A 3V8QA 3LXSA 2RBGA 1LXCA 3UENA 1GRQA 3IQXA 4NC9A 3UAWA 2UKDA 1NASA 3NTLA 5LNK1 2FEXA 3RVQA 2G8EA 4OKIA 2V5VA 2PYDA 1DOAA 4O2AA 1QG6A 4HLUC 1U3VA 3V7YA 1YA6A 1ULZA 5CX1A 3HUFA 3IIIA 3IRUA 4HEJA 4LTNA 1CULC 1GAWA 1X42A 2PGOA 1QU2A 3TUJC 2G0NA 2B5VA 3CURA 1CD5A 3X0DA 4J0KA 4YYZA 3B82A 1IEXA 1HDCA 4KG7A 3ZQ4A 3AEZA 3AETA 4INOA 2W6JD 5AO9A 5EZ5A 3EGXB 1YDHA 2QYSA 3HACA 3QBTA 4NYMR 2J5KA 5M5BA 1EXNA 3AMVA 1JA0A 5JS6A 2PRYA 3CJTA 5I9TA 1CDEA 4C22A 4MKGA 4FFVA 1BQ3A 5AVJA 4DA8A 1OH7A 1HETA 3G2HA 3O47A 3W34A 4CMHA 4YCCA 1NHGA 1X1AA 1XA3A 3HJTA 3TG2A 2ZUCA 4BP9A 3GEDA 1J90A 1PVJA 1X1RA 4CCYB 1DC8A 1XCJA 4HNAB 4R01A 3S3TA 3HHIA 2ZTUA 4UTRA 3H04A 4AMVA 4XDZA 2H07A 2PX5A 1YH3A 3LBAA 4P86A 1VCOA 4CN9A 3W9UA 3W5BA 4GL2A 1F60A 5DYWA 4CW7A 2ZBGA 4AICA 3L4EA 4H7EA 4HLDA 3RRBA 3BF8A 3ZVNA 3FTCA 3W05A 5HYVA 1GKLA 1HOTA 1B8VA 1FFEA 3KQMA 1CY8A 2WJ4A 1FP2A 5HIAA 2GZ2A 5K8VA 4Y2GA 2AS0A 2WMDA 4DV0B 3BBLA 2HW8A 4DLLA 5FTMA 1C9MA 5T57A 3P52A 3PRJA 1AK9A 1VP3A 1R16A 2E5FA 3Q7SA 4LIPD 5DCWA 3YASA 4KNYA 1ACLA 2C8VA 1BD3A 3ESRA 4XJVA 3GLVA 5GTDA 3MK31 1ESDA 2MT9A 4Y2QA 3CGGA 3Q10A 3ESAA 4EI8A 1X7ZB 2WJHA 4J0JA 3EGEA 4GRDA 4DRYA 4OA5A 1AY0A 2LP4Y 2P5TB 2XWBF 2DC8A 1ZFNA 1ZJJA 4EFNA 3K9NA 5DM1A 5K8UA 5L3ZA 2YHAA 2QMQA 4RKWA 3BIWA 1M73E 1B3BA 1ISMA 2H08A 2H54A 3CBQA 4BB6A 2CXQA 1RKQA 3IIJA 1NRJB 2PSJA 3HSYA 4RS3A 1SKBA 2VF8A 5IVDA 1C1DB 3E0QA 4JBWA 2O4CA 2IH2A 4V0OA 5LP1A 2V7WA 1YRLA 3HO8A 3OBIA 2QZ9A 2R8XA 5JD6A 3D1JA 1PJ3A 5CA1A 5DHQA 1ZU4A 3NUZA 3W2IA 3U0BA 1AZWA 3OFVA 1PIPA 4JBNA 3L7MA 1W59A 3BL6A 4JBXA 3UMMA 2GBIA 3PDJA 4CMIB 5F02A 4WGFA 5E3IA 4FNGA 2RD2A 3Q12A 3Q3GE 5KQSA 1ZK0A 3D2AA 4FMCB 1XELA 2Y67A 5U4QA 5CXQA 2BTEA 4DUYB 5ADHA 3Q0TA 5DI9A 3EX7C 2DM6A 2ZDGA 4RDHA 5SYMA 1NN3A 5BQ3A 3R8FA 1WB4A 1ZXBA 1OGJA 5EHXA 1BE1A 1MH9A 3Q8KA 2YJ4A 4IFBA 1HDRA 3H9UA 4UOEA 3OPYA 1TUIA 3QF7A 1M54A 3EYAA 4FDTA 4ECAA 5C32A 1A9XB 1U3DA 3IEJA 4JHLA 1Q11A 1WW8A 5DW0A 3RFFA 1ZLYA 2WPDD 2FDRA 1Q2UA 3M6FA 2ZRHA 1GNQA 4K6CA 3WWYA 1COWD 2BH9A 4F4JA 2Z6QA 1TAUA 3K9BA 5JCJA 1SC9A 3VHQA 1T9DA 1XMPA 3JQ9C 4A91A 3IFUA 4DDMA 1P17A 4JJAA 4Q1CA 1VJTA 3G5TA 1GG8A 1ORTA 2OV4A 2VUIB 3ITKA 5AJWA 2RH8A 3CSSA 3X1YA 1VSTA 2VAMA 3HBFA 4XCQA 1GSOA 4DMXA 3WYDA 1FFYA 4GLFA 1NLZA 3PHWA 2R9VA 4Y1RB 1BOOA 4AG3A 5F9MA 2JLZA 4G5QA 5IAOA 1QFSA 5MF6A 2OCAA 3QSDA 1B0PA 3E1GA 5FA6A 3VA7A 4QBKA 5DM70 3AG6A 4EHIA 2Y0EA 4NLLA 4RPKA 2RBEA 3CCFA 4WDQA 3GWZA 2W2OA 3RAFC 3V4VB 3NEAA 1XPOA 2DQ4A 3PT5A 4G2TA 3KKLA 3PR1A 3DPUA 1Z16A 2B94A 1MF7A 1R8YA 2GUWA 2NYRA 3FB1A 4GEGA 3VPXA 3RHZA 3LZDA 5JAHA 1THEA 4BFVA 1CUCA 1WAMA 1JA9A 2QRJA 1N2CA 5P8WA 3SVLA 3Q9NA 1LPBB 2Z6AA 4E46A 4FR5A 4P82A 5K0SA 3IDOA 4FQ8A 1VGRA 3EMDA 1EZ1A 2MMGA 4KACA 3MWDB 2PM8A 4M1SA 3X3HA 4BRWA 5FLKA 2A86A 2IYYA 2C04A 4BWGA 4BNVA 1ESMA 1FFHA 1A2QA 1I6KA 1W93A 3KFLA 2MINB 3KSRA 3S2ZA 4CCWA 1KDPA 2EATA 3WJ1A 5FPKA 4AO8A 1RLMA 1P8JA 3MUNA 3IOBA 4XB2A 3VNVA 3GHHA 5FPYA 3IHWA 2OR3A 5AVZA 2GI4A 3PE3A 2P41A 3ZZUA 4RF5A 4TLCA 3LH5A 5ISMA 5B1SA 2OUKA 7AT1A 1VRVA 4XDYA 2YCLA 4G0QA 1J22A 4P58A 5HX7A 3U2QA 3U3ZA 2H2DA 4UJ5A 2GB4A 3VSAA 1KQGA 1U5BA 3H6HA 4IOLA 4Y7CA 4B3SB 5EAIA 3PPYA 4C3UA 3OQCA 1EK5A 4IJ5A 1PX0A 1ZCMA 4R1SA 2XDAA 4MA5A 3CW2A 4PADA 3HLYA 1EFVA 3GR6A 3C85A 2D3WA 1E58A 2C7QA 4RF2A 2C4HA 4IWNA 3OLXA 3EWAA 3PGA1 1WSDA 3OZFA 5CH5A 3V1KA 3DL4A 5LQUA 5ALXA 5EJ2A 2JJ2A 3ZVLA 2PQ6A 1R10A 1U2EA 3LPAA 1FRNA 2VYFA 4N8WA 5JDIC 2Q4OA 5EMMA 1Z7BA 2JFFA 3ICEA 4YNBA 5C8DA 4PLFA 2Z83A 5C1PA 1E3EA 1Z7GA 4BGDA 4PLWA 2EWMA 3LFUA 2C2MA 3T4EA 1OWOA 1PS8A 3GFFA 1JLHA 1TA4A 2ZJ0A 4AJEA 1CSBB 3OKPA 4Y3UA 1W6RA 4MW9A 4BGVA 1YR3A 5ECGC 4BZXA 1ZLXA 1N3BA 1R50A 4JY7A 2PPLA 4DV4B 4H4DA 1PO7A 3UMVA 3HFRA 1GVNB 2P62A 1WKBA 4TMYA 5LA6F 1T15A 5ED0A 1N5RA 3X1XA 4YUXA 2F48A 3O0UA 1O5IA 2D7JA 4EAQA 3H2GA 4RNAA 4INZA 2ET6A 2P65A 4JSRA 3VR0A 4FT4A 4B34A 2FW6A 2WMYA 1RYMA 4Q9KA 5J5CA 4DQKA 3QMMA 3S2UA 3ZQJA 4ZU1X 2YS6A 3G5LA 4EB6A 4HD8A 1W30A 3COVA 3T1TA 1I2BA 1Z4IA 1IVSA 5EJ9A 3ICCA 1LRKA 3B1XA 3I9NA 4YMHA 3CS3A 2AKYA 4GPAA 4OHBA 1SJ9A 2IP1A 4PX2A 5I51A 2FG6C 1EVZA 2EX1A 4E4RA 1C9YA 1JEOA 4L7VA 3VJLA 1P1RA 2GYYA 5K8TA 4K1LA 2NUAB 5JO0A 2O8CA 2QXTA 1MIRA 1X13A 2BZ0A 2BISA 2MR6A 3AW9A 1ISPA 1K6JA 3H05A 4JHXA 4CM7A 4WBNF 4Y2XA 3OTOB 1TD9A 4QO7A 2QVCA 3V1TC 4I1IA 5TC4A 5JS7A 2ZXEA 4ME6A 1E4OA 3RVNA 1MW8X 1GNLA 2Z58A 1CXZA 1I0IA 2J8ZA 2VYVA 1M34E 3H2YA 4L5AA 1FYWA 4Q16A 1RU3A 4TRNA 4EGFA 5FBVB 2YQ5A 3H8JA 1O97D 1NI4A 1SBYA 1T2AA 3CB4A 3DZCA 4FKMA 4LDJA 4JB3A 5AQEA 4KQ1A 3V8PA 3KPJA 1IXSB 4D42A 5A1TA 4L8VA 4DIBA 4LF8B 5FBWB 3Q2IA 3Q3IA 5KJ6A 4C03A 3NDBB 3AP1A 2JZNA 3G1TA 5JNSA 3EAQA 1BGXT 1JR3D 4AY2A 4CFYA 3GEPA 4UMVA 2HA4A 1MGPA 4ID3A 1BHO1 1WDTA 3KETA 3OKFA 4ARZB 4JVSB 2CJXA 1NMYA 2CFOA 3QVVA 5HK9A 1U0RA 2F1GA 1NVBA 1P18A 2PMKA 2W58A 5C8ZA 1M8FA 5JQWA 1K7XB 3RASA 1C3OB 4WOKA 3BD8A 3ZTTA 2RC5A 2W6ZA 3MYRA 5F33A 2ZM6B 3QBVA 1QTQA 1FRVA 1VOTA 2XRMA 3DVQX 4AY6A 5H9VA 1P2SA 1NKTA 2YJ6A 4EJFA 1SBIA 2QXUA 3A1SA 1E9SA 3JR7A 4JUIA 4NI5A 1ZBDA 2I67A 2IFTA 4QKQA 1M34B 2WV9A 3FRHA 3GXBA 1GZ4A 4E4TA 3ONFA 1KY4A 1RAGA 2YZGA 1X80B 2IITA 3KZMA 3E53A 3NUQA 4YYUA 1V43A 4OL0A 2NW6A 2PZGA 3TMPA 5T67A 3OAAD 3TOZA 2VQ3A 4A7PA 1JG1A 3KZOA 1P7VA 1JFLA 4EA8A 1WOYA 4MO9A 1XBTA 4WOCA 4BS5A 4CN8A 1QYXA 2A9QA 3F2VA 3TS1A 5BSUA 3RS0A 4MKXA 1OH8A 5EMLA 1NVFA 1UANA 3IE1A 2GCIA 3H0EA 1V9SA 3BWBA 4P83A 4BQEA 4HRXA 4YRSA 1UR5A 2G82A 2GUGA 1WMBA 3KT8A 3A6JA 4NOJA 3IPCA 3R0XA 1YAJA 1JDPA 3W31A 3ICPA 3PCTA 3ZWPA 4XR7A 2Q1XA 2VBGA 4L5IA 4HNHA 4R8SA 2K7ZA 2ZBDA 4ACBA 4CKZA 2DR2A 1SKYE 3GFPA 4WKGA 3BY4A 1TQDA 1ZM9A 3ZDXB 1DFGA 3I30X 3WP0A 9MHTA 4BCCA 5HDBB 1LS1A 5TLSA 1AYWA 1HM5A 2J67A 1BX0A 1AZTA 1PR3A 4UZEA 4RQBA 4EKGA 2VDUE 1X7XA 2FOXA 3JYPA 4NAVA 2FPWA 2P2SA 4M49A 4TMFA 1EVIA 4TV9A 3UXHA 4CG2A 3LXRA 1X6VA 4D9CA 4E3WA 5KWEA 4DNXA 4QU5A 2WNHA 3H3XA 3ZE6A 3MP2A 1BVYF 5FPSA 2VTEA 3CG4A 2WIKA 2OZEA 3KKQA 5TEVA 3UN1A 4BFXA 2IHZA 1UKFA 3GI1A 1R0SA 3DZFA 1C7QA 4J16A 4ZAWA 2AZDA 4MGZR 4PIPA 2B83A 4URWR 1TCBA 1E8DA 1MJHA 5EXDA 4ZT5A 3NJ8A 5FYQA 3R8CA 3UUGA 3HVRA 4DTCA 2ORYA 3A32A 4O0MA 3QU4A 3ABQB 4W1SA 5K8JB 1PNOA 5KOHA 3RVLA 5PNTA 1IPEA 5A9TA 2EFYA 4YLEA 5JI3E 1D8AA 2B25A 1CV2A 1DC6A 1F2VA 4ID9A 4RD1A 1CDZA 5G0VA 3Q4GA 2C2WA 5KBYA 3BT7A 3H6KA 4BQIA 3GZ4A 3ZCRA 1XP5A 2M98A 1ORHA 2B34A 4UMEA 3QPUA 1JUDA 1M6EX 2G06A 2VHXA 3HP4A 4IPTA 3UWDA 1WVMA 2Z1NA 3KSBC 2JHFA 3PC8C 4OHZA 1E6KA 5K3CA 4XUDA 1ZICA 3OQVA 1QANA 3LP8A 3UMBA 4AKTA 2J9XB 3BE4A 2R6AA 3IO5A 4KX3A 1NR7A 4M21A 5EWJB 4ZMRA 3MJ4A 3R3SA 3T7TA 4JC8A 5GJVC 1F8UA 1U8AA 1XSEA 2B35A 1WTAA 2VQSA 5JJ5A 4AO6A 4J6FA 2OT3B 4RH1A 2UYCA 1QR2A 2PJDA 2G07A 1IK6A 3I2JA 3WHPA 1FXUA 2P68A 3CF4G 4N0MA 1ULTA 2XNDD 4X24A 3H83A 2VJBA 1F6WA 5JNLA 2HAEA 2WP8J 4JLJA 5LBTA 1KYZA 1XCMA 3SSMA 1YZNA 4MVXA 1YIDA 1QDEA 1ZOPA 2GJ4A 4L6IA 1Q74A 1LBQA 1MORA 4KRYA 2FX3A 5LZ7A 3QWBA 2QX9A 4U8HA 3VO2A 4XUCA 2P77A 2BAGA 4JOBA 4OH7A 5FBHA 3DL7A 4EKDA 3BRCA 4IIEA 3R9XB 2QN2A 2FH5B 2W6NA 2WTMA 2EEPA 1I8TA 4I9GA 3RU7A 3UC9A 2WUGA 5C7IO 3LP5A 3KX2A 2GZMA 1AS2A 1KHQA 1VYUA 7MDHA 1E32A 1P5JA 4BPVA 4RGBA 2AJLI 4Y6PA 4EYOA 3EPJA 3K5IA 1HQDA 4FKZA 3VR4D 1D7AA 2G83A 5F1PA 4JUFA 4MKRA 4XWYA 3K2QA 3M34A 1PT6A 3I62A 4Y2JA 4HI0E 4B32A 3BIJA 4K26A 3CUUA 4EG1A 1X1CA 1VSNA 4BQVA 4XDGA 3ZV4A 1XNGA 4IXTA 4WZAA 4L8GA 1DXHA 4HLQB 2JPDA 1QZ3A 4FHZA 4W8HA 3BFKA 2GEJA 3R9WA 5IDQA 5ITWA 2ZIGA 4IY1A 4EJSA 3L6EA 2NV2B 1DKMA 1XDDA 4HR7A 2FZLA 2MSCB 3H9EO 1KP2A 4G1EB 4X3PA 1WPXA 2BTWB 1F9EA 3KQTA 1LLDA 3R6TA 4MS3A 5CLLA 2R6R1 3AR4A 4L0DA 2AUZA 2WI8A 1FUEA 5KNBA 1OFUA 2EBWA 2JKYA 3BXZA 4LYHA 1A4RA 1TYDE 1U1CA 2RARA 4LVOA 3HXLA 1ZNZA 4OQDA 3OU7A 4MUJA 1KI4A 4YAOA 3GJ0A 2QP3A 1V3QE 3S44A 3UAXA 3TLBA 3BHIA 3L8HA 1TK3A 1EX7A 3T1YB 5EJAA 5KIAA 3M6UA 2V8BA 2XQFA 2YHBA 1X77A 3NAGA 1FBNA 3ZXXA 5IT0A 4IDAA 3GLHA 3TK1A 4M1WA 4L4YA 2PR2A 4WJZA 2BCEA 3CRQA 3OF5A 2BGRA 4V02A 3FZEA 2WKRA 2GSDA 1N5MA 4LTMA 4ND8B 4IX1A 5A5EA 3SG0A 1DPFA 3ZD7A 4ND7A 4KZKA 1CUWA 3CH2X 3BGIA 4PTLA 5CVCA 4NQRA 4TROA 2O3JA 3GLFA 4QU8A 4I05A 1EEXB 1LK5A 2Q3MA 3JARA 1L3CA 4F4DA 2OM2A 4RSMA 4AXBA 2NNLD 5E4TA 2GH1A 4EHNA 2X0JA 2UXBB 2ORIA 3ZYCA 1JHXA 2Q0XA 5K2MA 4NESA 2EX4A 2JFPA 4Y6GB 1URPA 1LK0A 3T5AA 1HTWA 1XTRA 2HJWA 3GJ8A 1JS1X 1KU6A 1L5KA 5HQ3A 2G40A 2F8TA 1TJYA 3QJYA 4ETMA 1LLQA 1A5ZA 1W5SA 2PL9A 4XTRA 2A1IA 1EUCB 4WERA 4DSZA 5F78A 2VDKB 4CKBA 3S81A 1FQOA 1XTPA 5DNVA 2H1LA 2ZBFA 4CLOB 2VDJA 1S3GA 1ZSYA 1LJLA 3GLIA 1FL9A 2XNCA 5I7AA 3TTVA 4P98A 4P81A 1NXPA 2N3ZA 2ZIXA 3EBPA 3O8QA 2EKPA 5LSAA 2J48A 3RJ5A 3FOFC 5AK6A 3M6AA 4I50A 2BKLA 4UAJA 3GA7A 5GP1A 4D7AA 4DXHA 5K4HA 2XCIA 3GDGA 4MCHA 1Z12A 4C01A 2NQ8A 1QRDA 1E8MA 3GPIA 3VR4A 4DAEA 1MBZA 1WMDA 5AOBA 3Q3JB 2C1ZA 1U1GA 1VLMA 2IE8A 3ABSB 3AL3A 3AUJB 3GVPA 3KEGA 4B3DA 4YYRA 3RTCA 3DHWC 3B60A 2I4IA 2PUBA 3DAPA 3A4MA 3OWXA 4FFBA 1TIKA 1V37A 3BX1A 2QYHA 4ZHQF 6REQB 5BOSA 1KZ6A 1MJNA 1MZPA 1C8VB 3EF3A 2VKTA 1QR6A 4H7IA 3GLHE 2EIXA 2DLCX 1M1YE 2B4KA 1KK2A 2JGIA 1EB9A 1Y08A 3O3NB 4URXR 1XJ0A 2HWXA 2VAWA 3OZIA 3P0IA 3OT1B 2FYEA 4Q4JA 4DPKA 1CDOA 3Q5EA 5H80A 4BO9A 2YQZA 1Q1GA 4CL0A 1EI9A 3A4NA 2E48A 2QMZA 2BSQA 2WVHA 4QJIA 4PXYA 1K2VN 3C1UA 2X7HA 3GYBA 3OICA 3ZJUA 2CDNA 4RJ2A 5K1ZA 5CDSA 4GGMX 2WMNB 3ISJA 4KFUA 4RANA 4B4OA 5KYXB 1W4LA 4N7RA 1KFJB 3E7PA 3JWEA 4D8TA 1OXVA 2K5UA 2X0NA 2DRIA 1GPH1 2XGSA 4MXDA 4DR5B 3RUCA 5IG2A 1WXFA 2RHLA 2XIQA 3AVXA 4QPNA 2FE1A 1Z08A 1N8NA 3GARA 1TLFA 4FLFA 1K8QA 3KR1A 2ODPA 1FP1D 2J7PD 3B5JA 1E2EA 5B1EA 4LVCA 4RD6A 1RRCA 4OAOA 1NHWA 2BIFA 4BP8A 3E2PA 3L1JA 2WSYB 3E7XA 3NVAA 4QYMA 5B12A 3ZUAA 2WIDA 4YMUA 4RW0A 1QHNA 2VDMB 1XRLA 1YB1A 2AG5A 4V2IA 5IUNC 1KQFA 3NBFA 5CX1B 1KVTA 2FUNB 1Z68A 3MD0A 1JZQA 1MB0A 2OSBA 4NS1A 4ZODA 5MGBA 1PBNA 2C0CA 2C96A 3I01M 2FWAA 2JVKA 4D4LA 3AF6A 1VPWA 4DMMA 1FJ2A 1GTG1 4O02B 1CU1A 1AU0A 3LIPA 3P5VA 3O73A 3K5PA 5GIOE 4JWTA 3HB4X 4ZOBA 1Y5NA 5DKFA 3RNVA 3DFMA 1KO4A 3L3BA 4HV4A 2IZ6A 3BXHA 3SOPA 3FZNA 2Y4OA 1FFDA 3N7AA 2XMPA 4J4TA 4BXOA 1CWUA 2YUIA 1KVUA 1PTJC 3K8ZA 2P7UA 3AV0B 3I28A 1JG4A 4LDNA 4LFAB 2GASA 2FCRA 1JJIA 3NV9A 1GDDA 2FP3A 3HJFA 3N0RA 3M1IA 2VCYA 4KMSA 3AY7A 4NYJR 3L6UA 3PPWA 4MWBA 4U2CA 3ZD6A 5TMPA 4KQGA 2ZJZA 3TB6A 3G2QA 3EQ8A 1CEXA 4XRRA 4TMXA 4UVEA 4RTMA 1KK0A 3ZGNA 1IJFA 5JDIA 1A9OA 4RVFA 3I09A 4YA6A 1N5OX 3MMZA 2P2LA 3HUDA 3OETA 4JJEA 2B2XA 2G9RA 4QUGA 5KCZA 1Y98A 4MAFA 1LPPA 2YWFA 4GYWA 2Y6EA 1W85B 2A30A 3D6NB 3DMGA 9LDBA 4BLVA 1W5FA 4QJ4A 3M82A 1GGMA 1I1QB 3E5HA 1AUVA 3TJZA 3MWFA 4RYDA 4LJ5A 4PLHA 2FX5A 4S1VA 2GNPA 4WOJA 4OQLA 1CE8A 2Z4TA 3VZBA 3DV0A 3BMXA 1SR8A 4QJ3A 1MLDA 2VQFB 1N77A 1PQ4A 3TLZA 2QP9X 3OA0A 1CRZA 2CDBA 2A9OA 4YEDA 5ALEA 2OMKA 2F9MA 3S1AA 1SD1A 4MV5A 3BPFA 3LWNA 1CX9B 5DLQC 4I50B 3OSUA 3WXMA 1V1MA 5KSZA 4QSHA 1Y4UA 3NYQA 4ZMSA 4BJ1A 3NT5A 2GLTA 1SOMA 2F1KA 3B3GA 2E4VA 5DZSA 4ZI7B 4FZVA 2CV0A 5CVUA 1S1MA 3KJGA 3HXOA 1ONSA 2II6A 2R7KA 3O8OB 1ZJWA 4UPVA 1ICFA 2OQ2A 4IMRA 1KAEA 1QRSA 2CYAA 1P81A 1SXJB 4BO1A 5K4GA 1NBWB 2FN3A 1HT3A 1IY0A 2DX7A 2NPIA 3TLMA 1L5NA 1VI2A 2PN1A 2OFFA 2ZSHA 2GM5A 3GJZA 4YUAA 5C2JB 3CKYA 3MQ2A 1SXHA 2ZP1A 4JVLA 5EQDA 4MB6A 3CX7A 4FFNA 2TS1A 4BV3A 5FV7A 4F97A 1NFFA 1K7FB 3MCAA 4UVGA 1Z8DA 3BH7A 3H7DA 4XOIA 2DFDA 5JAPA 1NBEA 1G21E 2CY0A 2WUWE 3BCHA 3INTA 2X8LA 5JH7A 2C98A 3LRXA 4FIZA 2YHIA 4BLUA 3BPSA 5D3ZA 1G17A 4E21A 1GZSA 3CLRC 5D7BA 1DT3A 4ZI2A 5AWFC 2ATIA 2V4MA 4D0GA 2BGIA 1VYTA 2R1TA 2VIIA 4B3MB 4LYGA 3ANYB 3N2YA 3WGJA 5K6AA 4BO0A 4S1TA 1GT6A 4CF4A 1KO5A 1ZP6A 1TO6A 3KUKA 2OZVA 3O21A 2G76A 4P2BA 2JHCA 3OOWA 1R6AA 4PYRA 5I8ZA 4KR0A 4WFKA 3ZCSA 4ZCTA 1VJ5A 5HF6A 3JQEA 2CV1A 4P7BA 4C78A 3VR3D 5C8VA 5BN5A 4DL9A 1GP2A 1CUXA 2HM7A 2WVAA 2PZKA 3FPHA 1T0PA 4LHEA 2QM7A 3AERB 4MWOA 1P2BA 3E9CA 4MVWA 4ZYVA 5JEEA 1WVIA 4HLNA 4Y6OA 1AA9A 1SVNA 3I01A 3JQ7B 3OVZA 3UAGA 5CA0B 4IEEA 2OLEA 1LNZA 3MPUA 4YJ3B 2FPPB 3DWEX 1OASA 3VH3A 4X1IA 4ZKDA 1BXKA 4ODIA 1UK9A 1PL6A 4OMCA 2WU3A 3JZIA 4KR7A 5JQGB 3ESBA 2Z30A 3KYDA 4RV9A 1SG6A 4AB1A 4UHCA 4LF6B 4PPQA 1KAQA 3OISA 2P27A 1NW4A 3QXJA 3AIMA 4FFBB 1RQ2A 2PEYA 4X6IA 3DLHA 2D54A 2FW0A 2OB1A 3GCDA 4DMRA 2OD9A 4TTJA 5COAA 4YR7A 1ZD2P 3ZOKA 1RDFA 1NT2A 2IEYA 3L0PA 5DULA 2Q41A 1Y6RA 2XKBA 2JAHA 1L9XA 1M0SA 5T4FA 4JLPA 3UHPA 1RKBA 5B53A 5DBIA 5C9ZA 2DTXA 1Z9BA 4B84A 1KHHA 3HCNA 2NNWB 3VXKA 1NBMD 1T3HA 4YRKA 1EP2B 2Q5JA 4GMDA 1XRSB 3T7JA 1H6DA 1E6MA 2BGKA 1N2GA 5THXA 1JWBB 3UT5B 3NAZA 2J3DA 1C0EA 1OLXB 1P77A 2WTEA 3IDFA 3PQ4A 1CT9A 3GJYA 4LISA 4QXAA 1EVJA 5A05A 3STWA 5ICSA 5HTOA 3ZDBA 4MQMA 1MC5A 5LXTA 3QTBA 4N0EA 3VPHA 2PLFA 4BTEA 1CR4A 1XAJA 1B3RA 4BGUA 3EA0A 1JMYA 2AMJA 3T7CA 1Y5LA 2CIOA 4JYAB 4HXDB 3B5EA 1XQ9A 1XDGA 2OAGA 2XVZA 5CH8A 1ZUWA 2X9GA 2PZEA 4X1YB 3N7TA 5G02A 2CN1A 1LQUA 1DWPA 3IEKA 1NP3A 3D7RA 4Z4GA 4Z49A 4O4JA 4RKEA 3TE6A 2GVZC 3W8NA 2B82A 2XQVA 1XPUA 1RLTA 1C4KA 2P78A 4LJ8A 2CF5A 1JEQB 4UE3S 1ZRSA 2CFRA 2PKQO 1VYVA 1D1TA 2GAFA 1QIHA 4UQLA 2JGMA 1NMEA 3ME5A 1N1DA 1PZXA 2VHVA 5IMBA 3HNOA 4NEQA 2C2XA 4YDRA 4C0XA 4DNOA 1C9KA 3RU2A 1GCAA 5KJ1A 4HXEB 4NCIA 2QAJA 3ZXYA 3EUFA 1ITZA 4Y9DA 4WURA 1B8UA 4UXIA 3NWOA 1RXEA 2H1IA 4PX9A 1IXZA 3T5GA 3TEFA 2NO1A 3SJZA 2AC7A 4BDSA 3RSQA 2E1PA 2ERXA 1ECBA 4ZPXA 5JCOA 2C1XA 3TYXA 1AYVA 1G0NA 5IF9A 4QUDA 1P2UA 5CG1A 5B58C 3EAFA 2PV0A 3C39A 3VTKA 2ZR8A 3KC2A 4QREA 5AW4A 5LCXA 4CM8A 4EM6A 4OA8A 3FCCA 2GM4A 1SA0A 5DOVA 1QHHA 4AX4A 4ZVKA 3ZDRA 3Q7PA 5C81A 1J20A 3TIVA 1PJTA 3IERA 2NVUA 4S2UA 1E18A 1UEXC 2OFXA 1A97A 4PS0A 4EHHA 2IIBA 4E08A 4AUMA 4V2UA 5JASA 4JZYA 1J33A 2F1RA 8ABPA 4BTVA 1CVZA 1VDMA 1FK8A 3ABRB 3CNHA 3GBPA 1QH1B 1RLJA 4HGYA 2QRLA 4AAYA 4W5TA 1JSRA 5CA0A 2HD5A 1YFKA 5DM2A 2NACA 3AVQA 4PLTA 3AERA 3HY3A 4AJLA 4E33A 3KB1A 1Q3TA 5AW9A 1RJWA 1VKOA 1S96A 3ASYA 3TTXA 1X1EA 3DMTA 4KO3S 5AW0A 1GCBA 3KL4A 4A2QA 4NPHA 1TYCA 1VRWA 3GK3A 4BFYA 1DWOA 2QZZA 2ARYA 1E5LA 3GFSA 2DC7A 4CEJA 2WUVA 4LXIA 3UKOA 4FLEA 4V3BA 4M38A 1L4KA 4YYEA 4LF9B 3OT4A 4A0SA 4YT8A 1TUBA 1X3LA 2Z84A 2DWQA 2BM9A 3DXXA 1PLKA 3MOSA 4V39A 3SJ7A 4HLCA 1NZDA 4UUPA 3HGMA 1S4VA 5BXYA 4OX9Y 3ZWNA 3BDVA 4TOIA 4AZ0A 5I9SA 3V1NA 1YHYA 4B3FX 1NW7A 2VHUA 3GF4A 4M88A 2J9ZB 5IJXA 4RGYA 2AN4A 2O48X 2Q6OA 1L1EA 2ZPUA 1M67A 1WU8A 2J59A 4JB2A 3CO5A 4WK2B 4WCVA 2PH7A 4G54A 4IXDA 4NR0A 4V0ME 3TQFA 2QUIA 5JJCA 3F5FA 4JLBA 2X5KO 1T36B 2HCBA 4RHFA 3WIVA 1TZ2A 3TZQA 3RSCA 2P9HA 1L8QA 1JQPA 2WNIA 3DE7X 3TGPA 4Z54A 1K06A 1IRIA 3R7BA 1Z2PX 4E7OA 1GDHA 4CXMA 3KOZA 3G2MA 1DG3A 2Y27A 3B70A 3UJNA 5LWQA 3O75A 2Y1LA 1OGIA 5EKUA 1E2IA 3ABZA 4N8SA 5B3LA 1CJVC 4LZOA 1RZUA 2FMXA 4M99A 3ONVA 1AECA 1K6MA 1X7ZA 3GT0A 3VDNB 3FCUB 5JZBA 3GMTA 2OCPA 3QVTA 4C0HA 5LPNA 1Z62A 2XU3A 1I5EA 4HWPA 2E3JA 1N2CB 3LUHA 4HXYA 5DBEX 4EY6A 1HEUA 1RQ7A 2O2ZA 5T4HA 2P7HA 1GTJ1 3R0QA 5KU1A 3AIKA 3K5HA 5GMOA 3WKEA 3BE6A 4RFVA 4Q3CA 3O8LA 1NRIA 4HTAA 5CFPA 1CETA 5A4IS 3PR3A 1TYEB 4LMBA 3V5NA 4ZO9A 1RWKA 3ZKAA 4ADSG 1TUGA 1N92A 1UDXA 3GP3A 4X6LA 3PRMA 5A3RA 1AKNA 1USUA 2J07A 1M7GA 4NFLA 1KDTA 3EXHC 4OJYA 2OBYA 3SZGA 3V8MA 3CVUA 1G1MA 3NNDA 5FL3A 2FUDA 3F78A 1AA6A 3ETLA 5LZ4A 5AW5A 5TT1A 3EISA 1Q92A 3URKA 1KO7A 5DCLA 4JFRA 1PDOA 2J5RA 4R3NA 4K40A 1ABEA 1ADCA 1K3TA 3HUTA 2XJ4A 3MGGA 1BAPA 3QQPA 1P44A 4IIYA 2YCBA 5EUBA 1RQNA 4B79A 5LP6F 3T5CA 1JI3A 2O59A 2QTRA 2V9CA 2H4FA 2SKDA 3G7SA 4K28A 4ZAYA 1YGPA 3QHQA 1SNYA 2Y2VA 4NBNA 2TMGA 4J0EA 4HEQA 5FORA 5LP6C 3TNFA 2AG6A 4N7BA 3OPYB 2B1JA 4RVGA 3UJPA 3CVVA 1TVEA 1XVUA 3KHTA 3ROPA 3EEYA 3K0EA 3PJFA 2B1MA 5TS3A 1YZLA 5E95A 1E1YA 2Q5QA 2H4YA 3L04A 1YS6A 4K6OA 3VKHA 2QDXA 5DLDA 2AKEA 4DNPA 2GBLC 3E0XA 2B2CA 3KV3O 5I9BA 1A7AA 3K94A 3L9XA 3WWPA 4CLXA 3RRNA 3ONWA 4IYJA 5EZYA 4U8GA 4L07A 3N5CA 2Q6VA 5G3ZA 4DADA 1FFWA 1II0A 2BGUA 3HVHA 3KYCB 1U9JA 2H29A 3FJ1A 3GGPA 1OH5A 2ZJ4A 2XU4A 2F1HA 4E15A 2DSTA 2HR1A 2VJMA 2A5GA 3RVXA 2J45A 4P4GA 1OXKB 3K71B 3GJXC 3U3JA 3R0VA 1BKSB 4LBWA 4NV1A 3GOHA 3RBXA 3PIRA 1ZJ4A 3TOVA 4CTOA 2Q5CA 3HY6A 4JBHA 2R9FA 3U1VA 4MS3B 3T61A 4KPEC 3I6BA 3LO8A 2FAXA 3NPMA 1IY2A 2CJWB 5TPWB 2BCJQ 4A92A 2NV0A 2WAAA 4XCXA 2QL6A 3IMAA 5JECA 3DDCA 5DHAA 2GZDA 2JGDA 1UBGA 2FZVA 3AL2A 2YMLA 5REQB 3ZH9B 2HT6A 1Q2XA 3V6CA 1RWMA 2Y68A 4JLOA 2ZYTX 1OLSB 3UQYS 2AYXA 1R18A 1V41E 2EYQA 2CYCA 2H2GA 3GJ6A 3A27A 3A2NA 1MT0A 1KTVA 1ZJZA 3AFGA 2PCLA 3DO8A 3E5MA 3KKEA 4R2JA 4WXEA 1BW9A 3ZIDA 1R88A 3HB7A 1J7JA 2GNOA 4NMWA 4ENQA 4IGKA 2IY7A 3P2EA 2XUIA 3HVKA 4QNMA 4RJKA 4LDRA 3D81A 5KJEA 2ZUFA 3O7MA 4PQRA 1DCFA 2CKMA 4J7CA 3BAFA 4RZSA 3AUSA 3EOAI 5H3LA 1ISGA 1LV7A 3LQ2A 3W1WA 2EKBA 1TEHA 2AK3A 1FBTA 1QO0D 4WFQA 1CR2A 2PS9A 3VKFA 1PFUA 1U4OA 3C70A 3MCWA 4PO1A 3NHSA 2VC2B 5J2UB 4GZMA 1M2WA 3L8CA 2JQGR 1N7HA 4UU1A 2ZRIA 5ETJA 4LPSA 1C9EA 3AHCA 1YDFA 4JQSA 4YP7A 2OY0A 4RSRA 3IUNA 3NBKA 1PR0A 3PQCA 3IP6A 2PE5A 5BRAA 4LDQA 1B1CA 1IBRA 2GPYA 2C2HA 5B7QA 1PR5A 3MNFA 4R7ZA 3HEBA 1NGSA 4IGFA 3UMFA 4BJ6A 1X3SA 4IIJF 4ZDIA 3IP3A 1DC5A 3P2MA 4EG0A 1L7BA 1QCZA 3KKOA 3PQDA 4LNUB 1LH0A 1T35A 4MP6A 5IYZA 1WHSA 3L41A 3IB3A 2O3TA 4XX1A 9GPBA 3GNLA 3EDQA 5FTJA 5HNKA 2PX3A 1U81A 2ZEJA 3DEZA 3DEYX 3ZE7A 3KQKA 1WS6A 3C48A 1FB5A 2QRVA 3HJCA 3UAOA 4QOIA 4XM1A 4QYXA 4HAWA 4BNWA 4PX3A 4GOLD 4UNRA 2FWIA 3L6CA 4KQ6A 4R2WA 1T8PA 3PSAA 4BOYA 2K2QB 1J1ZA 2KLHA 4JDUA 1JEAA 1RE0A 4FJ0A 3AIOA 3NHZA 2AOUB 2BZSA 4X66B 5FT9A 1Z4NA 1ZQ1A 4M9QA 4RQAA 5AHOA 4BWVA 4R8VA 4REOA 1HLGA 2G5CA 3SEFA 1SVLA 4OFWA 3JWHA 3FPLA 1AUOA 2VF7A 1ZMOA 2O3SA 3DB2A 2XMGA 5EINA 2GCPA 1VB5A 2EDCA 2VJQA 1QHFA 3VNSA 2RGNA 5G2OA 1TK9A 1WA5A 3O0TA 1EUDA 2UZ1A 4L28A 5KX5F 2ZSJA 2ZK7A 2PUAA 1QIDA 3I04A 1W34A 4CKYA 1S4MA 1HT0A 3ZX5A 4QUIA 1MC1A 2B8JA 1WUTA 3OFJA 4D0LB 5HM8A 5FO0A 1C1XA 2QY9A 3F90A 3LHKA 2Q9UA 3R6WA 1YQUA 1P1BA 3BF7A 1Z06A 1RRFA 1XU7A 4QRXA 4UKDA 3GLIE 3H8VA 1RI4A 1DU4A 3MCUA 4ED9A 2NQGA 3I4CA 3D3WB 1DBPA 4JBYA 4GKAA 3RFTA 1C7RA 2WFLA 5L6LB 3QNMA 3EVCA 2QZJA 1J42A 3OTIA 4N54A 2DT8A 4JR1A 3RS4A 5JSHA 3LC2O 4EMTA 1M1YB 3ZUGA 4Z4CA 5ICCA 1N9GB 1JSZA 3IJEB 4J3FA 1T9ZA 2GCGA 3H9BA 4O4LB 5JT1A 3KBOA 4BU1A 1VPTA 1VFPA 4K6MA 5E7MA 2FLKA 4DDVA 3RG8A 1JVBA 1RZVA 1MENA 1FTYA 1RYZA 4X45A 5J3JA 1SVSA 1XD2A 3EQ2A 4NNOA 3UJCA 2PU7A 1KK1A 2P9QA 4P3NA 3D4NA 3HU3A 4LGYA 1A5AB 5CM2Z 4PHCA 4QEZA 2AS8A 4EYSA 2JLQA 1JDJA 2AN5A 4GI1A 3H16A 3VYVA 3CLHA 1VKRA 1WVGA 2BFFA 4PHTA 1PL7A 1VB3A 5FHRA 1WXIA 3SK0A 2QTMA 5FBLB 5A24A 2E37A 5DH9A 3AQ4A 1ES9A 1NBOA 1UKYA 1USWA 2GBCA 3CZPA 3O2QB 4UVDA 3O8QB 5B4VA 3WB2A 3OX2A 3FFWA 1R0ZA 4X0EA 3I06A 2JJMA 4F6RA 1M7BA 1AKRA 2CFIA 4LRXA 1XTUA 4RCZA 2Z8XA 3HGQA 4XR4A 1CPYA 1G0OA 2XT6A 5FUWA 4DB2A 1AU2A 4G4SO 1ZY2A 2J3JA 1AURA 2HSZA 3CLVA 3TAUA 1SCUA 3WNQA 1H22A 1X7GA 2R8PA 2VT2A 2GOYA 2CBGA 3PRHA 2X2PA 3QFRA 4U3JB 4XYLA 3SJBA 4H4CA 3ER8A 4W5HA 4J7XA 2UVPB 4CMEA 3DULA 1CF9A 3ESYA 3M5WA 1HEYA 5EXXA 4RLFA 4F7DA 3K9HA 5K4AA 4K5QA 3H11B 4I55A 1IZ8A 3ENKA 4F2PA 1T2EA 2XNHA 1FDUA 1PK8A 3BK7A 4NHEA 2NU8A 3KOOA 2DTEA 5ALWA 5H5JA 2WD9A 5KX5A 2DULA 3JYLA 1A5BB 1SU6A 4JBGA 4AMZA 4M0CA 2GAAA 2IP4A 2UUPA 1FYXA 4G0XA 4J4BA 4FOSA 4DCGA 3TLGB 1G3MA 4TTVA 4BZWA 4KXVA 2A0WA 2SHKA 3G2IA 4MR9B 4QDZA 1KOJA 1O6GA 3AG5A 3DW1X 3CPHA 4OBXA 5FL7D 3Q7TA 4H7JA 5FQNA 3S99A 4I50F 3F96A 5AJHA 1KDVA 4QHTA 1AQ6A 2C3YA 1SVKA 1CRLA 3FPJA 4F86A 1XMSA 4M0DA 5DMXA 1NF2A 2QPLA 4M4SA 3UEOA 4BNLA 1QIFA 1J99A 5CT8A 3ZXIA 2W8ZA 1LDMA 4BC1A 2H1HA 2FGKA 3IJ5A 4LJ9A 5LZ8A 2WHYA 1PV2A 5E1BA 4YRTA 4REZA 2AOUA 1NN1A 2F3SA 1PHPA 1EH5A 2G67A 3V7WA 3RGGA 4I4TA 1JECA 4MS4B 3V6LA 2ODQA 4D82A 2V3CC 1NBHA 1G7SA 4TV8F 5A4FS 5CIQA 3D4LA 1Z4QA 3UB3A 4B6RA 2A33A 1OR8A 2Y0DA 4H3SA 3DDSA 1T29A 4C04A 2IHNA 4GMFA 3UJ6A 1E2FA 5EEGA 1MNQA 2O0HA 3TR0A 4UTNA 3RADC 2J3LA 3TI9A 4U02A 1JHYA 1QAOA 4X5OA 1HDOA 4IDCA 4GNRA 3HSKA 4F4FA 1HLPA 1FDRA 2VQDA 4PRLA 4Y1RA 5FQOA 3VTZA 5CFQA 3STTA 4FN4A 4R98A 1L7NA 1YBMA 2XWJI 2ENWA 4YALA 3A6ZA 3U17A 4ECEA 1HE1C 4CFZA 2V6GA 5FCDA 1L5LA 4B7UA 4FEGA 1N5LA 4DYDA 2WSSD 4BZQA 1HWYA 1V39A 3PF8A 1ECGA 1DI0A 5C46F 5HMLA 1SXQA 3OLVA 3AYZB 4KO2S 4KO1S 1ZVVA 3UNXA 1NJ1A 2B7BA 2QP4A 1V7ZA 3JQDA 3GXOA 3EVZA 4FZRA 4GRAA 4JJFA 2GZHA 3WJ2A 3DVAB 5ECDA 3CKLA 2RJ3A 4BQFA 2I66A 3EXFB 5JVDA 4ZV9A 2JIQA 1UJCA 4CU5A 3TZBA 1VE6A 1AKTA 2IYUA 5CVDA 1ENOA 1OY1A 2AG8A 2CSXA 4XI9A 4A36A 1PU2A 2ES4A 2WIAA 3NO4A 3OJWA 4FNAA 4FYWA 4JNKA 1CLUA 4G5HA 1THGA 4PC3A 1C30A 1T4CA 3PBKA 4M36A 2HUNA 4R2XA 3EHEA 1RXUA 5JJBA 1TLOA 1UM9A 1PIWA 2PSEA 3CWZA 4G5SA 3TRFA 3NEJA 4UDXX 5HZMA 1J9ZA 2NADA 1JTVA 4G65A 3M99A 3UHAA 5IK2D 1SCUB 4QRGA 2G4CA 2ADFA 2R8EA 2WU1A 3DEHA 4Z9BA 5EWJA 2ZSBA 2FW8A 4PG5A 3V32A 1WMFA 6AT1A 1C7EA 4QZVA 1XTKA 4DPMA 1SXJA 4HNTA 1NR5A 3OI7A 1KXZA 3KVYA 2J9FB 1PZEA 1UAAA 4M7WA 4NK4A 3PKIA 1IQUA 1GPJA 1Y1PA 2GJAA 3IYLW 3KM0A 3LDFA 5AVKA 1XNRB 2VWPA 2ZBVA 1Z13A 3A05A 4KYVA 5L45A 5ANRB 3KZVA 2GJKA 1TTHA 3OQIB 4I07A 2AZ4A 5BT9A 1XDWA 3TOXA 3QLUA 2QSUA 1EDBA 1UIMA 4R69A 2NQ2C 3DMPA 5KHAA 1E0KA 3A8TA 5IVHA 1F0YA 3VDXA 3G8YA 3IUJA 2CXTA 3DJYA 4ZV7A 1OQAA 1N7IA 2AOVA 1OI7A 5KNDH 1Z39A 5JMOA 1QH0A 1BKYA 3NH6A 4CKEA 3L4JA 4DQVA 3THXA 3UXEA 5CHVA 3JWPA 2IZZA 4TMKA 1FDIA 1I33A 1E0JA 1IB0A 3OOJA 4WESB 2MSKA 5BSMA 2HK7A 4PHGA 5AVTA 4BP3A 4ZANA 5B64A 4P34A 1Z7WA 3FH0A 3VR1A 1H2AS 2VHCA 2Y77A 4BO6A 4PR0A 4KR9A 1BHQ1 2P6OA 2PFSA 4JCOA 3EEBA 3OCVA 2ZUDA 4OQQA 4P4TA 3T52A 4ZYYA 5EF4A 1HKUA 4MVYA 2QLBA 4UQPA 1PWYE 4GD3Q 3H84A 3OZAA 2PL1A 4LOAA 3MELA 1FX0B 2QRZA 3TQIA 4UEJA 5BNWA 1IXKA 1O89A 3I64A 4JI3B 1IB6A 1MX3A 1PT5A 4EBFA 1A8HA 4CIDA 1ZIXA 3W5HA 3QENA 2GNAA 1IPHA 2PS1A 2WT8A 3FNRA 3NONA 4LOKA 4E1AA 4S2EA 3ZXSA 5AVQA 5I7VA 4GR5A 1EWOA 3CRMA 3ZS9A 2R11A 4H1VA 4BKRA 4IMPA 4DPLA 5KNDD 2X1HA 3PTZA 1TK2A 4G8DA 5BSFA 3VKUA 1KY5A 1V95A 1P8AA 2NTYC 1CIVA 3AETB 4DA4A 1DJOA 3NVDA 3MTBA 2X1LA 1EUQA 1A5TA 2I33A 1V5WA 3DT8A 1FMTA 5EC8A 4ZEMA 1AHNA 3KXDA 3FJYA 4BLSA 5ALGA 2P2GA 1JHRA 1FVOA 2ZWAA 4Q3LA 1INLA 4ZVTA 1EWQA 3PL1A 1PYOA 4K7JA 4IKPA 1ZUD1 1LTQA 4IVPA 3U1TA 1BQ4A 3AY6A 3WWOA 2OGZA 5FOVA 5BMOA 5JJKA 1JJFA 3N2GB 2WTXA 2OZ2A 1Z37A 2NVOA 4RYLA 2UZ0A 3RYHB 3EEQA 4EUNA 3FNBA 3P27A 3QU9A 4QNNA 2YDXA 1NVVR 2JW5A 2NPFA 2IRWA 3QG5A 1VKHA 1A77A 1RP1A 3O4GA 4FI3F 4RVCA 5E9QA 1UOPA 3VR2A 4DCTA 1PZNA 4NYJQ 1KPHA 1UZMA 1XGKA 3GJ7A 3W2FA 1N3LA 3LKDA 1O8CA 1R0BA 1T0JB 5BN1A 1TO1E 2YYAA 4G1FA 1Q7GA 3DO6A 1ID8A 1E5TA 4X62B 1SZJG 5E6RA 4KMMA 3L84A 1A50B 3QI2A 4Y9TA 2FZGA 1WX1A 2IDZA 4LJLA 4YMIA 3NUGA 4XQ9A 4AZ0B 1H5NA 1P2FA 4N65A 5AW7A 3IXQA 2VHWA 3FGZA 1SCQA 2YN2A 4BECA 3ER9A 2Y1DA 1GKUB 1F6DA 1CZLA 1WEKA 1JZSA 2AMFA 3GJ4A 1GN9A 1Z6ZA 2VHTA 2GAOA 2OBXA 2JASA 4HYTA 2ZBQA 2QN9A 5CPBA 3WKCA 3TBFA 1HTTA 1QP0A 1U9CA 2JQFR 5LB4A 1TCCA 2QTCA 1P74A 5EQJB 4Z9AA 4LPKA 4PAGA 4MUIA 5A6SB 1OYWA 1TT7A 3TSWA 2E4AA 2OULA 4MSXA 5HBGA 1YZUA 2IDKA 2XUFA 2JEYA 4H1UA 5HUQA 3OFND 4HX5A 3ENWA 2YJTD 4CUKA 4MRNA 4DXDA 4M8NE 1D9ZA 2GZAA 2HD4A 3HTXA 3LL7A 1ABBA 1N2OA 1FU7A 3LSTA 1PFKA 3HYLA 2BEUA 1YCFA 3PUVA 4AXLA 1GGNA 2DWUA 3SY8A 2A88A 1ML4A 2W2PA 3ZCTA 4K3UA 3OZDA 5AW3A 1LTKA 3G7UA 3RFUA 3SDBA 3E82A 13PKA 2ZUSA 3SXUB 4YHHB 3HMKA 4HWKA 4PRZA 3V7NA 2F43B 3ZLUA 3TCKA 5ITZA 4MI1A 1JDTA 1L5QA 1RAAA 2PDAA 3IILA 2C99A 3IKVA 4EF4A 1NJGA 1NVEA 1PNTA 1A9TA 5B30A 3IXMA 1Q0HA 3L7KA 3FHCB 3V80A 2XU1A 3H5AA 3Q7EA 3RV3A 3G17A 2PSHA 3E8XA 2QTBA 2WFZA 3KYIB 4MK4A 5I9IA 2KB0A 5AKHA 2EQBA 1XU9A 1NLMA 1YZ3A 2FB9A 2FSVC 5A7HA 2ZKIA 1O57A 3G13A 3JTEA 3RSSA 4O4JF 2VWGA 5JBQA 2BFMA 3STYA 1GUFA 3JU3A 2ETVA 4LZWA 4IIGA 1U98A 2WM8A 4MKFA 2AUNA 2CJFA 1PRYA 8ATCA 4NJOA 1X14A 2EFDB 3AVYA 1R5NA 2FQXA 3IMFA 1G60A 2FFHA 4X8LA 4RBNA 3TAXA 1CRPA 3HXMA 3WLRA 3L4BC 1Y1KE 4OSEA 2VXYA 3AESB 3J80A 1RI2A 4KUEA 4DEYA 1R4MA 5AJYA 4Q7KA 3W8RA 4PXAA 1AU4A 1Q95A 3HKBB 4HJXA 1N2SA 3F0TA 4Q15A 2Q62A 5AKLA 1B0ZA 4JJIA 1KAMA 3S28A 2YHSA 3LU1A 4MUBA 5GAJA 3T1VA 3HWNA 4YMTA 3RPEA 2P9YA 3F9RA 2RH5A 4WVFA 3NC1C 4HSEA 1O7JA 3GB9A 2WIBA 1TQ6A 2H9AA 2REQB 2YIVX 1JAZA 1N3YA 2D1FA 3FAZA 4PGHA 5FAXA 5KJFA 1FNDA 1CZRA 2MU1A 2CGEA 2QRPA 4Z6KA 3G88A 2RMKA 5KTOA 1QO9A 1KSGA 2XQJA 3VMMA 3E9SA 3MWGA 3DBLB 4W5OA 5KAMA 2IV7A 2C5LA 3G02A 1SVWA 2LUOA 2QE7A 3OCWA 3H3JA 3VYWA 1YQEA 2ADOA 3K1ZA 4RLSA 2XT9A 3UKDA 3WFZA 4J29A 3HO6A 2YJCA 4Q1BA 2A2ZA 5BOSB 4ZUXU 4UVIA 1ILEA 4GX1A 2X9NA 1G9XA 3MAGA 4LRTB 3R4VA 4II7A 3VOBA 2XNJA 1QHHB 1JLLA 1U9VA 3FVQA 3JXEA 3ZDDA 3PDFA 4HFJA 2AUMA 1KMHB 3DE6X 3JQGA 3I9V1 1ORVA 2LIPA 1A9ZA 1FMCA 3STUA 1RZRA 4P4SB 5JRDS 5L7TA 1T5HX 3FCXA 4YREA 3NU1A 3LLCA 4R54A 1REQB 4RORA 2PWYA 4IQ4A 4N4AA 3FNHA 1V48A 2RHGB 1X9GA 3LT5A 3CPSA 3PXEA 3QVGA 4NU6A 4ATNA 1YJ8A 2DQSA 3N76A 2ZFUA 1YZGA 4MRPA 1VA5A 2XE8A 2PGIA 2XAUA 3DMDA 2IXTA 3OHSX 4B47A 5J4KA 5KTRA 1GU1A 1TVKA 4DFDA 1QS0B 4POOA 3BIFA 4QTYA 1BU8A 3KT0A 4K9RA 4ETNA 4ZZIA 1MHPA 4PAQA 2GDJA 2IOQA 3ZLVA 3V6EA 2RGNC 1TZJA 4KTTE 5F2EA 5T8KA 5D6OA 3BRSA 4NPAA 3NX4A 3VU9B 1RJEA 1TB4A 4B74A 4RKXA 5JEDA 2I1LA 5IX8A 1D4FA 2ZPTX 1DHRA 4LJSA 3NBMA 3ZWWA 4TVSA 1LSUA 1Z6YA 4HY3A 4IUMA 1UPUA 2PIDA 5COQA 1BIFA 1TAGA 4QGHA 2E18A 4CI0B 2C8JA 3EG9B 3AK4A 3GGDA 3BFJA 3NVMB 5K8CA 1F14A 2GWRA 2WQ7A 1CB0A 2Q28A 1E4YA 1QO0A 1SUIA 3N3AC 2BM0A 3LM8A 4IJUA 4JQZA 1QPBA 2OL4A 2PUHA 5AKYA 3RJ9A 3U9LA 1N25A 5J4VA 3CUVA 2WJVA 2B6NA 3RTGA 2AMLA 3L7LA 1YUMA 2VF5X 1OIWA 4QUEA 5AIAA 3WR5A 1TW2A 1HV8A 1MMFB 1X92A 4KQ2A 3OECA 4DJDC 2PQMA 3OOSA 3FPAA 4EY4A 2HNBA 1D1SA 2FQYA 2PZAA 1W0KA 2RIPA 5F3DA 4AJPA 3NM4A 1JH9A 2F2TA 5JH7B 5J1SB 2NU7A 2Q1UA 1E4VA 1RPTA 3N2KB 2WFMA 2UYOA 4N79A 2WT4A 5KPJA 3GYGA 5AKIA 2VHZA 1L2TA 3MWYW 2WV7A 5IW8A 3I04M 3TLJA 3HCBA 3WOHA 1L7XA 1NC3A 5TF4A 3SFVA 4TXHA 2OZKA 3TNYA 5EZYB 2XUOA 1S6YA 4I5FA 5CFOA 4EMBA 1RM5A 3WL7A 4B0PA 3HPRA 1YS2X 2ZRKA 1QYVA 3AHGA 3PXBA 4DJFC 2R6NA 4B43A 4E5MA 3NWJA 4LBVA 4N4ZA 4HWRA 3NBZC 1LLFA 1YU6A 4KSBA 3N05A 2H4XA 4EUSA 2D5CA