5EZSA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease inhibited by e64d
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Non-structural Protein 2 Cysteine Protease
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezsA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezsA01
10MHA 1UFKA 1G60A 4XUDA 2IBSA 2FHPA 3OE4A 4DQ0A 2FK7A 1YB2A 3KR0A 3TPZA 1KHHA 5FUBA 2BM8A 1SUSA 3NWBA 5DX1A 3UA3A 3FUTA 1BHJA 3CCFA 4EK9A 2G70A 2YQZA 5K0CA 3NDJA 3UBTA 3MERA 2KW5A 4AZWA 2BR3A 3F4KA 3M6XA 2QYOA 1TW3A 3E05A 4XUCA 4AX8A 5EC8A 4MWZA 3A26A 4POOA 2GS9A 3EGIA 1RJEA 3EVEA 4BLUA 5K01A 5K8VA 1JQ3A 4ER3A 1QAQA 1JG3A 3BKXA 1UIRA 2G72A 3DH0A 3MCTA 5FWDA 3DUWA 2BR5A 3R3HA 3PLAE 4CXMA 3M6WA 3OZSA 4E30A 1G55A 4YMGA 2Q41A 1XTPA 2P3QA 2ZWAA 4X41A 3P71T 3VC1A 2NXNA 1N7JA 1D2GA 1V39A 3KU1A 4Y2HA 2B3TA 2OBFA 3NTVA 3HM2A 3V8VA 2FRXA 1VE3A 4GC9A 5K0EA 2DPMA 3A7EA 4RYLA 4CTJA 2GLUA 4IKPA 3RW9A 1EIZA 1SQGA 1FBNA 4M37A 2YTZA 4YUVA 5GIOE 4FSDA 4LECA 4C05A 3QV2A 5CCBA 4PCLA 3OZRA 1XDUA 3TRKA 5G02A 2BH2A 1O9GA 2H00A 2IGTA 1TPYA 3Q7EA 1ORIA 5D1NA 5C1IA 4AUKA 4PYOA 4C03A 3PFGA 4FZVA 1ZQ9A 1OR8A 3IHTA 4PGGA 1KXZA 5LR6A 1NE2A 5DM0A 3HCAA 3G8AA 2AVDA 2ZBPA 1VL5A 2PLWA 2P7IA 3TFWA 1XVAA 3TQSA 1NKVA 3UJ9A 3UJDA 3A25A 5E9JA 5K05A 4F86A 3ER8A 2AOTB 2WK1A 4FSXA 4HRAA 2ADMA 3NJRA 2V74B 4PIMA 4U7PB 5FULA 2PXAA 5EGSA 5ICEA 5LQUA 1KIAA 1EG2A 1JQDA 4KIGA 3G8BA 1JSZA 3KQTA 4QTTB 5EHGA 2CL5A 3T7SA 2ZZNA 3FTCA 3HCBA 2YX1A 3KR1A 5EHIA 5B1SA 1QANA 5E8RA 2VDVE 3DMFA 1XJ5A 1RJFA 1JG1A 1KYWA 1NW7A 1R18A 3HCCA 3HNRA 3HVJA 3L8DA 3MTEA 2H1RA 2ZVJA 1WG8A 3LL7A 2QY6A 2P41A 3S68A 4YV1A 5EZQA 3KQYA 2I62A 5DT2A 2JHAA 2O06A 1I9GA 2AOXA 4M38A 3UJBA 5EOVA 4QVGA 3LECA 5HIKA 4RTPA 2GB4A 1SG9A 3KQQA 4QDKA 2P7HA 3UJ7A 2AN4A 3B7PA 3GJYA 3GIWA 3OFJA 3I64A 4RVDA 3E23A 3UJ8A 3HEMA 4PYJA 4GC5A 2Z6AA 3O7WA 3UZUA 7MHTA 5K03A 3AY0A 3DMGA 2UYCA 2PV0A 2ZTHA 3TM5A 3P2EA 4RTQA 5EEGA 2JG3A 2XBMA 4PYNA 1FPQA 3DXZA 3GRYA 4LG1A 1Y8CA 2XYQA 2OB1A 3AXTA 3AJDA 3MB5A 4OQDA 3JWJA 4X60A 1HMYA 3DMHA 5DRYA 1XXLA 5FCDA 4BP1A 2YXEA 4MTLA 2ZIGA 2AN5A 1FP2A 3P8ZA 1YFJA 3LKDA 3X0DA 2ZFUA 1EAMA 3BZBA 2AOWA 4RWZA 5DTQA 2IH5A 5BW4A 1XDSA 4PYQA 4R6XA 4KDRA 3P2KA 3P9IA 5FA8A 2G8NA 4R05A 5KVAA 3CC8A 4QPPA 3THRA 2CKDA 3ELUA 5IKMA 3JWGA 3BUSA 1EJ6A 5T67A 5E9WA 5FADA 3TMAA 5K0BA 2HMYB 3CGGA 2P3OA 1L3BA 3MQ2A 3OU6A 4FS8A 4DM3A 3A7DA 3MCZA 3O4FA 3RIEA 4P7JA 2AN3A 2BZGA 5LQJA 1Q0SA 1XDZA 3BKWA 3PFHA 2AOVA 2IPXA 4QVKA 4HSGA 3EGEA 3EVBA 1ZKDA 3P9KA 1NT2A 3KKZA 3I53A 2VZ9A 4QDJA 2O0LA 3FTFA 2PJDA 5E8JA 2Z6UA 2NXJA 1JG4A 3GNLA 5E1MA 3DXXA 3KR9A 1JSXA 5GWXA 5K09A 2YXLA 2YUIA 5FTWA 4CKCA 1KPIA 1RI3A 2ONYA 1WZNA 4X63A 3GRVA 1X1DA 3GO4A 3DULA 2P3LA 3DOUA 3TKAA 5JUWA 2ZLBA 2K4MA 2Y1WA 3R9XB 4RSRA 1G6Q1 3EEOA 2P8JA 3OFKA 5DSXA 4RTMA 3FPEA 2ORED 2PX4A 3HVKA 3VYWA 3OZTA 4K6MA 4PINA 1NV8A 5CM2Z 1YFLA 5CVVA 3I5UA 4RTJA 2CMHA 2OPBA 3A4TA 2NP6A 3FUWA 1L1EA 2IBTA 3LHDA 2PWPA 4HGYA 1F3LA 1VQ1A 3EVAA 4AZSA 3LX6A 4XCXA 4GOLD 2CWWA 1KPGA 1R8YA 3UJAA 3BGDA 2UYQA 3LGAA 5E1DA 4ATNA 5KS2A 4QPNA 5CVJA 5EVJA 1AF7A 3TLJA 2HNKA 2PSSA 3OE5A 4O29A 4RVGA 3SX0A 5K0FA 2NP7A 8MHTA 4GOOD 1IM8A 1X1CA 4MIKA 4YUXA 3FZGA 3IV6A 2QM3A 4E33A 3FRHA 3P2IA 2ZIEA 3GDHA 4FT2A 1IY9A 2OZVA 3SMQA 5CUQA 3LDUA 3GXOA 5DSTA 4RTNA 3FUUA 3LKZA 4KDCA 5DRTA 3VC2A 3VSEA 4C07A 5F2KA 4YV0A 5HEKA 5GIPE 5GINE 5CIYA 4BY9E 3C3PA 3THSA 1JR4A 2VDUE 3AWIA 1KR5A 3WSTA 5DTRA 5P8WA 5GP1A 3QOXA 3EVDA 2OXTA 4C4AA 3TKYA 2IDKA 3Q87B 2WA1A 5E2BA 2BM9A 4GUAA 3PX3A 2PVCA 2C7RA 2EX4A 2AS0A 2C7QA 4P58A 4HTFB 3ERCA 1NW5A 3G7UA 3KPVA 2IDJA 1RJDA 3T0IA 4RTRA 3EEYA 3DLCA 3G2MA 1R74A 3CJQA 3CKKA 3T7TA 4DCGA 3OPNA 1T43A 5H02A 4CTKA 4F84A 3NVKI 4Z2YA 3BGIA 1G8SA 2OYRA 2AVNA 2AOUA 3FTDA 3SGLA 1F38A 1BOOA 1L3IA 2XVMA 3BGVA 1M6YA 1TW2A 5K0NA 5DM4A 2HWKA 4EKIA 2YXDA 5EZSA 3HP7A 3LDGA 3B89A 5F2NA 1YZ3A 2VP3A 3B3FA 3IYLW 3B3JA 4AZVA 2PWYA 1QAOA 3ER9A 2NXCA 3PT9A 2XYRA 3GRZA 4PWYA 4ZTBA 2O57A 5F2OA 5LSAA 3O31A 3GWZA 5LQNA 3DTNA 1AQIA 4E2XA 1ZGJA 3ANXA 1L3CA 4C06A 3M4XA 2ZZMA 1SKMA 2EJTA 3P9CA 2EG5A 1VP3A 1H1DA 2B2CA 2E5WA 4EVIA 4HGZA 5CVUA 3C3YA 4CWAA 1P39A 4BP3A 3HCEA 2Y1XA 2I9KA 4DZRA 3LCVB 3GCZA 3LPMA 1DUSA 3UA4A 3KQSA 1JTEA 4HH4A 4RVFA 2AOUB 4OBXA 2H11A 5IH3A 5BW5A 5EQJB 4A6DA 4GQBA 5ERGB 1YUBA 3TR6A 3U81A 3K6RA 4CKBA 1N2XA 1WXWA 3C6MA 1XCJA 4YV2A 1VIDA 5GM1A 1QZZA 5C0OE 3KQOA 2HR1A 2R6ZA 1QYRA 1L9KA 1BKYA 2DULA 3DXYA 3EPPA 3FPHA 2XVAA 3ELYA 5DLYA 1NW3A 2XYVA 3ID6C 1ZGAA 4DKJA 1ZG3A 3P9NA 3UFBA 1EQAA 1QAMA 4GF5A 3R0QA 5K0GA 1NV9A 3LSTA 1VBFA 3A27A 3LBYA 2UYOA 2A14A 2ESRA 3OU7A 5DPMA 4E70A 3R6TA 2BR4A 2GH1A 3KR2A 3KPUA 1R8XA 2PKWA 1Z3CA 3G2OA 3MAGA 5FQNA 1PJZA 5EMMA 5HZMA 3M6VA 5K0JA 2PXCA 2GPYA 1M0EA 5EEHA 5DM1A 5E2AA 1P1CA 2I7CA 2OKCA 1IXKA 5LQCA 4QQNA 3BWMA 1P1BA 1ZHFA 3HTXA 1RJGA 1G38A 4DF3A 1DCTA 3C6KA 1NW6A 3E8SA 3EMDA 3G2QA 1WS6A 3KQVA 4G56A 1ORHA 4NECA 5HIJA 1INLA 3B5IA 5T64A 5EKUA 1I4WA 5CVDA 4HC4A 1FJXA 3UWPA 4B17A 4F85A 2EJUA 2IIPA 5LQRA 1FP1D 3KPJA 2QRVA 1HNNA 1YF3A 4V0RA 5LQKA 3E7PA 2HV9A 4LWOA 4PCAA 2WA2A 4JXJA 2B9EA 3KPYA 2ERCA 2LD4A 3HVIA 3BT7A 4PYIA 3B3GA 1O54A 2B78A 3KQWA 1I1NA 2FYTA 2ZW9A 5FWAA 3BWCA 3MTIA 5DX8A 5ICCA 1KPHA 3LCCA 5C9ZA 1RI4A 9MHTA 3AXSA 3FPGA 1DL5A 2I6GA 2JHCA 3NWEA 5FHQA 2PXXA 3FYCA 1O9HA 2ZZKA 2C7OA 2N47A 4IV8A 4YMHA 4ER6A 3MHTA 5DM2A 4X61A 5HFJA 2PT9A 1X1AA 2O05A 1WY7A 1X1BA 1SVUA 5EG5A 4RX1A 3G5TA 5FA5A 3EVCA 1XCLA 4OQEA 4WVLA 1KP9A 1D2CA 1B42A 3LCUA 5T6BA 3GRRA 4M36A 4U7TB 3SSNA 4YUWA 5KYGA 3G88A 5CVEA 3GGDA 4RTKA 3FTEA 2ZBRA 4FR0A 5DWQA 2ZCJA 1G8AA 3ME5A 4LWPA 2OB2A 1UWVA 4R6WA 3NDIA 4A6EA 4BLVA 4PNEA 5E9QA 1YZHA 3FPJA 1AQJA 1R00A 2UYHA 3FUVA 3IEIA 3DLIA 3LDFA 5BP7A 1EJ0A 4PIPA 4V0QA 3EVFA 5FHRA 5JR3A 5KQSA 4GOMD 4KRGA 2ZBQA 4GBED 3PTAA 2FCAA 2AOTA 4OA5A 3JWIA 1U2ZA 3GU3A 4KIFA 5DTMA 5E1OA 1N7IA 5EIWA 2AR0A 3EGVA 4MQ4A 2P35A 5DXAA 4GEKA 2PX8A 2YVLA 2NXEA 4YUZA 2P40A 1WXXA 4BLWA 2F8LA 4HTFA 3G2PA 5HIIA 2JH9A 3TM4A 3REOA 4OX9Y 1RI1A 5FQOA 1JQEA 2PGXA 2YR0A 3QOWA 2UZ4A 2PT6A 2R3SA 2G71A 3JWHA 4P7GA 3EVZA 3NVMB 4GOND 3PB3A 3SR4A 1MHTA 3NW9A 3R24A 4R8RA 3M33A 5DX0A 5ICGA 4OA8A 2ZULA 1VP9A 3MGGA 4PYMA 3HA7A 2AZTA 1SUIA 2JJQA 3P97A 1P91A 1D2HA 4C04A 5LQAA 4PYLA 3I9FA 3BXOA 2QE6A 4ER5A 2ONZA 2ZIFA 3G89A 3FPFA 5EIFA 5HIMA 3SSOA 2G1PA 3KQPA 3BWBA 2QRVB 3LBFA 4WXHA 3G5LA 5MHTA 3OCJA 5KQRA 5K0LA 1JTFA 3HA3A 4EMSA 3TOSA 1M6EX 3FUXA 4PGHA 3RODA 4ER0A 4KWCA 4DA4A 3CJTA 3GRUA 5EPEA 5EMKA 4X1OA 3SSMA 1Q0TA 1AV6A 4L7VA 2CMGA 3CJRA 5DXJA 3PX2A 1VLMA 3UJCA 2VDWA 5HOQA 5CCXA 3CBGA 1NW8A 2ZWVA 3KHKA 4P7KA 5D1HA 4M7RA 2O07A 4P7FA 1VPTA 3PVCA 4IV0A 4EQZA 5M5BA 4RTSA 2IH4A 4DCMA 1PRYA 2EFJA 2NYUA 3CVOA 4E2YA 5E1BA 5CD1A 4H0NA 3I58A 4E31A 3OU2A 4PONA 3HCDA 4QTUB 3ELDA 3KPWA 2PY6A 4KW7A 4DMGA 1SQFA 4C08A 2HTEA 1BC5A 3D2LA 1RI2A 4RVHA 1MJFA 2FK8A 2ZSUA 3DP7A 4RV9A 5GM2A 4AZTA 3C0KA 4E2ZA 5EMJA 3ELWA 4FP9A 4KVZA 4RTLA 3V97A 4XUEA 2IH2A 4YUYA 2JH8A 3EVGA 1NBIA 2P1DA 1KYZA 3H2BA 4QQKA 5U4XA 2GA9A 4ER7A 5BXYA 3EMBA 3HCFA 2PX2A 3SVZA 3NMUF 3DR5A 3M70A 3PS9A 3FYDA 5ICFA 4OBWA 3K0BA 4PYKA 2OO3A 5EMLA 3UJ6A 4RTOA 4MHTA 3SXJA 4UOEA 2JHPA 3FRIA 4FT4A 2GAFA 5GOZA 4CKEA 4EKGA 3KQMA 1JG2A 2PX5A 4FGZA 2NNWB 2OY0A 3BWYA 3T7RA 3M6UA 5HILA 3HVHA 1R6AA 1RI5A 2B25A 1NBHA 2IP2A 2FPOA 4IWNA 4R8SA 2Z6QA 4E2WA 2VS1A 3ORHA 4Y30A 2IFTA 4ISCA 5EKXA 2V7EA 2PBFA 3SM3A 4HG2A 2C7PA 3HA5A 4E32A 1X19A
chains in the Genus database with same CATH superfamily
4YC7A 3OJLA 1ZC4A 2QRHA 4YCAA 5IX8A 2LDBA 3Q5EA 1USUA 1Z8DA 4MZDA 1XJ0A 1IH8A 1UT8A 2I6XA 2WNIA 3EHEA 4D4IA 2GK6A 3WICA 3GLKA 4BP9A 3IEVA 3H9UA 4OM8A 5A7FA 3CCFA 1Q3TA 1T4BA 4MO2A 2WUEA 3BFJA 3HKDB 3PNBA 1QO0D 4EG5A 1B73A 3AHEA 3A1VA 1DX4A 4Z7OB 3R8XA 2RKBA 1RLMA 1R6DA 3F4KA 2XU1A 1YVBA 3RYHB 1XU7A 3UCFA 1HTTA 1NI3A 3F5DA 1JLLA 4POOA 3H6HA 3RHFA 1SVKA 5JH7A 1EA7A 3ZGLA 2MYNA 4NAHA 4EECA 1D4FA 4I5DA 1OXTA 3PEEA 1P1IA 5E6UB 2JAOA 2JBHA 5HCUA 1J2RA 2XUZA 3B6JA 5IPFA 4E30A 1XRRA 4DUZB 4X90A 4WY5A 2ERXA 2P3QA 4E2YA 5CB4F 1XKGA 3W2IA 1OXXK 3A3YA 4HDMB 5I7FA 3VC1A 1N7JA 4FKMA 5T4HA 3V2IA 3WLQA 1QFXA 4BNGA 1DWPA 2L82A 2GF2A 1MAHA 5IAGA 4GLOA 2WVAA 3WOHA 1JB1A 2B8NA 1CHNA 2FW0A 2DWPA 4FIDA 2ES4A 5LA6A 1S0UA 3HS3A 2WBFX 3KHUA 5FAXA 2YMQA 4MCIA 3L0BA 1DTEA 5CLJA 4C2AA 4JQCA 5D1NA 2QU7A 3OQBA 4K46A 1MC4A 3FOBA 2FFQA 1TGYA 4YTEA 3IKVA 3X1DA 4ML3A 4D56A 4RKEA 1E9CA 3GJ6A 3HZRA 3JXEA 4DCSA 1FF9A 5KWJA 1Y9JA 2OBXA 1NE2A 1SCQA 3W4IA 1GL7A 4TRRA 2FN8A 2ZBPA 4Z4FA 1SCKA 1USGA 1KKMA 2ODBA 5A7HA 2IUSA 3DEAA 1FFXB 1A5SB 1IEVA 1SVIA 3AR8A 3W5IA 4CETA 2BUCA 4PZLA 3EXIA 3S3RA 1UMDB 4C0SA 3U3XA 1CFJA 1NC1A 4WFQA 5EGSA 4B31A 4FJ1A 4D41A 3N6XA 1EG2A 3K0AA 3G82C 1JXMA 3GEHA 2ZBVA 5IJ9A 3BGOS 3CE9A 1MJGA 1AGXA 1V1RB 4Z4GA 3UO8B 5KOHB 1HNWB 5DNAA 2JJ1A 3T9CA 4HCJA 1DXHA 2YS6A 2ZJYA 1NVKA 2OCXA 3KKOA 1W6UA 3KZKA 1PL6A 3MQ4A 3QWFA 4YMSA 2X2OA 4QU0A 4CM1A 4DYVA 1EX6A 2C57A 4O4LB 3GDGA 1BGOA 1KEEB 2G8EA 3K05A 1A8HA 1BSVA 3FROA 3Q9LA 3LL7A 4IO1A 1R0WA 5AKLA 3R7NA 1FFBA 4BWFB 4PP2E 4R0MA 3ZS9A 3U1TA 2FT2A 4HATA 4OXQA 4KFCA 3OZBA 2OQVA 2RKOA 3UBMA 4X6YA 4BC0A 3KSBC 3WO1A 2GB4A 4GBJA 3T1QA 2JCVA 1NDHA 1F12A 1JJIA 4I50A 5DU2A 4BV8A 3GIWA 2TYSB 2BCEA 1D5CA 4AXXA 1E2DA 1KAHA 2P2SA 2RI6A 2G88A 2XV1A 3Q0IA 3RTCA 4G0VA 2DJFB 2X5NA 4MZXA 1T3HA 1UFVA 2CL0X 4TS1A 5E6SA 1O77A 5KHLB 5KINB 3O9MA 5JBQA 1QLHA 1CY4A 3M5WA 1PUIA 2DR3A 3D8SA 4OYYA 4US0R 4RTQA 3EX7C 3WIDA 1JIIA 3DXZA 3IELA 3PQ6A 2DTXA 2FE4A 2B4RO 1G3IA 3WLKX 3MB5A 4KI7A 3ABIA 2VJCA 2J3MA 2BMDA 1JE0A 3ZEIA 1MX1A 4QE3A 3WYDA 1A04A 1W0CA 3CWZA 1H0RA 1YFJA 1QRDA 3M4JA 2FWIA 2BT4A 3K0EA 5H1YA 4ESOA 1JMKC 2HHAA 1V2HE 4M1YA 4B6GA 3NBYC 3NOOA 4QXPA 3TE6A 1KHTA 1T9BA 4MI6A 3TW0A 1YB4A 1Q0QA 4OPMA 1HXHA 4P4TA 4ASUD 2BTQB 5FORA 1P2TA 3H5VA 3O8BA 1YRHA 5F5LA 1E64A 4OQYA 4QM7A 3J81A 1M8GA 4LYDA 3Q5DA 3N2LA 2JASA 3IERA 1AN0A 4RLFA 3RSHA 1IZ9A 3BQMB 3OX4A 3RS8A 1KJQA 4MUAA 4WZAA 2IPXA 3UXYA 1PCXA 1VKNA 3KUXA 3JX9A 2JA2A 1OXBB 5KBYA 4TTVA 4FZ5A 1MO4A 3CR7A 2QSZA 4DMXA 4DE5A 1X9HA 2E48A 1UEIA 3R7LA 3N2GA 1HQKA 4MRNA 1FNDA 5AQ1A 2XF2A 1M34B 3KR9A 4J0IA 5DLDA 5K09A 1D6JA 2YUIA 2JGRA 4Y6LA 3V6LA 4Y9RA 3ZD7A 2ECKA 4IXTA 4ENSA 1ULZA 5ICMA 3EXHC 1E63A 1S3FA 4LTNA 2JW5A 2VJDA 4F97A 5IJ0A 1PW5A 1N36B 2P11A 3MTVA 4BOSA 1DUVG 3G8CA 2CNBA 3KJXA 4CM4A 4DEYA 1U3TA 3L6EA 3OFKA 2DG2A 4CFSA 1VKJA 1XA3A 2IZZA 2FETA 3B1VA 3HVKA 4PINA 5IDYA 1K7FB 3JWPA 4LXGA 4Q18A 4DMMA 2PA3A 4MGHA 4F2PA 2FWBA 2DWCA 2J5BA 3CO0S 4KQ9A 4YMIA 4BO0A 5HK9A 2VTBA 1UWCA 2WM3A 2XX3A 3DOCA 3F90A 3INRA 4PM4A 2R00C 3L06A 4LRSB 4YFVA 2CLFB 4JSYA 3HVRA 1CEYA 3TIFA 1V9SA 3ZE7A 2ZBGA 2ATOA 1RBYA 4LV6A 4PC3A 2YQ4A 4Z4HA 2IOQA 3UJAA 1D1SA 4R2JA 2FUNB 4NCHA 4NG4A 5FYQA 3IDOA 1OLUA 3MWKA 4MVJF 4IX1A 2HNKA 4KITB 3BICA 1XAGA 2QZ4A 4OYLA 1B2RA 1CK4A 4AWAA 1MBZA 1MIHA 2ZSHA 3V4RA 4F11A 2HSEA 2NYVA 3AUAA 3BIWA 3GP8A 4MS3A 1O97D 5KYYB 1E2PA 1JMVA 2ECOA 4Q05A 1EK6A 2EOAA 5TE9A 5MN6A 5CIYA 2DLDA 2Y77A 3CZPA 1HFEL 2Z1NA 3C3PA 3NH6A 4N7JA 1BEZA 2MYTA 3VVMA 5JXJA 1FYEA 3FETA 1IOLA 1JQJC 1YZUA 2OV8A 2PSDA 2W6OA 3WLOA 5PADA 3WHIA 2QR5A 1X0VA 2DPGA 3GCDA 3QOXA 1MO2A 4BUJA 2ASVA 1QV7A 1V4VA 4XQCA 2ZB3A 3NANA 3L4BA 4D3ZA 4NXNB 3SYLA 5CDSA 2NO9A 1MOZA 1IWOA 1BO6A 4RZ3A 2VDJA 3TCXB 1COZA 1JIXA 1VIAA 4O3MA 1WU8A 4JUFA 1DBSA 5AHRA 4BLPA 2L18A 3QBDA 1YMUA 4ZZ1A 2AD5A 4BKRA 3A1DA 1X8JA 5FI0B 1W0JA 4NZNA 1JFFB 2FTDA 1C7EA 5K4GA 1ITOA 4QQRA 5A1JA 4OL0A 2FFJA 1L7RA 4IJQA 4B7AA 3UK6A 3O03A 3SGLA 1Y8AA 3P5SA 3U5TA 1QUEA 5T3YA 1C4OA 4XQ9A 5DNDA 1L4NA 2WMNB 1TVKA 2OV2A 5DM4A 3A3PA 3PFBA 4L3OA 3CH3X 4WK4B 3IUMA 3QU9A 2PWYA 3B38A 2BMAA 3KOWA 1A8UA 2XYRA 4BNHA 1XZLA 4FE3A 2D5BA 3FNIA 4RKFA 3AETB 2IXEA 1QH8A 2FGJA 4A2PA 1V25A 2WF9A 1XMIA 3TZQA 3M89A 1U3VA 2ZT8A 3DTNA 4LJ7A 5LIRA 3HXKA 3KKNA 2R6AA 1GUAA 3DSRA 2VKTA 1ZMOA 1S3SA 3JV7A 3M4XA 4BKUA 2ZZMA 4A36A 1LW6E 2Q62A 1ZZEA 4ONEA 3MP2A 1XRJA 4MEBA 1M0TA 3HUTA 5DIZA 1US8B 3FBTA 3GMDA 2ZUUA 1SU6A 4G0QA 4M3NA 3D8RA 1JIJA 1ZUNA 1DUSA 3GCZA 3KKMA 4GXQA 4K6KA 1BMTA 1DEUA 3OT1A 2IZ6A 1UKFA 1FFDA 1ZSYA 5ERGB 1J2UA 1OYVA 1YUBA 2QE7A 1ZXXA 3EXAA 4MAFA 1Z7YA 5A62A 2IF2A 1O8BA 2CUKA 2DMRA 1JFVA 1V5FA 4GL2A 3PYXA 4K28A 4KFTA 1LXCA 3DXYA 4EP1A 4DR3B 2X86A 2C2WA 1MX3A 4CMEA 2PBRA 3ID6C 3PGXA 2J5QA 3QK7A 4OV6B 1JWBB 1RPTA 2X3YA 4HWPA 2VEOA 1R6XA 1JHMA 1HF3A 1PJ3A 5CA1F 2AG5A 3QUTA 2E37A 1FFXA 3PPXA 2YS7A 2ZRDA 4Q3LA 2IYSA 3R6TA 5BWLA 4M1MA 1R8XA 1TM2A 1Z3CA 2HRRA 1GGEA 2PKWA 3AG6A 3AR9A 3NBFA 4OI2A 4Q24A 3LX8A 3LZDA 1V47A 1Z6ZA 2IPPB 1M0EA 2J9YB 4CDDB 4XPIA 5EE3A 3PC6A 1ZD8A 3DV0B 1Z6PA 4ALLA 2LP4Y 2NADA 4H6PA 4HEHA 4CLOA 1RWWA 1VSVA 3WG9A 4NFHA 1EDEA 3JQCA 3G5UA 4B3JA 1D7AA 1IBKB 4YALA 2C3OA 2PLAA 1N0IA 3C43A 3OTGA 3W2TA 2PUFA 1W2GA 4CN9A 4O4LA 4ZQEA 3O7MA 4HC4A 3GFQA 4E5SA 4HYEA 1LKZA 5AKHA 3U1VA 2RGWA 4GX0A 3UJPA 2YICA 4Y2QA 3BXHA 4IKOA 5CNIA 5KJ1A 3BF7A 2QWXA 3O8RA 1K97A 2HV9A 2V45A 1RXUA 3LHIA 2WA2A 3NHJA 1QZUA 4GWGA 1Y3BE 3I1YA 2BZ0A 4L28A 4QPCA 5B57C 5K99A 3O1GA 1S7GA 5FKJA 4BWGA 1UODA 3RASA 2WMDA 4YLGA 1ME4A 4TMTA 5JV5A 1Z0ZA 3QWBA 5LYJB 2WLSA 3BWCA 5JNVA 1KXRA 3GK3A 3L4SO 3Q12A 4NICA 2WTBA 4YCCA 1ZM7A 3IAS1 5JZVA 3Q6IA 3JQBC 3IT2A 1D9ZA 2YVKA 4ZDIA 3K5IA 4IV8A 2DF8A 5KNDD 1YT7A 3GRAA 2HPVA 2DPXA 2X6RA 4KQKA 1WVIA 1L8LA 3EXG1 1IUPA 1SKBA 2P4UA 1P0FA 3LTEA 2L0XA 2O2EA 1X1BA 3NFRA 2I4OA 2QM7A 3DZKA 4A10A 4MWTA 5FA5A 4HAIA 1FH0A 2CEAA 2OQRA 1VLJA 4HGQA 4PZPA 5JCOC 1GUFA 3GRRA 4YUWA 3THYA 2DRIA 3RPEA 3CNQS 1H9BA 4MOWA 2J6CA 4I0WB 4PLHA 2BONA 4DJJA 3T9AA 1Q6ZA 5JNSA 1O6CA 1YZKA 4AU1A 1TU3A 4NBLA 3TLXA 4KQHA 3MS7A 1RC8A 1SCBA 2F43B 3WWYA 1EU1A 2QVCA 2X2FA 3SKVA 2V7UA 1FMJA 3UATA 2IL1A 1SC6A 4ES6A 1U1FA 5J1SB 1HYGA 3AEXA 1UFOA 4FLFA 2XDYA 4HAUA 4H7DA 4PZYA 3X1XA 1YGYA 3NAQA 5COAA 4J0EA 4QBKA 3TCKA 1W4CA 4FGJA 5DTMA 1YKSA 4PTZA 2PO5A 2P5UA 3SF8B 4EHJA 3TQRA 2IT1A 4RMHA 2IEAA 3H1GA 3T15A 2G5PA 4MUHA 2YJGA 2W2KB 4H60A 2YVLA 3ZU5A 1E2JA 3FWNA 3DMTA 1RQLA 2E87A 2TMYA 2Y93A 4YA6A 1Z0AA 5DIFA 1BQ3A 3WB9A 2G7YA 1POWA 2JH9A 1A9ZA 3K70B 5ILOA 1PFWA 1IONA 5B58T 3MT7A 4ZEXA 3ZHBA 3GFGA 4MQFB 5A3JA 3PB3A 4XQ0A 4R8VA 3SR4A 2WIKA 4BNJA 4NMLA 5HM6A 5GAJA 4CGYA 3VR2A 2E7ZA 2VYQA 5KTOA 2O8EB 4DTIA 3Q6MA 3LH5A 3WY9A 2VLIA 2JJQA 4IGIA 4ED9A 1TK3A 4BX0A 3R09A 1KK2A 3ZE6A 1EKXA 5GZ1A 1JAXA 2CYBA 2OEPA 2FG6C 3CONA 4JFRA 2PS1A 4R1SA 5DO9A 2F6RA 3PI7A 3UTDA 3R3SA 4WCDA 3LFHA 1AG9A 3OUZA 2JQFR 3U4IA 1AUQA 4BVFA 1ESEA 3ADDA 2P2NA 2BGNA 2O6LA 4BC1A 1L1RA 2R86A 5EPEA 1FDRA 5KJ6A 3DF7A 1Y3AA 1KFXL 5IK2A 2VDWA 2ZGVA 2PQ2A 4RDHA 2W58A 5CPFA 3CBGA 3H42B 1G5FA 3FF1A 4IJWA 3E58A 4OHRA 2QX8A 1Q17A 2RC6A 3WDMA 2VQFB 2HYIC 1QFJA 4UNIA 2E5LB 4NOMA 1DFGA 3W30A 3HC7A 4ND1A 2PANA 1BMFA 2QN6A 2ZIXA 1IWBB 4BXOB 2J6BA 4H1UA 5BOSA 2ZBDA 5AVSA 1X7WA 1X38A 1SBHA 3A3NA 1P5ZB 1V7PC 2GLXA 2BFBB 4YRIA 1JHDA 2AX3A 2NZXA 1SQFA 2QU8A 1XL1A 3D2LA 4HDOB 3VR3D 3GFRA 2DFVA 1EI9A 2FK8A 2WTNA 2ZRHA 1ADBA 1LWOA 1ZRSA 3MYRA 4HEQA 4D4GA 9ABPA 1NWCA 2QQEA 5HHTA 3JQ8B 4M2LA 1I2CA 3L77A 4L8WB 4WJKB 4P83A 1VHDA 3TAHA 1ZAYA 2XDQA 1W29A 1HEIA 2FVYA 4FFOA 3N8DA 1E5VA 4IVRA 3IIMA 4W5HA 5H82A 1X1TA 2I3BA 4BNVA 5KNDA 2IUEA 1FXSA 1OX5A 3LF1A 1MKYA 3BGWA 2PH1A 1MVOA 1YV9A 3MSCA 4L75A 4EHIA 5C4IA 2RH4A 2VK8A 2HSZA 2HWUA 5DOVA 3H2SA 3O4VA 4RSMA 2PX5A 1BXZA 1KARA 3O4JA 4EUEA 1YQGA 3FHLA 1R4NA 4GFDA 2IYYA 2WHPA 4NDAA 3HV2A 1GKUB 4F3KA 1SKQA 2VQ3A 4MW5A 3CUEF 1GZ3A 2H4XA 2PBFA 5EZ6B 1XKTA 4DQLA 3QEBZ 2YFYA 4J16C 1J42A 2IEIA 5GQSA 1FIUA 5I5EA 1KH3A 3EF0A 3I2KA 2A3RA 1I0ZA 4B6PA 3HDJA 1KZGB 4P7BA 4DHWA 2E89A 1OIWA 1NZFA 1K0UA 3EGXA 4J7XA 1CUGA 5A9RA 2BM8A 2CYAA 1F3OA 1YI0A 3AK4A 4EARA 5U9CA 1PVVA 2PUHA 4FN5A 1ZOPA 3QUCA 1D2EA 4L85A 4OUDB 4CR8A 3S2UA 4DSNA 1A77A 1ZLXA 2YNMD 4PXAA 1WLSA 1MV8A 1KORA 2QD3A 3RSSA 4YJ3A 2WKQA 5J59A 2D4AA 4Z49A 1DADA 1UC4B 2PIDA 4TLAA 4MWZA 1L7PA 3Q9SA 3JW8A 1C8BA 2H8GA 3U13A 3G17A 2ZSAA 5JS2A 4O2AA 1PTKA 1ODLA 2Y2VA 5A02A 4FOPA 4FTWA 1QGUB 2H65A 3P9SA 5CHYA 3TLCA 4DLRA 2O8BA 3CG0A 3DZ8A 1I5EA 2NQ8A 1RVDA 2Q1WA 4RH0A 3B9BA 1WKBA 3P2YA 2MMGA 3X2EA 3AUYA 2OM2A 4AC9A 1SG6A 2P4HX 1CZLA 2QRPA 1O97C 2ZJAA 3MTJA 4HNAB 3ANTA 2PKXA 3AEUB 4EPYA 4JZKA 2F43A 4DB2A 2PT5A 3V42A 1ITZA 2X1VA 3OWOA 2GJSA 4IOJA 4B6RA 3U3RA 1NQXA 1SQGA 1XX6A 4I1VA 1WCIB 1Z82A 4W4TA 3LW7A 3DXFA 1C8LA 1MJ5A 3AW8A 3EH2A 5CXQA 3GEPA 3I28A 4KB5A 3TRDA 5C1IA 3F4LA 4AUKA 4D45A 4E2WA 3ESDA 1EZ1A 4MWCA 4EFLA 3WBKA 1H6AA 3S8EA 1ZP6A 1OR8A 3HNPA 1L4YA 1P2BA 3E9RA 2BSAA 1M67A 1TZBA 2FJPA 4LN1A 4N40A 1ORWA 1JFRA 2R8RA 1ZICA 4R4JA 3U3DA 5A0TA 5LWQA 4JI3B 1RKQA 3GCGA 1NF9A 1NKVA 2WFLA 5AI0A 5FD8A 3UWMA 1IHPA 4AMYA 2ZS9A 3HU2A 3MCUA 3GJRA 3MF4A 3RBVA 5K6RA 2UUAB 3M5DA 3HADA 3P2JA 3E61A 5LYJA 3SS7X 1XNRB 2PGOA 1F7VA 2CMKA 4HHEA 4E07A 1MFPA 4PFKA 1FS5A 2ZE6A 2NVWA 1U63A 1JQDA 3L9XA 4YYEA 3EA4A 5EHGA 1XVIA 3LUHA 4KVGA 3KR1A 1TYEB 4CM4B 3ZXYA 1H2EA 2IITA 3HBNA 1YQQA 4UBKA 1W44A 2R6R1 1JFFA 3E5RA 5K0TA 1H6DA 5HW0A 4UFPA 1U7TA 5FWXB 1Q0PA 1T5LA 1J7KA 4L6CA 4G0OA 3PX7A 3NEAA 5A2QA 3AJEA 4Y9SA 3DUFA 1AK1A 1NASA 2JIMA 5ALZA 2HA5A 3ZXSA 2CT8A 1TVCA 3C7DB 2PR7A 3MCWA 3OQJA 1UPBA 3PHXA 3VBEA 1Q22A 2WDPA 5L6MB 2ZWOA 3AETA 2IPOA 3H7AA 1JEDA 4NBVA 4CDCB 3PFNA 1C1XA 1T5BA 2GZ3A 2I99A 3HO6A 4GC5A 4MMYB 4NJMB 1XP8A 5D01A 3U17A 4WECA 2Z6AA 4BE4A 1BDBA 1RCTE 3VPSA 3AY0A 4RY8A 4XR4A 4B74A 1GYQA 2VR1A 1ETUA 1V2GA 2X5JO 2CD7A 2X2EA 2ZIXB 1MRSA 1ZQ1A 2HRCA 3E3NA 5EXEA 1UFQA 4M9QA 4BOPA 4LG1A 2J09A 2HSWA 3GVPA 1JEAA 4II2A 1ZOSA 3IR5A 4ITUA 1UPUA 4P4SA 1ZIDA 4BQOA 1RQRA 3O94A 1QP4A 4MTLA 3SBXA 4HQFA 1YRBA 3V6EA 3U3OA 1DKRA 1MEJA 2EGGA 3LKDA 2A9KA 3FXAA 4N5DA 4X94A 3VJKA 5C7YA 2ZFUA 3LFYA 5JTTA 1AVTA 1PFQA 2DSNA 4MRRA 1HLFA 4E7OA 3HPQA 2GXQA 4R6XA 5DGDA 3TX2A 1A72A 1QVVA 3CGWA 1KDOA 5BV7A 4DCOA 4B2YA 4PP1A 3TOCA 2L19A 4MR7B 1V16B 1J0XO 4U0KA 4JR2A 1SUDA 2P3OA 2P2LA 3LP8A 4B44A 3HV0A 4M1KA 3WXEA 3W05A 3OQIA 1LLCA 1KQGA 4TTAA 1IQUA 1HQYE 1PF7E 2B2NA 3TTUA 3REGA 3EGEA 1LPSA 2GN8A 1S2NA 4A5SA 1PJ4A 1PNRA 2IYTA 2P79A 1PG5A 1WMSA 4EBBA 3RCBA 2ONKA 1YB1A 4CIAA 4DYDA 1ZUIA 2XOKD 2BDUA 3OMXA 4QOHA 1P60A 5KYWA 1G291 1TAGA 4QGGA 2C3MA 2KBEA 1SURA 3GT4A 3PNQA 2I3GA 3GVCA 4X63A 3PENA 3P4UA 5JPDA 4BYMA 4P8RA 1WABA 4WEQA 1SB8A 1K3BB 3K5PA 1CHDA 5F35A 4E15A 2MR6A 3WXMA 2GN0A 1Z8HA 3FNFA 1UJ5A 3CYFA 2OCAA 1TZJA 4RSRA 3IOMA 3AVOA 2MSDB 3M3PA 3VBCA 2FQXA 1QRRA 3DB2A 4K8OA 5KCMA 2IV7A 4B79A 2PX4A 1JTVA 1TFUA 2VH5R 4KXNA 4WZBA 5CM2Z 3IUBA 1HYEA 4TS9A 4B46A 1X7WB 4EM6A 2LXNA 5AYVA 1JLMA 1H2AS 4UNNA 1VGVA 2IX9A 4D0LB 3QU7A 4CLDA 5A4FS 4DB4A 2JTCA 2IEBA 1CERA 4HGYA 4LXIA 4OGWA 4AZSA 4QT4A 4YDQA 1VPEA 4ISBA 4CIXA 2PNFA 4L9RA 1M72A 5EWJB 3BGDA 1GTZA 2J3LA 1FUKA 1LD3A 2X0NA 3PHBE 5EIHA 1NRJB 4QPNA 4A0SA 3AIIA 3PQDA 3QHQA 1HV8A 4GQAA 3OC0A 4MV8A 4BVLA 4EL5A 1O0SA 4AY5A 3BMQB 2GUGA 1E79D 3THYB 2HBZA 4KYVA 5KYTA 3FZGA 1J25A 5CU7A 1EK5A 1UP6A 2WFZA 1ZD3A 2A5JA 4D92A 1TMGE 3THWB 2MSWA 3T1NA 1TJYA 4GX1A 4KCGA 4JR1A 2C2KA 4JB0A 3R74A 5HTKA 1RQNA 1PR3A 5DSTA 1NQVA 1UMBB 2FPRA 3C39A 3FUUA 3LKZA 5G0SA 4BLQA 5GINE 4EHKA 3U4QA 1NYQA 2V0GA 2ZS8A 3AWIA 5EF4A 3STHA 2VSXA 1KR5A 5CFZA 5JMWA 1OWNA 1Z22A 3BXZA 3JD2A 3RKUA 4IY1A 1NZDA 3KX1A 3EWIA 2GPSA 1ADFA 2V6JA 3OPXA 3V48A 5JNWA 3RUDA 3I8SA 1XCPA 2BM9A 3KVNA 4PV7A 2V6BA 3M5CA 4JI5B 4Y0NA 1ECCA 1T2AA 3R7BA 1W6RA 5IKPA 2VP0A 3W1EA 2DU8A 2V5VA 1Z68A 2Q7XA 2PFKA 1XLWA 4WUVA 3U4HA 3BG5A 5A6VA 3U7FB 4LPKA 3MIZA 3E8XA 4HFMA 4EB6B 2C07A 2I7XA 2UYGA 2XKBA 2VPTA 2DFPA 3RKRA 1TO2E 2AOUA 1DI0A 1NHGA 3UCEA 2G1JA 3TN7A 4UVGA 1M6YA 4UHHA 5LKRA 4YJFB 4JJFA 3IEPA 4MP8A 5F2NA 2I7TA 4AS2A 1MGOA 2VP3A 1QYXA 3JCZA 4E7PA 5EJEA 3S28A 3NGMA 3V2HA 1ZMTA 2HBQA 2NXCA 4DHEA 4JXXA 1G63A 4QELA 1QPZA 4M1QA 1KGDA 1J8FA 3IKJA 4N7BA 1UADA 4YN3A 2J45A 1UZLA 4RBNA 4H9GA 5JH3A 1YXMA 2C9OA 2BEKA 5H81A 5KOYA 1EZZA 1J1UA 1P61B 1U8TA 4WLOA 1ZYUA 4AXBA 2BHSA 1BYIA 1BX1A 4E6PA 4BGDA 1N1MA 2QHXA 1DDGA 2O1WA 3W78A 2W71A 3HP4A 1CUZA 1BQIA 3QF4A 4A6XA 1HRDA 1KERA 5C8VA 3DZDA 1SJ9A 1QC5A 4AJPA 1JHZA 1EBUA 4FZRA 2O2CA 3MRSA 5IT5A 2YC4C 3AM1A 4R54A 4HX9A 2EHJA 2XTJA 4U5XA 3HI6A 3ETEA 1LX7A 3S3QA 4D5GA 1LTHR 2JKYA 4JNCA 2RK6A 4N01A 4JOSA 1QHYA 3WL6A 4ZO4A 1G3RA 1L9KA 3ETCA 1VSTA 4QQ8A 3TNJA 1U28C 3E8MA 5CBKA 1E3MA 2Q0HA 1LBQA 3ENWA 1DXQA 2OO7A 3GUVA 2R6GA 3HXMA 3WYNA 3BBAA 4DV0B 2EIXA 4RH1A 5LZ9A 4OX9B 2P27A 3ZZ1A 1P7YA 5BSVA 1GNRA 3R0QA 4JT9A 2E03A 1VBFA 3NG1A 2EGUA 5LOVA 4X6HA 4G1CA 2A14A 2G6TA 4PO1A 1CVLA 2JAUA 1FNCA 4JLUA 1EB9A 2CLMB 4FIPA 2PX0A 4E5VA 1NVBA 3SBDA 3ZDFA 7AT1A 4DA7A 3M6VA 3ESXA 4GSLA 1PAUA 3L43A 1PBNA 5E2AA 2R9CA 5FX2A 4QQNA 5G4KA 1UL1X 3O1JC 3T7DA 4EHNA 2TMGA 3REFA 1JWLA 2VO1A 4E13A 2ZK7A 2X4IA 3C41J 3FBGA 1NW6A 4NECA 4J2TA 4WZ6A 1NM5C 2IHYA 3UFXB 3W4JA 5KQGA 5JSHA 3ZY2A 4C4SA 1KBZA 1WXGA 1DJQA 5IC5A 1KSJA 1N5IA 2JFHA 1N8TA 3C3AA 3DS8A 4DW8A 3F73A 2JHFA 3M83A 1Y8RA 1E4YA 3HL0A 3LX5A 4O0MA 1HNNA 4CU2A 1OH7A 2XXAA 1FYVA 4N5NA 1TCBA 2JAQA 3LHKA 4G86A 1UZNA 4RVSA 4DA0A 2P1ZA 3H0EA 1S5PA 4PYIA 4A8TA 2B78A 2UVDA 2VOJA 4NHOA 5DX8A 2SCUA 2XWBF 2IZOA 2WJHA 4AP5A 4E3WA 1OFVA 3IBYA 5ALHA 1EFPB 2H16A 2FZWA 2NACA 1DL5A 1NMQA 4G5QA 5LNK1 4CQMA 1P4SA 4NNJA 2VL7A 3BRQA 3D31A 1CUWA 2YV4A 4AAYA 1AGRA 1OIVA 4PBTA 3IUYA 2HA4A 5ADUS 1QQTA 2F00A 3JU3A 1NF8A 1JSRA 4N9QA 5JS7A 1ZRMA 2B8WA 2ODTX 3NBZC 1F2UA 1AIMA 1PPDA 1LC0A 2ODEA 2W6MA 3C5HA 3GRFA 2W6NA 4MUJA 4KR6A 4O4LF 3EAFA 1JLKA 1CDOA 2G3YA 3K9BA 2BYTA 1YH3A 3NTOA 1NBAA 2XMQA 2XPCA 1N6RA 2NNLD 4OFXA 5F1KA 3R6LA 4HWTA 4BLVA 4HB2A 2MWMA 1XLUA 4PNEA 1K8ZB 1XMOB 2VNIA 3KOZA 2C9ZA 4JD5A 3S1AA 3QZUA 3QU5A 3E3MA 1VLZA 4R7ZA 4W6QA 4XM2A 1MMFB 3ZHOA 2DQ4A 1OFUX 1UXJA 1KO4A 1JDZA 4YYWA 1SKYE 2GVNA 4ZA2A 1KOGA 4KIFA 4CQLA 3U56A 1XROA 4ZV4A 5AW0A 1E1CA 4ME6A 3QYFA 4WA8A 4BL5A 1GFIA 4AY6A 3EOAI 1G9SA 2G82A 1BXRA 2DCMA 3F1KA 1P0PA 2R8BA 4OU4A 4X8HA 4Y3UA 1I7PA 2P40A 1WXXA 1IBMB 3C3EA 4OI0A 2EKZA 3V7WA 3ZX5A 5FPHA 3MORA 1QZXA 1THGA 4KMOA 2YY6A 1J9GA 4E09A 2AEJA 3I3OA 1XHFA 2R1TA 3FUCA 1LQTA 4M0UA 4X8LA 3IQXA 2Z5LA 1IG0A 1MOPA 2O7QA 4XGRA 4JT2A 4D8XA 3QEAZ 1SZPA 3K30A 2IY9A 3QGMA 4ZO8A 3RK0A 1GUDA 2C20A 3QY9A 1FX0A 2JARA 2XVZA 2YV5A 3IESA 4G84A 3A11A 3BEDA 4MKIA 4OK6A 3BTVA 4XZ3A 3ZWDA 4XGNA 4CDGA 4DMHA 3J81k 3OCVA 2F3RA 2PLNA 4P53A 3KALA 5FO1A 5UKDA 1MXHA 2G7MC 5LFAA 1RHKA 3UY4A 4MJXA 4YJGA 2BSQA 4Z9AA 2XGOA 4L15A 2HLDA 3VRHA 5EJFA 4B34A 4HX2A 4AWBA 5H70A 4C4OA 2WZQA 4JITA 4QLOA 4D80A 3CO5A 5KTKA 3GWGA 2WJJA 2B1GA 5KQRA 3I9V1 3L3BA 4B2IA 2YW2A 3QFHA 3HKDA 4K9NA 3VKVA 4KNVA 4URZR 1V7QA 3OQPA 2Z43A 4EKYA 3RTAA 3ZX4A 5JW6A 2YY7A 5FWXA 4D46A 3ZVNA 2R9NA 1DG1G 5CDFA 5TDHA 3O0TA 5L3RA 2BU3A 1DEAA 4TYYA 1TTPB 1WULS 1YS2X 1FRFS 2QD1A 2WDZA 4I4LA 3WGIA 3ZQ6A 1UJ6A 2BEVB 1GPH1 2K5UA 5D1HA 2RK4A 1Z62A 4IV0A 1OVGA 2NU9A 1DFHA 2QNRA 1E3TA 2HPHA 1E6LA 1QC5B 2PD3A 4YEDA 2G7ZA 1O3YA 2NYUA 2WUGA 3H84A 1TYZA 5HS6A 1F8FA 3SN6A 1EP2B 3X44A 1CPYA 2BSXA 4O5AA 2WUFA 5T41A 1VHTA 1AQYA 1CPJA 1EVZA 3OIUA 4FQ7A 3PGLA 2KHZA 3LZ6A 4MPPA 4R0VA 4KW7A 3WIVA 2GF0A 3K2BA 1I6LA 3AVTA 1T5OA 2HTEA 2IUYA 3DB1A 3DDNA 2D1QA 4ZCPA 4ETNA 4YUYA 1CXZA 2ZPAA 2GN1A 2MIIA 4QUKA 4KSCA 4UE6A 3U19A 3PPWA 3DVAB 1E7SA 1G8FA 1A50B 1PSZA 2PX2A 3SVZA 3KLMX 3EDQA 1KJNA 4NV1A 3B5EA 3JQRA 1N92A 4X7BA 3FYDA 4ZZ2A 4B82A 1KAQA 1HZZA 2OHVA 4I5GA 3BB3A 2PHZA 3M6FA 1UK9A 1QPBA 4HKTA 4DSOA 2AHRA 2O5RA 1RADA 2V97A 3SR3A 3FRIA 5SYAA 2I76A 1L5ZA 1IC6A 1WA5A 3IP9A 4O8CA 1IMOA 5IAKA 2HDOA 2BE7A 2AC4A 3K15A 1BD3A 1ZN7A 1GCAA 1IQ0A 1OMOA 3EFHA 1HDZA 5HILA 4I4TA 4C7MA 2GBFA 2DWQA 1NB5A 2REOA 4UMFA 2G6BA 3S99A 1JDVA 4K2HA 4I19A 1IWDA 3VC7A 3L1HA 3HA5A 1XEWX 5A04A 4CDRA 1OU4A 1Y8RB 1UFKA 3RYHA 3WFIA 2WYIA 3D6VA 4YT5A 1S2OA 2PS3A 2IYRA 5LXTA 1NYRA 2QRMA 1DVRA 2G9RA 3NTUA 5KTRA 1I10A 1OGIA 3ZH9B 2AXQA 1N9GB 4HNVA 2OCBA 4FFNA 4AG6A 4H2DA 3SC2B 1NOKA 2YQZA 2QT0A 3NDJA 3MT8A 4I9UA 2KW5A 2VDRB 4GP6A 5SZJA 2BR3A 4EO7A 4FMCB 4G81A 1O57A 2WPDA 2GAAA 2VLBA 5EESA 2DT5A 1K1EA 2ZIUB 3KZXA 1TYBE 3SIWA 1GZHB 3EFBA 3FTQA 3P5VA 5KX5F 1T6ZA 3BKXA 5J2UF 3ZW8A 5EZYF 2AC7A 2GO1A 3WGVA 1BDHA 4YI3A 1ZI8A 2AG1A 2BMEA 3M6WA 4JASB 2CXRA 2FDRA 2AZ4A 1B16A 2W22A 4LTMA 4RV5A 5J4LA 3IAAA 4AY2A 3E3LA 4YQYA 5DCUA 2B3TA 2OHJA 5ALEA 5LZ5A 2AIRA 2HBRA 2AHOA 4ARAA 3WLPA 1WTCA 4QODA 3ZLTA 1LK0A 1X7YA 2HCRA 5IXSA 3M0EA 5EINA 1GLVA 3W8FA 2GPJA 2D5AA 4KODA 4KU4A 1BKSB 4YX9A 3BMQA 4Y9TA 3RU9A 3ZDQA 2JI7A 2VJOA 2WHRA 2YCBA 4C05A 2BC9A 3VDXA 2BH2A 3IUJA 2H00A 4CQLB 4PQEA 1JBQA 4MWEA 2Q9CA 4KXXA 3DYVA 3HN7A 1DBVO 4AQDA 3P5UA 1T24A 2WU1A 1SEVA 1P19A 1WDWB 5HZGA 2CFOA 1U80A 2VHVA 2H2FA 3V3KA 4AQYB 1EBFA 2OGUA 2WICA 1X42A 3MZ0A 2IRWA 1VCHA 1PIWA 4JB2A 1NBME 1T3SA 2V59A 1O0BA 3EFOA 5K03A 3QTLA 4M98A 1H65A 2WK1A 3CEAA 3WLNA 3WL5A 1OWLA 1UBSB 2GCNA 3PXEA 2XE4A 1RAGA 2CLLB 3K31A 4GXNA 5G41A 5B4VA 3ZC3A 3EVNA 4KE7A 3V4PB 1XMVA 4TYMA 3H87A 1JVSA 5L6LB 2RB5A 3QPCA 4LY9A 4NKRA 2H4WA 1T9GR 4KH1A 4MKZA 4UKDA 1P2UA 2CBGA 1L5VA 2NUBA 4PG8A 2Z3VA 5AJVB 1P1HA 2E4UA 2OLJA 4HDRA 5I47A 4J6FA 4RFVA 4IXMA 3K4PA 5ED4A 2ZVJA 3KZMA 5C4MA 5E0KB 3DQQA 4U7HA 3FIJA 4LBWA 3SEAA 1M1ZA 3AHJA 3MJFA 4OHMA 3PBHA 3SYMA 1D07A 1C9YA 4ILEA 3ROEA 1MHWA 3WA6A 5J4YA 1ENOA 3KQQA 5LU8A 2H1WA 2FFRA 1DPFA 2VTKA 2JL1A 4MROA 4DWVA 4Z2AA 2FQQA 3I5YA 1IBLB 1ABFA 2WWRA 4EEZA 1DJPA 5IZCA 2O8VA 1RRFA 3A6HA 3Q8MA 2PUWA 4K81B 3K5WA 3T52A 1PEYA 5FXMA 3FNRA 1THTA 5LYJF 3CVJA 2XBMA 2QZPA 1IUOA 1YHYA 5THXA 5K3EA 2WHQA 3LYAA 3KD2A 1GVHA 3P2EA 1G66A 4GI5A 4B6SA 1RABA 5I7EA 1Z63A 1C41A 1C3LA 2ZRPA 4EG1A 1OLUB 2BI8A 3UUWA 2V7WA 4AP6A 2AQHA 1HLPA 3ENVA 3EXEB 4M6WA 5FOXA 4BNTA 1XXLA 4IUCS 4X8MA 2JCBA 3TZHA 4EZIA 4EYOA 4R2IA 5B7PA 5JANA 1SZJG 4EFMA 3WKAA 4A15A 2VK2A 2MT9A 4FR5A 5HWSA 4UAJA 4OMCA 2WIJA 1ZN8A 2BZSA 2FDXA 1YL6A 2FFAA 3G2HA 1OBCA 3IAM6 4MRVA 4RWEA 4KDRA 3WI7A 2QF7A 2FZ5A 4AJKA 3A9TA 1CUUA 4BNLA 1FFEA 1Q7TA 2HIGA 2E82A 4XD7A 4E5KA 2HMYB 3OKAA 5KTSA 2ZDGA 3KYBA 2NUTB 2AFIB 3AFMA 1L3BA 1C4XA 4WCFA 4FHZA 2DUJA 3O4FA 1LNSA 3ZWCA 1MTZA 3R3YA 2CF5A 5IXJA 3PYLA 5JLAA 1A2OA 4G67A 3NASA 4NJEA 4OATA 4Z4EA 2PBLA 2Y05A 2ZG6A 3PKZA 2NGRA 5EMHA 3URMA 2CB9A 2IBIA 1QR6A 5DDIP 2BI4A 3FTFA 4AN0A 2WM2A 2OGWA 3T54A 4YJFA 4MVJD 4NMHA 1W36D 4F8EA 3E1ZB 1ZGZA 2IKQA 2IOFK 3DXXA 4UAVA 1ONOA 5AW3A 4CKCA 3IPRA 1XA4A 4G23A 4U2GA 2YJ9A 1XPRA 4FXOA 1X1DA 3DZFA 1GLNA 4J16A 5JUWA 2X9GA 5I8PA 2RHMA 3HSYA 3JVIA 3WYGA 5F3DA 2QRLA 4Q3NA 5CFRA 5F02A 3WISA 2DBYA 5DBGA 4AS3A 1PX0A 5I9SA 5FTLA 2OXRA 3GV0A 4KQMA 4ZI7A 4N3GA 3ZHTA 5JATA 2SCUB 1G5PA 3L0SA 1E2BA 1YFLA 1WE2A 3HXPA 3IPXA 3WMXA 2Z84A 5DNCA 1Z4JA 3TD2A 3ZWQA 1QRSA 1S89A 1A9XA 1EP3B 1G20A 4JYZA 2GM9A 1UPTA 4ZO9A 4QC2A 3K24A 3S1AB 1YDGA 4X7RA 4B71A 1W5FA 4YJKA 2VTVA 4IFBA 1K7YA 4GLBA 4LZNA 2OG2A 3Q8KA 4ACBA 1P2DA 2PMCA 5KS2A 1DBRA 5EVJA 1I51A 2BEJA 2F3PA 2OCDA 3K0HA 4JVMA 3O0DA 1Y1RA 3E27A 3W9UA 2G9UA 1DRJA 1IN6A 3U4MA 2IIVA 3U7JA 5KYNA 2D7JA 3GH1A 1SHUX 1Q1AA 1V5GA 2IIQA 2EBHX 2XYPA 3NIDB 3PDWA 3R5XA 4L4UA 3AF1A 4N49A 4MW2A 5AKJA 3UXEA 5LKAA 5CNMA 1QVZA 2Y0CA 4I81A 4DRXB 4G0WA 2PGAA 3NVAA 4TLDA 3SEFA 3OMLA 3LDUA 1S96A 2SECE 5DRTA 3B52X 5GIPE 2G4CA 3RADC 3AFGA 1U9CA 4NE7A 1L4BA 1R10A 3IPYA 2J0QA 2V6MA 5JCJD 4HB3A 6LDHA 3FDZA 1ZM3A 4ERXA 1Y34E 4AMZA 1VLHA 4IQ4A 3D3NA 1YE3A 5GP1A 3R6GA 2VF2A 3O8LA 1AURA 2YYYA 4RCYA 4WW0A 3ZOKA 5LQMA 2O5CA 5BVGB 2CB5A 1NMZA 1KSGA 3FMGA 3IODA 4I5EA 4DEVA 4MQMA 1ZWLA 5AUPB 2WJ6A 5TQJA 5TQ0B 1T5TA 1BYUA 2C2MA 3KPVA 4I08A 1M8JA 1SD2A 2JI4A 3KHSA 3T0IA 1TL9A 3VSCA 1OAKA 4E46A 1ZL0A 4D3YA 4R31A 1G2PA 3SE7A 1XXHB 4QWMA 4HLDA 3TDNA 2JFWA 2D2EA 4DRYA 1TO6A 3VX4A 2ZU0C 3B53X 5EGWA 3P2MA 2GDJA 1XU9A 2W6ZA 2YHIA 1P7WA 5A05A 1UWLA 4GLJA 3DF0A 5K0NA 2WR8A 4MULA 4HO1X 4Q9LA 3MWJA 4RGVA 1N77A 1L4EA 1QG6A 3K9GA 2W5UA 1H4VB 1BJKA 1W85B 4EW6A 5CAEA 1OHHD 2V7VA 4CUKA 3NBKA 3BHIA 2WIFA 4UTXA 5LLDA 1TMKA 3CVVA 4BB9A 5IZ4A 1A1VA 1IN8A 4DRZA 2AGAA 1LV8A 1J9ZA 3LGXA 5DI3A 5ENZA 4IUDS 1HSZA 1W0JD 5TIIA 2KX7A 1C50A 2OKGA 4B32A 4XIFA 4E2XA 1ZX1A 2DSTA 4TSFD 1GPJA 1GD1O 1XFDA 4FEAA 3H9GA 2EG5A 1K8YB 2F3QA 3DO8A 3FPBA 3LBIA 5E3HA 5FPQA 1KOFA 1LZKA 3JY6A 3PJFA 4ASUA 3VFDA 5KWEA 1VPLA 5J1TB 2V96A 4RXUA 1HEUA 2JLXA 1AYVA 4O3FA 2Y0DA 4RVFA 1CUBA 2H11A 3G7NA 4ZXFA 1NQCA 4LJ8A 3FOZA 4YRFA 3L01A 3PFIA 1RXWA 3ENNA 4P3NA 2CE7A 3JQ9A 5GM1A 1FU8A 4KQCA 1EYZA 2R6ZA 2FW9A 5B12A 4PAWA 4HGRA 3D3EA 3ABRB 2WTUA 4RENA 1GNLA 2OHOA 4FFMA 4EDFA 1H4TA 1XPJA 3LK7A 4M55A 4QYWA 2PADA 2EU8A 3MIIA 5IVHA 3EFOB 3JQGA 4TV8F 2YHSA 4R2HA 1C80A 5DPMA 4I3HA 4KN6A 4PPFA 5F1OA 1E20A 1FNNA 3E1GA 3MAGA 2Z6VA 2JFGA 1V41E 4IG4A 4UXJA 5K7SA 3EWSA 2COEA 4GDMA 1PUJA 2H9IA 2GBCA 1UBNA 2B99A 1IXKA 1BMDA 2RIPA 3GGCA 2BDEA 3WWCA 5DNUA 1FX0B 1J7JA 3L7DA 4AKGA 5E3JA 1G38A 4CV2A 3ZE9A 4OUDA 2J6HA 1QIGA 3HGQA 2JKZA 4KVAA 3ZU2A 2PX6A 4BRZA 3OBBA 1GT91 1ST2A 4KWTA 1JH9A 1MOQA 1FLVA 2YXNA 3TRHA 5J58A 4ZCSA 3GC6A 4TYQA 4PLTA 4RQAA 3N53A 1EGQA 3QBTA 4QSHA 3RE1A 4W5RA 1Z75A 3HYSA 4UEKA 3FR8A 2XVXA 2A0FA 1XJQA 3GLRA 2GT1A 4MINA 2D74A 1KJYA 3B3GA 1CF4A 1QHHA 2ZQ5A 3TZ6A 4LOHA 2OPHA 3ZBQA 8LDHA 1GTRA 3CLTC 3CUUA 4OXXA 3EQ7A 3L7AA 5DYIA 2OK8A 5CNJA 4RJJA 1T9GS 3L1KA 2I6GA 2FUDA 3NEYA 5F33A 5C5DA 1GTVA 3B6MA 2I6QA 1Z0IA 2ZJOA 1J8YF 3IE2A 3RTDA 3O82A 3DEYX 4Y7CA 3H4TA 2J33A 1AHPA 5IANA 4UNSA 3S29A 4GW3A 1IUNA 4HXFB 1HR0B 3ZGVA 1AKEA 5FLYA 1E66A 4TX1A 4F45A 3MQFA 2AQIA 4ZYWA 1C9KA 4N0DA 2V8OA 2ID8A 3G88A 3TMKA 1L5YA 3ASVA 3HFGA 3GR6A 2FZCA 3K32A 4J8PA 4KYIB 4MR9A 4RZUA 4KPFC 4DJAA 4UQLA 3N2EA 1VLVA 1GGNA 3W1VA 1DKOA 4AX4A 4WNIA 1FA9A 5FR2A 4B43A 3H9CA 4RW0A 5BOSB 1V8FA 2H1VA 1CQJA 1ZJZA 4AKHA 5CHVA 2ZVPX 4N79A 2ZQZA 3BULA 4N03A 4QDXA 5LM3A 1D5WA 4NBRA 5EIAA 3HXQA 3PRMA 2VJBA 4B5KA 4AF7A 4R1UA 4YMLA 1LNQA 3EW9A 5TMDA 3LUGA 4M1OA 4QD3A 5IJXA 3TNYA 4CLHA 4YACA 3TL3A 4UPVA 2WG2A 5EIWA 4S1TA 4AVYA 5C7OO 5CEJA 2Z1DA 1FFCA 3EODA 5KTTA 5MN4A 3WIEA 2H1OA 2P35A 3MCAA 3MOGA 4I07A 1GRNA 2XBLA 3NCTA 2NXEA 4LBZA 5KNBA 1V6SA 3IVAA 3AILA 2HCTA 3EDMA 4AKSA 5HIIA 3B12A 3ZVMA 1C7IA 1ZOOA 5DYTA 4D9JA 2FQYA 3DA8A 4HGOA 4HDKB 4M60A 4QPJC 1YB7A 3ITEA 4K6CA 2N0SA 3WB1A 1R6TA 2PT6A 4MB2A 3IMGA 1KAOA 1QIMA 2C7VA 3I23A 4TTJA 3AU9A 4NHEA 2C42A 1QJCA 1LLFA 1SHZA 1U5CA 4BQIA 1NZJA 2DKOA 2VP5A 2FR1A 4QUIA 1FNMA 1M66A 5K6TA 3R7AA 1SUIA 3U37A 1WUIS 4DG9A 5DBOA 3IULA 5K8LA 2J3QA 3I9FA 2BRUA 2FR0A 4I05A 2FLKA 3VDMA 1E58A 2XUJA 2XNHA 3G89A 4IGFA 1WHTA 5EIFA 3SSOA 4YIKA 4F6RB 4TLEA 4NCNA 1C0IA 4WZZA 3H75A 4CMJA 1FMFA 3AHDA 3AX6A 3FRJA 3HUUA 1IXYA 4JY7A 2PN1A 3PNKA 2C0YA 4JH0A 1M1XB 2FRDC 2R1ZA 3Q7TA 1EUCA 2Y3IA 1EFAA 4NU0A 1LPPA 1N3BA 2VTDA 1GKLA 4EHFA 4KWCA 5JXIA 1UKZA 1D3AA 4IIDA 2HNAA 1AZTA 1A7KA 1KQOA 3OX2A 4HNGA 5BYAA 5KPJA 1Z4LA 3GAFA 1VLMA 1AOXA 3KB1A 1WCXA 2DP4E 3IAHA 2YWFA 1KMCA 3SLRA 1PD0A 3P52A 3PJGA 1MB2A 4RACA 1TA9A 5FV4A 3IS3A 4FEEA 4IQ0A 1VSUA 4LCBA 1LDYA 5DH9A 4GVLA 3L93A 4XLZA 5E4TA 3KT8A 3Q3HA 3MRTA 4EMBA 4ESEA 1LW7A 1ISRA 1TQDA 2VA9A 1LRKA 2ZI5A 5BSHA 1YA6A 3IGFA 1NUQA 3BXEA 1WZ2A 3TB6A 4MLPA 1AUPA 1I0LA 1DTWB 1QE5A 1QWSA 3PXCX 4OTZA 2VFAA 1VBNA 1GUYA 4RNCA 1SN7A 2H4HA 4WN3A 2JAWA 1TVEA 3H5IA 3WBFA 1R9GA 2UVPA 3NHBA 2A0KA 3RROA 2OFXA 3C7CB 3Q1LA 4HJXA 4DY4A 4F1WA 1Y6FA 4OH1A 4P4UA 4DLKA 2C4UA 4F5YA 2HNBA 5L3SA 3PSEA 2EL9A 4JEIA 5PGMA 2IXFA 5HTOA 4MW4A 1U9IA 4QQKA 2Z5FA 1YK0A 1W1WA 2QENA 5DCLA 2Q7OE 3RFTA 1MOSA 1NI5A 3OLWA 3M6IA 5U1PA 4CKBB 1G8GA 3F97A 3VVCA 4OBWA 4R8MA 5HUHA 1ORRA 2BEUB 4JS0A 4PYKA 1V4BA 1PT7A 2YNMC 1E1RA 3GVIA 4LSGA 4D8VA 4ETWA 1U9WA 4JGGA 1UH5A 5CH5A 2EVWX 1P2FA 3STUA 1MENA 3E2IA 2Z2IA 3OPVA 2NPOA 5A4AA 2ZJ8A 3CH4B 1M2VA 5KNCD 3JYLA 1LBTA 1MJHA 1P4AA 1Y37A 4LGVA 4W7HA 2RAFA 1PL7A 2REBA 3CF4G 2QN1A 1I3CA 1EDOA 2QG6A 4TWRA 4WLVA 1NVEA 3IP8A 5CAEB 1UCFA 8ATCA 4NL4H 2IFTA 1K8RA 3ZY3A 5JLJA 4X95A 1GKKA 3VZRA 1M2HA 3PF9A 2CDNA 2HLHA 2ATXA 2CVQA 3TTVA 4BNMA 2HWWA 1CS0B 3BXXA 4E12A 2NU8A 4ENQA 2I4RA 1ZHOA 5KTPA 4H1HA 1QO7A 2YOHA 2FJ0A 3RNVA 1GTL1 4YK7A 1LQ2A 1QK3A 2M6RA 3NALA 4MS1A 3H5RA 3NHAA 1KRXA 1U5IA 1Y4ZA 1V11A 4GAEA 2R9FA 4G63A 4G8DA 1OC4A 5B2FA 4M9XA 2JGMA 2EJWA 3WTBA 4RF4A 4U9HS 1VE6A 3BTUA 1EESA 1EWPA 1WVGA 1F51E 1PYGA 2BFNA 4GPIB 1QE0A 1IBSA 1VJGA 2QTHA 1ZCAA 2MU1A 2QQGA 4XTCS 1DUIA 1RU3A 1JG3A 3DW1X 1FRNA 1PVDA 4R8LA 5FBLB 2J0SA 4QUJA 3WDSA 4F0JA 1HY3A 3DUWA 4I5FA 1KC3A 1JA0A 2AXPA 4INPA 2EC5A 2OORA 2QG4A 3VZSA 4XWWA 3E9SA 2N46A 2Q41A 3GLFB 3ELBA 3P71T 4MR9B 1DQRA 3H04A 3QVTA 2QUZA 4Y2HA 1QYCA 3PNMA 2J3KA 1TA4A 4QHTA 2PKQP 4BATA 1XHLA 2ERYA 2PVSA 1ZVVA 4KQ2A 4F4CA 3AF5A 2QJFA 2I9PA 2J46A 1Q57A 4GD3Q 4LE2A 5CM9C 3ZD9A 3KZCA 1A9PA 5M3BA 5I7SA 2WF8A 4S2EA 5GIOE 1CDDA 4M87A 4LECA 2RGGA 2W37A 1ZNWA 3EEIA 3OZVA 4W7SA 5CCBA 2Q3MA 3NP7A 3BQ9A 3G0CA 3BC1A 2GCOA 4UZEA 4J4BA 1GPAA 1GCGA 3L82B 1QCDA 1ND6A 3ZJYA 1Z37A 3DE3X 2J7PA 1PZGA 1IZ0A 1Q19A 1WP4A 5DM0A 2NYRA 1QH9A 3B1FA 2M1ZA 3NT2A 3O95A 4HAXA 4QPZA 2X8JA 3ZCQA 1AU2A 3CX8A 1X3LA 1A7JA 2EL7A 1WRBA 1Q50A 2Q0XA 3AUFA 3L7KA 3QTBA 1VL6A 1GCUA 1FSFA 1R0CA 1TZKA 3VKGA 2W2LA 4FCTA 2O6HA 4U00A 4TYNA 3T3HA 3LW8A 1FVXA 5AM3A 1MZVA 4K7JA 4ALIA 1SUFA 5KYWB 2QLFA 2CCKA 2IELA 3DMFA 4MMXB 4I1RA 2XRZA 3GXBA 1CNMA 2E1PA 2WD7B 4ZOAA 1Z2DA 1UKVY 3TS1A 1KJ8A 1WLYA 3SX2A 2BGWA 3R0JA 4GH5A 3AHHA 3LUAA 2GJ9A 4NP6A 3GJ4A 3G59A 1E2UA 1I9GA 2HIHA 2NO0A 1EUCB 3H6GA 2OP1A 3ZBUA 2EERA 2HMAA 4RTPA 1WQ3A 5TARA 4KHZA 1Z0UA 4ILKA 4KO3S 1Z2EA 4QHSA 2AN4A 3B7PA 5DI3B 2C97A 1GPDG 3KXLA 3I64A 2J4CA 3COSA 3UMGA 4RVUA 4CNQA 3IMKA 1VG8A 1KI1A 3L7YA 3FYUA 4Y2XA 5M7EA 1E1NA 5F7JA 2GFOA 4C22A 5J47A 4AKIA 1ZOLA 2JG3A 4ZKDA 1ODTC 2X6QA 1R6UA 1VIYA 3EF3A 4S3MA 4XVRA 3PPVA 5KC8A 4WXMA 4IDQA 2MINA 3RTGA 2W0MA 2A1IA 5G4KB 5TR9A 3F98A 2DH6A 3E35A 4L0CA 1FYFA 4YRJA 1XQ9A 1RYBA 2WLTA 1JKIA 5DKFA 1JE1A 1YC5A 4ZRMA 1I2AA 4UHDA 4C30A 2XNCA 1T3TA 3CUYA 3D8UA 1UMDA 2HDNB 1IIBA 3P9IA 3R41A 5BR8B 2M1XA 4QPPA 3T5AA 3R9WA 4XJXA 4GPZA 3K0AB 2XD4A 2BFDB 3WWDA 4EKEA 1HBJA 4L50A 1E0SA 1EJ6A 3BTOA 4LE1A 5T67A 4FZJA 4BUZA 3IEUA 3F49S 4IDEA 1Z13A 4ZZIA 3IFSA 2XAAA 1L4HA 3G6WA 1HA3A 3QQPA 3WGGA 4A3SA 4DM3A 1Q20A 2ZBFA 1UZMA 3D3JA 2FCRA 5KKCA 1E1YA 3PFHA 4DLYA 2IOYA 4DLNA 4X62B 4QVKA 4MGKR 1RXYA 2CLEB 2IYEA 2ZYAA 4KQ1A 5K0SA 1QBGA 3I2IA 4QDZA 1JA9A 4EDHA 5I9BA 3WXFA 4RPLA 2BD0A 2W4IA 4ABYA 2EKDA 2EEZA 2Y9MB 2Z2ZA 1S6YA 2H4YA 2HH9A 3PSAA 4EY6A 3QVJA 4HQ6A 4EHLA 1WZEA 3A36A 3DWEX 3RT7A 2ONYA 1S4QA 3MK31 4FGSA 4X65B 3IL2A 1L8OA 2XCUA 3TKAA 2ZLBA 2UUOA 4V2IA 4MP6A 3AVWA 3DFKA 3JAKB 1IB0A 2HMUA 5CYOA 5K8JB 3U4AA 2P8JA 3Q2IA 2FPLA 4I8DA 2AQ8A 3A4LA 1C0PA 1QHHB 1ID1A 2ACVA 1WXQA 3OZTA 4O08A 2HWYA 4ND6A 4DIBA 2P62A 2CDBA 4QUAA 3DCIA 1B8OA 1GU1A 3HD3A 1K5HA 2XMZA 2FUEA 1P2VA 3TLGA 4BO7A 1PVOA 2BTOA 1BE8A 3WFJA 1R8YA 3KSRA 1PKXA 4GBMA 3FIUA 1IXSB 1GZ7A 2WJYA 3E5HA 2ARKA 4DN6A 4YRCA 3WWPA 3F9RA 4F8YA 3E9CA 4Q16A 2BDLA 1XRMA 2BCGY 4OJYA 3LOQA 3I6ZA 1KAMA 4F6CA 1LI4A 2PS9A 5TGTA 2JCXA 2Q3JA 3PNLA 4I1IA 2AMFA 3E0XA 4XD7D 2OZVA 1Z4OA 1E0AA 4NCKA 2CHFA 4V3BA 3EUAA 3GUUA 4Q5IA 5H4GA 4P0PB 2ODPA 4PX2A 4DNPA 3EWAA 5F2KA 3RAPR 2ZRFA 1BE1A 2BFAA 2WMYA 3V8NA 3W3ZB 4MYRA 1EMDA 3EIUA 2G67A 1SUWA 3DMRA 3IVXA 3KJQA 4OSOA 2WB2A 1G59A 3WSTA 2PUCA 4L2IA 3KELA 2CEKA 3ZWBA 5A4DA 4RGBA 1VKHA 3CW9A 2OXTA 1YBHA 4N47A 2ALJA 4MVCA 3H18A 3BA6A 1BU5A 4GUAA 4ZCTA 4ZCMA 2EX4A 3U40A 3Q7PA 3WKDA 3T1HB 3VH4A 3KOYA 4GT1A 2ZRLA 1RLTA 1TKAA 3C48A 4X00A 1D04A 4CV3A 1XTSA 5HQTA 5JH7F 1XEXB 1WB4A 4S1NA 3LSYA 1V11B 2PSHA 1EXDA 1P74A 4HDKA 3SNHA 5EGNA 4BFUA 3A9WA 3CJQA 3OZFA 4MGEA 5A9SA 1E92A 3KG2A 3JQFA 3OPNA 1ONPA 4UM7A 3MT9A 4V1CI 4B3GA 2OULA 3RVWA 1FL9A 2VTBB 1JR3D 2BE9A 4MWDA 2V4MA 4MPRA 1E1RD 2XVMA 5FNVF 4BO1A 3QW2A 5JNUA 3H83A 3O2SB 1D1QA 1GG8A 2DUMA 3YASA 5MFZA 2CV2A 1DU4A 3L0DA 1T34A 1YZ3A 3P20A 2ECFA 2Z2JA 1KMHB 4JA0A 4OJNA 2HA7A 1BNCA 1BHQ1 1DAGA 2HW8A 3PC2A 2PKQO 2FV8A 2X13A 4XCVA 1MAUA 2ZRNA 4WA7A 4YYRA 3CKYA 3P94A 4UBLA 4RDIA 1OY1A 4ZIRB 4N8EA 4RFSB 4C2TA 4MKXA 3ZCSA 1H6CA 4BJ6A 3PD7A 4KAAA 3DYIA 4CUZA 5L9AA 4XFDA 3FFXA 5FBZA 1O4VA 2WUWE 5K9ZA 2VRNA 1LI5A 2PCJA 4NZOA 4D9BA 1RQ7A 4UPDA 4ZD6A 1HNXB 3RC8A 3V34A 1L4KA 5JAMA 3DAGA 1QXPA 1KTIA 2PMBA 4DUYB 3VZBA 4EG4A 4NZMA 9ATCA 3ENQA 4TZTA 1YNOA 1GADO 4B40A 5C0OE 3RRMA 5BUCA 2C9MA 5DM70 4GPD1 3MJ5A 1FJ2A 1IDN1 1L7NA 1S2IA 2KS6A 3SQWA 3GPBA 4TTIA 5ALRA 3PJEA 3WQBA 5GPBA 1HDYA 1REQA 1DC5A 3LI2A 2Q5QA 2WSMA 3GMTA 2VCHA 4LISA 3SPXA 2PM8A 4B3TB 2FPIA 3ROFA 4LQLA 3PWZA 1W2HA 3F75A 2OD7A 1EDBA 1YD7A 2HDWA 5EEHA 5EE9A 3AUJB 3PIIA 4KPUA 2RJ3A 1ZUNB 2GFIA 4Y67A 1GSHA 5DM60 4YCNA 3HTXA 3SBEA 1XNGA 5FO0A 4BVBA 3O92A 3RHZA 3SC2A 3WB0A 4ZMSA 5ALKA 2I71A 1OTHA 2LIVA 3D43A 1INLA 3DE6X 1L7BA 1UBOS 4JLJA 5IARA 1UMCA 2BM1A 5H83A 5FUVA 5HDBB 3CS3A 3RVPA 1UBTS 4GZ5A 3KPJA 4BVKA 5EMNA 2P5TB 3P0JA 5DOZA 3WGKA 4U3JA 1K6IA 1Z18A 1G0OA 1NNUA 2FZVA 2GSWA 4RIFA 2H3EA 3I09A 2B6NA 4BGIA 3F71A 1DWUA 1OI4A 1X80A 5FI1B 4V2UA 1X0XA 4B48A 1ZHHA 3EYWA 3B20A 2B4AA 3I8XA 3MTIA 1H6BA 4M86A 4QYXA 2HTFA 2A5GA 3A32A 4NONA 4K9LA 1ZJ5A 2I2WA 2ZB7A 1TAHA 1RHQA 3JD0A 3LQ4A 3PCRB 3OQNA 3R6WA 1T9CA 3JQQA 3O47A 3IOEA 4KIWA 2CL6X 5JYDA 3FPSA 1SVUA 3B3AA 3EK2A 1DAOA 1ZI6A 4WVLA 3OQHA 3TPCA 2W2PA 3D6TB 1PD1A 3PGKA 5FUYA 1NPTO 3SSNA 3UMBA 3NAMA 2DQKA 3A2LA 2IEDA 3ZWAA 5DWQA 1XB2A 3G1WA 3I6MA 2OD2A 2PXHA 5IK2D 3VISA 3NBAA 5LUAA 2VJMA 3EQ2A 1OFGA 4NYIQ 2W70A 4G6ZA 3VZDA 4AK9A 1EXVA 2FWJA 5F21A 1GDTA 4LF7B 2H5EA 1E6KA 3FPJA 3CHYA 5BQOA 2BFDA 1CQPA 3LDFA 4KMRA 3SF0A 3HCWA 1OROA 1E62A 2ZJBA 1XWWA 2LPMA 2C1EA 3L1VA 3OICA 3F7MA 4GOMD 7REQB 2F1GA 2G25A 4OQXA 2DOKA 4GECA 1TTTA 2Q49A 6PADA 4JJAA 4MQ4A 1D8TA 2YJNA 3BE5A 4PHTA 4OELA 3JZMA 1K5GA 3MS2A 5JSYA 3AHCA 1HE2A 3C3KA 2FJUA 2WQ6A 3JYOA 1G18A 4GX2A 4R69A 3GELA 3C0RA 1GTG1 4OUKX 3WS7A 4Q3DA 5B1YA 1KFEB 1WW8A 4FXPA 1BMQA 1IK6A 1WPGA 3K8YA 1LJUA 4HGPA 1I30A 1P9WA 1LBSA 3BS4A 3FMPB 4ALMA 2ETVA 1P5FA 5DFAA 4UHKA 1LSUA 2NU8B 1G1MA 1NUAA 4R2LA 4QEDA 1ESNA 2CUNA 2QEQA 4AYWA 3K35A 4H7IA 1GU7A 4U7DA 2E4YA 2OMKA 1VP9A 1C7RA 2G9QA 4F9TA 1E0JA 1PJAA 3RVXA 1WMBA 4J7CA 1A82A 1FTQA 4L0MA 1KIMA 4NZ9A 1SU7A 1VYTA 3BXOA 1BD4A 2QE6A 5TXGA 3I0MA 3TMPA 4EUNA 1O6BA 3HDHA 3GRKA 1GPYA 1T5IA 3EDYA 5K3AA 1JAYA 1E2KA 1QYWA 2O23A 2QMOA 3E53A 3NHPA 4L8VA 5ALXA 1JTFA 1YUNA 1MXFA 3ROMA 4ZZ0A 5F98A 3TOSA 3FUXA 3NYRA 2CFSA 4L0QA 1KVQA 3D0KA 3NUQA 3DVLA 4QDTA 4M0FA 4IQGA 2QSJA 1UDXA 4ZCIA 3GN2A 4KHPB 1X1EA 2W6PA 1W5SA 2PA0A 3T94A 1KXJA 2Q3DA 5KJCA 3ZZTA 1DC4A 3WYCA 2YYAA 2WSBA 3HHIA 1JUDA 7YASA 3Q6NA 4RMJA 5DYNA 2X7HA 4X91A 1ZRHA 4MV4A 2NVUA 2PAFA 1KI6B 5JNLA 5E1BA 2RDMA 1P3Y1 1IZZA 1R27A 3I58A 4RHUA 1KFJB 4MRPA 4PONA 1HQDA 4AS1A 2FYEA 3P26A 2NZYA 1BN6A 3PFWO 2NUTA 3UAOA 3KPWA 2VDNB 3IUQA 1X1SA 3FFWA 4R1LA 4S1PA 4Z0HO 4CI0B 4WY2A 3X1MA 2OE2A 3N39C 2CFTA 4PQFA 2XCQA 5J63A 5SICE 1WZIA 2GCOB 2B34A 1YI8A 3Q3EA 3D3QA 3O93A 1H5QA 3QPUA 4TKUA 4MYTA 3TGLA 2EKQA 4REOA 3ZNOA 4BB5A 1GV1A 4Q1VA 3I9V6 1OPRA 3PCTA 5D87A 1E3WA 4YDSA 1VRWA 3KCNA 1HRKA 3F5MA 3L4KA 3EBPA 4HDAA 3UJ6A 3L8FA 1ECBA 1F9EA 5A9SB 9LDTA 1QMGA 3FHOA 2B92A 2O8CA 2JI8A 4UOEA 2XCRB 2GAFA 3W5HA 4OF4A 4UUAA 3WL3A 3SHQA 1XI2A 1XZGA 4G0YA 3TH5A 5HGXA 4FKZA 4AYTA 1DJMA 2F1IA 1BJRE 4GKKB 1S2DA 1RI5A 5BSMA 5FPYA 2FPOA 2ZP1A 3DDOA 4LJAA 4OHWA 4CM7A 3GNTA 5JI3E 3F7NA 2HF8A 3KFQA 3LP5A 5ESWA 2XZPA 3VNQA 1KWKA 2WHEA 1K2WA 4U0JA 4E32A 5A4KA 4K05A 2QYHA 5HBRA 1U28A 5EXDA 5CB4A 2FRQA 2CHEA 4Q4HB 3WHLA 3AL0C 3ZEAA 1U7ZA 4XASA 2H1LA 3P96A 2X7XA 1O58A 2VZLA 2EFCB 3TLZA 1HL3A 1I36A 1SULA 1ES9A 3EJWA 5BMVB 1DC8A 3ROTA 1QH1B 2IUUA 1W8DA 3RS3A 4LQ4A 1DEKA 1YFKA 1ZONA 1DOAA 2CLDX 5GJCA 3W2HA 3W3AD 2QNIA 3HY4A 4NATA 1FSPA 1B74A 1JS1X 1GLGA 1D7OA 1PN3A 1UKBA 3FYUB 4MQBA 3EGIA 4AN1A 5LMCA 1P8AA 1I33A 2VT3A 4MPJA 4AFNA 1AC5A 1JQ3A 3C3XA 3PDHA 3UOAB 2LCFA 1QAQA 3X1WA 1QQ7A 3DL7A 1QH0A 5DVZA 4EHAA 4S12A 2GN2A 4OLHA 4FC6A 2Q2WA 5LZ2A 1GL3A 4HAZA 2C8KA 4RZIA 3PLAE 1Z4PX 4I4IA 3TLGB 3ZTWA 1ZUWA 4Q3BA 1D2GA 2WFAA 1S2MA 4PSAA 4UUBA 3I5XA 2RHBA 1OI2A 5PNTA 2DPMA 2GXAA 2Q2OA 2ROQA 3X1JA 3CLVA 1UKEA 4JMPA 4ACAA 4A2QA 3R0IA 3ETJA 3AGQA 1GR1A 3T3DA 3ZXUB 1DIHA 4MCHA 5EWMB 5AW4A 3PHUA 1XDUA 2IZ0A 3RVNA 5KKNB 2VJQA 5E4FA 4C5AA 4RLHA 1Q0HA 4AO7A 2ZBUA 3GI1A 4A1FA 5EFOA 4A0GA 2B4KA 2PKYX 4DIMA 5B2EA 3F1LA 1ETHA 4DREA 2B1RA 1FP4A 3N70A 3QKTA 3U26A 4BN4A 2XQJA 5HKOA 4BO2A 4PZ0A 3IRVA 4KWEA 1QF7A 4PHGA 2PLWA 1NL3A 3VPGA 2PNSA 4WCFB 3VKWA 1CY0A 2Q4TA 4HWRA 4L5JA 3TQSA 3JD1A 4OAQA 3VA7A 5ITSA 1WTAA 3V7YA 5K05A 1GYPA 3HYRA 2JIOA 4B0PA 4RF2A 4RPCA 1T9AA 5EUCA 2HO5A 2F4NA 2NTJA 3MMPA 5BSFA 3IA7A 4W5BA 4IUBS 1T4CA 3ZI0A 1A2BA 1V3TA 2GNOA 1KMNA 3G8BA 1WCIA 2R6CA 1JXOA 4LFAB 1O5IA 3C45A 2YX1A 3JQ9C 1QK4A 1QMPA 4R71A 1NMXA 1QOZA 4FX2A 1GPKA 4XUGB 1EVEA 1FP6A 3HBLA 2OD9A 1K27A 3MTEA 4HDQB 4DC1A 4IRXA 1E89A 3FOEC 1F8GA 3R3VA 3T3PB 4KOAA 2WJ4A 1K5PA 2CXXA