5EZSA

Venezuelan equine encephalitis virus (veev) nonstructural protein 2 (nsp2) cysteine protease inhibited by e64d
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
b'DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural Protein 2 Cysteine Protease
publication title Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain trinidad donkey)
molecule tags Hydrolase/hydrolase inhibitor
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ezsA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ezsA01
2QM3A 1JTEA 3G5LA 2JH9A 4HTFA 1UWVA 3OFKA 4RVFA 1MJFA 10MHA 4LWOA 3C3PA 4AZTA 3I58A 3CC8A 4ER7A 3EGIA 2CMGA 3C6MA 2QRVA 3DMHA 4MTLA 3HA7A 5DX0A 2VDVE 3M70A 5DWQA 4YUXA 2PGXA 5C1IA 3NWEA 5DLYA 5LSAA 4FSDA 2ZLBA 4BLUA 5EC8A 1SKMA 3IHTA 5EHGA 2PBFA 4E2WA 2B78A 2GB4A 3ELWA 3B3FA 3TM5A 4ATNA 2OYRA 4F85A 2F8LA 5E9JA 5HIIA 3QOXA 2YQZA 3BT7A 2ZWVA 3GCZA 5D1NA 2AR0A 3JWJA 3A26A 4RVDA 4WVLA 4AX8A 5GIOE 3NJRA 4BLVA 4FZVA 5FHRA 4Z2YA 1DL5A 1NT2A 2AOWA 3B3GA 4PYIA 5EGSA 1P39A 3UA3A 3IEIA 3DOUA 2JH8A 2JG3A 4CKCA 5K0EA 3SX0A 1P91A 5FQOA 2K4MA 3ERCA 4OQEA 5E1BA 1NE2A 1ORIA 3OE4A 4A6DA 3BKXA 3GRYA 3UJ9A 2QY6A 5K0GA 1YB2A 2BM8A 5KQRA 2JHAA 2ZBQA 4CTJA 4E30A 2P40A 5G02A 2B3TA 2ORED 3JWIA 3DMGA 5LQJA 4U7PB 1DUSA 3KPUA 2O06A 3G7UA 4KVZA 5DXJA 2FYTA 2FPOA 1NV8A 2GLUA 4QDKA 1XDUA 3HVHA 3P71T 4GC5A 5F2OA 4RTOA 1TW3A 3MCTA 2AOUB 3BZBA 3V8VA 5CD1A 2HR1A 2H1RA 1TW2A 2ONYA 3KPWA 4KW7A 4EKGA 1XDSA 2JHCA 2IDKA 1N7JA 2NXEA 4RTNA 2UZ4A 3EVAA 3AXSA 4UOEA 2HNKA 1N7IA 3DLCA 2P3LA 3AXTA 4PYLA 4OX9Y 3MHTA 2AN5A 1VE3A 3EMBA 3FPHA 5K0JA 1KXZA 4HTFB 2CWWA 5E1MA 3DMFA 4BP1A 4R6XA 4R05A 3Q87B 3MERA 2GPYA 4BP3A 3ME5A 4EMSA 4CKEA 3UJ8A 4OA8A 3LPMA 2PSSA 3LL7A 1TPYA 2AN3A 2V74B 4GF5A 4C04A 1WZNA 5EEHA 5CVVA 1L1EA 2OO3A 3FRHA 5KQSA 4U7TB 2PT6A 5HFJA 5GP1A 2H00A 3EEOA 1KR5A 2PXCA 3KQSA 5HIJA 2P3OA 3G88A 1QANA 1XVAA 4YUVA 1F38A 3MB5A 3FUTA 2CKDA 3TLJA 4FGZA 4HRAA 4MWZA 4C08A 1P1CA 2V7EA 3HCCA 1EQAA 5K0FA 1KYZA 2CMHA 5DX8A 5EKXA 1I4WA 1NW3A 3LCVB 4QPPA 2PWYA 5K01A 3KQWA 5K03A 3BGDA 4PINA 4KDCA 2P3QA 3LHDA 3RW9A 3ANXA 4LWPA 4EVIA 3EVFA 3OZSA 1SG9A 1RI2A 3IYLW 1AV6A 5EIFA 1R6AA 4HSGA 2EJTA 1NW8A 2ERCA 1SVUA 2VP3A 3I9FA 3OE5A 1EJ0A 3P9NA 4QDJA 5E9WA 3G5TA 3NVKI 4PNEA 4PYKA 1RI1A 4X61A 1NW6A 2PWPA 1QZZA 2ZTHA 2I62A 3BWBA 3KQQA 3KQTA 4PGGA 2HMYB 3TPZA 4DF3A 5ICGA 3TMAA 3ID6C 3KQYA 1VBFA 4RV9A 5CVDA 4C07A 2O57A 5E2BA 3SSMA 2FHPA 1EAMA 2FCAA 3UJAA 3CGGA 2XYVA 3TRKA 4FP9A 4QTUB 5DSXA 4DMGA 3ER9A 3GO4A 5C9ZA 2ZIEA 2HTEA 2PX2A 2AS0A 4X63A 1L9KA 3BXOA 1XJ5A 3GNLA 4XCXA 2BZGA 3OZRA 4GBED 5CCBA 1XTPA 5CUQA 3FUXA 3A4TA 5BP7A 4CXMA 4AZSA 5DSTA 4RWZA 1VL5A 2XYQA 1RI5A 2Z6QA 3CCFA 5K0LA 2IDJA 3EMDA 2YUIA 3QOWA 1DCTA 1ZQ9A 1AQIA 3UJDA 1D2GA 4KWCA 3UFBA 3C0KA 5DXAA 5GM1A 3PVCA 3RIEA 5LQCA 1JQEA 3DXZA 3NDIA 2ZBPA 3R24A 5DM0A 5ICCA 4RTSA 2I6GA 2P8JA 4QQKA 5DX1A 4KRGA 5E8JA 4ER0A 3A25A 3HVJA 3AY0A 4OBWA 1I9GA 3B89A 4RYLA 3PTAA 3G2OA 3O7WA 4P7JA 4F84A 1WXWA 1ZHFA 1VLMA 3FUVA 1QAQA 4GUAA 4M36A 3NW9A 3THSA 3AWIA 4E32A 2AOVA 3B7PA 3DXYA 3P97A 2P7IA 3FYCA 5U4XA 3HCFA 3O31A 3HEMA 3LKDA 1Q0TA 4OA5A 2Z6UA 3QV2A 2Q41A 3NTVA 3LKZA 2NP6A 2PVCA 3FPEA 3CKKA 1KIAA 3FPFA 3U81A 1BOOA 5IKMA 5IH3A 3KHKA 2EX4A 3OU2A 4V0QA 4K6MA 5HEKA 1YFLA 1UIRA 4YUWA 4IV0A 1XCLA 3E8SA 3KQVA 4L7VA 2BM9A 3LCCA 5KYGA 3AJDA 5HZMA 2OPBA 5F2KA 4EK9A 3UA4A 3PT9A 1ORHA 2ADMA 1G8SA 1D2CA 5EEGA 2WA1A 5CIYA 3SVZA 3P9KA 3MCZA 1WS6A 3CVOA 5DTQA 3LDGA 4NECA 2ZBRA 5DRYA 5C0OE 3SSNA 4XUEA 4AZWA 5T6BA 5BW5A 5BXYA 1VP9A 2IH5A 3ELYA 3LGAA 1R00A 1X1AA 3GRRA 4PYNA 5GINE 1JSZA 1IY9A 1T43A 3EPPA 3FPGA 4PIMA 5CM2Z 4RX1A 5ERGB 5HILA 5P8WA 5MHTA 3BWYA 2CL5A 4RTJA 2BR3A 3C6KA 3HNRA 2ESRA 4YUZA 3Q7EA 3OU6A 3TQSA 3PLAE 4MHTA 3SM3A 2UYCA 3TFWA 3HVKA 1O9HA 1N2XA 2NP7A 1Z3CA 3FTFA 2O05A 3DUWA 1I1NA 1YZ3A 3O4FA 2PV0A 2G8NA 3DR5A 3EVBA 5FCDA 1FP2A 2R3SA 2OXTA 2ZCJA 4OQDA 2OB1A 1BC5A 3HA5A 1JTFA 5HIKA 1IXKA 4BLWA 3L8DA 4YV2A 4Y2HA 2NYUA 5FA5A 1INLA 5H02A 3LBFA 1RJDA 5JR3A 1SQGA 1XDZA 4EQZA 3JWHA 3HCAA 2QYOA 5LQUA 2G71A 3I5UA 3M6UA 5CCXA 1WG8A 1KP9A 2B2CA 5FWAA 1FBNA 2H11A 1QAOA 8MHTA 3CJRA 1H1DA 1QYRA 3GRUA 3GGDA 2FK8A 3EVGA 4KIGA 4CKBA 3G8BA 2IH4A 1L3IA 3LDUA 2QE6A 3GJYA 2NXJA 4XUCA 5E1DA 3TR6A 2ZULA 3DTNA 4E2YA 3LBYA 1M6EX 3LSTA 2VDUE 5GOZA 4C05A 3MGGA 3HCDA 2DULA 1RI3A 5FULA 1EJ6A 2HV9A 3H2BA 5M5BA 2UYOA 3G2PA 4RTRA 4GC9A 3DP7A 1SUSA 1F3LA 1EG2A 3LCUA 5DRTA 3P2EA 4FSXA 1Y8CA 3TM4A 3EVCA 4XUDA 1MHTA 4QPNA 3FTCA 5EZQA 4RTPA 1IM8A 3MTIA 5FHQA 2PXXA 3OCJA 2PKWA 2N47A 3A7DA 1KPIA 3M6VA 3OPNA 4FT2A 4GOND 2VDWA 3OU7A 4M7RA 2P35A 3K0BA 3UJCA 5GIPE 3DH0A 1KPGA 1L3CA 3JWGA 3R6TA 3PX3A 1PJZA 3EVZA 4EKIA 3CJQA 4X41A 1YUBA 2P7HA 1XCJA 3VC2A 1NBHA 2I7CA 1NW5A 3GRZA 3UJ6A 5KVAA 1Q0SA 1WXXA 1VPTA 2AOXA 3B3JA 3PFHA 5LQAA 4BY9E 5LR6A 4ER6A 4ISCA 3C3YA 4PYMA 3S68A 1G6Q1 2UYHA 7MHTA 4PONA 4AZVA 5EZSA 1HMYA 2BR4A 2HWKA 3MAGA 3VYWA 4DCGA 2WA2A 5E1OA 2EG5A 2ZVJA 4CWAA 2Z6AA 4HGZA 1VIDA 3EVDA 5BW4A 5DTMA 5GWXA 1SQFA 5K05A 1JQDA 2AN4A 3SGLA 3OZTA 1YF3A 5D1HA 5EMLA 5DT2A 2OBFA 1AQJA 3R3HA 4E31A 1D2HA 3LDFA 2IBTA 2ZIFA 3DLIA 3M6XA 2ZZNA 3M4XA 3CBGA 4WXHA 3CJTA 5EVJA 5T67A 1OR8A 4G56A 1X1BA 5B1SA 4B17A 5K8VA 3DULA 3LX6A 2AOTA 3GXOA 1FP1D 3T7RA 3G2QA 5K09A 5DM4A 1R18A 4R8RA 5K0BA 4E33A 4YMGA 2PT9A 3HA3A 4FS8A 3GU3A 4RTQA 1QAMA 2PX8A 3I64A 5K0NA 5LQKA 4IWNA 3TKYA 3FUWA 5HIMA 4E2ZA 4R6WA 1M6YA 2WK1A 2YX1A 3PS9A 2PXAA 4P7FA 5T64A 2OB2A 5F2NA 3KQOA 3FYDA 2ZWAA 1JG3A 2UYQA 1V39A 3ER8A 4YUYA 1R8XA 3PFGA 1JR4A 2YTZA 2IBSA 1RJEA 3KPVA 5FWDA 3P2KA 4LECA 3SR4A 2C7PA 3ORHA 5EMJA 1X19A 4GEKA 4IKPA 1O54A 2IGTA 3P8ZA 3G2MA 1XXLA 2YR0A 3B5IA 2VZ9A 5E2AA 5GM2A 3M33A 3REOA 2A14A 2PLWA 3KU1A 4QQNA 5CVUA 4DM3A 4RTMA 5DM2A 3FTEA 2YVLA 2LD4A 3FZGA 3HM2A 2G70A 4X1OA 2ZZMA 2XVMA 4PYJA 2FRXA 2ZW9A 3GDHA 3P9IA 1FJXA 3HCBA 2B9EA 5K0CA 3BGVA 3E05A 3E23A 4ZTBA 1ZGJA 4C06A 5ICEA 2NXNA 3X0DA 3BKWA 3I53A 4HC4A 2GS9A 2JHPA 1X1CA 4P7GA 3SSOA 1O9GA 2GH1A 5FADA 2OKCA 4M38A 4QVGA 4V0RA 4ER3A 3GRVA 3MQ2A 5EQJB 5ICFA 2OY0A 4KIFA 5HOQA 2Y1XA 5EHIA 3LECA 5FTWA 2C7QA 4RTKA 4GQBA 3KQMA 3RODA 2EJUA 2OZVA 5LQRA 3KPYA 4KDRA 9MHTA 3T7SA 2YXEA 4P58A 4PWYA 1ZGAA 1YZHA 2R6ZA 4GOLD 1JSXA 1RI4A 2AOTB 1UFKA 2IIPA 3THRA 4DKJA 3UBTA 1NW7A 3T0IA 4E70A 3HP7A 3SXJA 2JJQA 2DPMA 3OFJA 1G55A 4O29A 3FPJA 4PGHA 4DA4A 3G89A 4PIPA 4QTTB 1NKVA 3T7TA 4CTKA 3HVIA 3UJBA 1HNNA 4FR0A 1U2ZA 2XVAA 5KS2A 2P1DA 3BWMA 2ZSUA 5EIWA 5FA8A 3FUUA 3NVMB 4PYQA 2IFTA 2XYRA 2QRVB 3TOSA 3V97A 1SUIA 4AUKA 2B25A 4X60A 3KKZA 2AZTA 3EVEA 4OBXA 2PJDA 2FK7A 4C4AA 4HH4A 5CVEA 4H0NA 3UJ7A 1JG4A 2AVNA 3A7EA 3PB3A 1PRYA 5EMMA 4FT4A 4YV0A 4MIKA 3P9CA 2PX5A 3GWZA 5EG5A 3TKAA 2O0LA 4YV1A 1KHHA 3FTDA 3DXXA 3K6RA 3EGVA 1G8AA 4RVGA 2C7OA 3KR9A 2XBMA 4C03A 1FPQA 3BGIA 2ONZA 5CVJA 2GAFA 4HGYA 3ELDA 4QVKA 3VC1A 1BKYA 3KR0A 3R9XB 1VQ1A 3IV6A 3E7PA 2ZFUA 3UZUA 3WSTA 1EIZA 4RVHA 4JXJA 2YXDA 4RTLA 5E8RA 4PCLA 1B42A 2IP2A 3HCEA 1M0EA 2BR5A 3KR1A 1ZG3A 3NWBA 1KPHA 5DPMA 5EPEA 5FQNA 1JQ3A 2NXCA 2G72A 2O07A 3KR2A 4RSRA 5DM1A 1JG1A 1R74A 3EEYA 4DZRA 1VP3A 2VS1A 1G38A 3GIWA 2E5WA 3A27A 3SMQA 3KQPA 3F4KA 3PX2A 3R0QA 5JUWA 1NBIA 4E2XA 3G8AA 1P1BA 2GA9A 3EGEA 1X1DA 5DTRA 3VSEA 1R8YA 1G60A 4ER5A 4P7KA 5EKUA 4YMHA 2IH2A 3KPJA 3MTEA 2NNWB 2AVDA 4GOMD 2I9KA 1AF7A 1NV9A 4LG1A 5FUBA 2IPXA 2C7RA 2ZIGA 2YXLA 1YFJA 1RJGA 2KW5A 4HG2A 1BHJA 4GOOD 2P41A 1RJFA 4POOA 3P2IA 4R8SA 5LQNA 4IV8A 3M6WA 5EOVA 4Y30A 2AOUA 3ELUA 2Y1WA 1L3BA 4PYOA 2BH2A 4MQ4A 3HTXA 3NDJA 1ZKDA 4DQ0A 3UWPA 2G1PA 3D2LA 1KYWA 2PY6A 3FRIA 4A6EA 4DCMA 2EFJA 3BUSA 4PCAA 2PX4A 5E9QA 4F86A 2ZZKA 5EMKA 1WY7A 3NMUF 3BWCA 4M37A 1JG2A
chains in the Genus database with same CATH superfamily
3ANNA 1BQ3A 1P7YA 2QL7A 2W37A 4I9FA 1X9YA 2FPWA 1DE0A 3EFOA 3AF3A 4KIJA 3EG9A 3TVYA 4AM8A 2B37A 4ALLA 4NFYA 3B3AA 1VZ3A 2PGXA 4RFVA 4XUGB 1EFRD 3PWTA 4ZCPA 4DLTA 5F1KA 1T3TA 1F3OA 1ZM4A 4E2WA 7REQB 2M6LA 1EIWA 4ZYLA 2XBLA 4LYJA 3FKQA 2GSDA 3MAAC 3P9XA 2OVBA 2CCJA 4O4LB 1QVVA 3A2MA 5AJVB 1NVVQ 5JYCA 5TX7A 4YK7A 4CM7A 4RD1A 3T7CA 4YQYA 3UA3A 1E7YA 2WSYB 4PYIA 4GPZA 2V7XA 4KDEA 4QDUA 3X3HA 1W48A 2ODBA 2YY6A 3MQ4A 4XW2A 2TS1A 2QRLA 1P2UA 4P9NA 5FDFA 2AUZA 4QJ3A 4XTRA 2RI1A 4HHEA 4DTIA 5K0EA 1GKYA 3HY3A 3HCNA 1J70A 5K0GA 1E77A 1PEAA 3UJ9A 3M49A 4OK6A 2A9FA 4FFDA 3THXA 1Q91A 1DKIA 4YRNA 4LQCA 3BWXA 1D4OA 1YO6A 4KL8S 3GQVA 3KCQA 4Y9SA 1Z0UA 4UATA 3WA6A 2QD2A 5JAUA 4JI2B 1WQ1R 1Z4KA 2Y05A 3O3CA 4IQ4A 2H0RA 3QRWA 1AX9A 4BO8A 2X0IA 4GPD1 3P5UA 3FF1A 2IPMA 4NG5A 2OHXA 4OREX 3K5WA 4EHDA 2VT3A 4G85A 1YXMA 4JOCA 4DLSA 2W6ID 1ZRMA 1EM8B 3HVHA 2GEVA 1PN3A 3U31A 5CD1A 3S0JA 3NS7A 4MMZB 1E9FA 1TQ2A 1X1EA 3NOQA 3VVLA 3PHGA 4EKGA 5HJ7A 5JPDA 2ZS7A 3MD0A 5M2QA 2ISQA 5HIAA 1T5DX 1HT1E 1SHKA 1EP9A 1R0XA 1IQPA 2JPDA 2BFNA 2GHRA 5CT8A 4DY6A 5J1SB 1QPZA 3PSEA 2XU1A 2CVZA 1H0SA 1JB1A 1E6CA 3GCGA 2YVKA 3DOJA 2EKPA 5GOTA 4IHKA 4BP3A 2FZWA 3Q87B 3VH3A 2ZJ7A 1A7UA 2PA0A 2WIBA 1JR2A 1O57A 5AJUA 4DLVA 1MFPA 1R4NA 2AYXA 2P0AA 4U2BA 4J0CA 3SYNA 3E1ZB 1TPYA 4NR0A 2X9GA 4PAOA 1WZNA 3KJHA 2WF6A 2MMGA 2XB2A 2UU9B 4HEHA 4MS4A 3LFHA 1A7JA 3EODA 2PXCA 1TAGA 2UAGA 3K9LA 1I13A 2BDTA 5IZ4A 1A9ZA 1LFDB 2WD7B 3Q8WA 3OA2A 4XM0A 1ZNYA 1GPYA 1Z4QA 1WPQA 3FF4A 4KCGA 1UDBA 3Q8XB 4TZKA 2VUUA 3RF7A 2X1LA 4MV7A 3ZTWA 1R8SA 5L3SA 1R4MA 3JAWA 3SC6A 4FKMA 3V9PA 1E6LA 1IN1A 4ZVPA 4ENVA 3L7JA 3L7MA 3CLRC 3QH4A 4B4KA 1R6DA 4YROA 3V6CA 1TVEA 2I29A 2AR9A 5C37A 3OHPA 3Q85A 3GLGB 4YMVA 3J81A 3G8DA 5EJMA 1W1WA 1QOZA 4OP2A 2ZYUX 3CONA 2G8LA 2X41A 2M6SA 5JE8A 2DECA 4AQYB 3E9ZA 1NAHA 2PHZA 3OC6A 4PNEA 4BWGA 4JEUA 3EWNA 2JK1A 4JVNA 4M9XA 4XVHA 4KXQA 1RXSA 1RE1A 2W8ZA 2PQ2A 3GC6A 4LYAA 3H2GA 4J6FA 4X54A 4BU0A 2QQEA 1KI3A 3QA3E 3F2IA 3G2KA 1RCTE 2H7XA 1QTIA 3OJXA 3GLGE 1LBHA 3H8BA 1SVKA 3IMAA 1KO7A 2YVQA 3H8WA 2LR0A 3UMRA 4OG2A 1S7GA 2PX2A 5TIIA 1VSBA 1BKSB 1FDRA 1G7TA 3FFWA 4FLFA 4ZI5A 4XCXA 1I0LA 1F7VA 5EF4A 5CVMA 2LBPA 2YV1A 3UMCA 3T3MB 3A4TA 2XMDA 5CAEA 4E08A 4JI0B 4AZSA 1DJMA 3MJFA 3KWBX 2OOKA 3LX5A 1ZUWA 4YPFA 1MO2A 3GFTA 1CB7A 3FZEA 5J40A 3DE4X 3JQ8B 2GAOA 5K3OA 1JEDA 3O0DA 4F9FA 4YAIA 4KWCA 1MABA 5JJ5A 4M1EA 3KQHA 3QT4A 2JEZA 3LTNC 4YRIA 2XUQA 3HM9A 1QGZA 1RYMA 1Z2PX 3DWFA 4FWBA 4W8HA 4XX1A 5DX1A 1U9VA 4DFDA 3A25A 5CDFA 3EPHA 3IX7A 4DIDA 4IWXA 3KKMA 1T9ZA 2BKXA 1W96A 2QSUA 2QZSA 4L3VA 4QOHA 4R84A 4V2UA 1ZHFA 1AG9A 2C42A 2P62A 4BEVA 4P98A 4Q24A 1MB2A 1VJ1A 3GOQA 5JAOA 2V5VA 3B7PA 4K9LA 3RYFB 5HZGA 5KEIA 3HCFA 4ME6A 1MRNA 3EZGA 3WLLA 3WLSA 3NOXA 1M67A 1AGPA 4N0MA 4K6OA 2IYEA 4HRYA 1UM9A 3ZCSA 1T9AA 1D4ZA 1BOOA 1CR6A 3B21A 3QKSA 3HO8A 2Z2YA 1NI4B 1L5SA 1QK3A 1C9EA 1J09A 1ENPA 3HDTA 3KQVA 1W52X 2P27A 3RJZA 4CLRA 3E81A 2OPBA 5HZMA 3HXMA 2BTWA 1NF2A 1XVVA 1WHSA 3DL4A 1ORHA 2LRHA 2QVXX 3PT9A 5EEGA 1RNLA 1GZUA 1A9TA 4NV1A 5IW8A 3AVVA 1F5SA 2JRIA 1DLJA 2Y0EA 4XUEA 5DLQC 1W30A 4DVGA 1ICIA 5BXYA 4C0AC 1JDUA 4LRQA 5JWOA 2IH5A 5LXTB 3CF4G 3A1VA 4OQFA 4KYTA 2DYKA 3EIUA 4QT0A 3VSCA 2XZOA 1XDWA 1C0LA 2PEYA 1IY9A 3CXUA 4GG1A 4URYR 3R9WA 4PP2E 4PAMA 1O6CA 5AW7A 4DMYA 1Z5WA 3N7AA 2OORA 4DS3A 1U1GA 5LOVF 4EJ2A 3PQEA 1BRMA 1IHUA 4R1TA 4O4IF 3U5ZB 4I07A 1TZKA 3B85A 4JHXA 3QM1A 2ESRA 5JH3A 3PSAA 4N3NA 3FLBA 4FGJA 4LZNA 4MHTA 3KWLA 5IWCA 1XTBA 4FEGA 2GVZC 4NV3A 1GLNA 5IAEA 4LNAA 3V4VB 5BUSA 1W93A 3HGTA 1VE5A 3UMFA 2CVOA 5H4GA 2VYVD 3DUWA 1UOEA 4G65A 2JCSA 5EKTA 1L1FA 2FYEA 2J09A 3QJYA 2NO5A 5B12A 5IUNC 3ABZA 3PF8A 1JI0A 4DZZA 3FOZA 1QUFA 2N1MA 4AY3A 3VTKA 4L6CA 1SQ5A 2VHTA 2X23A 1SUFA 3I62A 1SQGA 3AIKA 1SQ0A 1N2CB 4Z1MD 1OBVA 2Q8QA 5DBGA 3QVSA 3S2ZA 5AKYA 2C9ZA 1EPUA 1PNOA 2EFYA 2W90A 3H04A 1FBNA 1WV0A 1LTHR 3PKJA 2MMCA 3SC2B 4F2DA 2X5XA 3FHTA 1OFUX 3UXMA 5KSPA 3R5FA 2ZULA 5FPPA 2EARA 3R7AA 1PIWA 3W2TA 1YS9A 1CLUA 1XZFA 2CDNA 4KFSA 1P5ZB 4AKEA 1EJ6A 2KPOA 4KGXA 1RZUA 1N2CE 2P2CA 4M1QA 4CJXA 1Y4DE 4PZCA 2NG1A 3BCHA 3IAXA 4R3NA 5F9HA 4YQEA 3OPYB 2XCUA 3VO9A 2C3OA 3QPWA 4XGRA 3WGUA 5HKAA 4OK5A 3MSXA 1JEYA 1KHQA 1IM8A 4KO3S 3OCJA 3KOYA 1DLIA 3FOBA 3OX4A 3TLCA 1FVFA 2NACA 4GOND 1PR4A 5CG2A 3MD9A 2P35A 3MYRA 3DUFA 4HJXA 4MR8B 2G77B 3K94A 3AUFA 3EF0A 3R6TA 3ZZNA 1LTQA 3DEYX 5NULA 3GLSA 5REQA 4DYDA 5CVOB 3K0AA 1RBQA 2Q3EA 2JBAB 4OHCA 1DAMA 1A5BB 1D3AA 3G9XA 3IEPA 4YFVA 3GELA 4Y2YA 4YMUA 4YGXB 1HE1C 3W2EA 3IQGX 3WQHA 3GRZA 1XMSA 3ZY6A 3KKPA 3UJ6A 3WB1A 4E0BA 3QIVA 4OHKA 1LVGA 2G9NA 4W9NA 5HW0A 4DANA 1MFZA 4ISCA 4EBFA 4EKIA 3S68A 3ZW8A 2HF2A 3PE4A 3OQOA 4YMWA 4RULA 4KYVA 2L2QA 4DJAA 3RT9A 1K88A 4KXMA 2J8ZA 5KWVA 2YWDA 1V35A 4I14A 4P83A 1B1CA 3IO3A 3A1SA 1N1DA 2CHQA 1CFZA 3JQQA 4IDOA 1KC1A 3RV3A 3SGLA 1XG5A 2OESA 3ZQUA 4UQOA 3W9UA 1AJEA 4NH0A 1RKQA 5EMLA 1OPRA 1KU0A 1D2HA 4ZAFA 2PFKA 3M6XA 5JFGA 2VATA 3C5WP 3QVKA 1YS4A 4UXHA 1CQWA 2FZLA 4RUKA 5ERYA 1SXJB 5JNTA 4W99A 2P69A 4HO1X 1ZD9A 4NQZA 5B1SA 2Z5GA 3EGOA 4HCJA 3WI7A 1AM4D 4QUHA 4EF5A 1JAXA 2ZPAA 2EFHB 3NHKA 4GIBA 3V8RA 5KYNA 2QZPA 2A9PA 3PYLA 3B3QA 3DZIA 3UFXA 3L0ZA 1G66A 1BEUB 1A9PA 3HA3A 4GP9A 4CUZA 3GU3A 2BFEA 3B38A 1RQNA 4UQPA 1MAHA 5SZJA 1GUDA 4E2ZA 5CLHA 1SCBA 5ICSA 1SXJE 4JOSA 1XP5A 1DTWA 4HPXB 2WSIA 4CG0A 1AT1A 5KYTA 3D3NA 4MS1A 2R44A 3TNYA 5HOEA 4GRAA 1V6AA 1X9GA 3VZDA 2IYZA 3O8RA 3EULA 2WTAA 3AHJA 2H06A 1QIMA 3DV9A 3QPVA 2YICA 3ZOKA 1L2TA 4GEKA 1KKMA 1U5CA 4HK4A 4IKPA 1DC3A 2GN9A 4RMGA 2X0FA 2FB9A 2OGWA 4CT4B 3EDCA 5GM2A 1ATKA 3KU1A 4B7ZA 1YJQA 2O0MA 4RTMA 5DMHA 2P4EA 2YVLA 3DTYA 1Y34E 3FZGA 3L49A 3MHPA 4GZ3A 4IGFA 2XTNA 1P75A 2QM0A 1L7BA 2ZVQX 1AU3A 3SJAA 1O0SA 4D9JA 3BN3A 4P3YA 1HTTA 4WI1A 3LYAA 4GRIA 2F1HA 1S8AA 2GBIA 4URUR 2I80A 3DV0A 4D74A 3I61A 3H2SA 4G0MA 3ZDCA 4ZO6A 4KBFA 1P1KA 5CW2A 2V5AA 4IS2A 2YHIA 3BSFA 2YN2A 4Q4HB 4UNPA 4ZKEA 1E59A 1YQQA 2ZRFA 3HYRA 5C18A 1NG9A 2VJPA 3WGOA 4KFTA 2AEMA 4V0RA 4OH7A 2NXWA 3WL3A 3ZXXA 4RK5A 4CQMB 2WJYA 2VJDA 3RIHA 2XDQA 4QVIA 4LK2A 5ICFA 4PG5A 1WBDA 2GFQA 1SBNE 4B4WA 1Z74A 4GI2A 4HYTA 2DHEA 4NFHA 5LQRA 2EGGA 3DGEC 4RABA 2J5KA 4OHZA 2UZ1A 1TA9A 3ILSA 1KRWA 1LU9A 2NVWA 3DL7A 3M1AA 3LT5A 4M9SA 2NM0A 1K7SN 2DLCX 2A5GA 3JAKB 3S6JA 1DOZA 2W5UA 1BA3A 3UMSA 3VPFA 5JZEA 3TEJA 3FIUA 5A5GA 2J7KA 1I8TA 2ZYHA 5G1OA 3TFOA 3ISJA 4DAEA 4R01A 1BQ4A 4O4JB 3TXAA 4UBMA 3NTQA 4DMKA 2Q5CA 5D7NA 5CG1A 4KOEC 3FCYA 4KNVA 3ZWNA 3RRBA 4U3JA 4Z3DA 4ARVA 2ONJA 3SD7A 1GKLA 1ESDA 1VBKA 1I51A 2AV6A 4JJKA 5KTMA 5E6JA 3H3JA 3WYBA 5A4MS 3N28A 4OD0A 2ICAA 3PCXA 5AYVA 2A5FA 4HDMB 3JQ6A 3JU3A 1IBSA 3LUPA 2C0QA 4R7ZA 1DG1G 3K0HA 2X3YA 3PJFA 3A7EA 4S1PA 1KP2A 5IMBA 2QRPA 3PEWA 4BECA 5BN5A 2OHHA 5BV2P 3IAUA 1OI7A 4HJRA 1BMDA 1E3TA 1G17A 3KLOA 3K6RA 3VZRA 2QNIA 4UAJA 2C2ZA 5HXAA 1Z0AA 3C4QA 3DDHA 3RSLA 1L5HA 1S8OA 4CTOA 5JZBA 1OFIA 4BATA 3JPWA 4I05A 2DQKA 4PCLA 1ORRA 1XAIA 2DPYA 5BWBA 1ZJYA 4EVRA 1T0PA 5F23A 3DOEA 1P2GA 2OL4A 4B8WA 4EZEA 2J31A 3QWIA 1PL7A 2COKA 1UF9A 3BIJA 3KR2A 4MV8A 4D9BA 2BDUA 2HT6A 3L8GA 2I9PA 2VS1A 4B0PA 3GIWA 5J3JA 4IUMA 1SVOA 3R0QA 3IB3A 4R9UC 4YB8A 2YBEA 4BO3A 1AHPA 4G5FA 1P2TA 3E1SA 1O5TA 5AVQA 2AFIA 3G0CA 2HK6A 3EGEA 4KV9A 3GPDG 3HSKA 1Q7EA 3X1YA 3RVKA 2XUPA 2HA3A 2WT4A 4BRZA 4CEJB 4XB6B 2I9KA 3DKKA 3NBMA 4QJBA 2RAUA 1RWPA 3I0MA 2O1EA 4P22A 1UUFA 3I2YX 3RAFC 4BBJA 1WPRA 3ST7A 3NHAA 4I04A 1QQ6A 4J0GA 3I01A 1H94A 3AM4A 2WM8A 3ELUA 3LD9A 1L3BA 2A9RA 3NXSA 3A2NA 3OWXA 4PLYA 3WRYC 3AKCA 3WLQA 1ORDA 1GXSB 5EXTA 1KYWA 5DNVA 1KH2A 1XRMA 3C5VA 3K32A 2NU8B 3TTYA 2ANBA 2NT4A 1M0WA 4R0MA 4OI0A 3HZRA 5G4KB 3W5DA 3V1LA 3ILYA 1JZSA 1R12A 4OQYA 4QATA 2OWEA 1QQBA 4O6VA 1ODKA 4X6IA 2W4IA 3G23A 1TL7C 3UK1A 3OIGA 4B6SA 5JTUA 5ISMA 1O77A 2P9YA 3CC8A 1DPGA 1WSWA 5CX1B 2DPHA 2H63A 2XCRB 4BNMA 2DR0A 4E88A 2VDVE 5LLTA 2FI1A 4CMEA 5BURA 1OIVA 2O2XA 4EG8A 5AP9A 2MSDB 4GT1A 3D3WA 1S2DA 4MM3B 5C80A 3T7IA 5B2EA 1ZBQA 1GUAA 4ECEA 1MVLA 1VYHA 3NETA 4PGFA 4ZJYA 2RGNA 3QOXA 4AK9A 5F77A 3QLEA 5D1NA 3WTCA 1R27A 1WD7A 2ROQA 2VEOA 2XMRA 3ASUA 3G9TA 4O8ZA 1BG6A 1GQRA 1N5IA 2SCUB 1PGNA 1NT2A 1C7QA 2FR8C 4TMKA 1TLOA 1SA0B 3VKWA 4KV7A 5ALKA 3MB8A 3DYIA 1JLMA 1F8FA 4JWTA 4LJKA 2C0YA 4Y6SA 2IS1A 4F1WA 2O4CA 3DMYA 4WZ6A 3D0KA 4OQEA 1K4KA 3AERA 4P3OA 2W43A 4U2DA 3ZY2A 5K4GA 4R5MA 5K51A 2G7ZA 2QTRA 3BL6A 2JK0A 3LX4A 2X7JA 4J7UA 4KEAA 3DTVA 4UAGA 4ZOBA 5B53A 4YPOA 4C7OB 2OHJA 2ZIUB 3JQFC 5G3YA 5JCOC 3U2QA 4YLEA 2HCRA 2QRKA 2AG5A 3I6IA 3QFCA 1TU4A 1ZWKA 2DHRA 4JR1A 1BDMA 1F8UA 4MGEA 1JGTA 2NUAA 5F1PA 1NZJA 1Y89A 1MZPA 1WCIA 3G7UA 2O59A 3ONVA 4RFSA 4CV0A 4P4NA 2JQFR 3MUFA 3UKDA 1UJ6A 4JXXA 4TS1A 1C9NA 2E82A 2I87A 5DGXA 3CH3X 2O6HA 3ROGA 5JAPA 3PI6A 2FX5A 3KEMA 3NVAA 2E3JA 5K3FA 4BGIA 1IBLB 1OAAA 4QQRA 5ITZB 2D1TA 3HKEB 4AU1A 1XCPA 1U0OC 4ARCA 2YOFA 4EG4A 5SZKB 1J8QA 3IODA 3INRA 2C99A 2R6R1 2VPIA 2NV6A 4HXEB 4UE2A 2PG3A 3V34A 1C30A 1VFPA 3AR4A 2CWWA 3QHPA 4QHYA 4UHBA 5ECGC 1IWBB 5H70A 1E61A 3DB2A 3IELA 3HFSA 2GLTA 4BASA 1NMQA 2B2XA 1G5HA 3MWEA 1DRWA 1GNRA 1MORA 4GF5A 2NYAA 5A6SB 1T9KA 3MTQA 4E5VA 4U8HA 4OB7A 3O92A 2H16A 4TZTA 2RHRA 1J49A 2AI1A 1KR5A 2JW5A 3GRKA 3N9IA 3PUYA 3BZUA 2BEVA 3P9YA 1NMSA 4G36A 4WCVA 4J29A 5A0VA 1UMCB 3PC8A 3MILA 3LP6A 5G3ZA 2CB9A 1C1DB 2UUBB 2F43A 1RXUA 1TQHA 5FNVB 4B3HA 4GVLA 2WV7A 4OQQA 5JYEA 2C2BA 3AH8A 3LYLA 5F52A 3LQ4A 2CK3A 1CEXA 4RJ2A 4YJGA 3PEVA 4TTRA 2O2CA 3KQWA 5JH7B 5K03A 2D2VA 3BGDA 4BBZA 5CD9A 4BE9A 1L8OA 4LWPA 3GCBA 1PFGA 1SXJD 2WMNB 3B7GA 3O8OA 2G5GX 4ZPJA 2NX2A 1POPA 5I7WA 1JIQA 5CCDA 3BFKA 5LLDA 2J9YB 5G1NA 5JJCA 4CN9A 3G5TA 2H2GA 2R7NA 3S40A 1P81A 3LZCA 3ZGLA 1SWVA 1QZZA 3WKBA 1P1IA 1AKQA 2Z3VA 3ID6C 3UGTA 3FR7A 3T9BA 2DC9A 4IFTA 4LRUA 3VPGA 2QLTA 1SVNA 2C8LA 3CR3C 1WVMA 1E9AA 3FBGA 1QVWA 1UPCA 3HZHA 1D9ZA 2NU7B 2R1ZA 4HNGA 5FFNA 1GCAA 2GERA 3UWSA 3II6X 1S2OA 1YVUA 2J4FA 1WB5A 4F46A 5IDYA 5HPYB 3GDGA 3VUFA 2ZJBA 4YO8A 5A7FA 2BKVA 5BWOA 5F7XA 1PR2A 1HFKA 1DO2A 1E2NA 1JH8A 3D54D 3NEAA 4OIMA 4CLDA 4D97A 1JFRA 4RWZA 4Q1BA 3S70A 5FLKA 4HNSA 1RXIA 5JANA 3T1YB 2IDJA 3EMDA 3K1YA 2BHRA 3T3HA 5AVUA 1D2GA 2CCGA 3UQZA 3VI4B 1QZ3A 4U9HS 3FSJX 4RADA 1LW6E 1GILA 2XT9A 1T2AA 1XXHB 3FPCA 2BGWA 3DLBA 1N6OA 1S6YA 3GFRA 1FRFS 4O2AF 1K8QA 5BN4A 4K9RA 4DJTA 4QQKA 5LU8A 2VNAA 3SHWA 2JZNA 4M49A 2NQAA 1CBUA 1C29B 3FUVA 2QAJA 2QJWA 3E2PA 5IHPA 4FOSA 4RV5A 2I7TA 3P97A 2OTCA 2P7IA 1EVKA 1MAWA 1SOMA 5ALGA 1ZNWA 3TL6A 4IKOA 4CQMD 5I4IA 4N79A 3I5XA 1XXHE 2VSYA 3HEMA 4UHHA 4AY4A 4BQFA 2Z6UA 5LP6C 4DCUA 4TL6A 4PP1A 3KTDA 4PR0A 5F3WB 1D1TA 1YB4A 5C81A 9LDTA 3LVRE 1AKUA 3T5GA 16PKA 1P18A 2XT0A 3N0VA 5IKMA 3K0SA 3B5JA 2XUDA 4RKXA 3ZNHA 2OBMA 3EIEA 1YFLA 4CZWA 5JSKA 3DFKA 3C3DA 1R16A 1XL0A 3W8DA 3E8SA 1CW2B 4N6OA 4E6PA 2OD2A 1NRIA 5G0WA 4A8JC 1Y63A 2GPNA 4BMPB 3PE3A 3GPBA 2HIGA 3D6TB 5FRDA 1A6RA 3C4JA 1BE0A 2YZMA 1L4KA 3TRDA 1QMPA 1UJ2A 2I6SA 3ZV3A 1Y42X 5DHUA 4AWBA 4ZKDA 1VP9A 2GBLA 1JKJB 1O95A 4H6XA 4QPDA 1VHQA 2OR3A 3DOFA 4AMBA 1LRJA 1YV9A 1DEKA 2W2OA 1DARA 4ADSG 4AYWA 3PHUA 1E9EA 2BM1A 3S1SA 3C3WA 4AKIA 1H69A 1ZVVA 1KDRA 3ZZ0A 1RXWA 4HFMA 4MVJF 1HBJA 2FRDA 2OMEA 1P44A 2IXDA 5D2CA 3A3KA 1ZHHA 4MWTA 2AFRA 3EN0A 3KFVA 4PV7A 1MOQA 2JD1A 4BMYA 4YV8A 1GG9A 3FNRA 2W6JD 4D82A 4BAGA 2I4MA 3SS7X 1PIPA 4BOZA 3K1AA 4GHWA 4M99A 1ECCA 2GD0A 3O84A 1KI8A 4ZCMA 4JI7B 4P0TA 1O9HA 4DMUB 2QAGC 2VRNA 2AYZA 5GJVC 3X2FA 5AM2A 4DRXB 4LRSB 2M1XA 5FH9A 2PUJA 2JLVA 1UDXA 2O05A 1MO6A 1OWMA 4ZZ2A 1IATA 4D1YA 3TQHA 3DR5A 3EVBA 4B9AA 2R3SA 2FG7C 13PKA 1J20A 2OCDA 1MJGM 2ZPUA 1UKEA 1Q7CA 3Q8KA 3L8DA 4FB4A 4GX1A 1ZD8A 2O2IA 4TS9A 5BO5A 3OQBA 5JR3A 1WPGA 3ZWAA 1QK4A 4L74A 3N05A 1FTNA 1CUVA 1UJNA 4H15A 5DTJA 3M5CA 4OHFA 2IWHA 4DDWA 1C81A 2ATVA 3BXPA 5KCZA 4HPWA 3RUDA 1Y7TA 4WLOA 4CN8A 1VHTA 4MV6A 2NUTB 3G8BA 4H3KB 4DREA 3L84A 1AA6A 2AT1A 4N0EA 4Q6WA 3AB3A 1XE3A 2JEYA 2JLCA 3N3AC 4WZZA 1C3EA 3LVFO 2I03A 1YA8A 4Q93A 2A4KA 5DYNA 4ZEXA 1CRZA 5A9SB 1SHLA 2CEAA 4D96A 2FZKA 1KMIY 4JLAA 1SZDA 1VIAA 1IG3A 2HNBA 1NPZA 2D0OB 3LCUA 5I48A 4AKTA 1AK1A 4KQ1A 2G07A 4MPTA 3VV2A 3SFZA 4WFKA 3ZG6A 3PQDA 1Q16A 2PLRA 5TDHA 1FPMA 3AP1A 4JUBA 4U2GA 1CZUA 3U62A 5GADl 3OPNA 1G5PA 3FR8A 2BW0A 2I91A 3OOHA 5JOQA 3S2FA 3AVPA 2HF9A 2NNLD 3T3OA 5GIPE 1KPGA 2R7KA 2C82A 1JHQA 3R0XA 4B3CA 1XQ6A 2XTAA 3AUUA 4FSHA 2I3DA 5DMXA 3ROTA 5K6AA 1PI3A 3R6DA 3C5EA 4N5DA 4YRMA 2FDRA 2KLHA 2I7CA 4FHGA 1EKXA 4EP1A 4DABA 1AKMA 1LSJA 4CM4B 3ROXA 3PJGA 3C7KA 2EZUA 2Y0BA 2V7UA 3DFFA 1KWGA 3OX1A 4LY6A 4N5LA 4YJKA 1XCBA 4EJ0A 3JQAA 1EFDN 3WBFA 8LDHA 3AY7A 1NJ6A 3G6KA 2ZJ3A 2HK7A 7MHTA 1BHSA 3WIEA 3NJ8A 4QGAA 3IPRA 4QUKA 3TD9A 4AZVA 4Z0NA 4HNHA 3BIFA 2BTQA 1RRMA 2H5EA 2XWQA 4JV5B 1YS6A 4WKBA 3VU0A 5C53B 3VR5D 1TNDA 1YHZA 3FVRA 4O2BB 5LJLA 1YF3A 5A24A 4CHGA 2QAIA 2GM9A 1T1JA 3JYOA 4MVWA 3S2SA 5BQFA 2CBXA 4P36A 2IBTA 2FDXA 4JIGA 1TO1E 5AVRA 1U9QX 4TTQA 1RQRA 1T24A 2O0KA 4S05A 2GTIA 1GCOA 1W5FA 1JDBB 3HWRA 3CUYA 2WG0A 3HLKA 3R41A 1X70A 4NRDA 5CT9A 4D46A 2FE8A 3EASA 5CA0A 2JHGA 1YCFA 1E7RA 3G2QA 1JHYA 1A5TA 3K8YA 2PUWA 4TV9B 3VR3A 1W5TA 2JLZA 2JLWA 3QE9Y 4F45A 1PT5A 3P52A 3ZK7A 4J9VA 4MQLA 5ED4A 2Z3WA 1T4MA 5LQKA 2R62A 1TVKB 3IMEA 1MB9A 4UD2A 1TOAA 1ODTC 2R6AA 2Q4RA 1NVVR 3UHAA 3WWYA 4YJFA 3F8SA 4Z7NB 2XMPA 2YZNA 3OJFA 1FFEA 2FW9A 1H1LB 2RJOA 3NHWA 2C78A 3FYDA 2V8BA 1CY2A 3H4IA 2O8DA 1EGVB 3BZWA 1I4DD 3U44A 1DQSA 1RHJA 5FBZA 2ZG6A 5C5EA 1IEXA 3EPLA 2PREA 5EP1A 2JDIA 4Q7QA 4B7UA 3G2HA 5JBQA 1OTHA 2Q5IA 3KWJA 3NR2A 1A8IA 4R9NA 4D4JA 1XXLA 1XNQB 1CIPA 3NGMA 1ZAYA 4YTEA 1T10A 2D5LA 4XCVA 2EC5A 3BCSA 2QN1A 1II8B 1RABA 1QBGA 1VHDA 2HU8A 1TFRA 3X1XA 1V7QA 1B4DA 1YJ5A 2GYVA 2XVZA 4MVJG 1XO1A 1X7YA 3BHJA 4NHEA 1L5NA 1PL6A 1UJMA 2BP7B 2NXNA 2REQA 1OV6A 1I9CA 5AW6A 3U7GA 2O8FA 3W1VA 4RK1A 3HCRA 3BKWA 3T5DA 1B8UA 1N7HA 2XQFA 1HLDA 5TVGA 3P4UA 4Z4EA 3FOFC 1QO7A 1O9GA 1ZD4A 2GH1A 1TIPA 3RNLA 1V41E 3MNFA 1M33A 4QZVA 1I32A 3QEMA 3UK0A 2YVAA 3GZTB 1SXGA 2BRUA 1NQVA 4L4RA 3DW1X 2FX3A 4RHXA 3V4FA 3W8NA 3ZV6A 2F3SA 2C98A 3K96A 3LECA 4C5AA 2DZYA 3FFBA 1XHFA 2AXPA 2HSWA 2RH4A 4ZYWA 5K4HA 2MINA 2H5JA 3E35A 1XZ8A 4QELA 5HMLA 1IIRA 3VC3A 4Z5XA 3ISTA 1A9XA 1T36A 3X1DA 1PTJC 2QTBA 2ZR7A 3THWB 5DNDA 1DOHA 5E38A 1I7PA 2XNHA 1LB1B 5KKCA 4FYJA 4BO9A 3RUHA 4RZ2A 1L7DA 3AEZA 3SXJA 3PG5A 2BDEA 3I39X 3UC5A 3HDVA 4O29A 3VMFA 5TRTA 2O14A 4IMRA 2G1UA 3G89A 4JEIA 5BRNA 1OB2A 2WJVA 3UAZA 4LZLA 4KN5A 1QH1A 1V11A 4JJIA 1YZKA 4Q9IA 1U7WA 2ZSUA 4X1IA 3U9SA 4D9MA 1DKRA 1U1IA 4F91B 4OQMA 1VXOA 1WCV1 1RADA 5KVQA 1O94A 1T5SA 4V0SA 4MO9A 1OT3A 1PDWA 2VJNA 1BX1A 3KJZA 3M3HA 3E4CA 5ULLA 4WZAE 3F67A 3H8SA 2QTWB 3HABA 3I8XA 1JG4A 4MUMA 4Y6QA 5BSRA 2PMEA 3VO1A 4TPKA 3U6KA 2NTEA 2VP6A 3KVRA 2PX5A 4WUTA 1LV7A 2V9ZA 3PENA 4NF2A 2H8KA 2G5TA 4FEAA 5DEOA 3DMTA 5FBLB 2XBMA 1UXIA 1G8AA 4ND5A 4DV5B 4IR7A 4X71A 1KOLA 2FZ5A 1BXRA 1GPMA 1EWRA 3UPUA 1XDBA 3FIJA 1E2KA 1FXUA 4JI1B 2HDNB 3ZGVA 4MWSA 3B9QA 3COWA 5CBPA 3IAS6 4JNCA 4JSRA 3PUWA 1RYHA 1BOFA 2YFHA 4K9QA 2OQRA 4F5DA 1NNEA 2V3CC 2PADA 3EEYA 2EW2A 1G5RA 3FDFA 4E4YA 5E3IA 3EHEA 1CUFA 5D5QA 4K7JA 3D1JA 4NAVA 1Y1SA 4IQ0A 3WLIA 4CM8B 4URXR 2C7VA 3CIOA 4ZVVA 5HQJA 2GUWA 2H7VA 3F0TA 4Y2TA 4EUHA 1GMYA 4JB3A 2AVDA 2R5WA 4INOA 1BU8A 5FUBA 3RAPR 1QO0D 4ZTZB 2OYSA 2ZR0A 5FUWA 1XL1A 4FMCF 4LBZA 3GJ3A 4IDNA 1NX6A 5EJAA 2FOLA 3OH8A 2BUCA 2AU1A 2F4VB 4DDMA 2IOQA 4HPJB 4X6XA 2WNSA 4DMRA 2BMWA 2CXRA 5CDTA 5JSZB 1OWOA 1U2SA 4ND1A 4YEDA 1TYBE 4CM9D 3BMNB 4D4KA 1M7BA 2YV2A 3F8WA 2PY6A 1XZCA 5IXSA 2WU8A 4CCYA 1X7GA 2YV3A 821PA 1KMMA 4GQAA 2GBCA 3CPEA 3MWKA 4L51A 3RKUA 3SQLA 4DGQA 2Q6VA 3GLFA 2GESA 1U6IA 2QA5A 1OWPA 5JC1A 3SQMA 3DM5A 3DEFA 3KQKA 4E5KA 3L18A 3IVMA 4DIBA 4ENPA 3OOWA 4BNWA 1M1NB 1SMKA 1ZMTA 1PW7A 5AJTA 5E6RA 3AYXB 3BPMA 2IXFA 2QRZA 3DMHA 5F02A 4OVZA 1KZ1A 2E1PA 2WILA 5HYVA 1HH4A 3CPSA 3UV7A 4FZ5A 1J0XO 3BH6A 3GGCA 3BK7A 5IWAB 3KSZO 5LSAA 3EK2A 3H5IA 5JXHA 1SKMA 3IQIX 4TV8B 1KVTA 3F5QA 3TMYA 4DV4B 1Y4SA 5TPZD 2YDXA 1L7AA 1PUJA 2PTHA 4HUQB 4BFTA 3U09A 3E9RA 4BEJA 3JWJA 1MJGA 4R1MA 3ZX5A 5K2OA 3VJMA 1YDHA 1BFUA 5EP2A 3VR6A 4PQRA 4E32A 3FOAA 4WLEA 5EGSA 1T5HX 3O2NA 4W5NA 2GM3A 2H0QA 3KLNA 1ZVKA 1B41A 3G8YA 4M7PA 2MOKA 3DT9A 1F5NA 3DTTA 1K06A 4LE2A 4EX6A 2R6JA 1VKZA 4PANA 1DKNA 5DISB 1WP9A 3I1JA 4D4LA 1N34B 2ZUBA 5DGHA 1HDRA 1MC5A 2DQ4A 2GK4A 3I6MA 4CQLA 4MWGA 1IBKB 4HNRA 5H0IA 1KFCB 1DO8A 2ARYA 3UWKA 2YXPX 4PZEA 3OT5A 3ZDYB 1YR8A 2ZBQA 5DK4A 1QHNA 3GJXC 1UC4B 4GSKA 2H7CA 1NG1A 3PRPA 5G02A 2XXJA 3BULA 2FAXA 5B7QA 3L0SA 2W00A 5ALRA 3WB2A 3R0ZA 3HBLA 3WYCA 5A3RA 2O8CA 3KTOA 3GFGA 1F4VA 3K2BA 3M6AA 4GKAA 2YS7A 1XDUA 3ZUPA 1ZD2P 4BN4A 1CQJB 1X9IA 2AZMA 3BZBA 1MA3A 1Z7YA 2ZIXA 2DCDA 4UHKA 4H7JA 1UK8A 3AK4A 4ZP1A 1QRSA 1WABA 1I7DA 1IN7A 1YOVA 3UW1A 4DT1B 3KWMA 3UG7A 4FIZA 4RTNA 2WT8A 3HRKA 4GI7A 5F76A 4N6GA 5BORA 1TQDA 3AXSA 2HNKA 1JG7A 1N7IA 1U31A 4O0MA 3DT6A 3HKDA 3EMBA 3IP1A 2BEUB 3D59A 1F17A 1BDHA 4G25A 2YUTA 4V1CI 4ZVSA 4CKEA 1JR3A 1YDFA 5FBRB 1CSBB 1LPOA 3DSRA 3NT4A 3SIWA 3K71B 2PGOA 2IYOA 1HORA 1Z2EA 4MSUA 3PNRA 4G81A 3TOCA 1J1ZA 4LOAA 2ZSKA 1GCIA 3KYDB 4PCVA 1FQJA 2P1RA 4OP1A 5IYZF 5BN1A 5JZVA 4YJ3F 1YQ9A 4N12A 4Z4CA 5K3EA 1E7WA 5CLGA 4EUNA 3FUTA 3CZ4A 4IOKA 3QNWA 1PEYA 4LX0A 2FPLA 2X8JA 3GJSA 1JS1X 3WC4A 1I7LA 1M0TA 1OZFA 1Y7LA 1NBWB 3PKIA 4XDYA 3AY3A 1DJPA 3M82A 3LCVB 1BIFA 1P2VA 1POWA 3FHCB 4KWIA 4ZDWA 3ZWPA 1O97D 3M3PA 4BQSA 1YE3A 3T1TA 5ALIA 3HU3A 3V7UA 3U26A 4J16C 2H3EA 2FQQA 3CVUA 3ZGZA 1P4SA 1RI2A 2Z95A 3B12A 4GLBA 4I8XA 3OSUA 2VOJA 4ZPXA 4MLZA 2ERCA 1JKMA 4ZT5A 1XRRA 3RWOA 2IA5A 3HPRA 4QTYA 1BDBA 1RI1A 1N5OX 2OXCA 2QRQA 2ZTHA 3D0OA 4YN3A 1YASA 1Z47A 1PJQA 3KKLA 3E5HA 3E7DA 3ER9A 5HCUA 5EZ5A 3GWGA 4PFJA 3R0VA 1Y5IA 3WDLA 4B8YA 4KNYA 1MW8X 2CL6X 4WCFC 5IK2D 3N39C 2W7TA 2Q3LA 1VRWA 3BXOA 2BZGA 4GOXA 4GBED 4D79A 4Y9UA 3ORRA 4G3XA 3QVOA 3AL2A 1AS2A 1KK0A 3GGPA 2PV7A 1JHPA 4MW6A 3HJAA 1R64A 3CCFA 2Z6QA 1YRYE 4F2GA 4HXFB 1AQIA 4EY4A 1WX1A 4UBOA 1FMTA 2JD0A 3C6YA 3T6KA 1F14A 1NL3A 2A9QA 3NATA 4BQIA 1IVSA 1OIXA 5DN6D 4BKMA 3T3NA 2CFRA 4BNFA 2I6GA 1LSOA 3F74A 4EGCB 4LV5B 2JFOA 2PKYX 1HNWB 3FY4A 3MTJA 3U16A 3E7XA 4NDAA 4PHHA 1Q1ZA 4S1WA 1C1YA 3N8KA 2GBFA 2VCEA 2NQTA 3NT2A 2G6DA 1Z6PA 1USWA 4I4IA 2BZSA 4RS3A 2VEDA 3C6QA 3N7UA 1CDOA 2J0UA 1XZPA 3D6NB 3C6ZA 3OE1A 2Q9AA 5J4YA 4V0LA 3NHUA 2WYHA 1U98A 1NQCA 1T0UA 2ZRPA 4UPVA 2NTYC 3G79A 2ACKA 1H8HD 5AUPB 5K20A 5K8UA 1KMCA 1JN0A 4X7PA 4W8OA 1IZZA 2FG6C 2I7XA 2JEOA 2ZTSA 1Q2XA 1ONBA 1HA3A 4ZVTA 4Q37A 1P5JA 3B1ZA 4FPXA 3GYBA 2B7CA 4TKZA 4TLLB 3TZBA 3VH1A 3ZHQA 1ZISA 3BD9A 5T41A 4EY7A 2GXQA 2X86A 5JS6A 4BGVA 5ALOA 3JQGA 3VR2A 1UQTA 4LSMA 4GX0A 4KLZA 2YCLA 5DTQA 2MT9A 3BK1A 1KHPA 1ZIYA 2JFWA 5CU7A 1A04A 1GFSA 2AR7A 3OEYA 3UICA 1SJ9A 1X1AA 2FNAA 2FQYA 2H0AA 1G7SA 3L7IA 2YZKA 4LCBA 3I9KA 1EFVA 2PPLA 1Z4PX 4RZIA 2VNJA 1QFSA 1DRKA 3EPPA 2JLUA 5CM2Z 2ATCA 5KDDA 2HWYA 4RX1A 5F35A 5I9BA 3D4LA 2Y6VA 1TUBB 1V43A 5DF1A 3WHLA 3LFYA 3CT4A 4ETWA 1E1QA 1ZL2A 2XT6A 3EOBI 3HNRA 1GV1A 1CY7A 2ZCVA 3EQ7A 5LBTA 3V2GA 1CZOA 1W5SA 4QYIA 1PXVA 1EFAA 1G5IA 2VJMA 4WPGA 3MT8A 4D8XA 1D7AA 2BFOA 2ISSD 3TFWA 2WJAA 3WTBA 4L4SA 3PQFA 4JT9A 4CV2A 1OYVA 2V98A 1NR1A 1U9IA 1LVUA 1AK9A 1Z3CA 4BS9A 2X0DA 2BWJA 3MOSA 1WZUA 5BUCA 3K6JA 4QM7A 1COZA 5LA6F 1GQ2A 4UHCA 4IL5A 4E4RA 1UJCA 1Z9BA 3RIGA 1XLTC 3ZCPA 3P5XA 3NUGA 3L4BA 4D42A 3E27A 5AJHA 2PS0A 1EVYA 3RUPA 4Y1RA 1P3JA 4ZOQI 4DBVO 2C4TA 2OOSA 3H75A 4GEGA 3HQ4O 4JT4A 4A1FA 4D9NA 1T6ZA 5CB4F 1PADA 3GFPA 2QF7A 3BPSA 4CM6A 4TL7A 3UJNA 4RMHA 2P3SA 5FBVB 1YQGA 1Y8QB 5FOSA 4B6OA 3WGTA 1A50B 4FD2A 4AKGA 1QIEA 2H1IA 4XCQA 6AT1A 3KQUA 4COKA 1GFWA 3NHSA 5D5HA 2WNHA 1UZUA 2DFDA 4LV8B 2ODPA 1ZZEA 2I22A 5FULA 5IVKA 3OC0A 1XT6A 4RTRA 3E9MA 4WESA 2G7MC 1A8HA 4MPDA 3SOZA 4RHEA 3LXSA 3NFRA 3EZLA 5A5DA 2WHEA 3PKZA 3ZLJA 2VP4A 3OFND 9LDBA 1BN6A 1UMDA 4QBBA 3FMPB 1VIVA 4V02A 3QX7A 1G7RA 1MW9X 2PSJA 4M7RA 5JPIA 3ZXSA 1TKBA 3CMCO 3QVTA 2B35A 2YMMA 5M29A 4N47A 1C0IA 1TCBA 4M0DA 4FBGA 1E9RA 2FSIA 1P6XA 3TQRA 3TFQA 2PDAA 3WGVA 3BMOA 4IDHA 4PLCA 4WHMA 3W78A 1P77A 1T6XA 1YRAA 1OH5A 1G9XA 1GGKA 3EIOA 3ETGA 4I7EA 4QLOA 1D4AA 4U9IS 3VOSA 1PT8A 3OA0A 1Y1RA 3LBHA 1A5SB 2P2ZA 2J41A 4CL3A 1A97A 1SOVA 4CM1A 4EI8A 4EZBA 1NQOA 4QC2A 1QFZA 3BDIA 1IN4A 4HEJA 1C1XB 3GEEA 3MJ5A 4ZHSA 1ECPA 2RGBA 4TLCA 2AMFA 3MCUA 4YYQA 2I1VB 2AH5A 1EM6A 1YB7A 1EK0A 4JBNA 1W4LA 5JDCC 3TR5A 3C8MA 2RKWA 1E98A 1SUAA 4YP6A 1RPTA 2C5AA 4H60A 5CA1B 2WFAA 2Q2NA 5EVJA 2WWWA 4UAUA 4RA6A 2C0CA 1W36B 5SY4A 2N46A 1CU1A 1W6RA 1Z13A 2DFTA 5EVCA 4F7WA 4ZI2A 4I50B 3ZUGA 1PPDA 1R18A 3PE6A 1N2BA 2D1FA 4Q34A 2YS6A 4TLEA 1AKEA 3STHA 1T8SA 2Z5LA 1QP0A 3SZLA 4KR9A 3T15A 3L9XA 4PG8A 2ODEA 2VHWA 2WJ6A 4JC8A 521PA 2JGDB 4MRAA 4AJNA 4C4ZA 2JIZD 3NXKA 1DIBA 4R6WA 4RVSA 5T64A 2H2AA 3HUFA 3GXBA 4JUAA 2ZETA 2HT1A 5CDGA 1SC9A 5F2NA 3AETB 4PO1A 3STVA 3A6DA 1HSOA 4LZZA 5DYIA 1MIOA 3H3FA 3QQ5A 3WBJA 1HE5A 2FSPA 2QT9A 2Q2WA 4I1IA 4C4PA 3L1JA 3DBRB 4WEOA 1XFDA 2QJRA 1NQ5A 1T9GR 4BMXA 1EUZA 2MSNA 1YVRA 4YAEA 3HDQA 3HXLA 2WTUA 2IGTA 4HEQA 1UFRA 5BNIA 3Q7PA 1F2UA 3ZVKA 3C15C 1JW9B 1RXCA 4XSHA 4PXAA 3R7DA 2J6BA 3V4SA 3WYAA 1E3WA 1C2YA 5TJ9A 2RGDA 3E05A 3B48A 3GEMA 5TQ2B 1HG0A 2XE7A 1G5TA 1SUWA 2JB9A 3FM9A 3RSZA 3TPCA 3IV2A 2OCIA 3HJNA 3PR2B 5B5SA 4MKHA 3ZVNA 2XUIA 5JNWA 1KJZA 2H31A 1CQDA 4IIJA 4ZGGA 3V7WA 1H2FA 1J2YA 4H1VA 1QYVA 2C4NA 2EKZA 2ZUTA 5B3LA 3P19A 4M1SA 3VFDA 3WP1B 4PS1A 2Y1XA 1R4AA 4MW7A 1CS0A 3VISA 2WIKA 1PNQA 4XSGA 1CWUA 2EJUA 1N6RA 1ZM2A 2OZVA 2VHEA 2NVOA 3Q9LA 3C16C 1PS8A 3T7SA 5H3CA 4L27A 2WTNA 5IP5A 1IOVA 2Z58A 4RNAA 4PWYA 4LHWA 1OZGA 2I3GA 2AG0A 2HRZA 3R3ZA 1HLPA 1CZNA 3C6XA 2CF5A 3QUBA 4RGVA 1STOA 2PSEA 3IMCA 3M6FA 4M7WA 5KNDA 3IPLA 4DKJA 1U2DA 3E22B 3QE3A 2NO9A 1OD6A 3JR7A 2C5LA 1PQ4A 1QDLB 3Q2KA 4PIPA 3HHPA 5IEJA 4FE7A 1C9JA 1PL0A 2MYTA 3ANMA 1N9ZA 4QDOA 4X9XA 4N8DA 1CV8A 3L0PA 3AMVA 3JD1A 2ZUVA 3DZDA 1B16A 4HDRA 3L8EA 3K0FA 2WPNA 2VYNA 1HT0A 3EZ7A 5J1TB 2OC9A 3VAZA 4AUKA 1PZFA 1YH3A 3JX9A 2B25A 1KDPA 1JZTA 1KY4A 1V5GA 1XZNA 2GEDA 3S5JA 3TTWA 1I1HA 3ZVMA 2HH5A 3QI2A 1UKYA 3VA7A 3NGXA 4RK0A 5BVGB 3QGMA 3PB3A 2FW1A 1GG2A 3CINA 4OGGA 5CBKA 8ADHA 3BRQA 3ISVA 2ZJAA 3ET5A 3ZE7A 1U1CA 5HJEA 3LC0A 3EE6A 4FFSA 2C7OA 1UBUS 4RVGA 1E0AA 4CUKA 1ACLA 1GPLA 4YWJA 1KDYA 2ONZA 3G0IA 1JILA 4G1EB 4FYPA 5AVOA 4W8GA 3L7OA 2IBIA 4KFRA 3N4CA 1XU7A 1B42A 2IP2A 3SJ7A 2BR5A 3KR1A 3FMFA 3LKBA 2FSHA 2I78A 2V1XA 1JE1A 3K31A 4GQIA 4N5HX 5CT4A 1H42A 1JQ3A 3NT5A 2V4UA 5FXMA 2CXHA 1LH0A 4DWJA 2VAXA 3BE6A 3LUKA 1GSIA 4L22A 3KQPA 3KEQA 4PNHA 5G4LA 3A9CA 5FBHA 2J9FA 4E2XA 2UZAA 5JBIA 2CB0A 5HP4A 1H3NA 2HC9A 3MPUA 2XA1A 3J7AC 3IUMA 4L75A 2W4QA 3RSCA 3WO1A 1QONA 4P7KA 4D0GA 4KRFA 1F29A 4NCBA 1SC6A 2PN1A 3FDIA 2WSSD 5EI5A 1P9NA 2WRZA 1DCFA 1W85A 4MPJA 4PPFA 1JHMA 1UIMA 2PANA 4XYGA 5EHXA 2ISCA 2WIGA 4L73A 5EIHA 1BHJA 3I09A 3TD6A 3PYMA 5L3QB 2CXUA 3QU5A 5AOVA 1KVQA 3ZS9A 4ZI7A 2WBLC 5DSZA 2QEQA 4Y30A 3LMKA 5I8PA 4AS1A 4ZCIA 3IUJA 2O23A 1Q44A 1Q1BA 4S0ZA 4LWZA 5FF9A 5J2TF 3NNDA 3RSSA 4EVQA 3IHLA 4G5SA 4LXTA 1TTHA 5DGIA 3IV7A 2FPIA 1V6SA 2QR3A 3ZK8A 2CUKA 3HL0A 4MUIA 4A6EA 3SXPA 3WGMA 3N1UA 4Q3BA 5HR5A 4H6VA 2R00C 4XA8A 5EQFA 3GZNB 1I6MA 4KSYA 3I6BA 4DJDC 5BV1A 1LPMA 4HLDA 4JK3A 5LQMA 5EIEA 2H2HA 3AJ9A 4HYQA 1W59A 1YNSA 3ZW7A 1XTRA 3HCPA 3H7AA 3PLNA 2GKOA 3ZCXA 2QZZA 1SBIA 1J9EA 4K86A 3ZI7A 1E1LA 4MVJP 2WKRA 4YXWD 4Q9KA 1YJCA 3I9MA 1NXWA 4EEKA 4GFDA 3IJPA 2ODWA 5EHGA 1G8MA 1U90A 3PC3A 5CCXA 4HT3B 2HA5A 5IRCD 3TM5A 3HO1A 2OYRA 1NUTA 3K8QA 3KLPX 4OAPA 2F8LA 1U0GA 1I33A 4A0QA 1GTSA 2ZWVA 4RY2A 4X6LA 2ZYIA 3LVQE 3CW9A 5FL7A 3ZHBA 2ZB7A 1ND5A 4FZVA 4BLVA 1JAYA 3H2YA 5ER6A 4WKPA 3WQQA 3I1YA 5HQTA 1Z0KA 2WP0A 4RMJA 3U4GA 2D6FA 1TZCA 2RHGB 2GJ4A 4KACA 2I65A 5KSYA 1BNCA 3OETA 3IR7A 3CU5A 4QLAA 1K9VF 2K4MA 3QUCA 2EOAA 1NATA 2Q07A 3SQDA 3BGOS 3UAYA 3VH2A 1I3MA 1MR3F 5DNUA 5LWQA 4FCVA 4IP0A 4FYYA 5IS2A 2AYYA 1L4MA 1P72A 1UAYA 2BM8A 2ATIA 3C8ZA 3RTAA 2JAWA 1PYOA 3HUTA 4CTJA 2JVIA 4Y6PA 4E30A 2I2AA 5INTA 4AY5A 5TF0A 3VR1A 1FIUA 3DZBA 1LY1A 3GVPA 3VR6H 5CPBA 1P9LA 4GZ6A 4PSCA 1CC1S 1NXXA 2C1EA 1M6WA 2J3DA 3DMGA 3NM6B 3A4LA 4FHEA 4FMDF 2QTMA 5ELMA 4ALJA 3I9V6 3OQHA 2NW6A 4U2FA 3JQCA 2O06A 5DTEA 1GGHA 2L17A 4NBUA 5EXXA 2A9VA 1JFSA 1O03A 3Q3EA 3QITA 5F1YA 1HR0B 1KO5A 4DIUA 5KQMA 2GX6A 3QLVA 2BI8A 3KELA 4Z8YA 5LLSA 4DLXA 3AFIA 2I8LA 2AN1A 2B8NA 2Q62A 2OLEA 2J0SA 4FEEA 3WMXA 4AF6A 1D7OA 2HRDA 2C61A 2DT5A 2QVBA 3P96A 1UXHA 4MULA 5AI4A 3V33A 4B7CA 3Q8LA 1ZCMA 1SCIA 4LOKA 3UATA 3UGQA 4CZ2A 4R1SA 1DFIA 1FY2A 2W9XA 4MRVA 5BW8A 3ICOA 4ZVNA 1JHOA 1R8JA 5E1MA 1CVRA 4YAKA 4DWOA 5E7JA 4TYWA 2C00A 3O1JC 3ROZA 2HUNA 2V74B 2AKEA 5L7TA 4Q7MB 1UK6A 4XR9A 4LXYA 1LC0A 5KQSA 2QRGA 1NM5C 3QFRA 4Z2AA 2LTAA 1D1SA 1N0WA 1U8AA 2N75A 2P3OA 2B7BA 4DC0A 4BLRA 1F12A 1TAQA 4G0ZA 1B2LA 3KSDO 4GKBA 4S2EA 3TLJA 4OX9B 3ZN2A 4EF6A 1U7DA 1OSNA 4KQWA 1TYEB 4ANFA 4PFKA 2XXAB 3LF2A 5CB6A 1TTTA 3OF8A 3QKSB 1DHRA 2QTAA 2VDLB 5K01A 5F98A 2J6HA 2C2WA 5DLPA 3G0OA 3RBXA 3ZWQA 2C2MA 1E4OA 1II0A 1E58A 3K1JA 4POAA 1ISIA 1WEHA 1MB3A 1F0NA 1R6AA 4F21A 1W36D 2CNKA 4UDYX 4KG7A 3NVKI 4X24A 3F9IA 4IQFA 4NYIQ 5DYGA 3WYFA 3KL2A 5KOYA 2E1RA 4HDCA 3E3NA 4CYMA 3M34A 3OZEA 3QIAA 4P34A 2AKYA 2DH5A 1CETA 3IHWA 4RD3A 4YRTA 3OO1A 4PZAA 2H4XA 3OSZA 2Q28A 1DQNA 5BPHA 1Q3KA 2HMYB 1E2BA 4EHKA 4C07A 3ZZ1A 3M81A 1QIHA 4BE7B 1K5HA 3IFUA 2XYVA 1IUNA 4FFPA 3PITA 3PL5A 2YJ6A 2REBA 3U3RA 2AS0A 4N39A 2JIPA 3FYTA 2E4XA 3ABSB 5DOZA 3TQCA 5BQXA 3W5JA 3ZHSA 3OECA 3JXEA 1ZCAA 1TJNA 3PF9A 2H9IA 4K46A 1F0KA 4KAFA 1ISSA 1GFZA 2AXNA 1G3QA 1XV5A 1G3IA 4OY3A 2HYIC 3NI2A 5BP7A 3SN6A 2GN6A 1P6QA 3B1WA 4AZ0A 4ARUA 1Z28A 1EFRA 3DVAA 3QV1A 4R2LA 2C1ZA 4XR4A 3REQA 4CMBA 3ABQB 5KTYA 3MUEA 5HCIA 2FSFA 4F4IA 3OQIA 1ABEA 3PTZA 1QHIA 1BMTA 1P6UA 4AUNA 3EHDA 1QWSA 3RIEA 5KJ1A 2HJSA 4QBGB 1WEKA 2P6OA 1SCKA 3QEKA 3I34X 3FKSD 5FAKA 2ZBPA 5JSUA 4RTSA 3HJFA 3EF1A 1OLOA 1XZIA 2QTFA 2JJMA 1W8DA 4JL8A 4MI7A 4PI3A 3PTAA 1XZLA 3MWGA 5JJLA 2ACTA 3KT0A 3GJ7A 3V00A 4E5UA 2XNDD 3R0IA 1VLMA 1Q57A 2VDPB 4JQOA 3SKYA 3NYRA 2JJ1D 4FKZA 4V3CA 1NVGA 4TMZA 1NQUA 4JODA 2OO5A 2II6A 5U4XA 4B44A 4JVMA 3RVDA 1I2DA 4DLPA 4NAUA 4NVRA 3CGWA 3JZFA 3K9MA 2YYAA 3HG7A 3NIWA 1E79D 4J94A 4MPPA 1JNYA 3EZFA 1J23A 1KIAA 1NVUQ 1OHHD 5H8WA 4RKEA 1WBBA 1MH1A 4BAUA 4YUWA 3VPXA 3D3JA 5DBHX 3BA1A 3JATA 5LYJB 5TARA 1TGYA 1NDUA 1OCEA 2RBEA 1YULA 4EDFA 1CSEE 1G8SA 1NKSA 1PZNA 2PWAA 4UVEA 5EJ5A 4LJ5A 4XYLA 2D3TA 3IE1A 1L5RA 4JZKA 1NURA 2EDAA 3S2YA 4B79A 1GPH1 3R3SA 4ZHQA 1IG0A 4URVR 1OI3A 2QUAA 1D1QA 3Q88A 2C9BA 3PNKA 4UBKA 3OZDA 5FOUA 1PNRA 4GVPA 4G8CA 1JJBA 3PUHA 4TQGA 2PKCA 4XDHA 3PPIA 1AUPA 4CG1A 1MA0A 2CL5A 3GCDA 3H5RA 3I12A 4JB2A 4V0KA 3W06A 1KYVA 4F5EA 3RG2A 1AMUA 3TBKA 4ENTA 4QU0A 4NI5A 2I3ZA 4B6PA 4UEJA 1OLSA 4KQIA 3JWPA 3HJBA 4H59A 5B6JA 1V45E 3K4PA 5GZ6A 1QP4A 3IQDB 3KNZA 5FI5A 3GGOA 1GIAA 2WYIA 4Y8VA 4CLOA 1T91A 3EIWA 3CZ9A 3K8ZA 1R9MA 3IQWA 3PPWA 1U5BB 3ROQA 8OHMA 1XHLA 3FNIA 4CMKA 2OB1A 4P31A 4BLOA 4Q3CA 2RGEA 4QYWA 1JEQA 5JAHA 2AYNA 1D8TA 3TTUA 4Y2HA 1ECFA 1ZC3A 2BE7A 2B61A 1BEZA 4I4TB 1NU6A 1QJ4A 3OEED 2HMAA 5ALLA 1E3DA 1WOMA 4UMEA 3TS1A 5C5DA 1HV8A 5IM4A 2B2CA 2K6GA 2PQ0A 3A4NA 2XWJI 5FWAA 1G1AA 3QVGB 4FHZA 3ACCA 1CY0A 2ID9A 1MAAA 1E3LA 2X0RA 2EGUA 2ZREA 4LC9A 3UFXB 3DOOA 4FC6A 4MQUA 1DIHA 1M1UA 4D6XA 2IH4A 2F9MA 3T3GA 3I3TA 4LOIA 1W4BA 4XQ9A 5K9ZA 3LBYA 4AQ7A 1ZZGA 4UHEA 3SZUA 1A9OA 3CO5A 4C05A 2OFPA 2AJBA 2ID7A 5BXQC 1QGYA 1Y3HA 2HY7A 2G25A 1QQ5A 3VI3B 1VECA 4Q1DA 4MKGA 4B5LA 3EAFA 4NS4A 3H2IA 3PRKE 4KTTE 3G82C 4Q8HA 1MKYA 1SM4A 4C4YA 3TM4A 721PA 3JYQA 4RSGA 5HVNA 4KPGA 4C6TA 3DVRX 1FBTA 5KYGA 4YIKA 1FUEA 3SJBA 4QNMA 1Y9ZA 1ZBDA 2RC6A 4NIMA 4P35A 1K68A 4AFNA 3IRVA 5K8JB 1TKAA 4JC4A 4ACBA 3TD2A 1ZI9A 2BGTA 1X1RA 3L4SO 1LDBA 4BNJA 5K0SA 1EK6A 1Y7HA 2BU3A 1QV7A 2XZDA 2OP3A 4XPIA 1ZMXA 4HDAA 4RZ3A 1LX6A 4CT5A 4EITA 4PHFA 5IFLA 2CMDA 1SIOA 4YWHA 3P4YA 5GJWC 4CF5A 4DN6A 2R8BA 3U3MA 5DEIA 2XYGA 4ZZIA 1Q22A 2CDBA 2WDPA 2X77A 3PFWO 2XB6A 2JKVA 2OZLB 5I7FA 2Q21A 2Q9CA 3BJIC 1FXWA 2P9ZA 3G02A 2HWKA 1X7WA 3HB7A 5SV2A 2IYYA 2EG5A 2XBUA 4A8HA 5DO9A 4Z3OA 1FQOA 1Q1EA 4JELA 3M1LA 2Z6AA 3U80A 5MN4A 4OXYA 1MO4A 1SQFA 3ICVA 1FOEB 1I14A 3EQ8A 3MUOA 1C7RA 4WW0A 1RS0A 3GARA 1VKOA 3HB4X 5GAJA 3I2FA 1UJBA 3QYFA 2ZGVA 3HDHA 4HMQA 4Q6BA 3LXMA 4DR4B 4WXMA 2IZ6A 3EBLA 1Y4AE 3LDFA 1T5OA 1UT8A 4LYYA 4OATA 1JT2A 4EGFA 5C7OO 1PGOA 2WUGA 3GPIA 1QJCA 3GEIA 3UB2A 4LSGA 3NBKA 4UUNA 4TMTA 1LI7A 4MEJA 5IN5A 3NEJA 2CD9A 2E4WA 2XGGA 4S35A 3L6RA 1NFQA 3CNQS 4CKBB 4H16A 3L1KA 2AFHB 5JA7A 4KLBA 5KTPA 3FMVA 3KOXA 4DYHA 5FTLA 1E6EA 2BCJQ 1FNMA 1OAOA 4RPCA 4XQEA 1L1QA 3UMGA 3W05A 3ZNNA 2IDMA 2NZXA 4DHEA 4EQ6B 1RQ2A 5HIMA 1NRWA 3GGSA 3E4DA 4LZPA 1PZGA 3F2VA 2PZMA 4K40A 3SS9X 2OB2A 4EFLA 4M87A 4UU0A 1O6BA 2IL1A 4FKBA 5FYQA 3JQ7B 1P33A 2AFHE 5FWXA 4XTCS 1ENYA 3KDSE 3WGZA 4M0WA 1J22A 4J7XA 4C22A 2VDWB 1HTBA 4CKWA 4X66B 3N8DA 4FK5A 4QGHA 3P2KA 1MQ9A 5GONA 3SR4A 2AJCA 1MTOA 2YIJA 4LZOA 1NFFA 1IN8A 5DXJA 5LN1A 2D5BA 4WXEA 2XGJA 2O54A 3MJTA 2BHNA 1ZUIA 2PLWA 4QQNA 2VYVA 1ODJA 1RYYA 4L28A 1UWKA 1E6MA 4X20B 3QENA 3QA9A 2Z9DA 4F2PA 2GAJA 4GOJA 4EKEA 5JNVA 2ZJ6A 4DNPA 4YS6A 2HJWA 1U0EA 1ULZA 5IT9A 1IWDA 3KVOA 3F75A 1ZDMA 3I53A 2AB0A 1PZXA 2ZT5A 4KH1A 1EA5A 1K8RA 4ZC8A 2RHHA 2Y0PA 3EJ6A 3JS5A 4J7CA 3DE5X 1IM5A 4ER3A 1DJLA 4PT5A 1ITZA 2BFBA 4O4HF 3CRZA 4MW4A 4BFLA 1DQRA 2OA0A 5CH8A 1XEXB 4HZIA 1ZVQA 4IUDS 4IFBA 1S5PA 3TTTA 1Z29A 2IT1A 1TJ5A 4CKZA 1Z2NX 3L77A 5LPNA 4UCXA 3KC2A 5F73A 5BWLA 1N4AA 1TEZA 1J21A 3I32A 3WGIA 1E4EA 1C7JA 4MQFA 4G0WA 3LUGA 2F6RA 1GWNA 3J7TA 3ABIA 4WBNA 1M9NA 5KCMA 4RXUA 2H07A 3PC2A 3STYA 4G0XA 5EHZA 1ZH6A 3PNVA 4BFZA 3ENQA 1CUGA 3T3EA 4KREA 3LPCA 3UAXA 1XD2A 4EATA 3AB7A 1V5FA 4KPEC 4NFSA 1UMBA 2O8EB 5KS2A 1NGSA 1UBKS 5EFOA 5J2UA 2QOEA 4M2LA 2QSZA 3SM9A 2H4WA 4OB6A 1YUMA 3ROPA 4B9EA 2HQ1A 2WI8A 3FX2A 3MT9A 2BVNA 2IUTA 2NWQA 4M0MA 3TOSA 3V97A 4EARA 3IMFA 1S1CA 2JGJA 4GDMA 1QE3A 2C4WA 1M1XB 3DNMA 4KWHA 9PAPA 1B3BA 4HH4A 4JBIA 3O1HB 1ATIA 2QSYA 1OT5A 2AVNA 2PBRA 4XYEA 3TBHA 4M8KA 4FT4A 4JJFA 3PQ4A 1EE1A 2JAUA 2QD1A 1YU9A 1QVAA 4EB8A 1A1VA 1DUIA 4URWR 2PLFA 4OQZA 4BZXA 1ELOA 3CZAA 4P33A 2NSDA 1HG1A 4O4LA 2P9CA 4ZU6X 2RGAA 5KOHB 2TMKA 2B30A 4OFWA 4PZPA 3OE7D 4JXJA 1LNSA 4RGQA 3D2AA 4P86A 4YRRA 1SXHA 1J1IA 3SZRA 1M0EA 1F2TB 1SWWA 5C7LO 1ZG3A 2RGXA 2WC1A 3QXSA 2QV0A 1QU3A 3DBIA 5DM1A 2ZAGA 5EUCA 4DZRA 5B58C 3U56A 1VP3A 2AS8A 4Q00A 1YKFA 2QX9A 2W58A 4QHTA 1NRJB 3ORSA 3FYHA 4EPRA 4ZCTA 4RLFA 3G8AA 4CMHA 1TK3A 3EYWA 1T8RA 3H6KA 4YJHB 1F1BA 2D7DA 1OXBB 2PTGA 4KQFA 1G18A 4XZXA 3MRVA 1WULS 4MIOA 1BD4A 4X97A 3RC2A 3M2PA 3PQCA 1FK8A 1Z7BA 2Y2UA 2DOKA 1GEEA 1TM2A 4IZ6A 2BMAA 1A98A 1PW5A 2J9GA 3PQ6A 4M0EA 3ZCTA 4R9SA 1WE2A 4IHJF 4BMZA 1BVHA 1IVYA 1EM8A 2FPRA 1Q17A 2GPJA 2PO5A 3M4YA 5TNXA 4D4HA 4PLPA 4WMLA 2AX4A 4B1FA 1EI9A 1GAXA 3IOQA 4MUHA 3O65A 4JLPA 5DN9A 2LZ0A 4DQ0A 1RBMA 5G40A 1GGFA 3OMWA 5DI9A 4AZ3B 4PCAA 2VAVA 1KOJA 3HKCB 4BQVA 4IQ8A 5IBQA 4BTVA 3BWCA 4UNRA 4BKOA 2QM3A 1Q1AA 1E60A 2JH9A 3G5LA 1UWVA 1FVXA 2JVKA 4E3ZA 9ABPA 5EJ7A 2G88A 3RS8A 3LYUA 4DMFA 4YONB 1UEXC 2YYYA 3Q9UA 2GTHA 4OXNA 1DWOA 3L8YA 2EKDA 1T0IA 4K88A 5L45A 2A0XA 1Z75A 3EVNA 2FXIA 1TCVA 1MRZA 3TE6A 4EYOA 1W2HA 4X7BA 4PLWA 1Q20A 2GRAA 1KAEA 1DZIA 4IJ6A 2WD7A 4KQ2A 2BTEA 1DMSA 1MDWA 4X6JA 4DOMA 2VF4X 4RVUA 2P0YA 5F64A 3WWDA 5I7UA 3SZGA 5ALHA 3HN6A 4W5OA 2WP8J 3MWJA 4PX3A 1ZM3A 3F71A 1G0OA 3IEIA 1NBOA 2WM9B 1XMPA 1H5NA 3CTPA 3CY6A 4HBZA 3NEYA 4NNPA 3VYRB 4BFVA 5AJYA 4BRSA 4IO0A 3GLGA 5FQOA 4IIHA 3UHFA 5LMZA 1N32B 2OV1A 2CMKA 3GLTA 3R3WA 2QY6A 5IX8A 2DOSA 1TJYA 2R47A 4NZNA 4QOSA 3GG2A 1NBEA 1MOPA 6LDHA 4X6HA 1LSUA 2ZUFA 1B1AA 3YASA 3L7YA 2OULA 4G01B 5LQJA 3GJRA 3ZV5A 4Y2GA 4P16A 1A2OA 3PDUA 3K9HA 4Y9TA 1E0KA 3I0NA 4PLHA 4XE5A 5BQOA 5ITSA 2NQ8A 2HWUA 5AKLA 1P3DA 3ZE9A 2G17A 4R2WA 4YFYA 3E6AA 1ML3A 2OHOA 2WTBA 4R7TA 3W8EA 5HSGA 3EX7C 1GAWA 3ZGYA 2R9OA 1PU2A 2ZJ0A 1HF3A 2E37A 4PXYA 5B58T 4C4OA 1WB6A 3SQXA 1EFLA 1H9CA 4LMPA 2EWVA 3GDWA 1RC1A 2VSNA 1Z16A 1ZITA 2JAPA 3ZWWA 1K0FA 4K81B 3MHTA 1VE3A 3FPHA 1L1RA 3JQ8A 5GZ1A 5C1PA 2B4QA 2GHQA 5F9FA 3P0JA 1KH1A 1LI5A 4FX5A 1PTJA 4R31A 2C8KA 2RK4A 3L1HA 1TM5E 4CPDA 3TZLA 5JAMA 3TQTA 3E61A 1KK1A 1JHXA 2H4ZA 1D07A 3G17A 1XVTA 5CHVA 2OO3A 3OPVA 2ZU6A 2CT8A 1HY3A 1JPVA 4YP1A 4ND6A 1VIMA 1V95A 1XVAA 1AA9A 2EZ4A 4FGSA 1FNNA 2VRCD 4MICA 3VU3A 3RYFA 3UBMA 2HPVA 4KFUA 5KZMB 1OPXA 1FYXA 1KAMA 4WVFA 4BCCA 5ABPA 3KWZA 3RABA 1N5RA 1QRRA 5CK4A 2EX1A 2ZT7A 5DCUA 3OPQA 4TVBA 1EUDB 2ORVA 1HQCA 2CB5A 1WO8A 4PINA 4YV7A 1GA6A 2P3QA 1NI4A 1G8FA 4B3DA 3MHSA 3D4PA 1FRNA 2C7GA 3EVFA 4LCJA 5B37A 3V1YA 3IYLW 3W34A 1T4GA 5C51B 1PFYA 2CVHA 3A36A 1CQZA 3ESXA 4Q18A 5JLJA 4ND2A 3GCWA 3WKAA 4UU8A 4B71A 1C4KA 1ZSYA 4YI3A 4C30A 3R9IA 4UHJA 3KQQA 2NAPA 4LY3A 2ZWIA 3LP8A 2WD9A 5LXTA 4KLCA 4W4TA 1UPTA 3T7DA 4YYWA 3CGGA 1E4VA 3UT0A 3OF3A 1J8VA 5A3VA 5HMMA 4NY1A 1SQSA 4N3GA 4BN5A 6CHYA 2UVPB 2XVXA 5DCLA 1EZ4A 5K5EA 2IS4A 4RKWA 4ZJUA 3DKRA 3GAMA 3QX3A 2C2YA 4R2XA 3RC7A 4EPTA 4EMTA 4ZRDA 5KYXB 1FRVA 1U8ZA 2CNWD 5ADVA 1A95A 1HOTA 1FFGA 1MAVA 2Q3BA 2XYQA 4EA7A 5I6DA 1N6HA 2HJVA 2YVUA 1USGA 3ECAA 2PRYA 4FW8A 4K9NA 1EGQA 5C3UA 3NHFA 1UBEA 1DCTA 3RRJA