5F0GA

Structure of the glutathione transferase delta 2 from drosophila melanogaster
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
212
structure length
207
Chain Sequence
MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGLMAMKALFDARKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase D2
publication title Characterization of a Drosophila glutathione transferase involved in isothiocyanate detoxification.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 80
structure length 207
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f0gA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f0gA01
3GH6A 3EE2A 1C72A 4XHMA 2CAQA 3ERFA 1FB0A 1JZDA 3DMLA 2VO4A 4POKA 4K1FA 4JR6A 3N9JA 5DAKB 2FA4A 2NVLA 1XPVA 5J3RA 1GNEA 1G6YA 1UC7A 1A0RP 1VGLA 2YWNA 2L6CA 1OC3A 4HZ2A 4NV2A 1RW1A 4Z7XA 3LFLA 1FG4A 1PMTA 3HZ4A 1XWAA 1BJXA 3M9JA 3KD0A 4V1Ag 4AJ7A 3P90A 4TR1A 2CVKA 1TOFA 5HR0A 1YQ1A 1J9BA 4MF6A 2YANA 2R5GA 4G0LA 4PGTA 3TJJA 4POMA 3VWVA 4RI6A 5F05A 4QQ7A 1TRSA 2GQLA 1R4WA 2GT6A 4PUAA 3F3QA 1YY7A 2FNOA 2R2JA 2VCZA 1NHOA 4KCAA 4EDYA 4RUVA 1JZOA 5C04A 3FZAA 2G0FA 1U6TA 1XOBA 4GSSA 2TRCP 3F8UA 4I5QA 3QAVA 3TJKA 2XC2A 3HVVA 4MK3A 1YKCA 2JU5A 5AIXA 2H72A 1ABAA 3TJGA 3E3EA 3UBKA 1SENA 3ED3A 2I4AA 1T4YA 2MMZA 4OD7A 2X8GA 2H1DA 1B9XC 2P5RA 4HQSA 2DJ3A 5AGYA 3ISOA 4O7HA 3GURA 4LA1A 2HSYA 4HOJA 3ZLPA 5G1KA 1ZYEA 1GSSA 2VD0A 4FH8A 5F06A 4TXOA 1ZGNA 2E2GA 2AV4A 4K9ZA 4ILFA 2NBSA 1EOGA 3CRTA 3WD6A 1VF4A 3O3TA 2FWFA 4YAVA 4BVYA 2O85A 3VFIA 4BWQA 5DCHA 1GSUA 1XVQA 2PVQA 5IOWA 4FYCA 3ZRDA 4EO3A 2R4VA 1URMA 4TN8A 3HJOA 2EIRA 3F0IA 3APQA 1U88A 3DGQA 2E2MA 2E7PA 2HFDA 3KTLA 1X0RA 2JSZA 2FWEA 3FR9A 3RHBA 4IP6A 4JU5A 2DBCA 2LS5A 3DD3A 2QKEA 3D6IA 3TOTA 4HZ4A 4HU7A 3HD5A 4G9HA 1Z7RA 3LJRA 1HD2A 4MF7A 4P3YB 3HCZA 2DC5A 4WF4A 5C00A 2MZCA 3ZZXA 2HLSA 3KTBA 3VPQA 2H0HA 3WGXA 3IV4A 1V58A 2H6XA 2CZ3A 5IIZA 1DUGA 2J23A 5G2ZA 1THXA 3EMPA 2VCWA 3ZFBA 1K3LA 5B8BA 2RUEA 4E8HA 1BG5A 1LJRA 2N5FA 2VAFA 4MPFA 2VCTA 1I9DA 3LSZA 5E4WA 4JBBA 1GWCA 1U3IA 11GSA 2L5LA 3WGDA 4HJ2A 1N8JA 2YV9A 3Q18A 1X9WB 3QAGA 1B9YC 1I5GA 4TXVA 4Q5NA 4GQFA 2YWIA 3F4RA 3ME7A 4FYBA 1A2LA 3H4KA 4HU9A 4EVMA 4YQMA 4LMWA 2UZ8A 5A4VA 2GQKA 5ELAA 2LKUA 3Q6OA 3UVTA 4G10A 3VWXA 3IC4A 2PMTA 5JWQB 4XRDA 2FCHA 1EZKA 2GDRA 3A5WA 2YOIA 3LWAA 4ZBAA 3J7Yk 3HVXA 3VURA 1XCCA 3UL3A 3RHCA 2IWTA 4L0UA 2RIIA 3DXBA 2LNSA 3IPZA 3CRUA 3CTFA 2V32A 3G7YA 14GSA 1WWJA 2V41A 5EPFA 3Q74A 4Q5FA 1XW5A 1ON4A 1S3DA 1FVKA 3M3MA 3GNJA 3ZYWA 22GSA 2P5QA 3SWLA 5A4UA 5CRWA 4FIWA 3L9SA 2C3TA 2ON7A 2LEGA 3GH9A 3A2VA 2G2QA 3H8QA 1T3BA 4BVXA 3EMXA 5D9WA 1O8WA 4EDZA 4TKYA 3CMIA 4X43A 4ZL9A 2H70A 1SJZA 1UVZA 5IO2A 2IL3A 3F3RA 3IHQA 5FWGA 4K8MA 4YQUA 5B6MA 3DVXA 3EU4A 1V9WA 2DMLA 2JSYA 1PX6A 4MF5A 2A2RA 3L9UA 2LV3A 5FT3A 1OVNA 5IMFA 5DALB 3UVHA 5IMDA 2RUFA 2YWMA 2GZYA 2H6ZA 2H75A 2H0GA 4NHWA 3MWHA 3QMXA 4PURA 4J2FA 1EV4A 4E8EA 3P2AA 4WETA 1KEBA 2MBSA 3GA4A 2DMMA 1QMVA 1OC9B 4XS4A 1SK1A 3KIJA 2XHFA 2C4JA 3WT2A 2YZUA 2CV4A 2YJ7A 3GTUA 2WRTA 4LLRA 1USBA 5IMZA 4KUNA 3FKFA 1ZZYA 4TRXA 3EURA 2V6KA 2E0QA 1YKAA 4ECCA 3C8EA 3GN3A 4ZB9A 4F0CA 1BYEA 1XOAA 3FHKA 1UA5A 2V6OA 2BJXA 1KTEA 1XWGA 2RLIA 2HE3A 4POBA 3TRXA 2KUCA 2HZEA 1SU9A 3FK8A 3GMFA 1GUKA 1AAZA 2EC4A 3C1SA 2CVBA 3HXSA 1ERTA 1FB6A 4USSA 1M2BA 3LXTA 2VCVA 2P0GA 4GWRA 2H74A 1XIYA 3GKKA 1K0OA 4PQ1A 3I43A 1SKSB 4ML1A 3KM6A 2WGRA 1AQXA 1GUMA 1ILOA 1GSEA 4OWYA 1SL0B 1V40A 1ZOFA 2PU9C 1TXXA 4DSSA 4CDOA 2YJHA 2IFQB 4NXIA 1K0AA 4I2TA 4EL1A 2XPEA 5BMUA 2KP1A 1NHYA 4WF5A 1EEJA 1DSBA 1XBSA 2D2ZA 1AW9A 2AUVA 2FHEA 1X5EA 2JZSA 5A5KA 3QFBC 2ALBA 2H1AA 2L5OA 5ID2B 3KH9A 1W89A 5DAKA 1G7OA 2H76A 2YV7A 4GTUA 3H93A 4WBRD 4LL1B 1A23A 4HUAA 3QCPA 3GKXA 1SJIA 1X5DA 2YNXA 1ML6A 4MP4A 3ZIVA 2NPBA 5B8AA 4MH3A 5F8BA 3L9VA 3KP8A 5D9VA 5CRGA 1GTAA 1SD9A 3EVIA 3QAWA 3W8SA 5H5RA 1TJDA 3F4TA 3NIVA 5D96A 4MJBA 1M7TA 4V2NA 5ENUA 2HSMB 3C7MA 3SBCA 5DJMA 4KDXA 2CQ9A 3M9KA 1M2DA 2F9SA 3FZ5A 5DBQA 3ZL5A 3F6FA 1GSDA 1N2AA 4KCEA 4KA0A 4MJEA 2M72A 3TRPA 3QD9A 4NMUA 1XWKA 2K8SA 2FUG2 4EKZA 1BAYA 1SYRA 3TJFA 4I8BA 4POLA 1GTBA 2VL3A 1B4QA 1Z6MA 2V1MA 3C73A 4XS1A 5FHIA 1OKTA 1G7EA 4F2IA 1HYUA 4N0ZA 1QQ2A 6GSYA 2N5AA 1NM3A 4EC0A 3LEFA 5ECIB 4G2EA 1B4PA 4YAPA 1GNWA 3IOSA 5IMCA 4I2UA 3M8NA 5LD0A 3BOAA 2IMKA 1WPIA 4KAEA 2GS3A 2L59A 3GV1A 2DIZA 5ECHB 2AAWA 1M0UA 4V2LA 1WMJA 2DLXA 5CREA 2QGVA 1YF1A 1MDKA 4GQCA 1HNCA 1A8LA 2HRFA 1CQHA 2DJ2A 2VUPA 4ZB6A 4GF0A 3ZMKA 4TR0A 3IK9A 8GSSA 1M9AA 4PNGA 3GL5A 4IS0A 3DYRA 2X8HA 3VWUA 3TKRA 1GTUA 3M1GA 1MD4A 3I69A 5DDLA 3H1NA 1ZMAA 4XS6A 5JCGA 3UEMA 4ZIJA 1AQWA 1NSWA 4KDYA 4MZCA 1V57A 1PD21 3QFAC 5KN1A 2R6KA 3DWVA 2GVPA 1PRXA 4Q5QA 4JEDA 2K8VA 3D4MA 1K0MA 3HJPA 5AN1A 5EVOA 3QDNA 5CYYA 2C80A 4WXTA 1X5CA 3APSA 2RM5A 2H8LA 1GSQA 3ZMLA 3CYNA 3GKNA 3KH7A 2VLTA 2GLRA 18GSA 5IM9A 4IW9A 3U5RE 1R26A 5ECPB 5ECRB 1K0DA 5A4WA 2JZTA 2YWOA 4BWSA 3TDGA 1SK2A 4J57E 2OJLA 3KGKA 1GULA 2HRKB 1FHEA 2H01A 5ABRA 2IMFA 3KMOA 2IN3A 3FR3A 3NOFA 4X0XA 2AHEA 5CP1A 3UMAA 4JZQA 2PBJA 4H86A 4TOPA 3D21A 3DRNA 5G30A 5ECSA 1A0FA 3ME8A 1X9MB 4GSNA 1ACVA 4DSQA 1WIKA 1IYIA 2GQMA 1MDJA 2DJ0A 1TKDB 4OFTA 3K8NA 4WKWA 4YQVA 4BVYB 2IPAA 3BCKA 2X64A 2X8CA 1SL1B 1SKRB 2M80A 4AF2A 2HQTA 1K3OA 1THOA 3UBLA 5ECOB 2B6MA 4WR5A 4V1Ap 4K6XA 3BCIA 2OE0A 2LNTA 1O7UA 5LCZA 2WB9A 1T8EB 5GAND 5DQYA 5IQYA 3QOUA 4PXOA 1TK5B 1BX9A 4HI7A 6GSWA 1A8YA 2PPTA 1HNAA 1EGRA 4MDCA 1TI1A 4TVEA 2PWJA 2VL2C 2CT6A 2ZUPA 4K0NA 3IK7A 2VLUA 2WFCA 4IQ1A 2WZ9A 4ZL7A 5JCUA 1YF0A 2TRXA 1JLVA 1M2AA 1TRWA 3VLNA 3EINA 3E0UA 1ST9A 4EUYA 5GSTA 5JWRB 2HNLA 3CSHA 1F6MC 4AGSA 3WGEA 2KLXA 3BD2A 1VF1A 5HFIA 2VCXA 9GSSA 4KSOA 6GSSA 1T1VA 1PN9A 2IIYA 4JRRA 3V1WA 2VD1A 20GSA 1G6WA 3C1RA 4KGIA 4XIHA 3DIEA 3ERWA 3GIXA 3GKMA 1XXUA 1MD3A 4PTSA 2CAIA 5GZZB 1GSFA 1A2JA 3HZ8A 5H5SA 2H0IA 2B5XA 4X1UA 4QL9A 4N0VA 5IOXA 2F8AA 5H5QA 1GLPA 5JWOB 2PN8A 4MJAA 4MMMA 3BBYA 2K6VA 5F0GA 1EV9A 3D22A 5IMVA 5IMAA 4G0IA 4WEYA 3FW2A 2VCQA 3F4SA 4GRFA 2F3MA 7GSSA 4K7NA 2N5BA 2AJQB 2OE1A 3RAZA 3GX0A 3TB2A 1SKWB 3D0ZA 3NZNA 1GH2A 2I1UA 1OE8A 4PX1A 4KB3A 4F03A 4L0WA 5INYA 4NV5A 4O92A 1R5PA 2H71A 4DVCA 2QC7A 3GHAA 3F63A 2LRCA 5D9XA 5KEJA 3GFKA 13GSA 4IVFA 3G9BA 3ZIJA 2VM2A 4G19A 2GZPA 4PUFC 3VI7A 2JACA 1T7PB 3ZFLA 2JZRA 3UAPA 4ZXGA 3FYGA 1ZCPA 4GCIA 2DSAA 4BPYA 4GLTA 1Z6NA 1F3AA 1WJKA 4BA7A 4F9ZA 1FW1A 2B7JA 5GSSA 1F37A 1OKDA 4IHUA 4BVXB 3UJ1A 2PERA 3N5OA 2PUKC 4IN0A 1SL2B 4FO5A 4L8EA 4RQRA 4RQXA 3KJYA 1XWBA 2H1GA 3S9FA 3G7JA 1Z5YE 3J7Yb 1DE1A 3TKSE 1E6BA 1PL1A 4BL7A 1BQ7A 4HQZA 3WYWA 1AQVA 5HR3A 1RQMA 2IFQA 3G7IA 3O6TA 3IR4A 2KHPA 3IE3A 4DEJA 1XW6A 3LORA 2CZ2A 1K0CA 4IBPA 4NHZA 3JCML 3R3EA 3W8JA 1CQGA 5DCGA 5ID2A 3HA9A 2H6YA 2C0FA 4ZILA 1QK8A 3TKQA 5J9BA 1GRXA 1H75A 4IKHA 3HKRA 4Q5RA 4TR4A 1PGTA 1KNGA 1LBKA 1GSYA 3IDVA 4HJMA 2K18A 4HDEA 4JE1A 2REMA 1Y25A 2P31A 2VLVA 1B48A 2GSSA 5AIVA 3VK9A 2VIMA 17GSA 3TCOA 5G31A 4PNFA 3PINA 1ERVA 4EXJA 3O76A 2HT9A 2J9HA 2LUSA 1YZXA 2HXKA 4MH2A 1XFLA 2LQQA 2HZEB 2HSMA 5ECNB 1AIUA 2O87A 1GP1A 2HYXA 4AJ8A 4ZL8A 4XCSA 3HJMA 1XWCA 1Q98A 3EWLA 5B6NA 2CX4A 4D73B 4N30A 3BJ5A 4ZBBA 1K3YA 2VL2A 1YJ6A 2GGTA 1TK8B 2LTKA 3VI5A 4K7IA 4NWYA 3IRAA 1M99A 2NDOA 3FRCA 2B1LA 2Z9SA 1PKWA 2C8UA 4OCEA 4O5RA 3TKSA 3F9UA 4V2MA 2L6DA 3ZVJD 2GTUA 2NTOA 1JHBA 1EP7A 3PPUA 2YZHA 2FD3A 4QL7A 2FY6A 1YDKA 3TGZA 3GRXA 2L4QA 1PA3A 1A2MA 5J9CA 2F8FA 4HEA2 5KN0A 1F2EA 4XTSA 5ECQB 5D9TA 2MMOA 4OCFA 4EE0A 2ES7A 2FGXA 5ECKB 1QFNA 1AXDA 1MEKA 1O8XA 2LJKA 2O7KA 1EP8A 5GAPD 6GSXA 2CX3A 2WJUA 3AY8A 1OYJA 3IAM2 2DJ1A 1GTIA 4ML6A 3PR8A 3EU3A 2DJJA 3W6GA 1X9SB 2MYGA 3E9JB 3EYTA 3GUSA 4KDUA 3VWWA 2FLSA 2WDUA 4ISDA 3VPTA 4KSMA 2WULA 2ON5A 5D73A 4KNDA 2IMDA 1QXHA 2MMAA 4OO4A 2ZCTA 1PKZA 4N10A 1R7HA 3IC8A 1WE0A 3IAS2 1TU7A 3L0HA 1XW9A 1F3BA 5E59A 3RPPA 1JZWA 3TKPA 2XBIA 5EY6A 2LRTA 4TR1B 1J08A 5JCWA 3MAKA 5DQSA 2H19A 4ZBDA 1HQOA 4F0BA 1RK4A 5B7CA 2GT5A 3FR6A 5J4UA 3UOMA 2HRKA 2HRAA 2B1KA 4MCUA 5HQPA 2LJRA 4JR4A 2F51A 3ZVJA 3LGCA 3KEBA 4WR4A 2QSIA 3H79A 1FO5A 3D5JA 5ELGA 5DJLA 3LG6A 1MDIA 3U6VA 1T00A 4OMVA 3ERGA 4MJCA 2B7KA 3FEUA 3RDWA 16GSA 2O8VB 2IMIA 1XVWA 4YH2A 1SJ6A 4KX4A 2FA8A 5HR2A 3GX8A 1S3AA 4AJ6A 3F6DA 1IYHA 2C0GA 2H1BA 1O81A 1E2YA 2PGTA 2OBKA 3GL3A 1HNBA 3KP9A 2OKAA 4TXOB 3CBUA 4ECIA 1U87A 3CTGA 3P8WA 5HFKA 4KH7A 4CHSA 1S3CA 5COHA 2M46A 1M9BA 2I9HA 1Q4JA 3HY2A 5ECLB 2C0EA 1JZRA 4L5OA 2LJAA 2YN1A 4L5LA 3ZREA 4PQIA 2CA8A 5G5FA 1PX7A 5KN2A 3APOA 2MBTA 1GUHA 2GSRA 3L4NA 5LNKe 3KMNA 2EIOA 2L4CA 3GYKA 4K0GA 1K0BA 4KE3A 4ECBA 1FOVA 1MTCA 2B3SA 3RBTA 1YEPA 2YP6A 2AYTA 4FQUA 3TKSC 2A4VA 2AB6A 2B5EA 2DJKA 2TIRA 3TUEA 2H66A 4J56E 1FVJA 5IO0A 3DKSA 4OFNA 4I97A 5F07A 3CSIA 4LL4B 1WP0A 2FWHA 2C3NA 2HSHA 1AUCA 3MNGA 3LQ7A 5ECMB 2LSTA 12GSA 2YCDA 2O89A 3KZQA 4WBJA 2GZZA 1OC8A 1AC1A 5CAXA 1O6JA 4EF0A 2H30A 5D8IA 1Z9HA 2JL4A 1TK0B 2KP2A 3L78A 3DVWA 4MZWA 1GL8A 5DALA 3I9V2 1VF3A 1EGOA 3CXGA 4HS1A 2VL9A 1F9MA 6GSVA 3ZITA 3GSSA 1GLQA 1SYXA 5KN3A 3C71A 1ERUA 2C1YA 1DE2A 2R37A 6GSTA 3IXRA 4RI7A 2I81A 4PQHA 1G0TA 1OC9A 2IJYA 1BEDA 2OA7A 1VF2A 2B5YA 3HHVA 4IELA 4K7OA 2IMEA 4TW5A 5CNWA 5G1LA 2LQOA 1PQNA 1SK0A 3IA1A 2XBQA 1UN2A 2HRNA 4NPBA 1JFUA 5IPHA 3HVSA 1FAAA 5J41A 4G0KA 2GSQA 3R2QA 2FWGA 2K9FA 2ZNMA 2I3YA 3TJBA 2BTOT 5CO3A 2VOCA 1A24A 4GSTA 2OACA 4IJ3A 1WRYA 4ULXA 1V98A 3QR6A 3M0FA 1TRVA 3UIWA 2RM6A 4I6XA 1XZOA 1PSQA 3FZ9A 5G5EA 3ZTLA 3FZ4A 2L57A 4GXZA 2X99A 1J0FA 4OFMA 2A2SA 1T4ZA 3UARA 3EC3A 5CRDA 3GSTA 4O32A 2VM1A 4ECJA 2KOKA 4FYUA 1ZYQB 1Z3EA 2HI7A 3LYPA 4NAXA 3US3A 4IGJA 4ACSA 1Z7PA 5HR1A 3MDKA 4F82A 2C0DA 5CRHA 1YEXA 2JADA 5D93A 4MA9A 1TP9A 3A2WA 3HDCA 2LRNA 2CVDA 1QGVA 4MPGA 2DIYA 1Y6EA 3TRQA 1H4OA 4OO5A 4ID0A 3Q19A 4XS4B 4N11A 5IPGA 3I6AA 1TI3A 5EL8A 1O73A 3RPNA 3WT1A 4D73A 3MSZA 3PH9A 2OBIA 2WCIA 5HFGA 3FY7A 3GTUB 3QPMA 1TTZA 4CW9A 1B8XA 3IBHA 5J5NA 1KBNA 1W4VA 3DEXA 3KCMA 4KW6A 1PL2A 1TU8A 2WS2A 4MZBA 3TOUA 1EOHA 19GSA 2XPDA 1SD8A 5DVBA 1O85A 4IJIA 3D4TA 1LU4A 5AISA 1V2AA 6GSUA 2PVOC 3LXZA 3PGTA 1OAZA 1VRSD 1TW9A 1ZL9A 1NW2A 3CSJA 1TDIA 3KXOA 2GSTA 1OE7A 4BL7B 1QUWA 2MMNA 4KF9A 4LMVA 4K2DA 2R3XA 1U3AA 2V2GA 5L71A 4TR3A 2OADA 2YPMA 3A2XA 4MLYA 2OE3A 1EWXA 3LYKA 1DBYA 3HYPA 2EIQA 2BMXA 4XRAA 2H73A 3P7XA 4IQAA 4IP1A 3A3TA 2C3QA 2HZFA 1ERWA 4DSRA 10GSA 4DSSB 1JLWA 4ZB8A 4MABA 1EEMA 3OR5A 1R5AA 1K0NA 1WOUA 2HSNB 1TRUA
chains in the Genus database with same CATH superfamily
3GH6A 3EE2A 1C72A 4XHMA 2CAQA 3ERFA 1FB0A 1JZDA 3DMLA 2VO4A 4POKA 4K1FA 4JR6A 3N9JA 5DAKB 2FA4A 2NVLA 1XPVA 5J3RA 1GNEA 1G6YA 1UC7A 1A0RP 1VGLA 2YWNA 2L6CA 1OC3A 4HZ2A 4NV2A 1RW1A 4Z7XA 3LFLA 1FG4A 1PMTA 3HZ4A 1XWAA 1BJXA 3M9JA 3KD0A 4V1Ag 4AJ7A 3HMJG 3P90A 4TR1A 2CVKA 1TOFA 5HR0A 1YQ1A 1J9BA 4EIQA 4MF6A 2YANA 2R5GA 4G0LA 4PGTA 3TJJA 4POMA 3VWVA 4RI6A 5F05A 4QQ7A 1TRSA 2GQLA 1R4WA 2GT6A 4PUAA 3F3QA 1YY7A 2FNOA 2R2JA 2VCZA 1NHOA 4KCAA 4EDYA 4RUVA 1JZOA 5C04A 3FZAA 2G0FA 1U6TA 1XOBA 4GSSA 2TRCP 3F8UA 1BG1A 4I5QA 3QAVA 3TJKA 2XC2A 3HVVA 4MK3A 1YKCA 2JU5A 5AIXA 2H72A 1ABAA 3TJGA 3E3EA 3UBKA 1SENA 3ED3A 2I4AA 1T4YA 2MMZA 4OD7A 2X8GA 2H1DA 1B9XC 2P5RA 4HQSA 2DJ3A 5AGYA 3ISOA 4O7HA 3GURA 4LA1A 2HSYA 4HOJA 3ZLPA 5G1KA 1ZYEA 1GSSA 2VD0A 4FH8A 5F06A 4TXOA 1ZGNA 2E2GA 2AV4A 4K9ZA 4ILFA 2NBSA 1EOGA 3CRTA 3WD6A 1VF4A 3O3TA 2FWFA 4YAVA 4BVYA 5A34B 1PFOA 2O85A 3VFIA 4BWQA 5DCHA 1GSUA 1XVQA 2PVQA 5IOWA 4FYCA 3ZRDA 4EO3A 2R4VA 1URMA 4TN8A 1YVLA 3HJOA 2EIRA 2UV8G 3F0IA 3APQA 1U88A 3DGQA 2E2MA 2E7PA 2HFDA 3KTLA 1X0RA 2JSZA 2FWEA 3FR9A 3RHBA 4IP6A 4JU5A 2DBCA 2LS5A 3DD3A 2QKEA 3D6IA 3TOTA 4HZ4A 4HU7A 3HD5A 5KOXA 4G9HA 1Z7RA 3LJRA 1HD2A 4MF7A 4P3YB 3HCZA 2DC5A 4WF4A 5C00A 2MZCA 3ZZXA 2HLSA 3KTBA 3VPQA 2H0HA 3WGXA 3IV4A 1V58A 2H6XA 2CZ3A 5IIZA 1DUGA 2J23A 5G2ZA 1THXA 3EMPA 2VCWA 3ZFBA 1K3LA 5B8BA 2RUEA 4E8HA 1BG5A 1LJRA 2WW0A 2N5FA 2VAFA 2WW3A 4MPFA 2VCTA 1I9DA 3LSZA 5E4WA 4JBBA 1GWCA 1U3IA 11GSA 2L5LA 3WGDA 4HJ2A 1N8JA 2YV9A 3Q18A 1X9WB 3QAGA 1B9YC 1I5GA 4TXVA 2OT3A 4Q5NA 4GQFA 2YWIA 3F4RA 3ME7A 1XG8A 4FYBA 2WVXA 1A2LA 3H4KA 4HU9A 4EVMA 4YQMA 4LMWA 4BIKA 2UZ8A 5A4VA 2GQKA 5ELAA 2LKUA 3Q6OA 3UVTA 4G10A 3VWXA 1Y1UA 3IC4A 2PMTA 5JWQB 4N3ZA 4XRDA 5A1NB 2FCHA 1EZKA 2GDRA 3A5WA 2YOIA 3LWAA 4ZBAA 3J7Yk 5J47A 5BRTA 3HVXA 3VURA 1XCCA 3UL3A 3RHCA 2IWTA 2WVZA 4L0UA 2RIIA 3DXBA 2LNSA 3CTFA 3IPZA 3CRUA 2V32A 3G7YA 5J40A 14GSA 1WWJA 2V41A 5EPFA 3Q74A 4Q5FA 1XW5A 1ON4A 1S3DA 1FVKA 3M3MA 3GNJA 3ZYWA 22GSA 2P5QA 3SWLA 5A4UA 5CRWA 4FIWA 5KOWA 3L9SA 2C3TA 2ON7A 2LEGA 3GH9A 3A2VA 2G2QA 3H8QA 1T3BA 4BVXA 3EMXA 5D9WA 4QMKA 1O8WA 4EDZA 4TKYA 3CMIA 4X43A 4ZL9A 2H70A 1SJZA 1UVZA 5IO2A 2IL3A 3F3RA 3IHQA 4YKGA 5FWGA 4K8MA 4YQUA 5B6MA 5J4VA 3DVXA 3EU4A 1V9WA 2DMLA 2JSYA 1PX6A 4MF5A 2A2RA 3L9UA 2LV3A 5FT3A 1OVNA 5IMFA 5DALB 3UVHA 5IMDA 2RUFA 2YWMA 2GZYA 2H6ZA 2H75A 2H0GA 4NHWA 3MWHA 3QMXA 1SVLA 4PURA 4J2FA 1EV4A 4E8EA 3P2AA 4WETA 1KEBA 2MBSA 3GA4A 2DMMA 1QMVA 1OC9B 4XS4A 1SK1A 3KIJA 3IHGA 2XHFA 4W66A 2C4JA 3WT2A 2YZUA 2CV4A 2YJ7A 3GTUA 2WRTA 2QA2A 4LLRA 1USBA 5IMZA 4KUNA 2DKIA 3FKFA 1ZZYA 4TRXA 3EURA 2V6KA 2E0QA 1YKAA 4ECCA 3C8EA 3GN3A 4ZB9A 4F0CA 1BYEA 1XOAA 3FHKA 1UA5A 2V6OA 2BJXA 1KTEA 1XWGA 2RLIA 2HE3A 4POBA 3TRXA 2KUCA 2HZEA 1SU9A 3FK8A 3GMFA 1GUKA 1AAZA 2EC4A 3C1SA 2CVBA 3HXSA 1ERTA 1FB6A 4USSA 1M2BA 3LXTA 2VCVA 2P0GA 4GWRA 2H74A 1XIYA 3GKKA 1K0OA 4PQ1A 3I43A 1SKSB 4ML1A 3KM6A 2WGRA 1AQXA 1GUMA 1ILOA 1GSEA 4OWYA 1SL0B 1V40A 1ZOFA 2PU9C 1TXXA 4DSSA 4CDOA 2YJHA 2IFQB 4NXIA 1K0AA 4I2TA 4EL1A 2XPEA 5BMUA 2KP1A 2HSNA 1NHYA 4WF5A 1EEJA 1DSBA 1XBSA 2D2ZA 1AW9A 2AUVA 2FHEA 1X5EA 2JZSA 5A5KA 3QFBC 5J4YA 2ALBA 2H1AA 2L5OA 5ID2B 3KH9A 1W89A 5DAKA 1G7OA 2H76A 2YV7A 4GTUA 3H93A 4WBRD 4LL1B 1A23A 4HUAA 3QCPA 3GKXA 1SJIA 1X5DA 2YNXA 1ML6A 4MP4A 3ZIVA 2NPBA 5B8AA 4MH3A 5F8BA 3L9VA 3KP8A 5D9VA 5CRGA 1GTAA 5A5HA 1SD9A 3EVIA 3QAWA 3W8SA 5H5RA 1TJDA 3F4TA 3NIVA 5D96A 4MJBA 1M7TA 4K5RA 4V2NA 5ENUA 2HSMB 2EFDA 3C7MA 3SBCA 5DJMA 4KDXA 2CQ9A 3M9KA 1M2DA 2F9SA 3FZ5A 5DBQA 3ZL5A 3F6FA 1GSDA 1N2AA 4KCEA 4KA0A 4MJEA 2M72A 3TRPA 1TXUA 3QD9A 4NMUA 1XWKA 2K8SA 2FUG2 4EKZA 1BAYA 1SYRA 3TJFA 4I8BA 4POLA 1GTBA 2VL3A 1B4QA 1Z6MA 2V1MA 3C73A 4XS1A 5FHIA 1OKTA 1G7EA 4F2IA 1HYUA 4N0ZA 1QQ2A 6GSYA 2N5AA 1NM3A 4EC0A 3LEFA 5ECIB 4G2EA 1B4PA 4YAPA 1GNWA 3IOSA 5IMCA 4I2UA 3M8NA 5LD0A 3BOAA 2IMKA 1WPIA 4KAEA 2GS3A 2L59A 3GV1A 2DIZA 5ECHB 2AAWA 1M0UA 4V2LA 1WMJA 2DLXA 5CREA 2QGVA 1YF1A 1MDKA 4GQCA 1HNCA 1A8LA 2HRFA 1CQHA 2DJ2A 5A34A 2VUPA 4ZB6A 2A4HA 4GF0A 3ZMKA 4TR0A 3IK9A 8GSSA 1M9AA 4PNGA 3GL5A 4IS0A 3CQFA 3DYRA 2X8HA 3VWUA 3TKRA 1GTUA 3M1GA 1MD4A 3I69A 5DDLA 3H1NA 1ZMAA 4XS6A 5JCGA 3UEMA 4ZIJA 1AQWA 1NSWA 4KDYA 4MZCA 1V57A 1PD21 3QFAC 5KN1A 2R6KA 3DWVA 2GVPA 2EFHA 1PRXA 3RFRC 4Q5QA 4JEDA 2K8VA 3D4MA 1K0MA 3HJPA 5AN1A 5EVOA 3QDNA 5CYYA 2C80A 4WXTA 1X5CA 3APSA 2RM5A 2H8LA 1GSQA 3ZMLA 1M3JA 3CYNA 3GKNA 3KH7A 2VLTA 2GLRA 18GSA 5IM9A 4IW9A 4Z2UA 3U5RE 1R26A 5ECPB 5ECRB 1K0DA 5A4WA 2JZTA 2YWOA 4BWSA 3TDGA 1SK2A 4J57E 2O3EA 2OJLA 3KGKA 1GULA 2HRKB 1FHEA 2H01A 5ABRA 2EFEA 2IMFA 3KMOA 2IN3A 3FR3A 3NOFA 4X0XA 2AHEA 3CHXC 5CP1A 3UMAA 4JZQA 2PBJA 4H86A 4TOPA 3D21A 3DRNA 5G30A 5ECSA 1A0FA 2WVYA 3ME8A 1X9MB 4GSNA 1ACVA 4DSQA 1WIKA 1M3IA 1IYIA 2GQMA 1MDJA 2DJ0A 1TKDB 4OFTA 3K8NA 4WKWA 2EFCA 4YQVA 4BVYB 2IPAA 3BCKA 2X64A 3A5IA 2X8CA 1SL1B 1SKRB 2M80A 4AF2A 2HQTA 1I1IP 1K3OA 1THOA 3UBLA 5ECOB 2B6MA 4WR5A 4V1Ap 4K6XA 3BCIA 2OE0A 2LNTA 1O7UA 5LCZA 2WB9A 1T8EB 5GAND 5DQYA 5IQYA 3QOUA 4A5PA 4PXOA 1TK5B 1BX9A 4HI7A 6GSWA 1A8YA 2PPTA 1HNAA 1EGRA 4AKIA 4MDCA 1TI1A 4TVEA 2PWJA 2VL2C 2CT6A 2R0GA 2ZUPA 4K0NA 2A2PA 3IK7A 2VLUA 2WFCA 4IQ1A 2WZ9A 4ZL7A 4PI0C 5JCUA 1YF0A 2TRXA 1JLVA 1M2AA 1TRWA 3VLNA 4HSCX 3EINA 3E0UA 1ST9A 4EUYA 5GSTA 5JWRB 2HNLA 3CSHA 1F6MC 4AGSA 3WGEA 2KLXA 3BD2A 1VF1A 5HFIA 2VCXA 9GSSA 4KSOA 6GSSA 1T1VA 2X4AA 1PN9A 2IIYA 4JRRA 3V1WA 2VD1A 20GSA 1G6WA 3C1RA 4KGIA 4XIHA 3DIEA 3ERWA 1SVOA 3GIXA 3GKMA 1XXUA 1MD3A 4PTSA 2CAIA 5GZZB 1GSFA 1A2JA 3HZ8A 4MNNA 5H5SA 2H1LA 2H0IA 2B5XA 4X1UA 4QL9A 4N0VA 5IOXA 2F8AA 2WVXB 5H5QA 1GLPA 5JWOB 2PN8A 4MJAA 4MMMA 3BBYA 2K6VA 5F0GA 1EV9A 3D22A 5IMVA 5IMAA 4G0IA 4WEYA 3FW2A 2VCQA 3F4SA 4GRFA 2F3MA 7GSSA 4K7NA 2N5BA 2AJQB 2OE1A 3RAZA 3GX0A 3TB2A 1SKWB 3D0ZA 3NZNA 1GH2A 2I1UA 1OE8A 4PX1A 4KB3A 4F03A 4L0WA 5INYA 4NV5A 4O92A 1R5PA 2H71A 2VKZG 4DVCA 2QC7A 3GHAA 3F63A 2LRCA 5D9XA 5KEJA 3GFKA 3HVNA 13GSA 2WW1A 4IVFA 3G9BA 3ZIJA 2VM2A 4G19A 4E68A 2GZPA 4PUFC 3VI7A 2JACA 1T7PB 3ZFLA 3MIXA 2JZRA 3UAPA 4ZXGA 3FYGA 1ZCPA 4GCIA 2DSAA 4BPYA 4GLTA 1Z6NA 1F3AA 1WJKA 4BA7A 4F9ZA 1FW1A 2B7JA 5GSSA 2X49A 1F37A 1BF5A 1OKDA 4IHUA 4BVXB 3UJ1A 2PERA 3N5OA 2PUKC 4IN0A 1SL2B 4FO5A 4L8EA 4RQRA 4RQXA 3KJYA 1XWBA 2H1GA 3S9FA 3G7JA 1Z5YE 3J7Yb 1DE1A 3TKSE 1E6BA 4O5UA 1PL1A 4BL7A 1BQ7A 4HQZA 3WYWA 1AQVA 5HR3A 1RQMA 2IFQA 3G7IA 3O6TA 3IR4A 2KHPA 3IE3A 4DEJA 1XW6A 3LORA 2CZ2A 1K0CA 4IBPA 4NHZA 3JCML 4AI6A 3R3EA 3W8JA 1CQGA 5DCGA 5ID2A 3HA9A 2H6YA 2C0FA 4ZILA 1QK8A 3TKQA 1ZYPA 5J9BA 1GRXA 1H75A 4IKHA 3HKRA 4Q5RA 4TR4A 1PGTA 1KNGA 1LBKA 1GSYA 3IDVA 4HJMA 2K18A 4HDEA 4JE1A 2REMA 1Y25A 2P31A 2VLVA 1B48A 2GSSA 5AIVA 3VK9A 2VIMA 17GSA 3TCOA 5G31A 4PNFA 3PINA 1ERVA 4EXJA 3O76A 2HT9A 2J9HA 2LUSA 1YZXA 2HXKA 4MH2A 1XFLA 2LQQA 2HZEB 2HSMA 5ECNB 1S4BP 1AIUA 2O87A 1GP1A 2HYXA 4AJ8A 4ZL8A 4XCSA 3HJMA 1XWCA 1Q98A 3EWLA 5B6NA 2CX4A 4D73B 4N30A 2QA1A 3BJ5A 4ZBBA 1K3YA 2VL2A 1YJ6A 2GGTA 1TK8B 2LTKA 3VI5A 4K7IA 4PI2C 4NWYA 3IRAA 1M99A 2NDOA 3FRCA 2B1LA 2Z9SA 1PKWA 2C8UA 3LW9A 4OCEA 4O5RA 3TKSA 3F9UA 4V2MA 3RGBC 2L6DA 3ZVJD 2GTUA 2NTOA 1JHBA 1EP7A 3PPUA 2YZHA 2FD3A 4QL7A 2FY6A 1YDKA 3TGZA 3GRXA 2L4QA 1PA3A 1A2MA 5J9CA 2F8FA 4HEA2 5KN0A 1F2EA 4XTSA 5ECQB 5D9TA 2MMOA 4OCFA 4EE0A 2ES7A 2FGXA 5ECKB 4ZB7A 1QFNA 3MYDA 1AXDA 1MEKA 1O8XA 2LJKA 2O7KA 2R0PA 1EP8A 5GAPD 6GSXA 2CX3A 2WJUA 3AY8A 1OYJA 3IAM2 4G01A 2DJ1A 1GTIA 4ML6A 3PR8A 3EU3A 5A5HB 2DJJA 3W6GA 1X9SB 2MYGA 1S3RA 3E9JB 3EYTA 3GUSA 4KDUA 3VWWA 2FLSA 2WDUA 4ISDA 3VPTA 4KSMA 2WULA 2ON5A 5D73A 4KNDA 2IMDA 1QXHA 2MMAA 4OO4A 2ZCTA 1PKZA 4N10A 1R7HA 3IC8A 4PHZC 1WE0A 3IAS2 1TU7A 3L0HA 1XW9A 1F3BA 5E59A 4GDFA 4ICYA 3RPPA 1JZWA 3TKPA 2XBIA 5EY6A 2LRTA 4TR1B 1J08A 5JCWA 3MAKA 5DQSA 4K2XA 2H19A 4ZBDA 1HQOA 4F0BA 1RK4A 5B7CA 1SVMA 2GT5A 3FR6A 5J4UA 3UOMA 2HRKA 2HRAA 4AKHA 2B1KA 4MCUA 5HQPA 2LJRA 4JR4A 2F51A 3ZVJA 3LGCA 3KEBA 4WR4A 2QSIA 3H79A 1FO5A 3D5JA 5ELGA 5DJLA 3LG6A 1MDIA 3U6VA 1T00A 4OMVA 3ERGA 3FMWA 4MJCA 2B7KA 3FEUA 3RDWA 16GSA 2O8VB 2IMIA 1XVWA 4YH2A 1SJ6A 4KX4A 2FA8A 5HR2A 3GX8A 1S3AA 4AJ6A 3F6DA 1IYHA 2C0GA 2H1BA 1O81A 1E2YA 2PGTA 2OBKA 4EIPA 3GL3A 1HNBA 4CY6A 3KP9A 2OKAA 4TXOB 3CBUA 4ECIA 1U87A 1FOHA 3CTGA 3P8WA 5HFKA 4KH7A 4K5SA 4CHSA 1S3CA 5COHA 2M46A 1M9BA 2I9HA 1Q4JA 3HY2A 5ECLB 2C0EA 5A1NA 1JZRA 4L5OA 2LJAA 2YN1A 4L5LA 3ZREA 4CY8A 4PQIA 2CA8A 5G5FA 1PX7A 5KN2A 4Z2RA 3APOA 2MBTA 1GUHA 2GSRA 3L4NA 5LNKe 3KMNA 2O5VA 2EIOA 2L4CA 3GYKA 4K0GA 4X4JA 1K0BA 4KE3A 4ECBA 1FOVA 1MTCA 2B3SA 3RBTA 1YEPA 2YP6A 2AYTA 4FQUA 3TKSC 2A4VA 2AB6A 3CWGA 2B5EA 2DJKA 2TIRA 3TUEA 2H66A 2O36A 4J56E 1FVJA 5IO0A 3DKSA 4OFNA 4I97A 5F07A 3CSIA 4LL4B 4Z2TA 1WP0A 2FWHA 2R0CA 2C3NA 2HSHA 1AUCA 4YKFA 3MNGA 3LQ7A 5ECMB 2LSTA 12GSA 2YCDA 2O89A 3KZQA 4WBJA 2GZZA 1OC8A 1AC1A 5CAXA 1O6JA 4EF0A 2H30A 5D8IA 1Z9HA 2JL4A 1TK0B 2KP2A 3L78A 3DVWA 4MZWA 1GL8A 5DALA 3I9V2 1VF3A 1EGOA 3CXGA 4HS1A 2VL9A 1F9MA 6GSVA 3ZITA 3GSSA 1GLQA 1SYXA 5KN3A 3C71A 1ERUA 4O5QA 2C1YA 1DE2A 2R37A 6GSTA 3IXRA 4RI7A 2I81A 4PQHA 1G0TA 1OC9A 2IJYA 1BEDA 2OA7A 1VF2A 2B5YA 3HHVA 4IELA 4K7OA 2IMEA 4TW5A 5CNWA 5G1LA 2LQOA 1PQNA 1SK0A 3IA1A 2XBQA 1UN2A 2HRNA 1N25A 3EPTA 4NPBA 1JFUA 5IPHA 3HVSA 1FAAA 5J41A 4G0KA 2GSQA 3R2QA 2FWGA 2K9FA 2ZNMA 2I3YA 3TJBA 2BTOT 5CO3A 2VOCA 1A24A 4GSTA 2WW2A 2OACA 4IJ3A 1WRYA 4ULXA 1V98A 3QR6A 3M0FA 1TRVA 3UIWA 2RM6A 4I6XA 1XZOA 1PSQA 3FZ9A 5G5EA 3ZTLA 3FZ4A 2L57A 4GXZA 2X99A 1J0FA 4OFMA 2A2SA 1T4ZA 3UARA 3EC3A 5CRDA 3GSTA 4O32A 2VM1A 1YEWC 4ECJA 2KOKA 4FYUA 1ZYQB 1Z3EA 2HI7A 3LYPA 4NAXA 3US3A 4IGJA 4ACSA 1Z7PA 5HR1A 3MDKA 4F82A 2C0DA 5CRHA 1YEXA 2JADA 5D93A 4MA9A 1TP9A 3A2WA 3HDCA 2LRNA 2CVDA 1PN0A 1QGVA 4MPGA 2DIYA 1Y6EA 3TRQA 1H4OA 4OO5A 4ID0A 3Q19A 4XS4B 4N11A 5IPGA 3I6AA 1TI3A 5EL8A 1O73A 3RPNA 3WT1A 4D73A 3MSZA 3PH9A 2OBIA 2WCIA 5HFGA 2WZSA 3FY7A 3GTUB 3QPMA 1TTZA 4CW9A 1B8XA 3IBHA 5J5NA 1KBNA 1W4VA 3DEXA 3KCMA 1ZYNA 4KW6A 1PL2A 1TU8A 2WS2A 4MZBA 3TOUA 1EOHA 4AKGA 19GSA 2XPDA 1SD8A 5DVBA 1O85A 4IJIA 3D4TA 1LU4A 2DKHA 5AISA 1V2AA 6GSUA 2PVOC 3LXZA 3PGTA 1OAZA 1VRSD 1TW9A 1ZL9A 1NW2A 3CSJA 4FXYP 1TDIA 3KXOA 2GSTA 1OE7A 4BL7B 1QUWA 2MMNA 4KF9A 4AKXB 4LMVA 4K2DA 2R3XA 1U3AA 2V2GA 5L71A 4TR3A 2OADA 2YPMA 3A2XA 4MLYA 2OE3A 1EWXA 3LYKA 1DBYA 3HYPA 3TU3B 2EIQA 2BMXA 4XRAA 2H73A 3P7XA 4IQAA 4IP1A 3A3TA 2C3QA 2HZFA 1ERWA 4DSRA 10GSA 4DSSB 1JLWA 4ZB8A 4MABA 1EEMA 3OR5A 1R5AA 1K0NA 5BMUB 1WOUA 2HSNB 1TRUA
chains in the Genus database with same CATH topology
3GH6A 3EE2A 1C72A 4XHMA 2CAQA 3ERFA 1FB0A 1JZDA 3DMLA 2VO4A 4POKA 4K1FA 4JR6A 3N9JA 5DAKB 2FA4A 2NVLA 1XPVA 5J3RA 1GNEA 1G6YA 1UC7A 1A0RP 1VGLA 2YWNA 2L6CA 1OC3A 4HZ2A 4NV2A 1RW1A 4Z7XA 3LFLA 1FG4A 1PMTA 3HZ4A 1XWAA 1BJXA 3M9JA 3KD0A 4V1Ag 4AJ7A 3HMJG 3P90A 4TR1A 2CVKA 1TOFA 5HR0A 1YQ1A 1J9BA 4EIQA 4MF6A 2YANA 2R5GA 4G0LA 4PGTA 3TJJA 4POMA 3VWVA 4RI6A 5F05A 4QQ7A 1TRSA 2GQLA 1R4WA 2GT6A 4PUAA 3F3QA 1YY7A 2FNOA 2R2JA 2VCZA 1NHOA 4KCAA 4EDYA 4RUVA 1JZOA 5C04A 3FZAA 2G0FA 1U6TA 1XOBA 4GSSA 2TRCP 3F8UA 1BG1A 4I5QA 3QAVA 3TJKA 2XC2A 3HVVA 4MK3A 1YKCA 2JU5A 5AIXA 2H72A 1ABAA 3TJGA 3E3EA 3UBKA 1SENA 3ED3A 2I4AA 1T4YA 2MMZA 4OD7A 2X8GA 2H1DA 1B9XC 2P5RA 4HQSA 2DJ3A 5AGYA 3ISOA 4O7HA 3GURA 4LA1A 2HSYA 4HOJA 3ZLPA 5G1KA 1ZYEA 1GSSA 2VD0A 4FH8A 5F06A 4TXOA 1ZGNA 2E2GA 2AV4A 4K9ZA 4ILFA 2NBSA 1EOGA 3CRTA 3WD6A 1VF4A 3O3TA 2FWFA 4YAVA 4BVYA 5A34B 2O85A 3VFIA 4BWQA 5DCHA 1GSUA 1XVQA 2PVQA 5IOWA 4FYCA 3ZRDA 4EO3A 2R4VA 1URMA 4TN8A 1YVLA 3HJOA 2EIRA 2UV8G 3F0IA 3APQA 1U88A 3DGQA 2E2MA 2E7PA 2HFDA 3KTLA 1X0RA 2JSZA 2FWEA 3FR9A 3RHBA 4IP6A 4JU5A 2DBCA 2LS5A 3DD3A 2QKEA 3D6IA 3TOTA 4HZ4A 4HU7A 3HD5A 5KOXA 4G9HA 1Z7RA 3LJRA 1HD2A 4MF7A 4P3YB 3HCZA 2DC5A 4WF4A 5C00A 2MZCA 3ZZXA 2HLSA 3KTBA 3VPQA 2H0HA 3WGXA 3IV4A 1V58A 2H6XA 2CZ3A 5IIZA 1DUGA 2J23A 5G2ZA 1THXA 3EMPA 2VCWA 3ZFBA 1K3LA 5B8BA 2RUEA 4E8HA 1BG5A 1LJRA 2N5FA 2VAFA 4MPFA 2VCTA 1I9DA 3LSZA 5E4WA 4JBBA 1GWCA 1U3IA 11GSA 2L5LA 3WGDA 4HJ2A 1N8JA 2YV9A 3Q18A 1X9WB 3QAGA 1B9YC 1I5GA 4TXVA 2OT3A 4Q5NA 4GQFA 2YWIA 3F4RA 3ME7A 4FYBA 1A2LA 3H4KA 4HU9A 4EVMA 4YQMA 4LMWA 2UZ8A 5A4VA 2GQKA 5ELAA 2LKUA 3Q6OA 3UVTA 4G10A 3VWXA 1Y1UA 3IC4A 2PMTA 5JWQB 4N3ZA 4XRDA 5A1NB 2FCHA 1EZKA 2GDRA 3A5WA 2YOIA 3LWAA 4ZBAA 3J7Yk 5J47A 5BRTA 3HVXA 3VURA 1XCCA 3UL3A 3RHCA 2IWTA 4L0UA 2RIIA 3DXBA 2LNSA 3CTFA 3IPZA 3CRUA 2V32A 3G7YA 5J40A 14GSA 1WWJA 2V41A 5EPFA 3Q74A 4Q5FA 1XW5A 1ON4A 1S3DA 1FVKA 3M3MA 3GNJA 3ZYWA 22GSA 2P5QA 3SWLA 5A4UA 5CRWA 4FIWA 5KOWA 3L9SA 2C3TA 2ON7A 2LEGA 3GH9A 3A2VA 2G2QA 3H8QA 1T3BA 4BVXA 3EMXA 5D9WA 4QMKA 1O8WA 4EDZA 4TKYA 3CMIA 4X43A 4ZL9A 2H70A 1SJZA 1UVZA 5IO2A 2IL3A 3F3RA 3IHQA 4YKGA 5FWGA 4K8MA 4YQUA 5B6MA 5J4VA 3DVXA 3EU4A 1V9WA 2DMLA 2JSYA 1PX6A 4MF5A 2A2RA 3L9UA 2LV3A 5FT3A 1OVNA 5IMFA 5DALB 3UVHA 5IMDA 2RUFA 2YWMA 2GZYA 2H6ZA 2H75A 2H0GA 4NHWA 3MWHA 3QMXA 1SVLA 4PURA 4J2FA 1EV4A 4E8EA 3P2AA 4WETA 1KEBA 2MBSA 3GA4A 2DMMA 1QMVA 1OC9B 4XS4A 1SK1A 3KIJA 3IHGA 2XHFA 4W66A 2C4JA 3WT2A 2YZUA 2CV4A 2YJ7A 3GTUA 2WRTA 2QA2A 4LLRA 1USBA 5IMZA 4KUNA 2DKIA 3FKFA 1ZZYA 4TRXA 3EURA 2V6KA 2E0QA 1YKAA 4ECCA 3C8EA 3GN3A 4ZB9A 4F0CA 1BYEA 1XOAA 3FHKA 1UA5A 2V6OA 2BJXA 1KTEA 1XWGA 2RLIA 2HE3A 4POBA 3TRXA 2KUCA 2HZEA 1SU9A 3FK8A 3GMFA 1GUKA 1AAZA 2EC4A 3C1SA 2CVBA 3HXSA 1ERTA 1FB6A 4USSA 1M2BA 3LXTA 2VCVA 2P0GA 4GWRA 2H74A 1XIYA 3GKKA 1K0OA 4PQ1A 3I43A 1SKSB 4ML1A 3KM6A 2WGRA 1AQXA 1GUMA 1ILOA 1GSEA 4OWYA 1SL0B 1V40A 1ZOFA 2PU9C 1TXXA 4DSSA 4CDOA 2YJHA 2IFQB 4NXIA 1K0AA 4I2TA 4EL1A 2XPEA 5BMUA 2KP1A 2HSNA 1NHYA 4WF5A 1EEJA 1DSBA 1XBSA 2D2ZA 1AW9A 2AUVA 2FHEA 1X5EA 2JZSA 5A5KA 3QFBC 5J4YA 2ALBA 2H1AA 2L5OA 5ID2B 3KH9A 1W89A 5DAKA 1G7OA 2H76A 2YV7A 4GTUA 3H93A 4WBRD 4LL1B 1A23A 4HUAA 3QCPA 3GKXA 1SJIA 1X5DA 2YNXA 1ML6A 4MP4A 3ZIVA 2NPBA 5B8AA 4MH3A 5F8BA 3L9VA 3KP8A 5D9VA 5CRGA 1GTAA 5A5HA 1SD9A 3EVIA 3QAWA 3W8SA 5H5RA 1TJDA 3F4TA 3NIVA 5D96A 4MJBA 1M7TA 4K5RA 4V2NA 5ENUA 2HSMB 2EFDA 3C7MA 3SBCA 5DJMA 4KDXA 2CQ9A 3M9KA 1M2DA 2F9SA 3FZ5A 5DBQA 3ZL5A 3F6FA 1GSDA 1N2AA 4KCEA 4KA0A 4MJEA 2M72A 3TRPA 1TXUA 3QD9A 4NMUA 1XWKA 2K8SA 2FUG2 4EKZA 1BAYA 1SYRA 3TJFA 4I8BA 4POLA 1GTBA 2VL3A 1B4QA 1Z6MA 2V1MA 3C73A 4XS1A 5FHIA 1OKTA 1G7EA 4F2IA 1HYUA 4N0ZA 1QQ2A 6GSYA 2N5AA 1NM3A 4EC0A 3LEFA 5ECIB 4G2EA 1B4PA 4YAPA 1GNWA 3IOSA 5IMCA 4I2UA 3M8NA 5LD0A 3BOAA 2IMKA 1WPIA 4KAEA 2GS3A 2L59A 3GV1A 2DIZA 5ECHB 2AAWA 1M0UA 4V2LA 1WMJA 2DLXA 5CREA 2QGVA 1YF1A 1MDKA 4GQCA 1HNCA 1A8LA 2HRFA 1CQHA 2DJ2A 5A34A 2VUPA 4ZB6A 2A4HA 4GF0A 3ZMKA 4TR0A 3IK9A 8GSSA 1M9AA 4PNGA 3GL5A 4IS0A 3DYRA 2X8HA 3VWUA 3TKRA 1GTUA 3M1GA 1MD4A 3I69A 5DDLA 3H1NA 1ZMAA 4XS6A 5JCGA 3UEMA 4ZIJA 1AQWA 1NSWA 4KDYA 4MZCA 1V57A 1PD21 3QFAC 5KN1A 2R6KA 3DWVA 2GVPA 2EFHA 1PRXA 4Q5QA 4JEDA 2K8VA 3D4MA 1K0MA 3HJPA 5AN1A 5EVOA 3QDNA 5CYYA 2C80A 4WXTA 1X5CA 3APSA 2RM5A 2H8LA 1GSQA 3ZMLA 3CYNA 3GKNA 3KH7A 2VLTA 2GLRA 18GSA 5IM9A 4IW9A 4Z2UA 3U5RE 1R26A 5ECPB 5ECRB 1K0DA 5A4WA 2JZTA 2YWOA 4BWSA 3TDGA 1SK2A 4J57E 2OJLA 3KGKA 1GULA 2HRKB 1FHEA 2H01A 5ABRA 2EFEA 2IMFA 3KMOA 2IN3A 3FR3A 3NOFA 4X0XA 2AHEA 5CP1A 3UMAA 4JZQA 2PBJA 4H86A 4TOPA 3D21A 3DRNA 5G30A 5ECSA 1A0FA 3ME8A 1X9MB 4GSNA 1ACVA 4DSQA 1WIKA 1IYIA 2GQMA 1MDJA 2DJ0A 1TKDB 4OFTA 3K8NA 4WKWA 2EFCA 4YQVA 4BVYB 2IPAA 3BCKA 2X64A 3A5IA 2X8CA 1SL1B 1SKRB 2M80A 4AF2A 2HQTA 1K3OA 1THOA 3UBLA 5ECOB 2B6MA 4WR5A 4V1Ap 4K6XA 3BCIA 2OE0A 2LNTA 1O7UA 5LCZA 2WB9A 1T8EB 5GAND 5DQYA 5IQYA 3QOUA 4A5PA 4PXOA 1TK5B 1BX9A 4HI7A 6GSWA 1A8YA 2PPTA 1HNAA 1EGRA 4AKIA 4MDCA 1TI1A 4TVEA 2PWJA 2VL2C 2CT6A 2R0GA 2ZUPA 4K0NA 2A2PA 3IK7A 2VLUA 2WFCA 4IQ1A 2WZ9A 4ZL7A 5JCUA 1YF0A 2TRXA 1JLVA 1M2AA 1TRWA 3VLNA 3EINA 3E0UA 1ST9A 4EUYA 5GSTA 5JWRB 2HNLA 3CSHA 1F6MC 4AGSA 3WGEA 2KLXA 3BD2A 1VF1A 5HFIA 2VCXA 9GSSA 4KSOA 6GSSA 1T1VA 2X4AA 1PN9A 2IIYA 4JRRA 3V1WA 2VD1A 20GSA 1G6WA 3C1RA 4KGIA 4XIHA 3DIEA 3ERWA 1SVOA 3GIXA 3GKMA 1XXUA 1MD3A 4PTSA 2CAIA 5GZZB 1GSFA 1A2JA 3HZ8A 4MNNA 5H5SA 2H1LA 2H0IA 2B5XA 4X1UA 4QL9A 4N0VA 5IOXA 2F8AA 5H5QA 1GLPA 5JWOB 2PN8A 4MJAA 4MMMA 3BBYA 2K6VA 5F0GA 1EV9A 3D22A 5IMVA 5IMAA 4G0IA 4WEYA 3FW2A 2VCQA 3F4SA 4GRFA 2F3MA 7GSSA 4K7NA 2N5BA 2AJQB 2OE1A 3RAZA 3GX0A 3TB2A 1SKWB 3D0ZA 3NZNA 1GH2A 2I1UA 1OE8A 4PX1A 4KB3A 4F03A 4L0WA 5INYA 4NV5A 4O92A 1R5PA 2H71A 2VKZG 4DVCA 2QC7A 3GHAA 3F63A 2LRCA 5D9XA 5KEJA 3GFKA 13GSA 4IVFA 3G9BA 3ZIJA 2VM2A 4G19A 4E68A 2GZPA 4PUFC 3VI7A 2JACA 1T7PB 3ZFLA 3MIXA 2JZRA 3UAPA 4ZXGA 3FYGA 1ZCPA 4GCIA 2DSAA 4BPYA 4GLTA 1Z6NA 1F3AA 1WJKA 4BA7A 4F9ZA 1FW1A 2B7JA 5GSSA 2X49A 1F37A 1BF5A 1OKDA 4IHUA 4BVXB 3UJ1A 2PERA 3N5OA 2PUKC 4IN0A 1SL2B 4FO5A 4L8EA 4RQRA 4RQXA 3KJYA 1XWBA 2H1GA 3S9FA 3G7JA 1Z5YE 3J7Yb 1DE1A 3TKSE 1E6BA 4O5UA 1PL1A 4BL7A 1BQ7A 4HQZA 3WYWA 1AQVA 5HR3A 1RQMA 2IFQA 3G7IA 3O6TA 3IR4A 2KHPA 3IE3A 4DEJA 1XW6A 3LORA 2CZ2A 1K0CA 4IBPA 4NHZA 3JCML 4AI6A 3R3EA 3W8JA 1CQGA 5DCGA 5ID2A 3HA9A 2H6YA 2C0FA 4ZILA 1QK8A 3TKQA 1ZYPA 5J9BA 1GRXA 1H75A 4IKHA 3HKRA 4Q5RA 4TR4A 1PGTA 1KNGA 1LBKA 1GSYA 3IDVA 4HJMA 2K18A 4HDEA 4JE1A 2REMA 1Y25A 2P31A 2VLVA 1B48A 2GSSA 5AIVA 3VK9A 2VIMA 17GSA 3TCOA 5G31A 4PNFA 3PINA 1ERVA 4EXJA 3O76A 2HT9A 2J9HA 2LUSA 1YZXA 2HXKA 4MH2A 1XFLA 2LQQA 2HZEB 2HSMA 5ECNB 1AIUA 2O87A 1GP1A 2HYXA 4AJ8A 4ZL8A 4XCSA 3HJMA 1XWCA 1Q98A 3EWLA 5B6NA 2CX4A 4D73B 4N30A 2QA1A 3BJ5A 4ZBBA 1K3YA 2VL2A 1YJ6A 2GGTA 1TK8B 2LTKA 3VI5A 4K7IA 4NWYA 3IRAA 1M99A 2NDOA 3FRCA 2B1LA 2Z9SA 1PKWA 2C8UA 3LW9A 4OCEA 4O5RA 3TKSA 3F9UA 4V2MA 2L6DA 3ZVJD 2GTUA 2NTOA 1JHBA 1EP7A 3PPUA 2YZHA 2FD3A 4QL7A 2FY6A 1YDKA 3TGZA 3GRXA 2L4QA 1PA3A 1A2MA 5J9CA 2F8FA 4HEA2 5KN0A 1F2EA 4XTSA 5ECQB 5D9TA 2MMOA 4OCFA 4EE0A 2ES7A 2FGXA 5ECKB 4ZB7A 1QFNA 3MYDA 1AXDA 1MEKA 1O8XA 2LJKA 2O7KA 2R0PA 1EP8A 5GAPD 6GSXA 2CX3A 2WJUA 3AY8A 1OYJA 3IAM2 4G01A 2DJ1A 1GTIA 4ML6A 3PR8A 3EU3A 5A5HB 2DJJA 3W6GA 1X9SB 2MYGA 3E9JB 3EYTA 3GUSA 4KDUA 3VWWA 2FLSA 2WDUA 4ISDA 3VPTA 4KSMA 2WULA 2ON5A 5D73A 4KNDA 2IMDA 1QXHA 2MMAA 4OO4A 2ZCTA 1PKZA 4N10A 1R7HA 3IC8A 1WE0A 3IAS2 1TU7A 3L0HA 1XW9A 1F3BA 5E59A 4GDFA 4ICYA 3RPPA 1JZWA 3TKPA 2XBIA 5EY6A 2LRTA 4TR1B 1J08A 5JCWA 3MAKA 5DQSA 4K2XA 2H19A 4ZBDA 1HQOA 4F0BA 1RK4A 5B7CA 1SVMA 2GT5A 3FR6A 5J4UA 3UOMA 2HRKA 2HRAA 4AKHA 2B1KA 4MCUA 5HQPA 2LJRA 4JR4A 2F51A 3ZVJA 3LGCA 3KEBA 4WR4A 2QSIA 3H79A 1FO5A 3D5JA 5ELGA 5DJLA 3LG6A 1MDIA 3U6VA 1T00A 4OMVA 3ERGA 3FMWA 4MJCA 2B7KA 3FEUA 3RDWA 16GSA 2O8VB 2IMIA 1XVWA 4YH2A 1SJ6A 4KX4A 2FA8A 5HR2A 3GX8A 1S3AA 4AJ6A 3F6DA 1IYHA 2C0GA 2H1BA 1O81A 1E2YA 2PGTA 2OBKA 4EIPA 3GL3A 1HNBA 4CY6A 3KP9A 2OKAA 4TXOB 3CBUA 4ECIA 1U87A 1FOHA 3CTGA 3P8WA 5HFKA 4KH7A 4K5SA 4CHSA 1S3CA 5COHA 2M46A 1M9BA 2I9HA 1Q4JA 3HY2A 5ECLB 2C0EA 5A1NA 1JZRA 4L5OA 2LJAA 2YN1A 4L5LA 3ZREA 4CY8A 4PQIA 2CA8A 5G5FA 1PX7A 5KN2A 4Z2RA 3APOA 2MBTA 1GUHA 2GSRA 3L4NA 5LNKe 3KMNA 2O5VA 2EIOA 2L4CA 3GYKA 4K0GA 4X4JA 1K0BA 4KE3A 4ECBA 1FOVA 1MTCA 2B3SA 3RBTA 1YEPA 2YP6A 2AYTA 4FQUA 3TKSC 2A4VA 2AB6A 3CWGA 2B5EA 2DJKA 2TIRA 3TUEA 2H66A 4J56E 1FVJA 5IO0A 3DKSA 4OFNA 4I97A 5F07A 3CSIA 4LL4B 4Z2TA 1WP0A 2FWHA 2R0CA 2C3NA 2HSHA 1AUCA 4YKFA 3MNGA 3LQ7A 5ECMB 2LSTA 12GSA 2YCDA 2O89A 3KZQA 4WBJA 2GZZA 1OC8A 1AC1A 5CAXA 1O6JA 4EF0A 2H30A 5D8IA 1Z9HA 2JL4A 1TK0B 2KP2A 3L78A 3DVWA 4MZWA 1GL8A 5DALA 3I9V2 1VF3A 1EGOA 3CXGA 4HS1A 2VL9A 1F9MA 6GSVA 3ZITA 3GSSA 1GLQA 1SYXA 5KN3A 3C71A 1ERUA 4O5QA 2C1YA 1DE2A 2R37A 6GSTA 3IXRA 4RI7A 2I81A 4PQHA 1G0TA 1OC9A 2IJYA 1BEDA 2OA7A 1VF2A 2B5YA 3HHVA 4IELA 4K7OA 2IMEA 4TW5A 5CNWA 5G1LA 2LQOA 1PQNA 1SK0A 3IA1A 2XBQA 1UN2A 2HRNA 1N25A 3EPTA 4NPBA 1JFUA 5IPHA 3HVSA 1FAAA 5J41A 4G0KA 2GSQA 3R2QA 2FWGA 2K9FA 2ZNMA 2I3YA 3TJBA 2BTOT 5CO3A 2VOCA 1A24A 4GSTA 2OACA 4IJ3A 1WRYA 4ULXA 1V98A 3QR6A 3M0FA 1TRVA 3UIWA 2RM6A 4I6XA 1XZOA 1PSQA 3FZ9A 5G5EA 3ZTLA 3FZ4A 2L57A 4GXZA 2X99A 1J0FA 4OFMA 2A2SA 1T4ZA 3UARA 3EC3A 5CRDA 3GSTA 4O32A 2VM1A 4ECJA 2KOKA 4FYUA 1ZYQB 1Z3EA 2HI7A 3LYPA 4NAXA 3US3A 4IGJA 4ACSA 1Z7PA 5HR1A 3MDKA 4F82A 2C0DA 5CRHA 1YEXA 2JADA 5D93A 4MA9A 1TP9A 3A2WA 3HDCA 2LRNA 2CVDA 1PN0A 1QGVA 4MPGA 2DIYA 1Y6EA 3TRQA 1H4OA 4OO5A 4ID0A 3Q19A 4XS4B 4N11A 5IPGA 3I6AA 1TI3A 5EL8A 1O73A 3RPNA 3WT1A 4D73A 3MSZA 3PH9A 2OBIA 2WCIA 5HFGA 3FY7A 3GTUB 3QPMA 1TTZA 4CW9A 1B8XA 3IBHA 5J5NA 1KBNA 1W4VA 3DEXA 3KCMA 1ZYNA 4KW6A 1PL2A 1TU8A 2WS2A 4MZBA 3TOUA 1EOHA 4AKGA 19GSA 2XPDA 1SD8A 5DVBA 1O85A 4IJIA 3D4TA 1LU4A 2DKHA 5AISA 1V2AA 6GSUA 2PVOC 3LXZA 3PGTA 1OAZA 1VRSD 1TW9A 1ZL9A 1NW2A 3CSJA 1TDIA 3KXOA 2GSTA 1OE7A 4BL7B 1QUWA 2MMNA 4KF9A 4AKXB 4LMVA 4K2DA 2R3XA 1U3AA 2V2GA 5L71A 4TR3A 2OADA 2YPMA 3A2XA 4MLYA 2OE3A 1EWXA 3LYKA 1DBYA 3HYPA 3TU3B 2EIQA 2BMXA 4XRAA 2H73A 3P7XA 4IQAA 4IP1A 3A3TA 2C3QA 2HZFA 1ERWA 4DSRA 10GSA 4DSSB 1JLWA 4ZB8A 4MABA 1EEMA 3OR5A 1R5AA 1K0NA 5BMUB 1WOUA 2HSNB 1TRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GH6 A;  3EE2 A;  1C72 A;  4XHM A;  2CAQ A;  3ERF A;  1FB0 A;  1JZD A;  3DML A;  2VO4 A;  4POK A;  4K1F A;  4JR6 A;  3N9J A;  5DAK B;  2FA4 A;  2NVL A;  1XPV A;  5J3R A;  1GNE A;  1G6Y A;  1UC7 A;  1A0R P;  1VGL A;  2YWN A;  2L6C A;  1OC3 A;  4HZ2 A;  4NV2 A;  1RW1 A;  4Z7X A;  3LFL A;  1FG4 A;  1PMT A;  3HZ4 A;  1XWA A;  1BJX A;  3M9J A;  3KD0 A;  4V1A g;  4AJ7 A;  3P90 A;  4TR1 A;  2CVK A;  1TOF A;  5HR0 A;  1YQ1 A;  1J9B A;  4MF6 A;  2YAN A;  2R5G A;  4G0L A;  4PGT A;  3TJJ A;  4POM A;  3VWV A;  4RI6 A;  5F05 A;  4QQ7 A;  1TRS A;  2GQL A;  1R4W A;  2GT6 A;  4PUA A;  3F3Q A;  1YY7 A;  2FNO A;  2R2J A;  2VCZ A;  1NHO A;  4KCA A;  4EDY A;  4RUV A;  1JZO A;  5C04 A;  3FZA A;  2G0F A;  1U6T A;  1XOB A;  4GSS A;  2TRC P;  3F8U A;  4I5Q A;  3QAV A;  3TJK A;  2XC2 A;  3HVV A;  4MK3 A;  1YKC A;  2JU5 A;  5AIX A;  2H72 A;  1ABA A;  3TJG A;  3E3E A;  3UBK A;  1SEN A;  3ED3 A;  2I4A A;  1T4Y A;  2MMZ A;  4OD7 A;  2X8G A;  2H1D A;  1B9X C;  2P5R A;  4HQS A;  2DJ3 A;  5AGY A;  3ISO A;  4O7H A;  3GUR A;  4LA1 A;  2HSY A;  4HOJ A;  3ZLP A;  5G1K A;  1ZYE A;  1GSS A;  2VD0 A;  4FH8 A;  5F06 A;  4TXO A;  1ZGN A;  2E2G A;  2AV4 A;  4K9Z A;  4ILF A;  2NBS A;  1EOG A;  3CRT A;  3WD6 A;  1VF4 A;  3O3T A;  2FWF A;  4YAV A;  4BVY A;  2O85 A;  3VFI A;  4BWQ A;  5DCH A;  1GSU A;  1XVQ A;  2PVQ A;  5IOW A;  4FYC A;  3ZRD A;  4EO3 A;  2R4V A;  1URM A;  4TN8 A;  3HJO A;  2EIR A;  3F0I A;  3APQ A;  1U88 A;  3DGQ A;  2E2M A;  2E7P A;  2HFD A;  3KTL A;  1X0R A;  2JSZ A;  2FWE A;  3FR9 A;  3RHB A;  4IP6 A;  4JU5 A;  2DBC A;  2LS5 A;  3DD3 A;  2QKE A;  3D6I A;  3TOT A;  4HZ4 A;  4HU7 A;  3HD5 A;  4G9H A;  1Z7R A;  3LJR A;  1HD2 A;  4MF7 A;  4P3Y B;  3HCZ A;  2DC5 A;  4WF4 A;  5C00 A;  2MZC A;  3ZZX A;  2HLS A;  3KTB A;  3VPQ A;  2H0H A;  3WGX A;  3IV4 A;  1V58 A;  2H6X A;  2CZ3 A;  5IIZ A;  1DUG A;  2J23 A;  5G2Z A;  1THX A;  3EMP A;  2VCW A;  3ZFB A;  1K3L A;  5B8B A;  2RUE A;  4E8H A;  1BG5 A;  1LJR A;  2N5F A;  2VAF A;  4MPF A;  2VCT A;  1I9D A;  3LSZ A;  5E4W A;  4JBB A;  1GWC A;  1U3I A;  11GS A;  2L5L A;  3WGD A;  4HJ2 A;  1N8J A;  2YV9 A;  3Q18 A;  1X9W B;  3QAG A;  1B9Y C;  1I5G A;  4TXV A;  4Q5N A;  4GQF A;  2YWI A;  3F4R A;  3ME7 A;  4FYB A;  1A2L A;  3H4K A;  4HU9 A;  4EVM A;  4YQM A;  4LMW A;  2UZ8 A;  5A4V A;  2GQK A;  5ELA A;  2LKU A;  3Q6O A;  3UVT A;  4G10 A;  3VWX A;  3IC4 A;  2PMT A;  5JWQ B;  4XRD A;  2FCH A;  1EZK A;  2GDR A;  3A5W A;  2YOI A;  3LWA A;  4ZBA A;  3J7Y k;  3HVX A;  3VUR A;  1XCC A;  3UL3 A;  3RHC A;  2IWT A;  4L0U A;  2RII A;  3DXB A;  2LNS A;  3IPZ A;  3CRU A;  3CTF A;  2V32 A;  3G7Y A;  14GS A;  1WWJ A;  2V41 A;  5EPF A;  3Q74 A;  4Q5F A;  1XW5 A;  1ON4 A;  1S3D A;  1FVK A;  3M3M A;  3GNJ A;  3ZYW A;  22GS A;  2P5Q A;  3SWL A;  5A4U A;  5CRW A;  4FIW A;  3L9S A;  2C3T A;  2ON7 A;  2LEG A;  3GH9 A;  3A2V A;  2G2Q A;  3H8Q A;  1T3B A;  4BVX A;  3EMX A;  5D9W A;  1O8W A;  4EDZ A;  4TKY A;  3CMI A;  4X43 A;  4ZL9 A;  2H70 A;  1SJZ A;  1UVZ A;  5IO2 A;  2IL3 A;  3F3R A;  3IHQ A;  5FWG A;  4K8M A;  4YQU A;  5B6M A;  3DVX A;  3EU4 A;  1V9W A;  2DML A;  2JSY A;  1PX6 A;  4MF5 A;  2A2R A;  3L9U A;  2LV3 A;  5FT3 A;  1OVN A;  5IMF A;  5DAL B;  3UVH A;  5IMD A;  2RUF A;  2YWM A;  2GZY A;  2H6Z A;  2H75 A;  2H0G A;  4NHW A;  3MWH A;  3QMX A;  4PUR A;  4J2F A;  1EV4 A;  4E8E A;  3P2A A;  4WET A;  1KEB A;  2MBS A;  3GA4 A;  2DMM A;  1QMV A;  1OC9 B;  4XS4 A;  1SK1 A;  3KIJ A;  2XHF A;  2C4J A;  3WT2 A;  2YZU A;  2CV4 A;  2YJ7 A;  3GTU A;  2WRT A;  4LLR A;  1USB A;  5IMZ A;  4KUN A;  3FKF A;  1ZZY A;  4TRX A;  3EUR A;  2V6K A;  2E0Q A;  1YKA A;  4ECC A;  3C8E A;  3GN3 A;  4ZB9 A;  4F0C A;  1BYE A;  1XOA A;  3FHK A;  1UA5 A;  2V6O A;  2BJX A;  1KTE A;  1XWG A;  2RLI A;  2HE3 A;  4POB A;  3TRX A;  2KUC A;  2HZE A;  1SU9 A;  3FK8 A;  3GMF A;  1GUK A;  1AAZ A;  2EC4 A;  3C1S A;  2CVB A;  3HXS A;  1ERT A;  1FB6 A;  4USS A;  1M2B A;  3LXT A;  2VCV A;  2P0G A;  4GWR A;  2H74 A;  1XIY A;  3GKK A;  1K0O A;  4PQ1 A;  3I43 A;  1SKS B;  4ML1 A;  3KM6 A;  2WGR A;  1AQX A;  1GUM A;  1ILO A;  1GSE A;  4OWY A;  1SL0 B;  1V40 A;  1ZOF A;  2PU9 C;  1TXX A;  4DSS A;  4CDO A;  2YJH A;  2IFQ B;  4NXI A;  1K0A A;  4I2T A;  4EL1 A;  2XPE A;  5BMU A;  2KP1 A;  1NHY A;  4WF5 A;  1EEJ A;  1DSB A;  1XBS A;  2D2Z A;  1AW9 A;  2AUV A;  2FHE A;  1X5E A;  2JZS A;  5A5K A;  3QFB C;  2ALB A;  2H1A A;  2L5O A;  5ID2 B;  3KH9 A;  1W89 A;  5DAK A;  1G7O A;  2H76 A;  2YV7 A;  4GTU A;  3H93 A;  4WBR D;  4LL1 B;  1A23 A;  4HUA A;  3QCP A;  3GKX A;  1SJI A;  1X5D A;  2YNX A;  1ML6 A;  4MP4 A;  3ZIV A;  2NPB A;  5B8A A;  4MH3 A;  5F8B A;  3L9V A;  3KP8 A;  5D9V A;  5CRG A;  1GTA A;  1SD9 A;  3EVI A;  3QAW A;  3W8S A;  5H5R A;  1TJD A;  3F4T A;  3NIV A;  5D96 A;  4MJB A;  1M7T A;  4V2N A;  5ENU A;  2HSM B;  3C7M A;  3SBC A;  5DJM A;  4KDX A;  2CQ9 A;  3M9K A;  1M2D A;  2F9S A;  3FZ5 A;  5DBQ A;  3ZL5 A;  3F6F A;  1GSD A;  1N2A A;  4KCE A;  4KA0 A;  4MJE A;  2M72 A;  3TRP A;  3QD9 A;  4NMU A;  1XWK A;  2K8S A;  2FUG 2;  4EKZ A;  1BAY A;  1SYR A;  3TJF A;  4I8B A;  4POL A;  1GTB A;  2VL3 A;  1B4Q A;  1Z6M A;  2V1M A;  3C73 A;  4XS1 A;  5FHI A;  1OKT A;  1G7E A;  4F2I A;  1HYU A;  4N0Z A;  1QQ2 A;  6GSY A;  2N5A A;  1NM3 A;  4EC0 A;  3LEF A;  5ECI B;  4G2E A;  1B4P A;  4YAP A;  1GNW A;  3IOS A;  5IMC A;  4I2U A;  3M8N A;  5LD0 A;  3BOA A;  2IMK A;  1WPI A;  4KAE A;  2GS3 A;  2L59 A;  3GV1 A;  2DIZ A;  5ECH B;  2AAW A;  1M0U A;  4V2L A;  1WMJ A;  2DLX A;  5CRE A;  2QGV A;  1YF1 A;  1MDK A;  4GQC A;  1HNC A;  1A8L A;  2HRF A;  1CQH A;  2DJ2 A;  2VUP A;  4ZB6 A;  4GF0 A;  3ZMK A;  4TR0 A;  3IK9 A;  8GSS A;  1M9A A;  4PNG A;  3GL5 A;  4IS0 A;  3DYR A;  2X8H A;  3VWU A;  3TKR A;  1GTU A;  3M1G A;  1MD4 A;  3I69 A;  5DDL A;  3H1N A;  1ZMA A;  4XS6 A;  5JCG A;  3UEM A;  4ZIJ A;  1AQW A;  1NSW A;  4KDY A;  4MZC A;  1V57 A;  1PD2 1;  3QFA C;  5KN1 A;  2R6K A;  3DWV A;  2GVP A;  1PRX A;  4Q5Q A;  4JED A;  2K8V A;  3D4M A;  1K0M A;  3HJP A;  5AN1 A;  5EVO A;  3QDN A;  5CYY A;  2C80 A;  4WXT A;  1X5C A;  3APS A;  2RM5 A;  2H8L A;  1GSQ A;  3ZML A;  3CYN A;  3GKN A;  3KH7 A;  2VLT A;  2GLR A;  18GS A;  5IM9 A;  4IW9 A;  3U5R E;  1R26 A;  5ECP B;  5ECR B;  1K0D A;  5A4W A;  2JZT A;  2YWO A;  4BWS A;  3TDG A;  1SK2 A;  4J57 E;  2OJL A;  3KGK A;  1GUL A;  2HRK B;  1FHE A;  2H01 A;  5ABR A;  2IMF A;  3KMO A;  2IN3 A;  3FR3 A;  3NOF A;  4X0X A;  2AHE A;  5CP1 A;  3UMA A;  4JZQ A;  2PBJ A;  4H86 A;  4TOP A;  3D21 A;  3DRN A;  5G30 A;  5ECS A;  1A0F A;  3ME8 A;  1X9M B;  4GSN A;  1ACV A;  4DSQ A;  1WIK A;  1IYI A;  2GQM A;  1MDJ A;  2DJ0 A;  1TKD B;  4OFT A;  3K8N A;  4WKW A;  4YQV A;  4BVY B;  2IPA A;  3BCK A;  2X64 A;  2X8C A;  1SL1 B;  1SKR B;  2M80 A;  4AF2 A;  2HQT A;  1K3O A;  1THO A;  3UBL A;  5ECO B;  2B6M A;  4WR5 A;  4V1A p;  4K6X A;  3BCI A;  2OE0 A;  2LNT A;  1O7U A;  5LCZ A;  2WB9 A;  1T8E B;  5GAN D;  5DQY A;  5IQY A;  3QOU A;  4PXO A;  1TK5 B;  1BX9 A;  4HI7 A;  6GSW A;  1A8Y A;  2PPT A;  1HNA A;  1EGR A;  4MDC A;  1TI1 A;  4TVE A;  2PWJ A;  2VL2 C;  2CT6 A;  2ZUP A;  4K0N A;  3IK7 A;  2VLU A;  2WFC A;  4IQ1 A;  2WZ9 A;  4ZL7 A;  5JCU A;  1YF0 A;  2TRX A;  1JLV A;  1M2A A;  1TRW A;  3VLN A;  3EIN A;  3E0U A;  1ST9 A;  4EUY A;  5GST A;  5JWR B;  2HNL A;  3CSH A;  1F6M C;  4AGS A;  3WGE A;  2KLX A;  3BD2 A;  1VF1 A;  5HFI A;  2VCX A;  9GSS A;  4KSO A;  6GSS A;  1T1V A;  1PN9 A;  2IIY A;  4JRR A;  3V1W A;  2VD1 A;  20GS A;  1G6W A;  3C1R A;  4KGI A;  4XIH A;  3DIE A;  3ERW A;  3GIX A;  3GKM A;  1XXU A;  1MD3 A;  4PTS A;  2CAI A;  5GZZ B;  1GSF A;  1A2J A;  3HZ8 A;  5H5S A;  2H0I A;  2B5X A;  4X1U A;  4QL9 A;  4N0V A;  5IOX A;  2F8A A;  5H5Q A;  1GLP A;  5JWO B;  2PN8 A;  4MJA A;  4MMM A;  3BBY A;  2K6V A;  5F0G A;  1EV9 A;  3D22 A;  5IMV A;  5IMA A;  4G0I A;  4WEY A;  3FW2 A;  2VCQ A;  3F4S A;  4GRF A;  2F3M A;  7GSS A;  4K7N A;  2N5B A;  2AJQ B;  2OE1 A;  3RAZ A;  3GX0 A;  3TB2 A;  1SKW B;  3D0Z A;  3NZN A;  1GH2 A;  2I1U A;  1OE8 A;  4PX1 A;  4KB3 A;  4F03 A;  4L0W A;  5INY A;  4NV5 A;  4O92 A;  1R5P A;  2H71 A;  4DVC A;  2QC7 A;  3GHA A;  3F63 A;  2LRC A;  5D9X A;  5KEJ A;  3GFK A;  13GS A;  4IVF A;  3G9B A;  3ZIJ A;  2VM2 A;  4G19 A;  2GZP A;  4PUF C;  3VI7 A;  2JAC A;  1T7P B;  3ZFL A;  2JZR A;  3UAP A;  4ZXG A;  3FYG A;  1ZCP A;  4GCI A;  2DSA A;  4BPY A;  4GLT A;  1Z6N A;  1F3A A;  1WJK A;  4BA7 A;  4F9Z A;  1FW1 A;  2B7J A;  5GSS A;  1F37 A;  1OKD A;  4IHU A;  4BVX B;  3UJ1 A;  2PER A;  3N5O A;  2PUK C;  4IN0 A;  1SL2 B;  4FO5 A;  4L8E A;  4RQR A;  4RQX A;  3KJY A;  1XWB A;  2H1G A;  3S9F A;  3G7J A;  1Z5Y E;  3J7Y b;  1DE1 A;  3TKS E;  1E6B A;  1PL1 A;  4BL7 A;  1BQ7 A;  4HQZ A;  3WYW A;  1AQV A;  5HR3 A;  1RQM A;  2IFQ A;  3G7I A;  3O6T A;  3IR4 A;  2KHP A;  3IE3 A;  4DEJ A;  1XW6 A;  3LOR A;  2CZ2 A;  1K0C A;  4IBP A;  4NHZ A;  3JCM L;  3R3E A;  3W8J A;  1CQG A;  5DCG A;  5ID2 A;  3HA9 A;  2H6Y A;  2C0F A;  4ZIL A;  1QK8 A;  3TKQ A;  5J9B A;  1GRX A;  1H75 A;  4IKH A;  3HKR A;  4Q5R A;  4TR4 A;  1PGT A;  1KNG A;  1LBK A;  1GSY A;  3IDV A;  4HJM A;  2K18 A;  4HDE A;  4JE1 A;  2REM A;  1Y25 A;  2P31 A;  2VLV A;  1B48 A;  2GSS A;  5AIV A;  3VK9 A;  2VIM A;  17GS A;  3TCO A;  5G31 A;  4PNF A;  3PIN A;  1ERV A;  4EXJ A;  3O76 A;  2HT9 A;  2J9H A;  2LUS A;  1YZX A;  2HXK A;  4MH2 A;  1XFL A;  2LQQ A;  2HZE B;  2HSM A;  5ECN B;  1AIU A;  2O87 A;  1GP1 A;  2HYX A;  4AJ8 A;  4ZL8 A;  4XCS A;  3HJM A;  1XWC A;  1Q98 A;  3EWL A;  5B6N A;  2CX4 A;  4D73 B;  4N30 A;  3BJ5 A;  4ZBB A;  1K3Y A;  2VL2 A;  1YJ6 A;  2GGT A;  1TK8 B;  2LTK A;  3VI5 A;  4K7I A;  4NWY A;  3IRA A;  1M99 A;  2NDO A;  3FRC A;  2B1L A;  2Z9S A;  1PKW A;  2C8U A;  4OCE A;  4O5R A;  3TKS A;  3F9U A;  4V2M A;  2L6D A;  3ZVJ D;  2GTU A;  2NTO A;  1JHB A;  1EP7 A;  3PPU A;  2YZH A;  2FD3 A;  4QL7 A;  2FY6 A;  1YDK A;  3TGZ A;  3GRX A;  2L4Q A;  1PA3 A;  1A2M A;  5J9C A;  2F8F A;  4HEA 2;  5KN0 A;  1F2E A;  4XTS A;  5ECQ B;  5D9T A;  2MMO A;  4OCF A;  4EE0 A;  2ES7 A;  2FGX A;  5ECK B;  1QFN A;  1AXD A;  1MEK A;  1O8X A;  2LJK A;  2O7K A;  1EP8 A;  5GAP D;  6GSX A;  2CX3 A;  2WJU A;  3AY8 A;  1OYJ A;  3IAM 2;  2DJ1 A;  1GTI A;  4ML6 A;  3PR8 A;  3EU3 A;  2DJJ A;  3W6G A;  1X9S B;  2MYG A;  3E9J B;  3EYT A;  3GUS A;  4KDU A;  3VWW A;  2FLS A;  2WDU A;  4ISD A;  3VPT A;  4KSM A;  2WUL A;  2ON5 A;  5D73 A;  4KND A;  2IMD A;  1QXH A;  2MMA A;  4OO4 A;  2ZCT A;  1PKZ A;  4N10 A;  1R7H A;  3IC8 A;  1WE0 A;  3IAS 2;  1TU7 A;  3L0H A;  1XW9 A;  1F3B A;  5E59 A;  3RPP A;  1JZW A;  3TKP A;  2XBI A;  5EY6 A;  2LRT A;  4TR1 B;  1J08 A;  5JCW A;  3MAK A;  5DQS A;  2H19 A;  4ZBD A;  1HQO A;  4F0B A;  1RK4 A;  5B7C A;  2GT5 A;  3FR6 A;  5J4U A;  3UOM A;  2HRK A;  2HRA A;  2B1K A;  4MCU A;  5HQP A;  2LJR A;  4JR4 A;  2F51 A;  3ZVJ A;  3LGC A;  3KEB A;  4WR4 A;  2QSI A;  3H79 A;  1FO5 A;  3D5J A;  5ELG A;  5DJL A;  3LG6 A;  1MDI A;  3U6V A;  1T00 A;  4OMV A;  3ERG A;  4MJC A;  2B7K A;  3FEU A;  3RDW A;  16GS A;  2O8V B;  2IMI A;  1XVW A;  4YH2 A;  1SJ6 A;  4KX4 A;  2FA8 A;  5HR2 A;  3GX8 A;  1S3A A;  4AJ6 A;  3F6D A;  1IYH A;  2C0G A;  2H1B A;  1O81 A;  1E2Y A;  2PGT A;  2OBK A;  3GL3 A;  1HNB A;  3KP9 A;  2OKA A;  4TXO B;  3CBU A;  4ECI A;  1U87 A;  3CTG A;  3P8W A;  5HFK A;  4KH7 A;  4CHS A;  1S3C A;  5COH A;  2M46 A;  1M9B A;  2I9H A;  1Q4J A;  3HY2 A;  5ECL B;  2C0E A;  1JZR A;  4L5O A;  2LJA A;  2YN1 A;  4L5L A;  3ZRE A;  4PQI A;  2CA8 A;  5G5F A;  1PX7 A;  5KN2 A;  3APO A;  2MBT A;  1GUH A;  2GSR A;  3L4N A;  5LNK e;  3KMN A;  2EIO A;  2L4C A;  3GYK A;  4K0G A;  1K0B A;  4KE3 A;  4ECB A;  1FOV A;  1MTC A;  2B3S A;  3RBT A;  1YEP A;  2YP6 A;  2AYT A;  4FQU A;  3TKS C;  2A4V A;  2AB6 A;  2B5E A;  2DJK A;  2TIR A;  3TUE A;  2H66 A;  4J56 E;  1FVJ A;  5IO0 A;  3DKS A;  4OFN A;  4I97 A;  5F07 A;  3CSI A;  4LL4 B;  1WP0 A;  2FWH A;  2C3N A;  2HSH A;  1AUC A;  3MNG A;  3LQ7 A;  5ECM B;  2LST A;  12GS A;  2YCD A;  2O89 A;  3KZQ A;  4WBJ A;  2GZZ A;  1OC8 A;  1AC1 A;  5CAX A;  1O6J A;  4EF0 A;  2H30 A;  5D8I A;  1Z9H A;  2JL4 A;  1TK0 B;  2KP2 A;  3L78 A;  3DVW A;  4MZW A;  1GL8 A;  5DAL A;  3I9V 2;  1VF3 A;  1EGO A;  3CXG A;  4HS1 A;  2VL9 A;  1F9M A;  6GSV A;  3ZIT A;  3GSS A;  1GLQ A;  1SYX A;  5KN3 A;  3C71 A;  1ERU A;  2C1Y A;  1DE2 A;  2R37 A;  6GST A;  3IXR A;  4RI7 A;  2I81 A;  4PQH A;  1G0T A;  1OC9 A;  2IJY A;  1BED A;  2OA7 A;  1VF2 A;  2B5Y A;  3HHV A;  4IEL A;  4K7O A;  2IME A;  4TW5 A;  5CNW A;  5G1L A;  2LQO A;  1PQN A;  1SK0 A;  3IA1 A;  2XBQ A;  1UN2 A;  2HRN A;  4NPB A;  1JFU A;  5IPH A;  3HVS A;  1FAA A;  5J41 A;  4G0K A;  2GSQ A;  3R2Q A;  2FWG A;  2K9F A;  2ZNM A;  2I3Y A;  3TJB A;  2BTO T;  5CO3 A;  2VOC A;  1A24 A;  4GST A;  2OAC A;  4IJ3 A;  1WRY A;  4ULX A;  1V98 A;  3QR6 A;  3M0F A;  1TRV A;  3UIW A;  2RM6 A;  4I6X A;  1XZO A;  1PSQ A;  3FZ9 A;  5G5E A;  3ZTL A;  3FZ4 A;  2L57 A;  4GXZ A;  2X99 A;  1J0F A;  4OFM A;  2A2S A;  1T4Z A;  3UAR A;  3EC3 A;  5CRD A;  3GST A;  4O32 A;  2VM1 A;  4ECJ A;  2KOK A;  4FYU A;  1ZYQ B;  1Z3E A;  2HI7 A;  3LYP A;  4NAX A;  3US3 A;  4IGJ A;  4ACS A;  1Z7P A;  5HR1 A;  3MDK A;  4F82 A;  2C0D A;  5CRH A;  1YEX A;  2JAD A;  5D93 A;  4MA9 A;  1TP9 A;  3A2W A;  3HDC A;  2LRN A;  2CVD A;  1QGV A;  4MPG A;  2DIY A;  1Y6E A;  3TRQ A;  1H4O A;  4OO5 A;  4ID0 A;  3Q19 A;  4XS4 B;  4N11 A;  5IPG A;  3I6A A;  1TI3 A;  5EL8 A;  1O73 A;  3RPN A;  3WT1 A;  4D73 A;  3MSZ A;  3PH9 A;  2OBI A;  2WCI A;  5HFG A;  3FY7 A;  3GTU B;  3QPM A;  1TTZ A;  4CW9 A;  1B8X A;  3IBH A;  5J5N A;  1KBN A;  1W4V A;  3DEX A;  3KCM A;  4KW6 A;  1PL2 A;  1TU8 A;  2WS2 A;  4MZB A;  3TOU A;  1EOH A;  19GS A;  2XPD A;  1SD8 A;  5DVB A;  1O85 A;  4IJI A;  3D4T A;  1LU4 A;  5AIS A;  1V2A A;  6GSU A;  2PVO C;  3LXZ A;  3PGT A;  1OAZ A;  1VRS D;  1TW9 A;  1ZL9 A;  1NW2 A;  3CSJ A;  1TDI A;  3KXO A;  2GST A;  1OE7 A;  4BL7 B;  1QUW A;  2MMN A;  4KF9 A;  4LMV A;  4K2D A;  2R3X A;  1U3A A;  2V2G A;  5L71 A;  4TR3 A;  2OAD A;  2YPM A;  3A2X A;  4MLY A;  2OE3 A;  1EWX A;  3LYK A;  1DBY A;  3HYP A;  2EIQ A;  2BMX A;  4XRA A;  2H73 A;  3P7X A;  4IQA A;  4IP1 A;  3A3T A;  2C3Q A;  2HZF A;  1ERW A;  4DSR A;  10GS A;  4DSS B;  1JLW A;  4ZB8 A;  4MAB A;  1EEM A;  3OR5 A;  1R5A A;  1K0N A;  1WOU A;  2HSN B;  1TRU A; 
#chains in the Genus database with same CATH topology
 3GH6 A;  3EE2 A;  1C72 A;  4XHM A;  2CAQ A;  3ERF A;  1FB0 A;  1JZD A;  3DML A;  2VO4 A;  4POK A;  4K1F A;  4JR6 A;  3N9J A;  5DAK B;  2FA4 A;  2NVL A;  1XPV A;  5J3R A;  1GNE A;  1G6Y A;  1UC7 A;  1A0R P;  1VGL A;  2YWN A;  2L6C A;  1OC3 A;  4HZ2 A;  4NV2 A;  1RW1 A;  4Z7X A;  3LFL A;  1FG4 A;  1PMT A;  3HZ4 A;  1XWA A;  1BJX A;  3M9J A;  3KD0 A;  4V1A g;  4AJ7 A;  3HMJ G;  3P90 A;  4TR1 A;  2CVK A;  1TOF A;  5HR0 A;  1YQ1 A;  1J9B A;  4EIQ A;  4MF6 A;  2YAN A;  2R5G A;  4G0L A;  4PGT A;  3TJJ A;  4POM A;  3VWV A;  4RI6 A;  5F05 A;  4QQ7 A;  1TRS A;  2GQL A;  1R4W A;  2GT6 A;  4PUA A;  3F3Q A;  1YY7 A;  2FNO A;  2R2J A;  2VCZ A;  1NHO A;  4KCA A;  4EDY A;  4RUV A;  1JZO A;  5C04 A;  3FZA A;  2G0F A;  1U6T A;  1XOB A;  4GSS A;  2TRC P;  3F8U A;  1BG1 A;  4I5Q A;  3QAV A;  3TJK A;  2XC2 A;  3HVV A;  4MK3 A;  1YKC A;  2JU5 A;  5AIX A;  2H72 A;  1ABA A;  3TJG A;  3E3E A;  3UBK A;  1SEN A;  3ED3 A;  2I4A A;  1T4Y A;  2MMZ A;  4OD7 A;  2X8G A;  2H1D A;  1B9X C;  2P5R A;  4HQS A;  2DJ3 A;  5AGY A;  3ISO A;  4O7H A;  3GUR A;  4LA1 A;  2HSY A;  4HOJ A;  3ZLP A;  5G1K A;  1ZYE A;  1GSS A;  2VD0 A;  4FH8 A;  5F06 A;  4TXO A;  1ZGN A;  2E2G A;  2AV4 A;  4K9Z A;  4ILF A;  2NBS A;  1EOG A;  3CRT A;  3WD6 A;  1VF4 A;  3O3T A;  2FWF A;  4YAV A;  4BVY A;  5A34 B;  1PFO A;  2O85 A;  3VFI A;  4BWQ A;  5DCH A;  1GSU A;  1XVQ A;  2PVQ A;  5IOW A;  4FYC A;  3ZRD A;  4EO3 A;  2R4V A;  1URM A;  4TN8 A;  1YVL A;  3HJO A;  2EIR A;  2UV8 G;  3F0I A;  3APQ A;  1U88 A;  3DGQ A;  2E2M A;  2E7P A;  2HFD A;  3KTL A;  1X0R A;  2JSZ A;  2FWE A;  3FR9 A;  3RHB A;  4IP6 A;  4JU5 A;  2DBC A;  2LS5 A;  3DD3 A;  2QKE A;  3D6I A;  3TOT A;  4HZ4 A;  4HU7 A;  3HD5 A;  5KOX A;  4G9H A;  1Z7R A;  3LJR A;  1HD2 A;  4MF7 A;  4P3Y B;  3HCZ A;  2DC5 A;  4WF4 A;  5C00 A;  2MZC A;  3ZZX A;  2HLS A;  3KTB A;  3VPQ A;  2H0H A;  3WGX A;  3IV4 A;  1V58 A;  2H6X A;  2CZ3 A;  5IIZ A;  1DUG A;  2J23 A;  5G2Z A;  1THX A;  3EMP A;  2VCW A;  3ZFB A;  1K3L A;  5B8B A;  2RUE A;  4E8H A;  1BG5 A;  1LJR A;  2WW0 A;  2N5F A;  2VAF A;  2WW3 A;  4MPF A;  2VCT A;  1I9D A;  3LSZ A;  5E4W A;  4JBB A;  1GWC A;  1U3I A;  11GS A;  2L5L A;  3WGD A;  4HJ2 A;  1N8J A;  2YV9 A;  3Q18 A;  1X9W B;  3QAG A;  1B9Y C;  1I5G A;  4TXV A;  2OT3 A;  4Q5N A;  4GQF A;  2YWI A;  3F4R A;  3ME7 A;  1XG8 A;  4FYB A;  2WVX A;  1A2L A;  3H4K A;  4HU9 A;  4EVM A;  4YQM A;  4LMW A;  4BIK A;  2UZ8 A;  5A4V A;  2GQK A;  5ELA A;  2LKU A;  3Q6O A;  3UVT A;  4G10 A;  3VWX A;  1Y1U A;  3IC4 A;  2PMT A;  5JWQ B;  4N3Z A;  4XRD A;  5A1N B;  2FCH A;  1EZK A;  2GDR A;  3A5W A;  2YOI A;  3LWA A;  4ZBA A;  3J7Y k;  5J47 A;  5BRT A;  3HVX A;  3VUR A;  1XCC A;  3UL3 A;  3RHC A;  2IWT A;  2WVZ A;  4L0U A;  2RII A;  3DXB A;  2LNS A;  3CTF A;  3IPZ A;  3CRU A;  2V32 A;  3G7Y A;  5J40 A;  14GS A;  1WWJ A;  2V41 A;  5EPF A;  3Q74 A;  4Q5F A;  1XW5 A;  1ON4 A;  1S3D A;  1FVK A;  3M3M A;  3GNJ A;  3ZYW A;  22GS A;  2P5Q A;  3SWL A;  5A4U A;  5CRW A;  4FIW A;  5KOW A;  3L9S A;  2C3T A;  2ON7 A;  2LEG A;  3GH9 A;  3A2V A;  2G2Q A;  3H8Q A;  1T3B A;  4BVX A;  3EMX A;  5D9W A;  4QMK A;  1O8W A;  4EDZ A;  4TKY A;  3CMI A;  4X43 A;  4ZL9 A;  2H70 A;  1SJZ A;  1UVZ A;  5IO2 A;  2IL3 A;  3F3R A;  3IHQ A;  4YKG A;  5FWG A;  4K8M A;  4YQU A;  5B6M A;  5J4V A;  3DVX A;  3EU4 A;  1V9W A;  2DML A;  2JSY A;  1PX6 A;  4MF5 A;  2A2R A;  3L9U A;  2LV3 A;  5FT3 A;  1OVN A;  5IMF A;  5DAL B;  3UVH A;  5IMD A;  2RUF A;  2YWM A;  2GZY A;  2H6Z A;  2H75 A;  2H0G A;  4NHW A;  3MWH A;  3QMX A;  1SVL A;  4PUR A;  4J2F A;  1EV4 A;  4E8E A;  3P2A A;  4WET A;  1KEB A;  2MBS A;  3GA4 A;  2DMM A;  1QMV A;  1OC9 B;  4XS4 A;  1SK1 A;  3KIJ A;  3IHG A;  2XHF A;  4W66 A;  2C4J A;  3WT2 A;  2YZU A;  2CV4 A;  2YJ7 A;  3GTU A;  2WRT A;  2QA2 A;  4LLR A;  1USB A;  5IMZ A;  4KUN A;  2DKI A;  3FKF A;  1ZZY A;  4TRX A;  3EUR A;  2V6K A;  2E0Q A;  1YKA A;  4ECC A;  3C8E A;  3GN3 A;  4ZB9 A;  4F0C A;  1BYE A;  1XOA A;  3FHK A;  1UA5 A;  2V6O A;  2BJX A;  1KTE A;  1XWG A;  2RLI A;  2HE3 A;  4POB A;  3TRX A;  2KUC A;  2HZE A;  1SU9 A;  3FK8 A;  3GMF A;  1GUK A;  1AAZ A;  2EC4 A;  3C1S A;  2CVB A;  3HXS A;  1ERT A;  1FB6 A;  4USS A;  1M2B A;  3LXT A;  2VCV A;  2P0G A;  4GWR A;  2H74 A;  1XIY A;  3GKK A;  1K0O A;  4PQ1 A;  3I43 A;  1SKS B;  4ML1 A;  3KM6 A;  2WGR A;  1AQX A;  1GUM A;  1ILO A;  1GSE A;  4OWY A;  1SL0 B;  1V40 A;  1ZOF A;  2PU9 C;  1TXX A;  4DSS A;  4CDO A;  2YJH A;  2IFQ B;  4NXI A;  1K0A A;  4I2T A;  4EL1 A;  2XPE A;  5BMU A;  2KP1 A;  2HSN A;  1NHY A;  4WF5 A;  1EEJ A;  1DSB A;  1XBS A;  2D2Z A;  1AW9 A;  2AUV A;  2FHE A;  1X5E A;  2JZS A;  5A5K A;  3QFB C;  5J4Y A;  2ALB A;  2H1A A;  2L5O A;  5ID2 B;  3KH9 A;  1W89 A;  5DAK A;  1G7O A;  2H76 A;  2YV7 A;  4GTU A;  3H93 A;  4WBR D;  4LL1 B;  1A23 A;  4HUA A;  3QCP A;  3GKX A;  1SJI A;  1X5D A;  2YNX A;  1ML6 A;  4MP4 A;  3ZIV A;  2NPB A;  5B8A A;  4MH3 A;  5F8B A;  3L9V A;  3KP8 A;  5D9V A;  5CRG A;  1GTA A;  5A5H A;  1SD9 A;  3EVI A;  3QAW A;  3W8S A;  5H5R A;  1TJD A;  3F4T A;  3NIV A;  5D96 A;  4MJB A;  1M7T A;  4K5R A;  4V2N A;  5ENU A;  2HSM B;  2EFD A;  3C7M A;  3SBC A;  5DJM A;  4KDX A;  2CQ9 A;  3M9K A;  1M2D A;  2F9S A;  3FZ5 A;  5DBQ A;  3ZL5 A;  3F6F A;  1GSD A;  1N2A A;  4KCE A;  4KA0 A;  4MJE A;  2M72 A;  3TRP A;  1TXU A;  3QD9 A;  4NMU A;  1XWK A;  2K8S A;  2FUG 2;  4EKZ A;  1BAY A;  1SYR A;  3TJF A;  4I8B A;  4POL A;  1GTB A;  2VL3 A;  1B4Q A;  1Z6M A;  2V1M A;  3C73 A;  4XS1 A;  5FHI A;  1OKT A;  1G7E A;  4F2I A;  1HYU A;  4N0Z A;  1QQ2 A;  6GSY A;  2N5A A;  1NM3 A;  4EC0 A;  3LEF A;  5ECI B;  4G2E A;  1B4P A;  4YAP A;  1GNW A;  3IOS A;  5IMC A;  4I2U A;  3M8N A;  5LD0 A;  3BOA A;  2IMK A;  1WPI A;  4KAE A;  2GS3 A;  2L59 A;  3GV1 A;  2DIZ A;  5ECH B;  2AAW A;  1M0U A;  4V2L A;  1WMJ A;  2DLX A;  5CRE A;  2QGV A;  1YF1 A;  1MDK A;  4GQC A;  1HNC A;  1A8L A;  2HRF A;  1CQH A;  2DJ2 A;  5A34 A;  2VUP A;  4ZB6 A;  2A4H A;  4GF0 A;  3ZMK A;  4TR0 A;  3IK9 A;  8GSS A;  1M9A A;  4PNG A;  3GL5 A;  4IS0 A;  3CQF A;  3DYR A;  2X8H A;  3VWU A;  3TKR A;  1GTU A;  3M1G A;  1MD4 A;  3I69 A;  5DDL A;  3H1N A;  1ZMA A;  4XS6 A;  5JCG A;  3UEM A;  4ZIJ A;  1AQW A;  1NSW A;  4KDY A;  4MZC A;  1V57 A;  1PD2 1;  3QFA C;  5KN1 A;  2R6K A;  3DWV A;  2GVP A;  2EFH A;  1PRX A;  3RFR C;  4Q5Q A;  4JED A;  2K8V A;  3D4M A;  1K0M A;  3HJP A;  5AN1 A;  5EVO A;  3QDN A;  5CYY A;  2C80 A;  4WXT A;  1X5C A;  3APS A;  2RM5 A;  2H8L A;  1GSQ A;  3ZML A;  1M3J A;  3CYN A;  3GKN A;  3KH7 A;  2VLT A;  2GLR A;  18GS A;  5IM9 A;  4IW9 A;  4Z2U A;  3U5R E;  1R26 A;  5ECP B;  5ECR B;  1K0D A;  5A4W A;  2JZT A;  2YWO A;  4BWS A;  3TDG A;  1SK2 A;  4J57 E;  2O3E A;  2OJL A;  3KGK A;  1GUL A;  2HRK B;  1FHE A;  2H01 A;  5ABR A;  2EFE A;  2IMF A;  3KMO A;  2IN3 A;  3FR3 A;  3NOF A;  4X0X A;  2AHE A;  3CHX C;  5CP1 A;  3UMA A;  4JZQ A;  2PBJ A;  4H86 A;  4TOP A;  3D21 A;  3DRN A;  5G30 A;  5ECS A;  1A0F A;  2WVY A;  3ME8 A;  1X9M B;  4GSN A;  1ACV A;  4DSQ A;  1WIK A;  1M3I A;  1IYI A;  2GQM A;  1MDJ A;  2DJ0 A;  1TKD B;  4OFT A;  3K8N A;  4WKW A;  2EFC A;  4YQV A;  4BVY B;  2IPA A;  3BCK A;  2X64 A;  3A5I A;  2X8C A;  1SL1 B;  1SKR B;  2M80 A;  4AF2 A;  2HQT A;  1I1I P;  1K3O A;  1THO A;  3UBL A;  5ECO B;  2B6M A;  4WR5 A;  4V1A p;  4K6X A;  3BCI A;  2OE0 A;  2LNT A;  1O7U A;  5LCZ A;  2WB9 A;  1T8E B;  5GAN D;  5DQY A;  5IQY A;  3QOU A;  4A5P A;  4PXO A;  1TK5 B;  1BX9 A;  4HI7 A;  6GSW A;  1A8Y A;  2PPT A;  1HNA A;  1EGR A;  4AKI A;  4MDC A;  1TI1 A;  4TVE A;  2PWJ A;  2VL2 C;  2CT6 A;  2R0G A;  2ZUP A;  4K0N A;  2A2P A;  3IK7 A;  2VLU A;  2WFC A;  4IQ1 A;  2WZ9 A;  4ZL7 A;  4PI0 C;  5JCU A;  1YF0 A;  2TRX A;  1JLV A;  1M2A A;  1TRW A;  3VLN A;  4HSC X;  3EIN A;  3E0U A;  1ST9 A;  4EUY A;  5GST A;  5JWR B;  2HNL A;  3CSH A;  1F6M C;  4AGS A;  3WGE A;  2KLX A;  3BD2 A;  1VF1 A;  5HFI A;  2VCX A;  9GSS A;  4KSO A;  6GSS A;  1T1V A;  2X4A A;  1PN9 A;  2IIY A;  4JRR A;  3V1W A;  2VD1 A;  20GS A;  1G6W A;  3C1R A;  4KGI A;  4XIH A;  3DIE A;  3ERW A;  1SVO A;  3GIX A;  3GKM A;  1XXU A;  1MD3 A;  4PTS A;  2CAI A;  5GZZ B;  1GSF A;  1A2J A;  3HZ8 A;  4MNN A;  5H5S A;  2H1L A;  2H0I A;  2B5X A;  4X1U A;  4QL9 A;  4N0V A;  5IOX A;  2F8A A;  2WVX B;  5H5Q A;  1GLP A;  5JWO B;  2PN8 A;  4MJA A;  4MMM A;  3BBY A;  2K6V A;  5F0G A;  1EV9 A;  3D22 A;  5IMV A;  5IMA A;  4G0I A;  4WEY A;  3FW2 A;  2VCQ A;  3F4S A;  4GRF A;  2F3M A;  7GSS A;  4K7N A;  2N5B A;  2AJQ B;  2OE1 A;  3RAZ A;  3GX0 A;  3TB2 A;  1SKW B;  3D0Z A;  3NZN A;  1GH2 A;  2I1U A;  1OE8 A;  4PX1 A;  4KB3 A;  4F03 A;  4L0W A;  5INY A;  4NV5 A;  4O92 A;  1R5P A;  2H71 A;  2VKZ G;  4DVC A;  2QC7 A;  3GHA A;  3F63 A;  2LRC A;  5D9X A;  5KEJ A;  3GFK A;  3HVN A;  13GS A;  2WW1 A;  4IVF A;  3G9B A;  3ZIJ A;  2VM2 A;  4G19 A;  4E68 A;  2GZP A;  4PUF C;  3VI7 A;  2JAC A;  1T7P B;  3ZFL A;  3MIX A;  2JZR A;  3UAP A;  4ZXG A;  3FYG A;  1ZCP A;  4GCI A;  2DSA A;  4BPY A;  4GLT A;  1Z6N A;  1F3A A;  1WJK A;  4BA7 A;  4F9Z A;  1FW1 A;  2B7J A;  5GSS A;  2X49 A;  1F37 A;  1BF5 A;  1OKD A;  4IHU A;  4BVX B;  3UJ1 A;  2PER A;  3N5O A;  2PUK C;  4IN0 A;  1SL2 B;  4FO5 A;  4L8E A;  4RQR A;  4RQX A;  3KJY A;  1XWB A;  2H1G A;  3S9F A;  3G7J A;  1Z5Y E;  3J7Y b;  1DE1 A;  3TKS E;  1E6B A;  4O5U A;  1PL1 A;  4BL7 A;  1BQ7 A;  4HQZ A;  3WYW A;  1AQV A;  5HR3 A;  1RQM A;  2IFQ A;  3G7I A;  3O6T A;  3IR4 A;  2KHP A;  3IE3 A;  4DEJ A;  1XW6 A;  3LOR A;  2CZ2 A;  1K0C A;  4IBP A;  4NHZ A;  3JCM L;  4AI6 A;  3R3E A;  3W8J A;  1CQG A;  5DCG A;  5ID2 A;  3HA9 A;  2H6Y A;  2C0F A;  4ZIL A;  1QK8 A;  3TKQ A;  1ZYP A;  5J9B A;  1GRX A;  1H75 A;  4IKH A;  3HKR A;  4Q5R A;  4TR4 A;  1PGT A;  1KNG A;  1LBK A;  1GSY A;  3IDV A;  4HJM A;  2K18 A;  4HDE A;  4JE1 A;  2REM A;  1Y25 A;  2P31 A;  2VLV A;  1B48 A;  2GSS A;  5AIV A;  3VK9 A;  2VIM A;  17GS A;  3TCO A;  5G31 A;  4PNF A;  3PIN A;  1ERV A;  4EXJ A;  3O76 A;  2HT9 A;  2J9H A;  2LUS A;  1YZX A;  2HXK A;  4MH2 A;  1XFL A;  2LQQ A;  2HZE B;  2HSM A;  5ECN B;  1S4B P;  1AIU A;  2O87 A;  1GP1 A;  2HYX A;  4AJ8 A;  4ZL8 A;  4XCS A;  3HJM A;  1XWC A;  1Q98 A;  3EWL A;  5B6N A;  2CX4 A;  4D73 B;  4N30 A;  2QA1 A;  3BJ5 A;  4ZBB A;  1K3Y A;  2VL2 A;  1YJ6 A;  2GGT A;  1TK8 B;  2LTK A;  3VI5 A;  4K7I A;  4PI2 C;  4NWY A;  3IRA A;  1M99 A;  2NDO A;  3FRC A;  2B1L A;  2Z9S A;  1PKW A;  2C8U A;  3LW9 A;  4OCE A;  4O5R A;  3TKS A;  3F9U A;  4V2M A;  3RGB C;  2L6D A;  3ZVJ D;  2GTU A;  2NTO A;  1JHB A;  1EP7 A;  3PPU A;  2YZH A;  2FD3 A;  4QL7 A;  2FY6 A;  1YDK A;  3TGZ A;  3GRX A;  2L4Q A;  1PA3 A;  1A2M A;  5J9C A;  2F8F A;  4HEA 2;  5KN0 A;  1F2E A;  4XTS A;  5ECQ B;  5D9T A;  2MMO A;  4OCF A;  4EE0 A;  2ES7 A;  2FGX A;  5ECK B;  4ZB7 A;  1QFN A;  3MYD A;  1AXD A;  1MEK A;  1O8X A;  2LJK A;  2O7K A;  2R0P A;  1EP8 A;  5GAP D;  6GSX A;  2CX3 A;  2WJU A;  3AY8 A;  1OYJ A;  3IAM 2;  4G01 A;  2DJ1 A;  1GTI A;  4ML6 A;  3PR8 A;  3EU3 A;  5A5H B;  2DJJ A;  3W6G A;  1X9S B;  2MYG A;  1S3R A;  3E9J B;  3EYT A;  3GUS A;  4KDU A;  3VWW A;  2FLS A;  2WDU A;  4ISD A;  3VPT A;  4KSM A;  2WUL A;  2ON5 A;  5D73 A;  4KND A;  2IMD A;  1QXH A;  2MMA A;  4OO4 A;  2ZCT A;  1PKZ A;  4N10 A;  1R7H A;  3IC8 A;  4PHZ C;  1WE0 A;  3IAS 2;  1TU7 A;  3L0H A;  1XW9 A;  1F3B A;  5E59 A;  4GDF A;  4ICY A;  3RPP A;  1JZW A;  3TKP A;  2XBI A;  5EY6 A;  2LRT A;  4TR1 B;  1J08 A;  5JCW A;  3MAK A;  5DQS A;  4K2X A;  2H19 A;  4ZBD A;  1HQO A;  4F0B A;  1RK4 A;  5B7C A;  1SVM A;  2GT5 A;  3FR6 A;  5J4U A;  3UOM A;  2HRK A;  2HRA A;  4AKH A;  2B1K A;  4MCU A;  5HQP A;  2LJR A;  4JR4 A;  2F51 A;  3ZVJ A;  3LGC A;  3KEB A;  4WR4 A;  2QSI A;  3H79 A;  1FO5 A;  3D5J A;  5ELG A;  5DJL A;  3LG6 A;  1MDI A;  3U6V A;  1T00 A;  4OMV A;  3ERG A;  3FMW A;  4MJC A;  2B7K A;  3FEU A;  3RDW A;  16GS A;  2O8V B;  2IMI A;  1XVW A;  4YH2 A;  1SJ6 A;  4KX4 A;  2FA8 A;  5HR2 A;  3GX8 A;  1S3A A;  4AJ6 A;  3F6D A;  1IYH A;  2C0G A;  2H1B A;  1O81 A;  1E2Y A;  2PGT A;  2OBK A;  4EIP A;  3GL3 A;  1HNB A;  4CY6 A;  3KP9 A;  2OKA A;  4TXO B;  3CBU A;  4ECI A;  1U87 A;  1FOH A;  3CTG A;  3P8W A;  5HFK A;  4KH7 A;  4K5S A;  4CHS A;  1S3C A;  5COH A;  2M46 A;  1M9B A;  2I9H A;  1Q4J A;  3HY2 A;  5ECL B;  2C0E A;  5A1N A;  1JZR A;  4L5O A;  2LJA A;  2YN1 A;  4L5L A;  3ZRE A;  4CY8 A;  4PQI A;  2CA8 A;  5G5F A;  1PX7 A;  5KN2 A;  4Z2R A;  3APO A;  2MBT A;  1GUH A;  2GSR A;  3L4N A;  5LNK e;  3KMN A;  2O5V A;  2EIO A;  2L4C A;  3GYK A;  4K0G A;  4X4J A;  1K0B A;  4KE3 A;  4ECB A;  1FOV A;  1MTC A;  2B3S A;  3RBT A;  1YEP A;  2YP6 A;  2AYT A;  4FQU A;  3TKS C;  2A4V A;  2AB6 A;  3CWG A;  2B5E A;  2DJK A;  2TIR A;  3TUE A;  2H66 A;  2O36 A;  4J56 E;  1FVJ A;  5IO0 A;  3DKS A;  4OFN A;  4I97 A;  5F07 A;  3CSI A;  4LL4 B;  4Z2T A;  1WP0 A;  2FWH A;  2R0C A;  2C3N A;  2HSH A;  1AUC A;  4YKF A;  3MNG A;  3LQ7 A;  5ECM B;  2LST A;  12GS A;  2YCD A;  2O89 A;  3KZQ A;  4WBJ A;  2GZZ A;  1OC8 A;  1AC1 A;  5CAX A;  1O6J A;  4EF0 A;  2H30 A;  5D8I A;  1Z9H A;  2JL4 A;  1TK0 B;  2KP2 A;  3L78 A;  3DVW A;  4MZW A;  1GL8 A;  5DAL A;  3I9V 2;  1VF3 A;  1EGO A;  3CXG A;  4HS1 A;  2VL9 A;  1F9M A;  6GSV A;  3ZIT A;  3GSS A;  1GLQ A;  1SYX A;  5KN3 A;  3C71 A;  1ERU A;  4O5Q A;  2C1Y A;  1DE2 A;  2R37 A;  6GST A;  3IXR A;  4RI7 A;  2I81 A;  4PQH A;  1G0T A;  1OC9 A;  2IJY A;  1BED A;  2OA7 A;  1VF2 A;  2B5Y A;  3HHV A;  4IEL A;  4K7O A;  2IME A;  4TW5 A;  5CNW A;  5G1L A;  2LQO A;  1PQN A;  1SK0 A;  3IA1 A;  2XBQ A;  1UN2 A;  2HRN A;  1N25 A;  3EPT A;  4NPB A;  1JFU A;  5IPH A;  3HVS A;  1FAA A;  5J41 A;  4G0K A;  2GSQ A;  3R2Q A;  2FWG A;  2K9F A;  2ZNM A;  2I3Y A;  3TJB A;  2BTO T;  5CO3 A;  2VOC A;  1A24 A;  4GST A;  2WW2 A;  2OAC A;  4IJ3 A;  1WRY A;  4ULX A;  1V98 A;  3QR6 A;  3M0F A;  1TRV A;  3UIW A;  2RM6 A;  4I6X A;  1XZO A;  1PSQ A;  3FZ9 A;  5G5E A;  3ZTL A;  3FZ4 A;  2L57 A;  4GXZ A;  2X99 A;  1J0F A;  4OFM A;  2A2S A;  1T4Z A;  3UAR A;  3EC3 A;  5CRD A;  3GST A;  4O32 A;  2VM1 A;  1YEW C;  4ECJ A;  2KOK A;  4FYU A;  1ZYQ B;  1Z3E A;  2HI7 A;  3LYP A;  4NAX A;  3US3 A;  4IGJ A;  4ACS A;  1Z7P A;  5HR1 A;  3MDK A;  4F82 A;  2C0D A;  5CRH A;  1YEX A;  2JAD A;  5D93 A;  4MA9 A;  1TP9 A;  3A2W A;  3HDC A;  2LRN A;  2CVD A;  1PN0 A;  1QGV A;  4MPG A;  2DIY A;  1Y6E A;  3TRQ A;  1H4O A;  4OO5 A;  4ID0 A;  3Q19 A;  4XS4 B;  4N11 A;  5IPG A;  3I6A A;  1TI3 A;  5EL8 A;  1O73 A;  3RPN A;  3WT1 A;  4D73 A;  3MSZ A;  3PH9 A;  2OBI A;  2WCI A;  5HFG A;  2WZS A;  3FY7 A;  3GTU B;  3QPM A;  1TTZ A;  4CW9 A;  1B8X A;  3IBH A;  5J5N A;  1KBN A;  1W4V A;  3DEX A;  3KCM A;  1ZYN A;  4KW6 A;  1PL2 A;  1TU8 A;  2WS2 A;  4MZB A;  3TOU A;  1EOH A;  4AKG A;  19GS A;  2XPD A;  1SD8 A;  5DVB A;  1O85 A;  4IJI A;  3D4T A;  1LU4 A;  2DKH A;  5AIS A;  1V2A A;  6GSU A;  2PVO C;  3LXZ A;  3PGT A;  1OAZ A;  1VRS D;  1TW9 A;  1ZL9 A;  1NW2 A;  3CSJ A;  4FXY P;  1TDI A;  3KXO A;  2GST A;  1OE7 A;  4BL7 B;  1QUW A;  2MMN A;  4KF9 A;  4AKX B;  4LMV A;  4K2D A;  2R3X A;  1U3A A;  2V2G A;  5L71 A;  4TR3 A;  2OAD A;  2YPM A;  3A2X A;  4MLY A;  2OE3 A;  1EWX A;  3LYK A;  1DBY A;  3HYP A;  3TU3 B;  2EIQ A;  2BMX A;  4XRA A;  2H73 A;  3P7X A;  4IQA A;  4IP1 A;  3A3T A;  2C3Q A;  2HZF A;  1ERW A;  4DSR A;  10GS A;  4DSS B;  1JLW A;  4ZB8 A;  4MAB A;  1EEM A;  3OR5 A;  1R5A A;  1K0N A;  5BMU B;  1WOU A;  2HSN B;  1TRU A; 
#chains in the Genus database with same CATH homology
 3GH6 A;  3EE2 A;  1C72 A;  4XHM A;  2CAQ A;  3ERF A;  1FB0 A;  1JZD A;  3DML A;  2VO4 A;  4POK A;  4K1F A;  4JR6 A;  3N9J A;  5DAK B;  2FA4 A;  2NVL A;  1XPV A;  5J3R A;  1GNE A;  1G6Y A;  1UC7 A;  1A0R P;  1VGL A;  2YWN A;  2L6C A;  1OC3 A;  4HZ2 A;  4NV2 A;  1RW1 A;  4Z7X A;  3LFL A;  1FG4 A;  1PMT A;  3HZ4 A;  1XWA A;  1BJX A;  3M9J A;  3KD0 A;  4V1A g;  4AJ7 A;  3HMJ G;  3P90 A;  4TR1 A;  2CVK A;  1TOF A;  5HR0 A;  1YQ1 A;  1J9B A;  4EIQ A;  4MF6 A;  2YAN A;  2R5G A;  4G0L A;  4PGT A;  3TJJ A;  4POM A;  3VWV A;  4RI6 A;  5F05 A;  4QQ7 A;  1TRS A;  2GQL A;  1R4W A;  2GT6 A;  4PUA A;  3F3Q A;  1YY7 A;  2FNO A;  2R2J A;  2VCZ A;  1NHO A;  4KCA A;  4EDY A;  4RUV A;  1JZO A;  5C04 A;  3FZA A;  2G0F A;  1U6T A;  1XOB A;  4GSS A;  2TRC P;  3F8U A;  1BG1 A;  4I5Q A;  3QAV A;  3TJK A;  2XC2 A;  3HVV A;  4MK3 A;  1YKC A;  2JU5 A;  5AIX A;  2H72 A;  1ABA A;  3TJG A;  3E3E A;  3UBK A;  1SEN A;  3ED3 A;  2I4A A;  1T4Y A;  2MMZ A;  4OD7 A;  2X8G A;  2H1D A;  1B9X C;  2P5R A;  4HQS A;  2DJ3 A;  5AGY A;  3ISO A;  4O7H A;  3GUR A;  4LA1 A;  2HSY A;  4HOJ A;  3ZLP A;  5G1K A;  1ZYE A;  1GSS A;  2VD0 A;  4FH8 A;  5F06 A;  4TXO A;  1ZGN A;  2E2G A;  2AV4 A;  4K9Z A;  4ILF A;  2NBS A;  1EOG A;  3CRT A;  3WD6 A;  1VF4 A;  3O3T A;  2FWF A;  4YAV A;  4BVY A;  5A34 B;  2O85 A;  3VFI A;  4BWQ A;  5DCH A;  1GSU A;  1XVQ A;  2PVQ A;  5IOW A;  4FYC A;  3ZRD A;  4EO3 A;  2R4V A;  1URM A;  4TN8 A;  1YVL A;  3HJO A;  2EIR A;  2UV8 G;  3F0I A;  3APQ A;  1U88 A;  3DGQ A;  2E2M A;  2E7P A;  2HFD A;  3KTL A;  1X0R A;  2JSZ A;  2FWE A;  3FR9 A;  3RHB A;  4IP6 A;  4JU5 A;  2DBC A;  2LS5 A;  3DD3 A;  2QKE A;  3D6I A;  3TOT A;  4HZ4 A;  4HU7 A;  3HD5 A;  5KOX A;  4G9H A;  1Z7R A;  3LJR A;  1HD2 A;  4MF7 A;  4P3Y B;  3HCZ A;  2DC5 A;  4WF4 A;  5C00 A;  2MZC A;  3ZZX A;  2HLS A;  3KTB A;  3VPQ A;  2H0H A;  3WGX A;  3IV4 A;  1V58 A;  2H6X A;  2CZ3 A;  5IIZ A;  1DUG A;  2J23 A;  5G2Z A;  1THX A;  3EMP A;  2VCW A;  3ZFB A;  1K3L A;  5B8B A;  2RUE A;  4E8H A;  1BG5 A;  1LJR A;  2N5F A;  2VAF A;  4MPF A;  2VCT A;  1I9D A;  3LSZ A;  5E4W A;  4JBB A;  1GWC A;  1U3I A;  11GS A;  2L5L A;  3WGD A;  4HJ2 A;  1N8J A;  2YV9 A;  3Q18 A;  1X9W B;  3QAG A;  1B9Y C;  1I5G A;  4TXV A;  2OT3 A;  4Q5N A;  4GQF A;  2YWI A;  3F4R A;  3ME7 A;  4FYB A;  1A2L A;  3H4K A;  4HU9 A;  4EVM A;  4YQM A;  4LMW A;  2UZ8 A;  5A4V A;  2GQK A;  5ELA A;  2LKU A;  3Q6O A;  3UVT A;  4G10 A;  3VWX A;  1Y1U A;  3IC4 A;  2PMT A;  5JWQ B;  4N3Z A;  4XRD A;  5A1N B;  2FCH A;  1EZK A;  2GDR A;  3A5W A;  2YOI A;  3LWA A;  4ZBA A;  3J7Y k;  5J47 A;  5BRT A;  3HVX A;  3VUR A;  1XCC A;  3UL3 A;  3RHC A;  2IWT A;  4L0U A;  2RII A;  3DXB A;  2LNS A;  3CTF A;  3IPZ A;  3CRU A;  2V32 A;  3G7Y A;  5J40 A;  14GS A;  1WWJ A;  2V41 A;  5EPF A;  3Q74 A;  4Q5F A;  1XW5 A;  1ON4 A;  1S3D A;  1FVK A;  3M3M A;  3GNJ A;  3ZYW A;  22GS A;  2P5Q A;  3SWL A;  5A4U A;  5CRW A;  4FIW A;  5KOW A;  3L9S A;  2C3T A;  2ON7 A;  2LEG A;  3GH9 A;  3A2V A;  2G2Q A;  3H8Q A;  1T3B A;  4BVX A;  3EMX A;  5D9W A;  4QMK A;  1O8W A;  4EDZ A;  4TKY A;  3CMI A;  4X43 A;  4ZL9 A;  2H70 A;  1SJZ A;  1UVZ A;  5IO2 A;  2IL3 A;  3F3R A;  3IHQ A;  4YKG A;  5FWG A;  4K8M A;  4YQU A;  5B6M A;  5J4V A;  3DVX A;  3EU4 A;  1V9W A;  2DML A;  2JSY A;  1PX6 A;  4MF5 A;  2A2R A;  3L9U A;  2LV3 A;  5FT3 A;  1OVN A;  5IMF A;  5DAL B;  3UVH A;  5IMD A;  2RUF A;  2YWM A;  2GZY A;  2H6Z A;  2H75 A;  2H0G A;  4NHW A;  3MWH A;  3QMX A;  1SVL A;  4PUR A;  4J2F A;  1EV4 A;  4E8E A;  3P2A A;  4WET A;  1KEB A;  2MBS A;  3GA4 A;  2DMM A;  1QMV A;  1OC9 B;  4XS4 A;  1SK1 A;  3KIJ A;  3IHG A;  2XHF A;  4W66 A;  2C4J A;  3WT2 A;  2YZU A;  2CV4 A;  2YJ7 A;  3GTU A;  2WRT A;  2QA2 A;  4LLR A;  1USB A;  5IMZ A;  4KUN A;  2DKI A;  3FKF A;  1ZZY A;  4TRX A;  3EUR A;  2V6K A;  2E0Q A;  1YKA A;  4ECC A;  3C8E A;  3GN3 A;  4ZB9 A;  4F0C A;  1BYE A;  1XOA A;  3FHK A;  1UA5 A;  2V6O A;  2BJX A;  1KTE A;  1XWG A;  2RLI A;  2HE3 A;  4POB A;  3TRX A;  2KUC A;  2HZE A;  1SU9 A;  3FK8 A;  3GMF A;  1GUK A;  1AAZ A;  2EC4 A;  3C1S A;  2CVB A;  3HXS A;  1ERT A;  1FB6 A;  4USS A;  1M2B A;  3LXT A;  2VCV A;  2P0G A;  4GWR A;  2H74 A;  1XIY A;  3GKK A;  1K0O A;  4PQ1 A;  3I43 A;  1SKS B;  4ML1 A;  3KM6 A;  2WGR A;  1AQX A;  1GUM A;  1ILO A;  1GSE A;  4OWY A;  1SL0 B;  1V40 A;  1ZOF A;  2PU9 C;  1TXX A;  4DSS A;  4CDO A;  2YJH A;  2IFQ B;  4NXI A;  1K0A A;  4I2T A;  4EL1 A;  2XPE A;  5BMU A;  2KP1 A;  2HSN A;  1NHY A;  4WF5 A;  1EEJ A;  1DSB A;  1XBS A;  2D2Z A;  1AW9 A;  2AUV A;  2FHE A;  1X5E A;  2JZS A;  5A5K A;  3QFB C;  5J4Y A;  2ALB A;  2H1A A;  2L5O A;  5ID2 B;  3KH9 A;  1W89 A;  5DAK A;  1G7O A;  2H76 A;  2YV7 A;  4GTU A;  3H93 A;  4WBR D;  4LL1 B;  1A23 A;  4HUA A;  3QCP A;  3GKX A;  1SJI A;  1X5D A;  2YNX A;  1ML6 A;  4MP4 A;  3ZIV A;  2NPB A;  5B8A A;  4MH3 A;  5F8B A;  3L9V A;  3KP8 A;  5D9V A;  5CRG A;  1GTA A;  5A5H A;  1SD9 A;  3EVI A;  3QAW A;  3W8S A;  5H5R A;  1TJD A;  3F4T A;  3NIV A;  5D96 A;  4MJB A;  1M7T A;  4K5R A;  4V2N A;  5ENU A;  2HSM B;  2EFD A;  3C7M A;  3SBC A;  5DJM A;  4KDX A;  2CQ9 A;  3M9K A;  1M2D A;  2F9S A;  3FZ5 A;  5DBQ A;  3ZL5 A;  3F6F A;  1GSD A;  1N2A A;  4KCE A;  4KA0 A;  4MJE A;  2M72 A;  3TRP A;  1TXU A;  3QD9 A;  4NMU A;  1XWK A;  2K8S A;  2FUG 2;  4EKZ A;  1BAY A;  1SYR A;  3TJF A;  4I8B A;  4POL A;  1GTB A;  2VL3 A;  1B4Q A;  1Z6M A;  2V1M A;  3C73 A;  4XS1 A;  5FHI A;  1OKT A;  1G7E A;  4F2I A;  1HYU A;  4N0Z A;  1QQ2 A;  6GSY A;  2N5A A;  1NM3 A;  4EC0 A;  3LEF A;  5ECI B;  4G2E A;  1B4P A;  4YAP A;  1GNW A;  3IOS A;  5IMC A;  4I2U A;  3M8N A;  5LD0 A;  3BOA A;  2IMK A;  1WPI A;  4KAE A;  2GS3 A;  2L59 A;  3GV1 A;  2DIZ A;  5ECH B;  2AAW A;  1M0U A;  4V2L A;  1WMJ A;  2DLX A;  5CRE A;  2QGV A;  1YF1 A;  1MDK A;  4GQC A;  1HNC A;  1A8L A;  2HRF A;  1CQH A;  2DJ2 A;  5A34 A;  2VUP A;  4ZB6 A;  2A4H A;  4GF0 A;  3ZMK A;  4TR0 A;  3IK9 A;  8GSS A;  1M9A A;  4PNG A;  3GL5 A;  4IS0 A;  3DYR A;  2X8H A;  3VWU A;  3TKR A;  1GTU A;  3M1G A;  1MD4 A;  3I69 A;  5DDL A;  3H1N A;  1ZMA A;  4XS6 A;  5JCG A;  3UEM A;  4ZIJ A;  1AQW A;  1NSW A;  4KDY A;  4MZC A;  1V57 A;  1PD2 1;  3QFA C;  5KN1 A;  2R6K A;  3DWV A;  2GVP A;  2EFH A;  1PRX A;  4Q5Q A;  4JED A;  2K8V A;  3D4M A;  1K0M A;  3HJP A;  5AN1 A;  5EVO A;  3QDN A;  5CYY A;  2C80 A;  4WXT A;  1X5C A;  3APS A;  2RM5 A;  2H8L A;  1GSQ A;  3ZML A;  3CYN A;  3GKN A;  3KH7 A;  2VLT A;  2GLR A;  18GS A;  5IM9 A;  4IW9 A;  4Z2U A;  3U5R E;  1R26 A;  5ECP B;  5ECR B;  1K0D A;  5A4W A;  2JZT A;  2YWO A;  4BWS A;  3TDG A;  1SK2 A;  4J57 E;  2OJL A;  3KGK A;  1GUL A;  2HRK B;  1FHE A;  2H01 A;  5ABR A;  2EFE A;  2IMF A;  3KMO A;  2IN3 A;  3FR3 A;  3NOF A;  4X0X A;  2AHE A;  5CP1 A;  3UMA A;  4JZQ A;  2PBJ A;  4H86 A;  4TOP A;  3D21 A;  3DRN A;  5G30 A;  5ECS A;  1A0F A;  3ME8 A;  1X9M B;  4GSN A;  1ACV A;  4DSQ A;  1WIK A;  1IYI A;  2GQM A;  1MDJ A;  2DJ0 A;  1TKD B;  4OFT A;  3K8N A;  4WKW A;  2EFC A;  4YQV A;  4BVY B;  2IPA A;  3BCK A;  2X64 A;  3A5I A;  2X8C A;  1SL1 B;  1SKR B;  2M80 A;  4AF2 A;  2HQT A;  1K3O A;  1THO A;  3UBL A;  5ECO B;  2B6M A;  4WR5 A;  4V1A p;  4K6X A;  3BCI A;  2OE0 A;  2LNT A;  1O7U A;  5LCZ A;  2WB9 A;  1T8E B;  5GAN D;  5DQY A;  5IQY A;  3QOU A;  4A5P A;  4PXO A;  1TK5 B;  1BX9 A;  4HI7 A;  6GSW A;  1A8Y A;  2PPT A;  1HNA A;  1EGR A;  4AKI A;  4MDC A;  1TI1 A;  4TVE A;  2PWJ A;  2VL2 C;  2CT6 A;  2R0G A;  2ZUP A;  4K0N A;  2A2P A;  3IK7 A;  2VLU A;  2WFC A;  4IQ1 A;  2WZ9 A;  4ZL7 A;  5JCU A;  1YF0 A;  2TRX A;  1JLV A;  1M2A A;  1TRW A;  3VLN A;  3EIN A;  3E0U A;  1ST9 A;  4EUY A;  5GST A;  5JWR B;  2HNL A;  3CSH A;  1F6M C;  4AGS A;  3WGE A;  2KLX A;  3BD2 A;  1VF1 A;  5HFI A;  2VCX A;  9GSS A;  4KSO A;  6GSS A;  1T1V A;  2X4A A;  1PN9 A;  2IIY A;  4JRR A;  3V1W A;  2VD1 A;  20GS A;  1G6W A;  3C1R A;  4KGI A;  4XIH A;  3DIE A;  3ERW A;  1SVO A;  3GIX A;  3GKM A;  1XXU A;  1MD3 A;  4PTS A;  2CAI A;  5GZZ B;  1GSF A;  1A2J A;  3HZ8 A;  4MNN A;  5H5S A;  2H1L A;  2H0I A;  2B5X A;  4X1U A;  4QL9 A;  4N0V A;  5IOX A;  2F8A A;  5H5Q A;  1GLP A;  5JWO B;  2PN8 A;  4MJA A;  4MMM A;  3BBY A;  2K6V A;  5F0G A;  1EV9 A;  3D22 A;  5IMV A;  5IMA A;  4G0I A;  4WEY A;  3FW2 A;  2VCQ A;  3F4S A;  4GRF A;  2F3M A;  7GSS A;  4K7N A;  2N5B A;  2AJQ B;  2OE1 A;  3RAZ A;  3GX0 A;  3TB2 A;  1SKW B;  3D0Z A;  3NZN A;  1GH2 A;  2I1U A;  1OE8 A;  4PX1 A;  4KB3 A;  4F03 A;  4L0W A;  5INY A;  4NV5 A;  4O92 A;  1R5P A;  2H71 A;  2VKZ G;  4DVC A;  2QC7 A;  3GHA A;  3F63 A;  2LRC A;  5D9X A;  5KEJ A;  3GFK A;  13GS A;  4IVF A;  3G9B A;  3ZIJ A;  2VM2 A;  4G19 A;  4E68 A;  2GZP A;  4PUF C;  3VI7 A;  2JAC A;  1T7P B;  3ZFL A;  3MIX A;  2JZR A;  3UAP A;  4ZXG A;  3FYG A;  1ZCP A;  4GCI A;  2DSA A;  4BPY A;  4GLT A;  1Z6N A;  1F3A A;  1WJK A;  4BA7 A;  4F9Z A;  1FW1 A;  2B7J A;  5GSS A;  2X49 A;  1F37 A;  1BF5 A;  1OKD A;  4IHU A;  4BVX B;  3UJ1 A;  2PER A;  3N5O A;  2PUK C;  4IN0 A;  1SL2 B;  4FO5 A;  4L8E A;  4RQR A;  4RQX A;  3KJY A;  1XWB A;  2H1G A;  3S9F A;  3G7J A;  1Z5Y E;  3J7Y b;  1DE1 A;  3TKS E;  1E6B A;  4O5U A;  1PL1 A;  4BL7 A;  1BQ7 A;  4HQZ A;  3WYW A;  1AQV A;  5HR3 A;  1RQM A;  2IFQ A;  3G7I A;  3O6T A;  3IR4 A;  2KHP A;  3IE3 A;  4DEJ A;  1XW6 A;  3LOR A;  2CZ2 A;  1K0C A;  4IBP A;  4NHZ A;  3JCM L;  4AI6 A;  3R3E A;  3W8J A;  1CQG A;  5DCG A;  5ID2 A;  3HA9 A;  2H6Y A;  2C0F A;  4ZIL A;  1QK8 A;  3TKQ A;  1ZYP A;  5J9B A;  1GRX A;  1H75 A;  4IKH A;  3HKR A;  4Q5R A;  4TR4 A;  1PGT A;  1KNG A;  1LBK A;  1GSY A;  3IDV A;  4HJM A;  2K18 A;  4HDE A;  4JE1 A;  2REM A;  1Y25 A;  2P31 A;  2VLV A;  1B48 A;  2GSS A;  5AIV A;  3VK9 A;  2VIM A;  17GS A;  3TCO A;  5G31 A;  4PNF A;  3PIN A;  1ERV A;  4EXJ A;  3O76 A;  2HT9 A;  2J9H A;  2LUS A;  1YZX A;  2HXK A;  4MH2 A;  1XFL A;  2LQQ A;  2HZE B;  2HSM A;  5ECN B;  1AIU A;  2O87 A;  1GP1 A;  2HYX A;  4AJ8 A;  4ZL8 A;  4XCS A;  3HJM A;  1XWC A;  1Q98 A;  3EWL A;  5B6N A;  2CX4 A;  4D73 B;  4N30 A;  2QA1 A;  3BJ5 A;  4ZBB A;  1K3Y A;  2VL2 A;  1YJ6 A;  2GGT A;  1TK8 B;  2LTK A;  3VI5 A;  4K7I A;  4NWY A;  3IRA A;  1M99 A;  2NDO A;  3FRC A;  2B1L A;  2Z9S A;  1PKW A;  2C8U A;  3LW9 A;  4OCE A;  4O5R A;  3TKS A;  3F9U A;  4V2M A;  2L6D A;  3ZVJ D;  2GTU A;  2NTO A;  1JHB A;  1EP7 A;  3PPU A;  2YZH A;  2FD3 A;  4QL7 A;  2FY6 A;  1YDK A;  3TGZ A;  3GRX A;  2L4Q A;  1PA3 A;  1A2M A;  5J9C A;  2F8F A;  4HEA 2;  5KN0 A;  1F2E A;  4XTS A;  5ECQ B;  5D9T A;  2MMO A;  4OCF A;  4EE0 A;  2ES7 A;  2FGX A;  5ECK B;  4ZB7 A;  1QFN A;  3MYD A;  1AXD A;  1MEK A;  1O8X A;  2LJK A;  2O7K A;  2R0P A;  1EP8 A;  5GAP D;  6GSX A;  2CX3 A;  2WJU A;  3AY8 A;  1OYJ A;  3IAM 2;  4G01 A;  2DJ1 A;  1GTI A;  4ML6 A;  3PR8 A;  3EU3 A;  5A5H B;  2DJJ A;  3W6G A;  1X9S B;  2MYG A;  3E9J B;  3EYT A;  3GUS A;  4KDU A;  3VWW A;  2FLS A;  2WDU A;  4ISD A;  3VPT A;  4KSM A;  2WUL A;  2ON5 A;  5D73 A;  4KND A;  2IMD A;  1QXH A;  2MMA A;  4OO4 A;  2ZCT A;  1PKZ A;  4N10 A;  1R7H A;  3IC8 A;  1WE0 A;  3IAS 2;  1TU7 A;  3L0H A;  1XW9 A;  1F3B A;  5E59 A;  4GDF A;  4ICY A;  3RPP A;  1JZW A;  3TKP A;  2XBI A;  5EY6 A;  2LRT A;  4TR1 B;  1J08 A;  5JCW A;  3MAK A;  5DQS A;  4K2X A;  2H19 A;  4ZBD A;  1HQO A;  4F0B A;  1RK4 A;  5B7C A;  1SVM A;  2GT5 A;  3FR6 A;  5J4U A;  3UOM A;  2HRK A;  2HRA A;  4AKH A;  2B1K A;  4MCU A;  5HQP A;  2LJR A;  4JR4 A;  2F51 A;  3ZVJ A;  3LGC A;  3KEB A;  4WR4 A;  2QSI A;  3H79 A;  1FO5 A;  3D5J A;  5ELG A;  5DJL A;  3LG6 A;  1MDI A;  3U6V A;  1T00 A;  4OMV A;  3ERG A;  3FMW A;  4MJC A;  2B7K A;  3FEU A;  3RDW A;  16GS A;  2O8V B;  2IMI A;  1XVW A;  4YH2 A;  1SJ6 A;  4KX4 A;  2FA8 A;  5HR2 A;  3GX8 A;  1S3A A;  4AJ6 A;  3F6D A;  1IYH A;  2C0G A;  2H1B A;  1O81 A;  1E2Y A;  2PGT A;  2OBK A;  4EIP A;  3GL3 A;  1HNB A;  4CY6 A;  3KP9 A;  2OKA A;  4TXO B;  3CBU A;  4ECI A;  1U87 A;  1FOH A;  3CTG A;  3P8W A;  5HFK A;  4KH7 A;  4K5S A;  4CHS A;  1S3C A;  5COH A;  2M46 A;  1M9B A;  2I9H A;  1Q4J A;  3HY2 A;  5ECL B;  2C0E A;  5A1N A;  1JZR A;  4L5O A;  2LJA A;  2YN1 A;  4L5L A;  3ZRE A;  4CY8 A;  4PQI A;  2CA8 A;  5G5F A;  1PX7 A;  5KN2 A;  4Z2R A;  3APO A;  2MBT A;  1GUH A;  2GSR A;  3L4N A;  5LNK e;  3KMN A;  2O5V A;  2EIO A;  2L4C A;  3GYK A;  4K0G A;  4X4J A;  1K0B A;  4KE3 A;  4ECB A;  1FOV A;  1MTC A;  2B3S A;  3RBT A;  1YEP A;  2YP6 A;  2AYT A;  4FQU A;  3TKS C;  2A4V A;  2AB6 A;  3CWG A;  2B5E A;  2DJK A;  2TIR A;  3TUE A;  2H66 A;  4J56 E;  1FVJ A;  5IO0 A;  3DKS A;  4OFN A;  4I97 A;  5F07 A;  3CSI A;  4LL4 B;  4Z2T A;  1WP0 A;  2FWH A;  2R0C A;  2C3N A;  2HSH A;  1AUC A;  4YKF A;  3MNG A;  3LQ7 A;  5ECM B;  2LST A;  12GS A;  2YCD A;  2O89 A;  3KZQ A;  4WBJ A;  2GZZ A;  1OC8 A;  1AC1 A;  5CAX A;  1O6J A;  4EF0 A;  2H30 A;  5D8I A;  1Z9H A;  2JL4 A;  1TK0 B;  2KP2 A;  3L78 A;  3DVW A;  4MZW A;  1GL8 A;  5DAL A;  3I9V 2;  1VF3 A;  1EGO A;  3CXG A;  4HS1 A;  2VL9 A;  1F9M A;  6GSV A;  3ZIT A;  3GSS A;  1GLQ A;  1SYX A;  5KN3 A;  3C71 A;  1ERU A;  4O5Q A;  2C1Y A;  1DE2 A;  2R37 A;  6GST A;  3IXR A;  4RI7 A;  2I81 A;  4PQH A;  1G0T A;  1OC9 A;  2IJY A;  1BED A;  2OA7 A;  1VF2 A;  2B5Y A;  3HHV A;  4IEL A;  4K7O A;  2IME A;  4TW5 A;  5CNW A;  5G1L A;  2LQO A;  1PQN A;  1SK0 A;  3IA1 A;  2XBQ A;  1UN2 A;  2HRN A;  1N25 A;  3EPT A;  4NPB A;  1JFU A;  5IPH A;  3HVS A;  1FAA A;  5J41 A;  4G0K A;  2GSQ A;  3R2Q A;  2FWG A;  2K9F A;  2ZNM A;  2I3Y A;  3TJB A;  2BTO T;  5CO3 A;  2VOC A;  1A24 A;  4GST A;  2OAC A;  4IJ3 A;  1WRY A;  4ULX A;  1V98 A;  3QR6 A;  3M0F A;  1TRV A;  3UIW A;  2RM6 A;  4I6X A;  1XZO A;  1PSQ A;  3FZ9 A;  5G5E A;  3ZTL A;  3FZ4 A;  2L57 A;  4GXZ A;  2X99 A;  1J0F A;  4OFM A;  2A2S A;  1T4Z A;  3UAR A;  3EC3 A;  5CRD A;  3GST A;  4O32 A;  2VM1 A;  4ECJ A;  2KOK A;  4FYU A;  1ZYQ B;  1Z3E A;  2HI7 A;  3LYP A;  4NAX A;  3US3 A;  4IGJ A;  4ACS A;  1Z7P A;  5HR1 A;  3MDK A;  4F82 A;  2C0D A;  5CRH A;  1YEX A;  2JAD A;  5D93 A;  4MA9 A;  1TP9 A;  3A2W A;  3HDC A;  2LRN A;  2CVD A;  1PN0 A;  1QGV A;  4MPG A;  2DIY A;  1Y6E A;  3TRQ A;  1H4O A;  4OO5 A;  4ID0 A;  3Q19 A;  4XS4 B;  4N11 A;  5IPG A;  3I6A A;  1TI3 A;  5EL8 A;  1O73 A;  3RPN A;  3WT1 A;  4D73 A;  3MSZ A;  3PH9 A;  2OBI A;  2WCI A;  5HFG A;  3FY7 A;  3GTU B;  3QPM A;  1TTZ A;  4CW9 A;  1B8X A;  3IBH A;  5J5N A;  1KBN A;  1W4V A;  3DEX A;  3KCM A;  1ZYN A;  4KW6 A;  1PL2 A;  1TU8 A;  2WS2 A;  4MZB A;  3TOU A;  1EOH A;  4AKG A;  19GS A;  2XPD A;  1SD8 A;  5DVB A;  1O85 A;  4IJI A;  3D4T A;  1LU4 A;  2DKH A;  5AIS A;  1V2A A;  6GSU A;  2PVO C;  3LXZ A;  3PGT A;  1OAZ A;  1VRS D;  1TW9 A;  1ZL9 A;  1NW2 A;  3CSJ A;  1TDI A;  3KXO A;  2GST A;  1OE7 A;  4BL7 B;  1QUW A;  2MMN A;  4KF9 A;  4AKX B;  4LMV A;  4K2D A;  2R3X A;  1U3A A;  2V2G A;  5L71 A;  4TR3 A;  2OAD A;  2YPM A;  3A2X A;  4MLY A;  2OE3 A;  1EWX A;  3LYK A;  1DBY A;  3HYP A;  3TU3 B;  2EIQ A;  2BMX A;  4XRA A;  2H73 A;  3P7X A;  4IQA A;  4IP1 A;  3A3T A;  2C3Q A;  2HZF A;  1ERW A;  4DSR A;  10GS A;  4DSS B;  1JLW A;  4ZB8 A;  4MAB A;  1EEM A;  3OR5 A;  1R5A A;  1K0N A;  5BMU B;  1WOU A;  2HSN B;  1TRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...