5F0GA

Structure of the glutathione transferase delta 2 from drosophila melanogaster
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
212
structure length
207
Chain Sequence
MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGLMAMKALFDARKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase D2
publication title Characterization of a Drosophila glutathione transferase involved in isothiocyanate detoxification.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 80
structure length 207
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f0gA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f0gA01
2VCQA 4ISDA 1X5CA 5HFGA 4ML1A 4F9ZA 2LJAA 3TJGA 3A2VA 4HZ2A 2H72A 2O7KA 2DSAA 3KM6A 4CW9A 3DMLA 4J57E 1Z3EA 3FKFA 2XBIA 1SKSB 2WJUA 2XPEA 3WGXA 3A2XA 1V57A 2L59A 3UOMA 9GSSA 3FW2A 1UN2A 3GX8A 1XPVA 2H70A 2EIOA 4MF6A 3HA9A 5D93A 3KXOA 1TRVA 3CTFA 2HRKB 1U6TA 3VWVA 3EC3A 1G6YA 2R2JA 5IQYA 2DMMA 5IOXA 3C7MA 4KDUA 3WYWA 5HR3A 5J5NA 3CTGA 3PR8A 1A0FA 2A2RA 3LGCA 5B8AA 3G7YA 1MEKA 4AJ7A 2H75A 1TTZA 1SKWB 3DXBA 2FGXA 3ZITA 1Z6MA 2HSMA 2M72A 5ECNB 2CX3A 2KHPA 4I2UA 1TU8A 2XBQA 1DE1A 6GSUA 4BVXB 4JE1A 2FUG2 2MMNA 1F9MA 2A4VA 2H73A 1PX7A 5INYA 3ZIJA 2OBKA 4K7OA 1GNWA 2VO4A 2OADA 3ERWA 3C73A 5CREA 2NDOA 1SK0A 2I1UA 2ALBA 1Z7RA 1XFLA 4I97A 3QAWA 2K18A 5D9TA 3KIJA 1K0OA 5DBQA 3TKSE 2FY6A 5IMAA 3TCOA 5H5QA 4HU7A 1OKDA 1Y25A 4OCEA 1QXHA 4JRRA 4OFMA 3KMNA 5G1LA 5DQYA 3I6AA 2H6YA 2OE1A 2PVQA 2MMZA 1RQMA 3H4KA 1GSUA 1O8WA 2LRNA 2IN3A 2H71A 2GSQA 4GWRA 4K0NA 4AGSA 2DJJA 3FRCA 4GSSA 4TKYA 5KN0A 2L4QA 5IO2A 3KP9A 4HEA2 1EV9A 4LMWA 4YAVA 1GL8A 1W4VA 4WBRD 3ZRDA 3ZMLA 2O85A 3E3EA 2YPMA 1EOGA 1PX6A 4I5QA 1SL2B 4EO3A 1VF1A 5E4WA 1G6WA 6GSTA 2H1BA 1F3AA 1AAZA 4F82A 3R3EA 19GSA 2K6VA 4TR1B 1XWCA 4MZBA 1M2BA 1TP9A 3O3TA 2NPBA 5IOWA 4RUVA 3CSHA 4D73B 3W8JA 8GSSA 4USSA 2PBJA 2P31A 1XZOA 2H66A 1OC9A 2H01A 4G9HA 1SL0B 1WOUA 5HFKA 4PQ1A 2HQTA 3DRNA 2QKEA 4KSOA 3IOSA 2YNXA 5GAND 1ACVA 4JEDA 1QFNA 3K8NA 3HYPA 4MJCA 4PGTA 2G2QA 3GUSA 3MDKA 4HZ4A 3QDNA 5KN1A 1AQVA 2X99A 2F8AA 3Q74A 4G0KA 4IQAA 5J9BA 2IMIA 3UVTA 4NMUA 1ZYQB 1XOBA 3GH9A 1YEPA 5LCZA 2GZYA 2HZEB 2GLRA 4IN0A 2X64A 3PGTA 3IRAA 3HJPA 2WCIA 11GSA 2RUEA 2IWTA 3P2AA 4EF0A 1PGTA 4K9ZA 2F8FA 4I8BA 1GRXA 2RM5A 3KCMA 3DGQA 1Z7PA 2FD3A 4EVMA 2GTUA 2JL4A 1UVZA 2XPDA 5ELGA 2HFDA 3I9V2 4HJ2A 5IM9A 3GTUA 2C3NA 3M1GA 3ED3A 2H30A 3QCPA 5CNWA 2EIRA 3I43A 4KAEA 2CV4A 3EE2A 2VCXA 2LKUA 2KP2A 2VCWA 2C3QA 2C0GA 4LA1A 5AN1A 1UA5A 4NV5A 4O7HA 1O6JA 3ZIVA 3IE3A 2YZHA 2CAQA 4HQSA 4ZBDA 1EGOA 4MP4A 3GH6A 4F2IA 4OD7A 3L9VA 1XWGA 3TOTA 5JWOB 1GSSA 4MA9A 2HRKA 2UZ8A 2O8VB 1I9DA 1B4PA 1EGRA 4LL1B 1MD4A 2GQKA 1BEDA 4PURA 2LRCA 3U5RE 4POBA 5AISA 4J2FA 1EP7A 2FWFA 2LUSA 1R26A 4TXOB 3VWWA 1SL1B 3G7JA 4BL7B 5J3RA 2C0FA 1FHEA 1EV4A 2L4CA 2ZCTA 5JCUA 3GURA 4NV2A 4JR6A 2VLUA 3TKSC 3TKQA 3UJ1A 1NW2A 3GYKA 4GQFA 2LQQA 4HU9A 1V98A 3FYGA 2C1YA 2J9HA 4QL9A 4K1FA 5J41A 2AUVA 2C0EA 4EUYA 2DJ1A 3IHQA 1GULA 4G10A 3D5JA 1GTAA 4DVCA 2RIIA 3EURA 5AIVA 1ZL9A 6GSYA 3BJ5A 1T3BA 4K7NA 3ZTLA 1HD2A 3IR4A 3HHVA 3C1RA 4ZL9A 4O92A 2LQOA 5EVOA 2B1KA 4ML6A 1A2JA 2IIYA 1SJIA 5FHIA 3F4TA 5F8BA 2P5QA 4AF2A 2VD0A 4V1Ag 4ECCA 1M2DA 1QK8A 5D96A 3TJFA 2DJKA 3FZAA 1YF0A 5ECLB 4KGIA 4OMVA 2YCDA 1ERUA 2DC5A 1F37A 4RQXA 4FH8A 4ZB9A 2PPTA 3M9JA 12GSA 2FWGA 3PH9A 3GSSA 2V6OA 3WD6A 5CRGA 4KCAA 3Q18A 1GSDA 3GV1A 1AIUA 1OE8A 3NOFA 3OR5A 3LG6A 4TR1A 1M9BA 5C04A 4XRAA 3UBKA 1URMA 2HNLA 1ZMAA 2KOKA 4G0LA 1RW1A 3W8SA 3CYNA 2JZSA 4YQVA 4D73A 2B1LA 1MDKA 3BCIA 2I81A 2B7KA 2QSIA 3FZ4A 2OA7A 2K8VA 2AB6A 2PMTA 3R2QA 2GSSA 4KB3A 1FOVA 4L5OA 4EDYA 1Z5YE 2HRFA 2N5FA 2AV4A 5ECSA 2C0DA 5DVBA 1SK2A 4OO5A 3EU4A 4POKA 4K8MA 3LSZA 4PNGA 1JZRA 5D9XA 1JZOA 5DJLA 3F8UA 4OWYA 3H8QA 2E2MA 2EIQA 4EDZA 1H75A 4F0BA 5FT3A 4WR4A 5J9CA 1MTCA 2OACA 2YANA 1X5EA 2H1DA 4JBBA 5DAKB 2HT9A 3PINA 2BJXA 2PU9C 1GLQA 1Y6EA 3RDWA 2RLIA 4QL7A 4P3YB 4FYBA 3QAGA 2HI7A 2C4JA 2H8LA 1X5DA 1V9WA 2VLVA 1B8XA 3M9KA 3GX0A 1VF4A 3RBTA 5ELAA 5IPHA 5EL8A 4HDEA 3KH9A 1JFUA 3RPNA 5ENUA 3D0ZA 3MWHA 4JZQA 3A3TA 3GKNA 4V1Ap 1SENA 5AGYA 1A23A 4IJIA 1HYUA 3FZ9A 4N11A 4WXTA 3CXGA 4MPFA 3IAS2 3EU3A 3GKXA 3ME7A 2DBCA 1NHYA 4IKHA 3FEUA 2FNOA 4PXOA 3EWLA 1QMVA 3MNGA 4RI7A 3ZMKA 3SBCA 2ZUPA 3S9FA 2XHFA 4F0CA 4X43A 3TOUA 3TJJA 2CZ3A 1GLPA 2V6KA 3LQ7A 3CSIA 2YJ7A 2OJLA 3L78A 4LMVA 1V40A 1JZDA 2FWHA 5ID2B 4OFTA 1K0AA 4Q5FA 1XOAA 4TXOA 1MDJA 3L0HA 4BL7A 1G7EA 2LJKA 1N2AA 1XW5A 4DSSB 1AQXA 1VRSD 4GCIA 4G19A 2MZCA 4OCFA 3O6TA 2WB9A 3DVWA 3DYRA 4ID0A 4FO5A 4WKWA 4HQZA 4NXIA 3D4TA 1IYIA 1AUCA 4BA7A 4ZBBA 5ECQB 2PN8A 2E7PA 1K0NA 2QC7A 3RHBA 1O85A 5A5KA 3G9BA 3DWVA 4POLA 1EEMA 4IP6A 4WBJA 1JLWA 1BJXA 4KSMA 4XS1A 1TW9A 4EKZA 4WETA 3WT1A 2GS3A 3F3QA 3F4RA 2YN1A 2X8GA 4ACSA 2M80A 2R37A 4X1UA 3EVIA 4PX1A 3VURA 5D73A 5ECRB 1MD3A 4IELA 2CA8A 1XBSA 3H1NA 1DSBA 3TJBA 4GSNA 4MPGA 2E0QA 1SK1A 3GNJA 2PGTA 4GLTA 1XW9A 2X8HA 1ZCPA 1QQ2A 3TDGA 4MZWA 1CQGA 5F07A 1PSQA 4MLYA 5IMVA 3AY8A 5ECPB 4IJ3A 2IJYA 1R5PA 4TXVA 1Q4JA 3GMFA 3ISOA 2IFQA 2LTKA 4KUNA 4KDYA 4PQIA 2HZFA 1PKWA 4N0ZA 4MZCA 3O76A 2HSYA 3VI5A 1GSEA 2B7JA 1ON4A 3LEFA 1T7PB 2DMLA 2A2SA 5CAXA 2FCHA 2N5BA 1YEXA 4DSQA 4G0IA 4TW5A 1XCCA 3HD5A 2EC4A 3FR3A 2JZRA 4EXJA 5IMZA 1C72A 5F0GA 2P5RA 1FB0A 4ECIA 2IMKA 1WE0A 2JZTA 2L6CA 3ZFBA 2R6KA 1TK5B 1Z9HA 3QPMA 4XTSA 3CSJA 5COHA 3LXTA 4O32A 3APOA 2J23A 2G0FA 3ERGA 2OE3A 1TU7A 1E6BA 2MMOA 5DAKA 2OKAA 3D22A 2L5OA 4XS4B 1WJKA 3ZL5A 3L4NA 4MH3A 3G7IA 4PNFA 2GSTA 2N5AA 5AIXA 4OO4A 1S3DA 3D21A 4MF5A 1AW9A 3WT2A 1WPIA 4GXZA 4EL1A 5ECKB 5GZZB 2B5EA 1YJ6A 1SYXA 4K6XA 5JWQB 3GFKA 3TRPA 7GSSA 4N10A 1B9YC 3F9UA 4XHMA 3GN3A 2GQMA 4ZBAA 4DSRA 4GTUA 4KDXA 1I5GA 1SKRB 5DJMA 5HR0A 1MDIA 3VLNA 5CRWA 1X9MB 1T1VA 4RQRA 1OAZA 1OE7A 3UBLA 2VAFA 4MH2A 1J0FA 2LNTA 1AC1A 5B8BA 4G2EA 4GSTA 2H0IA 1OC3A 4IW9A 2L57A 1PL2A 5IMDA 2DIYA 2GSRA 3D6IA 2VCTA 4PQHA 4FIWA 5ID2A 4BVXA 2Z9SA 2F3MA 2YZUA 2HLSA 3EINA 6GSXA 1PRXA 3DKSA 5KEJA 3EMXA 3F6FA 2V41A 3ZVJA 3A2WA 4DSSA 1SD8A 3VPTA 3LORA 4FYCA 1GUMA 1AXDA 2WDUA 1VF3A 4QQ7A 3BD2A 4TR4A 3LWAA 4HS1A 3TRQA 5IMCA 3FR9A 4ZB8A 5LNKe 2MYGA 4HI7A 4K7IA 3JCML 1FO5A 4WEYA 1XWAA 2C8UA 4DEJA 3QFBC 1K0MA 1HNBA 1TRWA 1M7TA 2H76A 1O7UA 4ZXGA 4CHSA 2H1AA 2YWOA 3GKKA 4J56E 1U87A 1ERTA 1O81A 2VL9A 5DCHA 1GUHA 3F3RA 3BBYA 1YKCA 2AHEA 1WP0A 4Q5QA 1IYHA 2WRTA 1V2AA 2ON5A 4YQMA 5IMFA 3TKRA 4LLRA 3V1WA 2CVBA 3KTBA 3UAPA 3BOAA 5A4UA 4XS6A 2DIZA 2LSTA 3GRXA 3VFIA 1XW6A 2TIRA 3HZ8A 3APQA 1SU9A 3QMXA 1YF1A 2FLSA 1T00A 1GH2A 5E59A 2B5YA 4ECJA 20GSA 3QOUA 2H6XA 3L9UA 1RK4A 3I69A 2CT6A 2JSZA 5JWRB 3FR6A 3QR6A 3GSTA 1OC9B 3VK9A 3KTLA 3VPQA 5A4WA 1TOFA 5DALB 1GWCA 4PTSA 4KE3A 4N0VA 1K0DA 1FB6A 5D8IA 2LS5A 2AAWA 4HOJA 5ECHB 3EMPA 2GDRA 5BMUA 4FYUA 3Q6OA 4PUAA 3M0FA 1YKAA 4XIHA 1SJZA 3J7Yk 4ULXA 2VLTA 1G7OA 3LXZA 4JU5A 1GTBA 4TOPA 2F9SA 4BPYA 2LEGA 2HZEA 3WGDA 1TDIA 1FG4A 4TRXA 1WIKA 1R4WA 5ABRA 2C80A 2B3SA 6GSSA 1OYJA 1THXA 3BCKA 2DJ2A 2CQ9A 3HDCA 3HY2A 4XS4A 4MMMA 1DBYA 5B6MA 5DQSA 1YQ1A 3TGZA 1M0UA 2MBTA 3TUEA 1K3OA 2HYXA 5JCGA 2I9HA 5G1KA 1XVWA 3GTUB 1K0BA 3UARA 5DDLA 2FWEA 1FVJA 5D9WA 3LJRA 1CQHA 1F3BA 1LBKA 3UIWA 5GSTA 2R4VA 4KW6A 1F2EA 2GT5A 2VOCA 1BX9A 2PVOC 3GL3A 2KP1A 3GHAA 5ECIB 3VWXA 3PPUA 2RUFA 1TXXA 4CDOA 2GZZA 5DCGA 2FA4A 4L0WA 2VUPA 4WF5A 4K0GA 2YOIA 3HKRA 1ERWA 2NBSA 1EEJA 1GUKA 1Q98A 1HNAA 3DEXA 2VL2C 5KN3A 3HXSA 1K0CA 4L8EA 1ST9A 2YV9A 2VCZA 1QGVA 3QFAC 1YZXA 2I3YA 3KP8A 3F63A 3N9JA 2LRTA 1ERVA 3F6DA 5J4UA 2PWJA 1VF2A 5H5RA 2H19A 2VL2A 1TI3A 5FWGA 5LD0A 2H0HA 1OKTA 4BVYB 3IK7A 1N8JA 4KNDA 3GL5A 1B48A 1NM3A 5B7CA 2X8CA 4I6XA 1JLVA 1PKZA 3FY7A 3LYPA 1ZGNA 1PD21 4ZL8A 3M3MA 2AJQB 1DE2A 2MBSA 2V2GA 1S3CA 2GQLA 5HQPA 4IS0A 1YDKA 1ZZYA 1XWKA 3IDVA 4ZIJA 2DJ0A 3H93A 4LL4B 5D9VA 2CX4A 1GTIA 1SD9A 3E9JB 1X0RA 1PA3A 3TJKA 1HNCA 1VGLA 1PQNA 5ECOB 2OE0A 2K8SA 4Q5NA 1BQ7A 4XCSA 3ZREA 3L9SA 5IPGA 2IL3A 1QUWA 2CVKA 2B5XA 4POMA 1ZOFA 4ECBA 1K3YA 3GKMA 5L71A 1B4QA 5HR2A 2YJHA 4F03A 4V2MA 4WR5A 2REMA 3IC4A 4IQ1A 2YWIA 2ES7A 4X0XA 4KCEA 4IGJA 2IMDA 2PUKC 1R5AA 1BAYA 3WGEA 3NIVA 1GSFA 1SYRA 5G2ZA 3GA4A 2R3XA 1TRUA 10GSA 2LNSA 4GQCA 3HZ4A 3W6GA 4GF0A 4V2NA 3TB2A 3FHKA 3KH7A 4JR4A 3KJYA 5HR1A 1TKDB 2OBIA 1SJ6A 3P90A 4MDCA 1GSQA 3DD3A 3ME8A 2KUCA 4EE0A 1GP1A 1NHOA 3SWLA 1JZWA 2JACA 2IMEA 4ZL7A 5DALA 5IO0A 16GSA 4Q5RA 2K9FA 3F4SA 1ZYEA 3IBHA 3HJMA 2HE3A 4MK3A 5G5FA 2JU5A 2WZ9A 2CVDA 4BWQA 2YWNA 5CRHA 2YV7A 1EP8A 4EC0A 22GSA 2H1GA 4TR3A 1ML6A 2V1MA 5CP1A 3QD9A 6GSVA 3IXRA 2ZNMA 1PN9A 2BTOT 4AJ8A 1BG5A 4AJ6A 2WGRA 1M2AA 3UEMA 4GRFA 1Z6NA 2GGTA 2GT6A 4MJBA 2MMAA 4BWSA 1XIYA 1THOA 2AYTA 2TRCP 2GZPA 4MCUA 3HJOA 3VWUA 4KF9A 5GSSA 3C1SA 5CO3A 2VM2A 2QGVA 3HVSA 3E0UA 1KBNA 2FA8A 4V2LA 5GAPD 4YQUA 4ZB6A 1ILOA 4IP1A 1S3AA 2H6ZA 3HVVA 5KN2A 1J9BA 1HQOA 4L0UA 1YY7A 4NAXA 2HSHA 2V32A 4MABA 3IA1A 3RHCA 3ZLPA 4KX4A 1O8XA 3FK8A 4XRDA 1USBA 3RAZA 2WULA 3APSA 2LV3A 2BMXA 2YP6A 4H86A 2LJRA 3ZVJD 5C00A 1GSYA 4E8HA 3FZ5A 3H79A 3IV4A 5H5SA 3DVXA 2M46A 3TKPA 3ZYWA 2IMFA 2PERA 3DIEA 5F06A 3Q19A 4MJEA 2IPAA 1W89A 2L6DA 5IIZA 2HSMB 14GSA 2CZ2A 3LFLA 1H4OA 3GIXA 1TRSA 3UL3A 2HXKA 1FAAA 1ABAA 3MSZA 4HUAA 3IK9A 6GSWA 2I4AA 1T4YA 4O5RA 2FHEA 4MJAA 1LU4A 2HRNA 3P7XA 4BVYA 4FQUA 1EOHA 2O87A 4ILFA 5A4VA 4L5LA 3MAKA 1U3AA 1U88A 4YAPA 4OFNA 1A2LA 2F51A 1X9SB 1WMJA 1FVKA 2NTOA 3CMIA 2DJ3A 3UMAA 2H0GA 3D4MA 1TI1A 3CRUA 2KLXA 1XWBA 5G31A 4HJMA 3TKSA 5EY6A 1T4ZA 4YH2A 1A2MA 4PUFC 3ZFLA 5CYYA 2B6MA 3IPZA 1NSWA 4NHZA 2TRXA 5F05A 1X9WB 1OVNA 1TJDA 1DUGA 2WS2A 3LYKA 1A0RP 4TR0A 1TK0B 5G30A 1KNGA 5B6NA 5JCWA 5ECMB 2H74A 1OC8A 3A5WA 4NPBA 3KZQA 5CRDA 2ON7A 1XVQA 3HVXA 1GTUA 1EWXA 18GSA 1JHBA 1A8LA 1WRYA 2VIMA 3NZNA 1K3LA 2XC2A 3CBUA 2GVPA 3KGKA 2CAIA 4IVFA 1J08A 4E8EA 2VCVA 3IC8A 4KA0A 2JADA 1PMTA 4MF7A 1R7HA 4N30A 2VD1A 2C3TA 3KD0A 1M99A 2L5LA 3IAM2 1A24A 1BYEA 2DLXA 2IFQB 13GSA 2RM6A 2D2ZA 3C8EA 1U3IA 4TN8A 1PL1A 2WFCA 4ZILA 1F6MC 4KH7A 3EYTA 5EPFA 3US3A 17GSA 1G0TA 3ZZXA 1T8EB 4IHUA 1XXUA 3N5OA 3TRXA 2O89A 1KTEA 2HRAA 1EZKA 4RI6A 4Z7XA 1B9XC 2JSYA 1AQWA 3KEBA 2HSNB 5G5EA 1M9AA 3J7Yb 5HFIA 1TK8B 3C71A 4WF4A 2NVLA 3CRTA 1LJRA 4TVEA 4I2TA 2P0GA 3RPPA 3QAVA 1V58A 1WWJA 4NHWA 3F0IA 2VM1A 3HCZA 1GNEA 1A8YA 3ERFA 1KEBA 2R5GA 3P8WA 2VL3A 1O73A 4NWYA 4K2DA 1FW1A 3M8NA 3KMOA 3U6VA 1UC7A 4IBPA 2YWMA 2E2GA 1E2YA 3VI7A 3UVHA
chains in the Genus database with same CATH superfamily
2VCQA 4ISDA 1X5CA 2A2PA 4ML1A 5HFGA 4F9ZA 2LJAA 3TJGA 3A2VA 4HZ2A 2H72A 2O7KA 2DSAA 3KM6A 4CW9A 3DMLA 4J57E 1Z3EA 3FKFA 2XBIA 1SKSB 2WJUA 2XPEA 3WGXA 3A2XA 1V57A 2L59A 3UOMA 9GSSA 3FW2A 5A5HA 4PHZC 1UN2A 3GX8A 1XPVA 2H70A 2EIOA 4MF6A 3HA9A 5D93A 3KXOA 1TRVA 3CTFA 2HRKB 1U6TA 3VWVA 3EC3A 4A5PA 1G6YA 2R2JA 5IQYA 4FXYP 2DMMA 5IOXA 3C7MA 4KDUA 3WYWA 5HR3A 5J5NA 3CTGA 3PR8A 1A0FA 2A2RA 3LGCA 5B8AA 3G7YA 5J40A 1MEKA 4AJ7A 2H75A 1TTZA 1SKWB 3DXBA 2FGXA 3ZITA 1Z6MA 2HSMA 2M72A 5ECNB 2CX3A 2KHPA 4I2UA 1TU8A 2XBQA 1DE1A 6GSUA 4BVXB 4JE1A 2FUG2 2MMNA 1F9MA 2A4VA 2H73A 1PX7A 5INYA 3ZIJA 2OBKA 4K7OA 1GNWA 2VO4A 2OADA 3ERWA 3C73A 5CREA 2NDOA 1SK0A 2I1UA 2ALBA 1Z7RA 1XFLA 1YEWC 4I97A 3QAWA 2K18A 5D9TA 3KIJA 1K0OA 5DBQA 3TKSE 2FY6A 5IMAA 3TCOA 2X4AA 5H5QA 3CHXC 4HU7A 1OKDA 1Y25A 4OCEA 1QXHA 4JRRA 5A1NB 4OFMA 3KMNA 5G1LA 4ZB7A 5DQYA 3I6AA 2H6YA 2OE1A 2PVQA 2MMZA 1RQMA 3H4KA 1GSUA 1O8WA 2LRNA 2IN3A 2H71A 2GSQA 4GWRA 4K0NA 4AGSA 2DJJA 3FRCA 4GSSA 4TKYA 5KN0A 2L4QA 5IO2A 3KP9A 4HEA2 1EV9A 4LMWA 4YAVA 1GL8A 1W4VA 4WBRD 3ZRDA 3ZMLA 2O85A 3E3EA 2YPMA 1EOGA 1PX6A 4I5QA 1SL2B 4EO3A 1VF1A 5E4WA 1G6WA 6GSTA 2H1BA 1F3AA 1AAZA 4F82A 3R3EA 19GSA 2K6VA 4TR1B 4K5RA 1XWCA 4MZBA 1M2BA 1TP9A 3O3TA 2NPBA 5IOWA 4O5QA 4N3ZA 4RUVA 3CSHA 4D73B 3W8JA 4GDFA 1BF5A 8GSSA 4USSA 2PBJA 2P31A 1XZOA 2H66A 1OC9A 2H01A 4G9HA 1SL0B 2WW1A 1WOUA 5HFKA 4PQ1A 2HQTA 3DRNA 2QKEA 4KSOA 3IOSA 2YNXA 5GAND 1ACVA 4JEDA 1QFNA 3K8NA 3HYPA 4MJCA 5BMUB 4PGTA 2G2QA 3GUSA 3MDKA 4HZ4A 3QDNA 5KN1A 1AQVA 2X99A 2F8AA 3Q74A 4G0KA 4IQAA 5J9BA 2IMIA 3UVTA 4NMUA 1ZYQB 1XOBA 3GH9A 1YEPA 5LCZA 2GZYA 2HZEB 2GLRA 4IN0A 2DKIA 2X64A 3PGTA 3IRAA 3HJPA 2WCIA 11GSA 2RUEA 2IWTA 3P2AA 4EF0A 1PGTA 4K9ZA 2F8FA 4I8BA 2EFDA 1GRXA 2RM5A 3KCMA 3DGQA 1Z7PA 2FD3A 4EVMA 2GTUA 2JL4A 1UVZA 2XPDA 5ELGA 2HFDA 3I9V2 4HJ2A 5IM9A 3GTUA 2WVZA 2C3NA 3M1GA 3ED3A 2H30A 3QCPA 3A5IA 5CNWA 4AKGA 2EIRA 3I43A 2H1LA 4KAEA 2CV4A 3EE2A 2VCXA 2LKUA 2KP2A 2VCWA 2C3QA 2C0GA 4LA1A 5AN1A 1UA5A 4NV5A 4O7HA 1O6JA 3ZIVA 3IE3A 2YZHA 2CAQA 4HQSA 4ZBDA 1EGOA 4MP4A 3GH6A 4F2IA 4OD7A 3L9VA 1XWGA 3TOTA 5JWOB 3MYDA 1GSSA 2WZSA 4MA9A 2HRKA 2UZ8A 2O8VB 1I9DA 1B4PA 1EGRA 4LL1B 1MD4A 2GQKA 1BEDA 4PURA 2LRCA 3U5RE 4POBA 5AISA 4J2FA 1EP7A 2FWFA 2LUSA 1R26A 4TXOB 3VWWA 1SL1B 3G7JA 4BL7B 5J3RA 2C0FA 1FHEA 1EV4A 2L4CA 2ZCTA 5JCUA 3GURA 4NV2A 4JR6A 2VLUA 3RGBC 3TKSC 3TKQA 3UJ1A 1NW2A 3GYKA 4GQFA 2LQQA 5A34B 4HU9A 1V98A 3FYGA 2C1YA 2J9HA 4QL9A 4K1FA 5J41A 2AUVA 2C0EA 4EUYA 2DJ1A 3IHQA 1GULA 4G10A 3D5JA 1GTAA 4DVCA 2RIIA 3EURA 5AIVA 1ZL9A 6GSYA 3BJ5A 1T3BA 4K7NA 3ZTLA 1HD2A 3IR4A 5A1NA 3HHVA 3C1RA 4ZL9A 4O92A 2LQOA 5EVOA 2B1KA 2WW0A 4ML6A 1A2JA 2IIYA 1SJIA 5FHIA 3F4TA 5F8BA 2P5QA 4AF2A 2VD0A 4V1Ag 4ECCA 1M2DA 1QK8A 5D96A 3TJFA 2DJKA 3FZAA 1SVOA 1YF0A 5ECLB 4KGIA 4OMVA 2YCDA 1ERUA 2DC5A 1F37A 4RQXA 4FH8A 4ZB9A 2PPTA 3M9JA 12GSA 2FWGA 2R0GA 3PH9A 3GSSA 2V6OA 3WD6A 5CRGA 4KCAA 3Q18A 1GSDA 3GV1A 2EFCA 1AIUA 1OE8A 3NOFA 3OR5A 3LG6A 4TR1A 1YVLA 1M9BA 5C04A 4XRAA 3UBKA 1URMA 2HNLA 1ZMAA 2KOKA 4G0LA 1RW1A 3W8SA 3CYNA 2JZSA 4YQVA 4D73A 2B1LA 1MDKA 3BCIA 2I81A 2B7KA 2QSIA 3FZ4A 2OA7A 2X49A 2K8VA 2AB6A 2PMTA 3R2QA 2GSSA 4KB3A 1FOVA 4L5OA 4EDYA 1Z5YE 2HRFA 2N5FA 2AV4A 5ECSA 2R0CA 2C0DA 5DVBA 1SK2A 4OO5A 3EU4A 4POKA 4K8MA 3LSZA 4PNGA 1JZRA 4PI2C 5D9XA 1JZOA 5DJLA 3F8UA 4OWYA 3H8QA 2E2MA 2EIQA 4EDZA 1H75A 4F0BA 5FT3A 4WR4A 5J9CA 1MTCA 2OACA 2YANA 1X5EA 2H1DA 3HVNA 4JBBA 5DAKB 2HT9A 3PINA 2BJXA 2PU9C 1GLQA 1Y6EA 3RDWA 2RLIA 4QL7A 4P3YB 4FYBA 3QAGA 2HI7A 2C4JA 2H8LA 1X5DA 4YKFA 1V9WA 2VLVA 1B8XA 3M9KA 3GX0A 1VF4A 3RBTA 5ELAA 5IPHA 5EL8A 1XG8A 4HDEA 3KH9A 1JFUA 3RPNA 5ENUA 3D0ZA 3MWHA 4JZQA 3A3TA 3GKNA 4V1Ap 1SENA 5AGYA 1A23A 4IJIA 1HYUA 3FZ9A 4N11A 4WXTA 3CXGA 4MPFA 3IAS2 3EU3A 3GKXA 4CY8A 3ME7A 2DBCA 1NHYA 4IKHA 3FEUA 2FNOA 4PXOA 3EWLA 2O3EA 1QMVA 3MNGA 4QMKA 4RI7A 3ZMKA 3SBCA 2ZUPA 3S9FA 2XHFA 4F0CA 4X43A 3TOUA 3TJJA 2CZ3A 1GLPA 2V6KA 3LQ7A 1S3RA 3CSIA 2YJ7A 2OJLA 3L78A 4LMVA 1V40A 1JZDA 2FWHA 3CWGA 5ID2B 4OFTA 1K0AA 4Q5FA 1XOAA 4TXOA 1MDJA 3L0HA 4BL7A 1G7EA 2LJKA 1N2AA 1XW5A 4DSSB 1AQXA 1VRSD 4GCIA 4G19A 2MZCA 4OCFA 3O6TA 2O5VA 2WB9A 3DVWA 3DYRA 4ID0A 4FO5A 4WKWA 4HQZA 4NXIA 3D4TA 5A34A 1IYIA 1AUCA 4BA7A 4ZBBA 5ECQB 2PN8A 2E7PA 1K0NA 2QC7A 3RHBA 1O85A 5A5KA 3G9BA 3DWVA 4POLA 1EEMA 4IP6A 4WBJA 1JLWA 1BJXA 4KSMA 4MNNA 4XS1A 1TW9A 4EKZA 4WETA 3WT1A 2GS3A 3F3QA 3F4RA 2YN1A 2X8GA 4ACSA 2M80A 2R37A 4X1UA 3EVIA 4PX1A 3VURA 5D73A 5ECRB 1MD3A 4IELA 2CA8A 1XBSA 3H1NA 1DSBA 3TJBA 4GSNA 4MPGA 2E0QA 1SK1A 3GNJA 2PGTA 4GLTA 1XW9A 2X8HA 1ZCPA 1QQ2A 3TDGA 4MZWA 1CQGA 5F07A 1PSQA 4MLYA 5IMVA 3AY8A 5ECPB 4IJ3A 2IJYA 4Z2UA 5J4VA 1R5PA 4TXVA 1Q4JA 3GMFA 3ISOA 2IFQA 2LTKA 4KUNA 4KDYA 4PQIA 2HZFA 1PKWA 4N0ZA 4MZCA 3O76A 2HSYA 3VI5A 1GSEA 2B7JA 1ON4A 3LEFA 1T7PB 2DMLA 2A2SA 5CAXA 2FCHA 2N5BA 1YEXA 4DSQA 4G0IA 4TW5A 1XCCA 3HD5A 2EC4A 2HSNA 3FR3A 2JZRA 4EXJA 5IMZA 1C72A 5F0GA 2P5RA 1FB0A 4ECIA 2IMKA 1WE0A 2JZTA 2L6CA 3ZFBA 2R6KA 1TK5B 1Z9HA 3QPMA 4XTSA 3CSJA 5COHA 3LXTA 4O32A 3APOA 2J23A 2G0FA 3ERGA 2OE3A 1TU7A 1E6BA 2MMOA 5DAKA 2OKAA 3D22A 2L5OA 4XS4B 1WJKA 3ZL5A 3L4NA 4MH3A 3G7IA 4PNFA 2GSTA 2VKZG 2WVXB 2N5AA 5AIXA 4OO4A 1S3DA 3D21A 4HSCX 4MF5A 1AW9A 3WT2A 1WPIA 4GXZA 4EL1A 5ECKB 5GZZB 2B5EA 1YJ6A 2A4HA 1SYXA 4O5UA 4K6XA 5JWQB 3GFKA 3TRPA 7GSSA 4N10A 1B9YC 3F9UA 5A5HB 4XHMA 3GN3A 2GQMA 4ZBAA 4DSRA 4GTUA 4KDXA 1I5GA 1SKRB 5DJMA 5HR0A 1MDIA 3VLNA 1FOHA 5CRWA 1X9MB 1T1VA 4RQRA 1OAZA 1OE7A 3UBLA 2VAFA 4MH2A 1J0FA 2LNTA 1AC1A 5B8BA 1PN0A 4G2EA 4GSTA 2H0IA 1OC3A 4IW9A 2L57A 1PL2A 5IMDA 2DIYA 2GSRA 3D6IA 2VCTA 4PQHA 4FIWA 5ID2A 4BVXA 2Z9SA 2F3MA 2YZUA 2HLSA 3EINA 6GSXA 1PRXA 3DKSA 5KEJA 3EMXA 3F6FA 2V41A 3ZVJA 3A2WA 4DSSA 1SD8A 3VPTA 3LORA 4FYCA 1GUMA 1AXDA 2WDUA 5BRTA 1VF3A 4QQ7A 3BD2A 4TR4A 3LWAA 4HS1A 3TRQA 5IMCA 3FR9A 4ZB8A 5LNKe 2MYGA 4HI7A 4K7IA 3JCML 1FO5A 4AKIA 4WEYA 1XWAA 2C8UA 4DEJA 3QFBC 1K0MA 1HNBA 1SVMA 1TRWA 1M7TA 2H76A 1O7UA 4ZXGA 4CHSA 2H1AA 2YWOA 3GKKA 4J56E 1U87A 1ERTA 1O81A 2VL9A 5DCHA 1GUHA 3F3RA 3BBYA 1YKCA 2AHEA 1WP0A 4Q5QA 1IYHA 2WRTA 1V2AA 2ON5A 4YQMA 5IMFA 3TKRA 4LLRA 3V1WA 2CVBA 3FMWA 3KTBA 3UAPA 3BOAA 5A4UA 4XS6A 2DIZA 2LSTA 3GRXA 4ICYA 3VFIA 1XW6A 4BIKA 2TIRA 1TXUA 3HZ8A 3APQA 1SU9A 3QMXA 1YF1A 2FLSA 4W66A 1T00A 1GH2A 5E59A 2B5YA 4ECJA 20GSA 3QOUA 2H6XA 3L9UA 1RK4A 3I69A 2CT6A 2JSZA 5JWRB 3FR6A 3QR6A 3GSTA 1OC9B 3VK9A 3IHGA 4E68A 3KTLA 3VPQA 5A4WA 1TOFA 5DALB 1GWCA 1Y1UA 4PTSA 4KE3A 4N0VA 1K0DA 1FB6A 5D8IA 2LS5A 2AAWA 4HOJA 2WVYA 5ECHB 3EMPA 2GDRA 5BMUA 4FYUA 3Q6OA 4PUAA 3M0FA 1YKAA 4XIHA 1SJZA 3J7Yk 4ULXA 2VLTA 1G7OA 3LXZA 4JU5A 1GTBA 4TOPA 2F9SA 4YKGA 4BPYA 4EIPA 2LEGA 2HZEA 3WGDA 1TDIA 1FG4A 4TRXA 1WIKA 1R4WA 5ABRA 2C80A 2B3SA 6GSSA 1I1IP 1OYJA 1THXA 3BCKA 2DJ2A 2CQ9A 3HDCA 3HY2A 4XS4A 4MMMA 1DBYA 5B6MA 5DQSA 1YQ1A 3TGZA 1M0UA 2MBTA 3TUEA 2EFHA 1K3OA 2HYXA 5JCGA 2I9HA 5G1KA 1XVWA 3GTUB 1K0BA 3UARA 5DDLA 2FWEA 1FVJA 5D9WA 3LJRA 1CQHA 1F3BA 1LBKA 3UIWA 5GSTA 2R4VA 4KW6A 1F2EA 2GT5A 2VOCA 1BX9A 4CY6A 2PVOC 3GL3A 2KP1A 3GHAA 5ECIB 3VWXA 3PPUA 2RUFA 1TXXA 4CDOA 2GZZA 5DCGA 2FA4A 4L0WA 2VUPA 4PI0C 4WF5A 4K0GA 2YOIA 3HKRA 1ERWA 2NBSA 1EEJA 4K5SA 1GUKA 1Q98A 1HNAA 4EIQA 3DEXA 2VL2C 5KN3A 3HXSA 1K0CA 4L8EA 5KOWA 1ST9A 2YV9A 2VCZA 1QGVA 3QFAC 1YZXA 2I3YA 3KP8A 1M3JA 3F63A 4Z2TA 3N9JA 2LRTA 1ERVA 3F6DA 5J4UA 2PWJA 1S4BP 1VF2A 5H5RA 2H19A 2VL2A 1TI3A 5FWGA 5LD0A 2H0HA 1OKTA 4BVYB 3IK7A 1N8JA 4KNDA 3GL5A 3CQFA 1B48A 1NM3A 5B7CA 2X8CA 4I6XA 1JLVA 1PKZA 3FY7A 3LYPA 1ZYNA 1ZGNA 1PD21 4ZL8A 3M3MA 2AJQB 2QA1A 1DE2A 2MBSA 2V2GA 1S3CA 2GQLA 5HQPA 4IS0A 1YDKA 1ZZYA 1XWKA 2O36A 5J47A 3IDVA 4ZIJA 2DJ0A 3H93A 4LL4B 5D9VA 2CX4A 1GTIA 1SD9A 3E9JB 1X0RA 1PA3A 3TJKA 1HNCA 1VGLA 1PQNA 5ECOB 2OE0A 2K8SA 4Q5NA 1BQ7A 4XCSA 3ZREA 3L9SA 5IPGA 2IL3A 1QUWA 2CVKA 2B5XA 4POMA 5J4YA 1ZOFA 4ECBA 1K3YA 3GKMA 5L71A 1B4QA 5HR2A 2YJHA 4F03A 4V2MA 4WR5A 2REMA 3IC4A 4IQ1A 2YWIA 2ES7A 4X0XA 4KCEA 4IGJA 2IMDA 1BG1A 2PUKC 1R5AA 1BAYA 3WGEA 3NIVA 1GSFA 1SYRA 5G2ZA 4AKHA 3GA4A 2R3XA 1TRUA 10GSA 2LNSA 4X4JA 4GQCA 3HZ4A 3W6GA 4GF0A 4V2NA 3TB2A 3FHKA 3KH7A 4JR4A 3KJYA 5HR1A 1TKDB 2OBIA 1SJ6A 3P90A 4MDCA 1GSQA 3DD3A 2WW3A 3ME8A 2KUCA 4EE0A 1GP1A 1NHOA 3SWLA 1JZWA 2JACA 2IMEA 4ZL7A 5DALA 5IO0A 16GSA 4Q5RA 2K9FA 3F4SA 1ZYEA 3IBHA 3HJMA 2HE3A 4MK3A 5G5FA 2JU5A 2WZ9A 2CVDA 4BWQA 2YWNA 5CRHA 3HMJG 2YV7A 1EP8A 4EC0A 22GSA 2H1GA 4TR3A 1ML6A 2V1MA 5CP1A 3QD9A 6GSVA 3IXRA 2ZNMA 1PN9A 2BTOT 4AJ8A 1BG5A 4AJ6A 2WGRA 1M2AA 3MIXA 3UEMA 4GRFA 1Z6NA 2GGTA 2GT6A 4MJBA 2MMAA 4BWSA 1XIYA 1THOA 2AYTA 2TRCP 2GZPA 4MCUA 3HJOA 3VWUA 4KF9A 5GSSA 3C1SA 5CO3A 2VM2A 2QGVA 3HVSA 3E0UA 1KBNA 2FA8A 4V2LA 5GAPD 4YQUA 4ZB6A 1ILOA 4IP1A 1S3AA 2H6ZA 3HVVA 5KN2A 1J9BA 3EPTA 2WW2A 1PFOA 1HQOA 4L0UA 1YY7A 4NAXA 2HSHA 2V32A 4MABA 3IA1A 4Z2RA 3RHCA 3ZLPA 4KX4A 2OT3A 1O8XA 3FK8A 4XRDA 1USBA 3RAZA 3LW9A 2WULA 3APSA 2LV3A 2BMXA 2YP6A 4H86A 2LJRA 3ZVJD 5C00A 1GSYA 4E8HA 1SVLA 3FZ5A 3H79A 3IV4A 5H5SA 3DVXA 2M46A 1M3IA 3TKPA 3ZYWA 2IMFA 2PERA 3DIEA 5F06A 3Q19A 4MJEA 2IPAA 1W89A 2L6DA 5IIZA 2HSMB 14GSA 3TU3B 2CZ2A 3LFLA 1H4OA 3GIXA 1TRSA 3UL3A 2HXKA 1FAAA 1ABAA 3MSZA 4HUAA 3IK9A 6GSWA 2I4AA 3RFRC 1T4YA 4O5RA 2FHEA 4MJAA 1LU4A 2HRNA 3P7XA 4BVYA 4FQUA 2EFEA 1EOHA 2O87A 4ILFA 5A4VA 4L5LA 3MAKA 1U3AA 1U88A 4YAPA 4OFNA 1A2LA 2F51A 1X9SB 1WMJA 4K2XA 1FVKA 2NTOA 3CMIA 2DJ3A 3UMAA 2H0GA 3D4MA 1TI1A 3CRUA 2KLXA 5KOXA 1XWBA 5G31A 2DKHA 4HJMA 3TKSA 5EY6A 1T4ZA 4YH2A 1A2MA 4PUFC 3ZFLA 5CYYA 4AKXB 2B6MA 3IPZA 1NSWA 4NHZA 2QA2A 2TRXA 5F05A 1X9WB 1OVNA 1TJDA 1DUGA 2WS2A 3LYKA 1A0RP 4TR0A 1TK0B 5G30A 1KNGA 5B6NA 5JCWA 5ECMB 2H74A 1OC8A 3A5WA 4NPBA 3KZQA 5CRDA 4AI6A 2ON7A 1XVQA 3HVXA 1GTUA 1EWXA 18GSA 1JHBA 1A8LA 1WRYA 2VIMA 1K3LA 3NZNA 2XC2A 3CBUA 2GVPA 3KGKA 2CAIA 4IVFA 1J08A 4E8EA 2VCVA 3IC8A 2JADA 1ZYPA 4KA0A 1PMTA 4MF7A 1R7HA 4N30A 2VD1A 2C3TA 3KD0A 1M99A 2L5LA 3IAM2 1A24A 1BYEA 2DLXA 1N25A 2R0PA 2IFQB 13GSA 2RM6A 2D2ZA 3C8EA 1U3IA 4TN8A 1PL1A 2WFCA 4ZILA 1F6MC 4G01A 4KH7A 3EYTA 5EPFA 3US3A 17GSA 1G0TA 3ZZXA 1T8EB 2UV8G 4IHUA 1XXUA 3N5OA 3TRXA 2O89A 1KTEA 2HRAA 1EZKA 4RI6A 4Z7XA 1B9XC 2JSYA 1AQWA 3KEBA 2HSNB 5G5EA 1M9AA 3J7Yb 5HFIA 1TK8B 3C71A 4WF4A 2NVLA 3CRTA 1LJRA 4TVEA 4I2TA 2P0GA 3RPPA 3QAVA 1V58A 1WWJA 4NHWA 3F0IA 2VM1A 3HCZA 1GNEA 1A8YA 3ERFA 1KEBA 2R5GA 3P8WA 2VL3A 1O73A 4NWYA 4K2DA 1FW1A 3M8NA 3KMOA 3U6VA 1UC7A 4IBPA 2WVXA 2YWMA 2E2GA 1E2YA 3VI7A 3UVHA
chains in the Genus database with same CATH topology
2VCQA 4ISDA 1X5CA 2A2PA 4ML1A 5HFGA 4F9ZA 2LJAA 3TJGA 3A2VA 4HZ2A 2H72A 2O7KA 2DSAA 3KM6A 4CW9A 3DMLA 4J57E 1Z3EA 3FKFA 2XBIA 1SKSB 2WJUA 2XPEA 3WGXA 3A2XA 1V57A 2L59A 3UOMA 9GSSA 3FW2A 5A5HA 1UN2A 3GX8A 1XPVA 2H70A 2EIOA 4MF6A 3HA9A 5D93A 3KXOA 1TRVA 3CTFA 2HRKB 1U6TA 3VWVA 3EC3A 4A5PA 1G6YA 2R2JA 5IQYA 2DMMA 5IOXA 3C7MA 4KDUA 3WYWA 5HR3A 5J5NA 3CTGA 3PR8A 1A0FA 2A2RA 3LGCA 5B8AA 3G7YA 5J40A 1MEKA 4AJ7A 2H75A 1TTZA 1SKWB 3DXBA 2FGXA 3ZITA 1Z6MA 2HSMA 2M72A 5ECNB 2CX3A 2KHPA 4I2UA 1TU8A 2XBQA 1DE1A 6GSUA 4BVXB 4JE1A 2FUG2 2MMNA 1F9MA 2A4VA 2H73A 1PX7A 5INYA 3ZIJA 2OBKA 4K7OA 1GNWA 2VO4A 2OADA 3ERWA 3C73A 5CREA 2NDOA 1SK0A 2I1UA 2ALBA 1Z7RA 1XFLA 4I97A 3QAWA 2K18A 5D9TA 3KIJA 1K0OA 5DBQA 3TKSE 2FY6A 5IMAA 3TCOA 2X4AA 5H5QA 4HU7A 1OKDA 1Y25A 4OCEA 1QXHA 4JRRA 5A1NB 4OFMA 3KMNA 5G1LA 4ZB7A 5DQYA 3I6AA 2H6YA 2OE1A 2PVQA 2MMZA 1RQMA 3H4KA 1GSUA 1O8WA 2LRNA 2IN3A 2H71A 2GSQA 4GWRA 4K0NA 4AGSA 2DJJA 3FRCA 4GSSA 4TKYA 5KN0A 2L4QA 5IO2A 3KP9A 4HEA2 1EV9A 4LMWA 4YAVA 1GL8A 1W4VA 4WBRD 3ZRDA 3ZMLA 2O85A 3E3EA 2YPMA 1EOGA 1PX6A 4I5QA 1SL2B 4EO3A 1VF1A 5E4WA 1G6WA 6GSTA 2H1BA 1F3AA 1AAZA 4F82A 3R3EA 19GSA 2K6VA 4TR1B 4K5RA 1XWCA 4MZBA 1M2BA 1TP9A 3O3TA 2NPBA 5IOWA 4O5QA 4N3ZA 4RUVA 3CSHA 4D73B 3W8JA 4GDFA 1BF5A 8GSSA 4USSA 2PBJA 2P31A 1XZOA 2H66A 1OC9A 2H01A 4G9HA 1SL0B 1WOUA 5HFKA 4PQ1A 2HQTA 3DRNA 2QKEA 4KSOA 3IOSA 2YNXA 5GAND 1ACVA 4JEDA 1QFNA 3K8NA 3HYPA 4MJCA 5BMUB 4PGTA 2G2QA 3GUSA 3MDKA 4HZ4A 3QDNA 5KN1A 1AQVA 2X99A 2F8AA 3Q74A 4G0KA 4IQAA 5J9BA 2IMIA 3UVTA 4NMUA 1ZYQB 1XOBA 3GH9A 1YEPA 5LCZA 2GZYA 2HZEB 2GLRA 4IN0A 2DKIA 2X64A 3PGTA 3IRAA 3HJPA 2WCIA 11GSA 2RUEA 2IWTA 3P2AA 4EF0A 1PGTA 4K9ZA 2F8FA 4I8BA 2EFDA 1GRXA 2RM5A 3KCMA 3DGQA 1Z7PA 2FD3A 4EVMA 2GTUA 2JL4A 1UVZA 2XPDA 5ELGA 2HFDA 3I9V2 4HJ2A 5IM9A 3GTUA 2C3NA 3M1GA 3ED3A 2H30A 3QCPA 3A5IA 5CNWA 4AKGA 2EIRA 3I43A 2H1LA 4KAEA 2CV4A 3EE2A 2VCXA 2LKUA 2KP2A 2VCWA 2C3QA 2C0GA 4LA1A 5AN1A 1UA5A 4NV5A 4O7HA 1O6JA 3ZIVA 3IE3A 2YZHA 2CAQA 4HQSA 4ZBDA 1EGOA 4MP4A 3GH6A 4F2IA 4OD7A 3L9VA 1XWGA 3TOTA 5JWOB 3MYDA 1GSSA 4MA9A 2HRKA 2UZ8A 2O8VB 1I9DA 1B4PA 1EGRA 4LL1B 1MD4A 2GQKA 1BEDA 4PURA 2LRCA 3U5RE 4POBA 5AISA 4J2FA 1EP7A 2FWFA 2LUSA 1R26A 4TXOB 3VWWA 1SL1B 3G7JA 4BL7B 5J3RA 2C0FA 1FHEA 1EV4A 2L4CA 2ZCTA 5JCUA 3GURA 4NV2A 4JR6A 2VLUA 3TKSC 3TKQA 3UJ1A 1NW2A 3GYKA 4GQFA 2LQQA 5A34B 4HU9A 1V98A 3FYGA 2C1YA 2J9HA 4QL9A 4K1FA 5J41A 2AUVA 2C0EA 4EUYA 2DJ1A 3IHQA 1GULA 4G10A 3D5JA 1GTAA 4DVCA 2RIIA 3EURA 5AIVA 1ZL9A 6GSYA 3BJ5A 1T3BA 4K7NA 3ZTLA 1HD2A 3IR4A 5A1NA 3HHVA 3C1RA 4ZL9A 4O92A 2LQOA 5EVOA 2B1KA 4ML6A 1A2JA 2IIYA 1SJIA 5FHIA 3F4TA 5F8BA 2P5QA 4AF2A 2VD0A 4V1Ag 4ECCA 1M2DA 1QK8A 5D96A 3TJFA 2DJKA 3FZAA 1SVOA 1YF0A 5ECLB 4KGIA 4OMVA 2YCDA 1ERUA 2DC5A 1F37A 4RQXA 4FH8A 4ZB9A 2PPTA 3M9JA 12GSA 2FWGA 2R0GA 3PH9A 3GSSA 2V6OA 3WD6A 5CRGA 4KCAA 3Q18A 1GSDA 3GV1A 2EFCA 1AIUA 1OE8A 3NOFA 3OR5A 3LG6A 4TR1A 1YVLA 1M9BA 5C04A 4XRAA 3UBKA 1URMA 2HNLA 1ZMAA 2KOKA 4G0LA 1RW1A 3W8SA 3CYNA 2JZSA 4YQVA 4D73A 2B1LA 1MDKA 3BCIA 2I81A 2B7KA 2QSIA 3FZ4A 2OA7A 2X49A 2K8VA 2AB6A 2PMTA 3R2QA 2GSSA 4KB3A 1FOVA 4L5OA 4EDYA 1Z5YE 2HRFA 2N5FA 2AV4A 5ECSA 2R0CA 2C0DA 5DVBA 1SK2A 4OO5A 3EU4A 4POKA 4K8MA 3LSZA 4PNGA 1JZRA 5D9XA 1JZOA 5DJLA 3F8UA 4OWYA 3H8QA 2E2MA 2EIQA 4EDZA 1H75A 4F0BA 5FT3A 4WR4A 5J9CA 1MTCA 2OACA 2YANA 1X5EA 2H1DA 4JBBA 5DAKB 2HT9A 3PINA 2BJXA 2PU9C 1GLQA 1Y6EA 3RDWA 2RLIA 4QL7A 4P3YB 4FYBA 3QAGA 2HI7A 2C4JA 2H8LA 1X5DA 4YKFA 1V9WA 2VLVA 1B8XA 3M9KA 3GX0A 1VF4A 3RBTA 5ELAA 5IPHA 5EL8A 4HDEA 3KH9A 1JFUA 3RPNA 5ENUA 3D0ZA 3MWHA 4JZQA 3A3TA 3GKNA 4V1Ap 1SENA 5AGYA 1A23A 4IJIA 1HYUA 3FZ9A 4N11A 4WXTA 3CXGA 4MPFA 3IAS2 3EU3A 3GKXA 4CY8A 3ME7A 2DBCA 1NHYA 4IKHA 3FEUA 2FNOA 4PXOA 3EWLA 1QMVA 3MNGA 4QMKA 4RI7A 3ZMKA 3SBCA 2ZUPA 3S9FA 2XHFA 4F0CA 4X43A 3TOUA 3TJJA 2CZ3A 1GLPA 2V6KA 3LQ7A 3CSIA 2YJ7A 2OJLA 3L78A 4LMVA 1V40A 1JZDA 2FWHA 3CWGA 5ID2B 4OFTA 1K0AA 4Q5FA 1XOAA 4TXOA 1MDJA 3L0HA 4BL7A 1G7EA 2LJKA 1N2AA 1XW5A 4DSSB 1AQXA 1VRSD 4GCIA 4G19A 2MZCA 4OCFA 3O6TA 2O5VA 2WB9A 3DVWA 3DYRA 4ID0A 4FO5A 4WKWA 4HQZA 4NXIA 3D4TA 5A34A 1IYIA 1AUCA 4BA7A 4ZBBA 5ECQB 2PN8A 2E7PA 1K0NA 2QC7A 3RHBA 1O85A 5A5KA 3G9BA 3DWVA 4POLA 1EEMA 4IP6A 4WBJA 1JLWA 1BJXA 4KSMA 4MNNA 4XS1A 1TW9A 4EKZA 4WETA 3WT1A 2GS3A 3F3QA 3F4RA 2YN1A 2X8GA 4ACSA 2M80A 2R37A 4X1UA 3EVIA 4PX1A 3VURA 5D73A 5ECRB 1MD3A 4IELA 2CA8A 1XBSA 3H1NA 1DSBA 3TJBA 4GSNA 4MPGA 2E0QA 1SK1A 3GNJA 2PGTA 4GLTA 1XW9A 2X8HA 1ZCPA 1QQ2A 3TDGA 4MZWA 1CQGA 5F07A 1PSQA 4MLYA 5IMVA 3AY8A 5ECPB 4IJ3A 2IJYA 4Z2UA 5J4VA 1R5PA 4TXVA 1Q4JA 3GMFA 3ISOA 2IFQA 2LTKA 4KUNA 4KDYA 4PQIA 2HZFA 1PKWA 4N0ZA 4MZCA 3O76A 2HSYA 3VI5A 1GSEA 2B7JA 1ON4A 3LEFA 1T7PB 2DMLA 2A2SA 5CAXA 2FCHA 2N5BA 1YEXA 4DSQA 4G0IA 4TW5A 1XCCA 3HD5A 2EC4A 2HSNA 3FR3A 2JZRA 4EXJA 5IMZA 1C72A 5F0GA 2P5RA 1FB0A 4ECIA 2IMKA 1WE0A 2JZTA 2L6CA 3ZFBA 2R6KA 1TK5B 1Z9HA 3QPMA 4XTSA 3CSJA 5COHA 3LXTA 4O32A 3APOA 2J23A 2G0FA 3ERGA 2OE3A 1TU7A 1E6BA 2MMOA 5DAKA 2OKAA 3D22A 2L5OA 4XS4B 1WJKA 3ZL5A 3L4NA 4MH3A 3G7IA 4PNFA 2GSTA 2VKZG 2N5AA 5AIXA 4OO4A 1S3DA 3D21A 4MF5A 1AW9A 3WT2A 1WPIA 4GXZA 4EL1A 5ECKB 5GZZB 2B5EA 1YJ6A 2A4HA 1SYXA 4O5UA 4K6XA 5JWQB 3GFKA 3TRPA 7GSSA 4N10A 1B9YC 3F9UA 5A5HB 4XHMA 3GN3A 2GQMA 4ZBAA 4DSRA 4GTUA 4KDXA 1I5GA 1SKRB 5DJMA 5HR0A 1MDIA 3VLNA 1FOHA 5CRWA 1X9MB 1T1VA 4RQRA 1OAZA 1OE7A 3UBLA 2VAFA 4MH2A 1J0FA 2LNTA 1AC1A 5B8BA 1PN0A 4G2EA 4GSTA 2H0IA 1OC3A 4IW9A 2L57A 1PL2A 5IMDA 2DIYA 2GSRA 3D6IA 2VCTA 4PQHA 4FIWA 5ID2A 4BVXA 2Z9SA 2F3MA 2YZUA 2HLSA 3EINA 6GSXA 1PRXA 3DKSA 5KEJA 3EMXA 3F6FA 2V41A 3ZVJA 3A2WA 4DSSA 1SD8A 3VPTA 3LORA 4FYCA 1GUMA 1AXDA 2WDUA 5BRTA 1VF3A 4QQ7A 3BD2A 4TR4A 3LWAA 4HS1A 3TRQA 5IMCA 3FR9A 4ZB8A 5LNKe 2MYGA 4HI7A 4K7IA 3JCML 1FO5A 4AKIA 4WEYA 1XWAA 2C8UA 4DEJA 3QFBC 1K0MA 1HNBA 1SVMA 1TRWA 1M7TA 2H76A 1O7UA 4ZXGA 4CHSA 2H1AA 2YWOA 3GKKA 4J56E 1U87A 1ERTA 1O81A 2VL9A 5DCHA 1GUHA 3F3RA 3BBYA 1YKCA 2AHEA 1WP0A 4Q5QA 1IYHA 2WRTA 1V2AA 2ON5A 4YQMA 5IMFA 3TKRA 4LLRA 3V1WA 2CVBA 3FMWA 3KTBA 3UAPA 3BOAA 5A4UA 4XS6A 2DIZA 2LSTA 3GRXA 4ICYA 3VFIA 1XW6A 2TIRA 1TXUA 3HZ8A 3APQA 1SU9A 3QMXA 1YF1A 2FLSA 4W66A 1T00A 1GH2A 5E59A 2B5YA 4ECJA 20GSA 3QOUA 2H6XA 3L9UA 1RK4A 3I69A 2CT6A 2JSZA 5JWRB 3FR6A 3QR6A 3GSTA 1OC9B 3VK9A 3IHGA 4E68A 3KTLA 3VPQA 5A4WA 1TOFA 5DALB 1GWCA 1Y1UA 4PTSA 4KE3A 4N0VA 1K0DA 1FB6A 5D8IA 2LS5A 2AAWA 4HOJA 5ECHB 3EMPA 2GDRA 5BMUA 4FYUA 3Q6OA 4PUAA 3M0FA 1YKAA 4XIHA 1SJZA 3J7Yk 4ULXA 2VLTA 1G7OA 3LXZA 4JU5A 1GTBA 4TOPA 2F9SA 4YKGA 4BPYA 4EIPA 2LEGA 2HZEA 3WGDA 1TDIA 1FG4A 4TRXA 1WIKA 1R4WA 5ABRA 2C80A 2B3SA 6GSSA 1OYJA 1THXA 3BCKA 2DJ2A 2CQ9A 3HDCA 3HY2A 4XS4A 4MMMA 1DBYA 5B6MA 5DQSA 1YQ1A 3TGZA 1M0UA 2MBTA 3TUEA 2EFHA 1K3OA 2HYXA 5JCGA 2I9HA 5G1KA 1XVWA 3GTUB 1K0BA 3UARA 5DDLA 2FWEA 1FVJA 5D9WA 3LJRA 1CQHA 1F3BA 1LBKA 3UIWA 5GSTA 2R4VA 4KW6A 1F2EA 2GT5A 2VOCA 1BX9A 4CY6A 2PVOC 3GL3A 2KP1A 3GHAA 5ECIB 3VWXA 3PPUA 2RUFA 1TXXA 4CDOA 2GZZA 5DCGA 2FA4A 4L0WA 2VUPA 4WF5A 4K0GA 2YOIA 3HKRA 1ERWA 2NBSA 1EEJA 4K5SA 1GUKA 1Q98A 1HNAA 4EIQA 3DEXA 2VL2C 5KN3A 3HXSA 1K0CA 4L8EA 5KOWA 1ST9A 2YV9A 2VCZA 1QGVA 3QFAC 1YZXA 2I3YA 3KP8A 3F63A 4Z2TA 3N9JA 2LRTA 1ERVA 3F6DA 5J4UA 2PWJA 1VF2A 5H5RA 2H19A 2VL2A 1TI3A 5FWGA 5LD0A 2H0HA 1OKTA 4BVYB 3IK7A 1N8JA 4KNDA 3GL5A 1B48A 1NM3A 5B7CA 2X8CA 4I6XA 1JLVA 1PKZA 3FY7A 3LYPA 1ZYNA 1ZGNA 1PD21 4ZL8A 3M3MA 2AJQB 2QA1A 1DE2A 2MBSA 2V2GA 1S3CA 2GQLA 5HQPA 4IS0A 1YDKA 1ZZYA 1XWKA 5J47A 3IDVA 4ZIJA 2DJ0A 3H93A 4LL4B 5D9VA 2CX4A 1GTIA 1SD9A 3E9JB 1X0RA 1PA3A 3TJKA 1HNCA 1VGLA 1PQNA 5ECOB 2OE0A 2K8SA 4Q5NA 1BQ7A 4XCSA 3ZREA 3L9SA 5IPGA 2IL3A 1QUWA 2CVKA 2B5XA 4POMA 5J4YA 1ZOFA 4ECBA 1K3YA 3GKMA 5L71A 1B4QA 5HR2A 2YJHA 4F03A 4V2MA 4WR5A 2REMA 3IC4A 4IQ1A 2YWIA 2ES7A 4X0XA 4KCEA 4IGJA 2IMDA 1BG1A 2PUKC 1R5AA 1BAYA 3WGEA 3NIVA 1GSFA 1SYRA 5G2ZA 4AKHA 3GA4A 2R3XA 1TRUA 10GSA 2LNSA 4X4JA 4GQCA 3HZ4A 3W6GA 4GF0A 4V2NA 3TB2A 3FHKA 3KH7A 4JR4A 3KJYA 5HR1A 1TKDB 2OBIA 1SJ6A 3P90A 4MDCA 1GSQA 3DD3A 3ME8A 2KUCA 4EE0A 1GP1A 1NHOA 3SWLA 1JZWA 2JACA 2IMEA 4ZL7A 5DALA 5IO0A 16GSA 4Q5RA 2K9FA 3F4SA 1ZYEA 3IBHA 3HJMA 2HE3A 4MK3A 5G5FA 2JU5A 2WZ9A 2CVDA 4BWQA 2YWNA 5CRHA 3HMJG 2YV7A 1EP8A 4EC0A 22GSA 2H1GA 4TR3A 1ML6A 2V1MA 5CP1A 3QD9A 6GSVA 3IXRA 2ZNMA 1PN9A 2BTOT 4AJ8A 1BG5A 4AJ6A 2WGRA 1M2AA 3MIXA 3UEMA 4GRFA 1Z6NA 2GGTA 2GT6A 4MJBA 2MMAA 4BWSA 1XIYA 1THOA 2AYTA 2TRCP 2GZPA 4MCUA 3HJOA 3VWUA 4KF9A 5GSSA 3C1SA 5CO3A 2VM2A 2QGVA 3HVSA 3E0UA 1KBNA 2FA8A 4V2LA 5GAPD 4YQUA 4ZB6A 1ILOA 4IP1A 1S3AA 2H6ZA 3HVVA 5KN2A 1J9BA 3EPTA 1HQOA 4L0UA 1YY7A 4NAXA 2HSHA 2V32A 4MABA 3IA1A 4Z2RA 3RHCA 3ZLPA 4KX4A 2OT3A 1O8XA 3FK8A 4XRDA 1USBA 3RAZA 3LW9A 2WULA 3APSA 2LV3A 2BMXA 2YP6A 4H86A 2LJRA 3ZVJD 5C00A 1GSYA 4E8HA 1SVLA 3FZ5A 3H79A 3IV4A 5H5SA 3DVXA 2M46A 3TKPA 3ZYWA 2IMFA 2PERA 3DIEA 5F06A 3Q19A 4MJEA 2IPAA 1W89A 2L6DA 5IIZA 2HSMB 14GSA 3TU3B 2CZ2A 3LFLA 1H4OA 3GIXA 1TRSA 3UL3A 2HXKA 1FAAA 1ABAA 3MSZA 4HUAA 3IK9A 6GSWA 2I4AA 1T4YA 4O5RA 2FHEA 4MJAA 1LU4A 2HRNA 3P7XA 4BVYA 4FQUA 2EFEA 1EOHA 2O87A 4ILFA 5A4VA 4L5LA 3MAKA 1U3AA 1U88A 4YAPA 4OFNA 1A2LA 2F51A 1X9SB 1WMJA 4K2XA 1FVKA 2NTOA 3CMIA 2DJ3A 3UMAA 2H0GA 3D4MA 1TI1A 3CRUA 2KLXA 5KOXA 1XWBA 5G31A 2DKHA 4HJMA 3TKSA 5EY6A 1T4ZA 4YH2A 1A2MA 4PUFC 3ZFLA 5CYYA 4AKXB 2B6MA 3IPZA 1NSWA 4NHZA 2QA2A 2TRXA 5F05A 1X9WB 1OVNA 1TJDA 1DUGA 2WS2A 3LYKA 1A0RP 4TR0A 1TK0B 5G30A 1KNGA 5B6NA 5JCWA 5ECMB 2H74A 1OC8A 3A5WA 4NPBA 3KZQA 5CRDA 4AI6A 2ON7A 1XVQA 3HVXA 1GTUA 1EWXA 18GSA 1JHBA 1A8LA 1WRYA 2VIMA 1K3LA 3NZNA 2XC2A 3CBUA 2GVPA 3KGKA 2CAIA 4IVFA 1J08A 4E8EA 2VCVA 3IC8A 2JADA 1ZYPA 4KA0A 1PMTA 4MF7A 1R7HA 4N30A 2VD1A 2C3TA 3KD0A 1M99A 2L5LA 3IAM2 1A24A 1BYEA 2DLXA 1N25A 2R0PA 2IFQB 13GSA 2RM6A 2D2ZA 3C8EA 1U3IA 4TN8A 1PL1A 2WFCA 4ZILA 1F6MC 4G01A 4KH7A 3EYTA 5EPFA 3US3A 17GSA 1G0TA 3ZZXA 1T8EB 2UV8G 4IHUA 1XXUA 3N5OA 3TRXA 2O89A 1KTEA 2HRAA 1EZKA 4RI6A 4Z7XA 1B9XC 2JSYA 1AQWA 3KEBA 2HSNB 5G5EA 1M9AA 3J7Yb 5HFIA 1TK8B 3C71A 4WF4A 2NVLA 3CRTA 1LJRA 4TVEA 4I2TA 2P0GA 3RPPA 3QAVA 1V58A 1WWJA 4NHWA 3F0IA 2VM1A 3HCZA 1GNEA 1A8YA 3ERFA 1KEBA 2R5GA 3P8WA 2VL3A 1O73A 4NWYA 4K2DA 1FW1A 3M8NA 3KMOA 3U6VA 1UC7A 4IBPA 2YWMA 2E2GA 1E2YA 3VI7A 3UVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCQ A;  4ISD A;  1X5C A;  5HFG A;  4ML1 A;  4F9Z A;  2LJA A;  3TJG A;  3A2V A;  4HZ2 A;  2H72 A;  2O7K A;  2DSA A;  3KM6 A;  4CW9 A;  3DML A;  4J57 E;  1Z3E A;  3FKF A;  2XBI A;  1SKS B;  2WJU A;  2XPE A;  3WGX A;  3A2X A;  1V57 A;  2L59 A;  3UOM A;  9GSS A;  3FW2 A;  1UN2 A;  3GX8 A;  1XPV A;  2H70 A;  2EIO A;  4MF6 A;  3HA9 A;  5D93 A;  3KXO A;  1TRV A;  3CTF A;  2HRK B;  1U6T A;  3VWV A;  3EC3 A;  1G6Y A;  2R2J A;  5IQY A;  2DMM A;  5IOX A;  3C7M A;  4KDU A;  3WYW A;  5HR3 A;  5J5N A;  3CTG A;  3PR8 A;  1A0F A;  2A2R A;  3LGC A;  5B8A A;  3G7Y A;  1MEK A;  4AJ7 A;  2H75 A;  1TTZ A;  1SKW B;  3DXB A;  2FGX A;  3ZIT A;  1Z6M A;  2HSM A;  2M72 A;  5ECN B;  2CX3 A;  2KHP A;  4I2U A;  1TU8 A;  2XBQ A;  1DE1 A;  6GSU A;  4BVX B;  4JE1 A;  2FUG 2;  2MMN A;  1F9M A;  2A4V A;  2H73 A;  1PX7 A;  5INY A;  3ZIJ A;  2OBK A;  4K7O A;  1GNW A;  2VO4 A;  2OAD A;  3ERW A;  3C73 A;  5CRE A;  2NDO A;  1SK0 A;  2I1U A;  2ALB A;  1Z7R A;  1XFL A;  4I97 A;  3QAW A;  2K18 A;  5D9T A;  3KIJ A;  1K0O A;  5DBQ A;  3TKS E;  2FY6 A;  5IMA A;  3TCO A;  5H5Q A;  4HU7 A;  1OKD A;  1Y25 A;  4OCE A;  1QXH A;  4JRR A;  4OFM A;  3KMN A;  5G1L A;  5DQY A;  3I6A A;  2H6Y A;  2OE1 A;  2PVQ A;  2MMZ A;  1RQM A;  3H4K A;  1GSU A;  1O8W A;  2LRN A;  2IN3 A;  2H71 A;  2GSQ A;  4GWR A;  4K0N A;  4AGS A;  2DJJ A;  3FRC A;  4GSS A;  4TKY A;  5KN0 A;  2L4Q A;  5IO2 A;  3KP9 A;  4HEA 2;  1EV9 A;  4LMW A;  4YAV A;  1GL8 A;  1W4V A;  4WBR D;  3ZRD A;  3ZML A;  2O85 A;  3E3E A;  2YPM A;  1EOG A;  1PX6 A;  4I5Q A;  1SL2 B;  4EO3 A;  1VF1 A;  5E4W A;  1G6W A;  6GST A;  2H1B A;  1F3A A;  1AAZ A;  4F82 A;  3R3E A;  19GS A;  2K6V A;  4TR1 B;  1XWC A;  4MZB A;  1M2B A;  1TP9 A;  3O3T A;  2NPB A;  5IOW A;  4RUV A;  3CSH A;  4D73 B;  3W8J A;  8GSS A;  4USS A;  2PBJ A;  2P31 A;  1XZO A;  2H66 A;  1OC9 A;  2H01 A;  4G9H A;  1SL0 B;  1WOU A;  5HFK A;  4PQ1 A;  2HQT A;  3DRN A;  2QKE A;  4KSO A;  3IOS A;  2YNX A;  5GAN D;  1ACV A;  4JED A;  1QFN A;  3K8N A;  3HYP A;  4MJC A;  4PGT A;  2G2Q A;  3GUS A;  3MDK A;  4HZ4 A;  3QDN A;  5KN1 A;  1AQV A;  2X99 A;  2F8A A;  3Q74 A;  4G0K A;  4IQA A;  5J9B A;  2IMI A;  3UVT A;  4NMU A;  1ZYQ B;  1XOB A;  3GH9 A;  1YEP A;  5LCZ A;  2GZY A;  2HZE B;  2GLR A;  4IN0 A;  2X64 A;  3PGT A;  3IRA A;  3HJP A;  2WCI A;  11GS A;  2RUE A;  2IWT A;  3P2A A;  4EF0 A;  1PGT A;  4K9Z A;  2F8F A;  4I8B A;  1GRX A;  2RM5 A;  3KCM A;  3DGQ A;  1Z7P A;  2FD3 A;  4EVM A;  2GTU A;  2JL4 A;  1UVZ A;  2XPD A;  5ELG A;  2HFD A;  3I9V 2;  4HJ2 A;  5IM9 A;  3GTU A;  2C3N A;  3M1G A;  3ED3 A;  2H30 A;  3QCP A;  5CNW A;  2EIR A;  3I43 A;  4KAE A;  2CV4 A;  3EE2 A;  2VCX A;  2LKU A;  2KP2 A;  2VCW A;  2C3Q A;  2C0G A;  4LA1 A;  5AN1 A;  1UA5 A;  4NV5 A;  4O7H A;  1O6J A;  3ZIV A;  3IE3 A;  2YZH A;  2CAQ A;  4HQS A;  4ZBD A;  1EGO A;  4MP4 A;  3GH6 A;  4F2I A;  4OD7 A;  3L9V A;  1XWG A;  3TOT A;  5JWO B;  1GSS A;  4MA9 A;  2HRK A;  2UZ8 A;  2O8V B;  1I9D A;  1B4P A;  1EGR A;  4LL1 B;  1MD4 A;  2GQK A;  1BED A;  4PUR A;  2LRC A;  3U5R E;  4POB A;  5AIS A;  4J2F A;  1EP7 A;  2FWF A;  2LUS A;  1R26 A;  4TXO B;  3VWW A;  1SL1 B;  3G7J A;  4BL7 B;  5J3R A;  2C0F A;  1FHE A;  1EV4 A;  2L4C A;  2ZCT A;  5JCU A;  3GUR A;  4NV2 A;  4JR6 A;  2VLU A;  3TKS C;  3TKQ A;  3UJ1 A;  1NW2 A;  3GYK A;  4GQF A;  2LQQ A;  4HU9 A;  1V98 A;  3FYG A;  2C1Y A;  2J9H A;  4QL9 A;  4K1F A;  5J41 A;  2AUV A;  2C0E A;  4EUY A;  2DJ1 A;  3IHQ A;  1GUL A;  4G10 A;  3D5J A;  1GTA A;  4DVC A;  2RII A;  3EUR A;  5AIV A;  1ZL9 A;  6GSY A;  3BJ5 A;  1T3B A;  4K7N A;  3ZTL A;  1HD2 A;  3IR4 A;  3HHV A;  3C1R A;  4ZL9 A;  4O92 A;  2LQO A;  5EVO A;  2B1K A;  4ML6 A;  1A2J A;  2IIY A;  1SJI A;  5FHI A;  3F4T A;  5F8B A;  2P5Q A;  4AF2 A;  2VD0 A;  4V1A g;  4ECC A;  1M2D A;  1QK8 A;  5D96 A;  3TJF A;  2DJK A;  3FZA A;  1YF0 A;  5ECL B;  4KGI A;  4OMV A;  2YCD A;  1ERU A;  2DC5 A;  1F37 A;  4RQX A;  4FH8 A;  4ZB9 A;  2PPT A;  3M9J A;  12GS A;  2FWG A;  3PH9 A;  3GSS A;  2V6O A;  3WD6 A;  5CRG A;  4KCA A;  3Q18 A;  1GSD A;  3GV1 A;  1AIU A;  1OE8 A;  3NOF A;  3OR5 A;  3LG6 A;  4TR1 A;  1M9B A;  5C04 A;  4XRA A;  3UBK A;  1URM A;  2HNL A;  1ZMA A;  2KOK A;  4G0L A;  1RW1 A;  3W8S A;  3CYN A;  2JZS A;  4YQV A;  4D73 A;  2B1L A;  1MDK A;  3BCI A;  2I81 A;  2B7K A;  2QSI A;  3FZ4 A;  2OA7 A;  2K8V A;  2AB6 A;  2PMT A;  3R2Q A;  2GSS A;  4KB3 A;  1FOV A;  4L5O A;  4EDY A;  1Z5Y E;  2HRF A;  2N5F A;  2AV4 A;  5ECS A;  2C0D A;  5DVB A;  1SK2 A;  4OO5 A;  3EU4 A;  4POK A;  4K8M A;  3LSZ A;  4PNG A;  1JZR A;  5D9X A;  1JZO A;  5DJL A;  3F8U A;  4OWY A;  3H8Q A;  2E2M A;  2EIQ A;  4EDZ A;  1H75 A;  4F0B A;  5FT3 A;  4WR4 A;  5J9C A;  1MTC A;  2OAC A;  2YAN A;  1X5E A;  2H1D A;  4JBB A;  5DAK B;  2HT9 A;  3PIN A;  2BJX A;  2PU9 C;  1GLQ A;  1Y6E A;  3RDW A;  2RLI A;  4QL7 A;  4P3Y B;  4FYB A;  3QAG A;  2HI7 A;  2C4J A;  2H8L A;  1X5D A;  1V9W A;  2VLV A;  1B8X A;  3M9K A;  3GX0 A;  1VF4 A;  3RBT A;  5ELA A;  5IPH A;  5EL8 A;  4HDE A;  3KH9 A;  1JFU A;  3RPN A;  5ENU A;  3D0Z A;  3MWH A;  4JZQ A;  3A3T A;  3GKN A;  4V1A p;  1SEN A;  5AGY A;  1A23 A;  4IJI A;  1HYU A;  3FZ9 A;  4N11 A;  4WXT A;  3CXG A;  4MPF A;  3IAS 2;  3EU3 A;  3GKX A;  3ME7 A;  2DBC A;  1NHY A;  4IKH A;  3FEU A;  2FNO A;  4PXO A;  3EWL A;  1QMV A;  3MNG A;  4RI7 A;  3ZMK A;  3SBC A;  2ZUP A;  3S9F A;  2XHF A;  4F0C A;  4X43 A;  3TOU A;  3TJJ A;  2CZ3 A;  1GLP A;  2V6K A;  3LQ7 A;  3CSI A;  2YJ7 A;  2OJL A;  3L78 A;  4LMV A;  1V40 A;  1JZD A;  2FWH A;  5ID2 B;  4OFT A;  1K0A A;  4Q5F A;  1XOA A;  4TXO A;  1MDJ A;  3L0H A;  4BL7 A;  1G7E A;  2LJK A;  1N2A A;  1XW5 A;  4DSS B;  1AQX A;  1VRS D;  4GCI A;  4G19 A;  2MZC A;  4OCF A;  3O6T A;  2WB9 A;  3DVW A;  3DYR A;  4ID0 A;  4FO5 A;  4WKW A;  4HQZ A;  4NXI A;  3D4T A;  1IYI A;  1AUC A;  4BA7 A;  4ZBB A;  5ECQ B;  2PN8 A;  2E7P A;  1K0N A;  2QC7 A;  3RHB A;  1O85 A;  5A5K A;  3G9B A;  3DWV A;  4POL A;  1EEM A;  4IP6 A;  4WBJ A;  1JLW A;  1BJX A;  4KSM A;  4XS1 A;  1TW9 A;  4EKZ A;  4WET A;  3WT1 A;  2GS3 A;  3F3Q A;  3F4R A;  2YN1 A;  2X8G A;  4ACS A;  2M80 A;  2R37 A;  4X1U A;  3EVI A;  4PX1 A;  3VUR A;  5D73 A;  5ECR B;  1MD3 A;  4IEL A;  2CA8 A;  1XBS A;  3H1N A;  1DSB A;  3TJB A;  4GSN A;  4MPG A;  2E0Q A;  1SK1 A;  3GNJ A;  2PGT A;  4GLT A;  1XW9 A;  2X8H A;  1ZCP A;  1QQ2 A;  3TDG A;  4MZW A;  1CQG A;  5F07 A;  1PSQ A;  4MLY A;  5IMV A;  3AY8 A;  5ECP B;  4IJ3 A;  2IJY A;  1R5P A;  4TXV A;  1Q4J A;  3GMF A;  3ISO A;  2IFQ A;  2LTK A;  4KUN A;  4KDY A;  4PQI A;  2HZF A;  1PKW A;  4N0Z A;  4MZC A;  3O76 A;  2HSY A;  3VI5 A;  1GSE A;  2B7J A;  1ON4 A;  3LEF A;  1T7P B;  2DML A;  2A2S A;  5CAX A;  2FCH A;  2N5B A;  1YEX A;  4DSQ A;  4G0I A;  4TW5 A;  1XCC A;  3HD5 A;  2EC4 A;  3FR3 A;  2JZR A;  4EXJ A;  5IMZ A;  1C72 A;  5F0G A;  2P5R A;  1FB0 A;  4ECI A;  2IMK A;  1WE0 A;  2JZT A;  2L6C A;  3ZFB A;  2R6K A;  1TK5 B;  1Z9H A;  3QPM A;  4XTS A;  3CSJ A;  5COH A;  3LXT A;  4O32 A;  3APO A;  2J23 A;  2G0F A;  3ERG A;  2OE3 A;  1TU7 A;  1E6B A;  2MMO A;  5DAK A;  2OKA A;  3D22 A;  2L5O A;  4XS4 B;  1WJK A;  3ZL5 A;  3L4N A;  4MH3 A;  3G7I A;  4PNF A;  2GST A;  2N5A A;  5AIX A;  4OO4 A;  1S3D A;  3D21 A;  4MF5 A;  1AW9 A;  3WT2 A;  1WPI A;  4GXZ A;  4EL1 A;  5ECK B;  5GZZ B;  2B5E A;  1YJ6 A;  1SYX A;  4K6X A;  5JWQ B;  3GFK A;  3TRP A;  7GSS A;  4N10 A;  1B9Y C;  3F9U A;  4XHM A;  3GN3 A;  2GQM A;  4ZBA A;  4DSR A;  4GTU A;  4KDX A;  1I5G A;  1SKR B;  5DJM A;  5HR0 A;  1MDI A;  3VLN A;  5CRW A;  1X9M B;  1T1V A;  4RQR A;  1OAZ A;  1OE7 A;  3UBL A;  2VAF A;  4MH2 A;  1J0F A;  2LNT A;  1AC1 A;  5B8B A;  4G2E A;  4GST A;  2H0I A;  1OC3 A;  4IW9 A;  2L57 A;  1PL2 A;  5IMD A;  2DIY A;  2GSR A;  3D6I A;  2VCT A;  4PQH A;  4FIW A;  5ID2 A;  4BVX A;  2Z9S A;  2F3M A;  2YZU A;  2HLS A;  3EIN A;  6GSX A;  1PRX A;  3DKS A;  5KEJ A;  3EMX A;  3F6F A;  2V41 A;  3ZVJ A;  3A2W A;  4DSS A;  1SD8 A;  3VPT A;  3LOR A;  4FYC A;  1GUM A;  1AXD A;  2WDU A;  1VF3 A;  4QQ7 A;  3BD2 A;  4TR4 A;  3LWA A;  4HS1 A;  3TRQ A;  5IMC A;  3FR9 A;  4ZB8 A;  5LNK e;  2MYG A;  4HI7 A;  4K7I A;  3JCM L;  1FO5 A;  4WEY A;  1XWA A;  2C8U A;  4DEJ A;  3QFB C;  1K0M A;  1HNB A;  1TRW A;  1M7T A;  2H76 A;  1O7U A;  4ZXG A;  4CHS A;  2H1A A;  2YWO A;  3GKK A;  4J56 E;  1U87 A;  1ERT A;  1O81 A;  2VL9 A;  5DCH A;  1GUH A;  3F3R A;  3BBY A;  1YKC A;  2AHE A;  1WP0 A;  4Q5Q A;  1IYH A;  2WRT A;  1V2A A;  2ON5 A;  4YQM A;  5IMF A;  3TKR A;  4LLR A;  3V1W A;  2CVB A;  3KTB A;  3UAP A;  3BOA A;  5A4U A;  4XS6 A;  2DIZ A;  2LST A;  3GRX A;  3VFI A;  1XW6 A;  2TIR A;  3HZ8 A;  3APQ A;  1SU9 A;  3QMX A;  1YF1 A;  2FLS A;  1T00 A;  1GH2 A;  5E59 A;  2B5Y A;  4ECJ A;  20GS A;  3QOU A;  2H6X A;  3L9U A;  1RK4 A;  3I69 A;  2CT6 A;  2JSZ A;  5JWR B;  3FR6 A;  3QR6 A;  3GST A;  1OC9 B;  3VK9 A;  3KTL A;  3VPQ A;  5A4W A;  1TOF A;  5DAL B;  1GWC A;  4PTS A;  4KE3 A;  4N0V A;  1K0D A;  1FB6 A;  5D8I A;  2LS5 A;  2AAW A;  4HOJ A;  5ECH B;  3EMP A;  2GDR A;  5BMU A;  4FYU A;  3Q6O A;  4PUA A;  3M0F A;  1YKA A;  4XIH A;  1SJZ A;  3J7Y k;  4ULX A;  2VLT A;  1G7O A;  3LXZ A;  4JU5 A;  1GTB A;  4TOP A;  2F9S A;  4BPY A;  2LEG A;  2HZE A;  3WGD A;  1TDI A;  1FG4 A;  4TRX A;  1WIK A;  1R4W A;  5ABR A;  2C80 A;  2B3S A;  6GSS A;  1OYJ A;  1THX A;  3BCK A;  2DJ2 A;  2CQ9 A;  3HDC A;  3HY2 A;  4XS4 A;  4MMM A;  1DBY A;  5B6M A;  5DQS A;  1YQ1 A;  3TGZ A;  1M0U A;  2MBT A;  3TUE A;  1K3O A;  2HYX A;  5JCG A;  2I9H A;  5G1K A;  1XVW A;  3GTU B;  1K0B A;  3UAR A;  5DDL A;  2FWE A;  1FVJ A;  5D9W A;  3LJR A;  1CQH A;  1F3B A;  1LBK A;  3UIW A;  5GST A;  2R4V A;  4KW6 A;  1F2E A;  2GT5 A;  2VOC A;  1BX9 A;  2PVO C;  3GL3 A;  2KP1 A;  3GHA A;  5ECI B;  3VWX A;  3PPU A;  2RUF A;  1TXX A;  4CDO A;  2GZZ A;  5DCG A;  2FA4 A;  4L0W A;  2VUP A;  4WF5 A;  4K0G A;  2YOI A;  3HKR A;  1ERW A;  2NBS A;  1EEJ A;  1GUK A;  1Q98 A;  1HNA A;  3DEX A;  2VL2 C;  5KN3 A;  3HXS A;  1K0C A;  4L8E A;  1ST9 A;  2YV9 A;  2VCZ A;  1QGV A;  3QFA C;  1YZX A;  2I3Y A;  3KP8 A;  3F63 A;  3N9J A;  2LRT A;  1ERV A;  3F6D A;  5J4U A;  2PWJ A;  1VF2 A;  5H5R A;  2H19 A;  2VL2 A;  1TI3 A;  5FWG A;  5LD0 A;  2H0H A;  1OKT A;  4BVY B;  3IK7 A;  1N8J A;  4KND A;  3GL5 A;  1B48 A;  1NM3 A;  5B7C A;  2X8C A;  4I6X A;  1JLV A;  1PKZ A;  3FY7 A;  3LYP A;  1ZGN A;  1PD2 1;  4ZL8 A;  3M3M A;  2AJQ B;  1DE2 A;  2MBS A;  2V2G A;  1S3C A;  2GQL A;  5HQP A;  4IS0 A;  1YDK A;  1ZZY A;  1XWK A;  3IDV A;  4ZIJ A;  2DJ0 A;  3H93 A;  4LL4 B;  5D9V A;  2CX4 A;  1GTI A;  1SD9 A;  3E9J B;  1X0R A;  1PA3 A;  3TJK A;  1HNC A;  1VGL A;  1PQN A;  5ECO B;  2OE0 A;  2K8S A;  4Q5N A;  1BQ7 A;  4XCS A;  3ZRE A;  3L9S A;  5IPG A;  2IL3 A;  1QUW A;  2CVK A;  2B5X A;  4POM A;  1ZOF A;  4ECB A;  1K3Y A;  3GKM A;  5L71 A;  1B4Q A;  5HR2 A;  2YJH A;  4F03 A;  4V2M A;  4WR5 A;  2REM A;  3IC4 A;  4IQ1 A;  2YWI A;  2ES7 A;  4X0X A;  4KCE A;  4IGJ A;  2IMD A;  2PUK C;  1R5A A;  1BAY A;  3WGE A;  3NIV A;  1GSF A;  1SYR A;  5G2Z A;  3GA4 A;  2R3X A;  1TRU A;  10GS A;  2LNS A;  4GQC A;  3HZ4 A;  3W6G A;  4GF0 A;  4V2N A;  3TB2 A;  3FHK A;  3KH7 A;  4JR4 A;  3KJY A;  5HR1 A;  1TKD B;  2OBI A;  1SJ6 A;  3P90 A;  4MDC A;  1GSQ A;  3DD3 A;  3ME8 A;  2KUC A;  4EE0 A;  1GP1 A;  1NHO A;  3SWL A;  1JZW A;  2JAC A;  2IME A;  4ZL7 A;  5DAL A;  5IO0 A;  16GS A;  4Q5R A;  2K9F A;  3F4S A;  1ZYE A;  3IBH A;  3HJM A;  2HE3 A;  4MK3 A;  5G5F A;  2JU5 A;  2WZ9 A;  2CVD A;  4BWQ A;  2YWN A;  5CRH A;  2YV7 A;  1EP8 A;  4EC0 A;  22GS A;  2H1G A;  4TR3 A;  1ML6 A;  2V1M A;  5CP1 A;  3QD9 A;  6GSV A;  3IXR A;  2ZNM A;  1PN9 A;  2BTO T;  4AJ8 A;  1BG5 A;  4AJ6 A;  2WGR A;  1M2A A;  3UEM A;  4GRF A;  1Z6N A;  2GGT A;  2GT6 A;  4MJB A;  2MMA A;  4BWS A;  1XIY A;  1THO A;  2AYT A;  2TRC P;  2GZP A;  4MCU A;  3HJO A;  3VWU A;  4KF9 A;  5GSS A;  3C1S A;  5CO3 A;  2VM2 A;  2QGV A;  3HVS A;  3E0U A;  1KBN A;  2FA8 A;  4V2L A;  5GAP D;  4YQU A;  4ZB6 A;  1ILO A;  4IP1 A;  1S3A A;  2H6Z A;  3HVV A;  5KN2 A;  1J9B A;  1HQO A;  4L0U A;  1YY7 A;  4NAX A;  2HSH A;  2V32 A;  4MAB A;  3IA1 A;  3RHC A;  3ZLP A;  4KX4 A;  1O8X A;  3FK8 A;  4XRD A;  1USB A;  3RAZ A;  2WUL A;  3APS A;  2LV3 A;  2BMX A;  2YP6 A;  4H86 A;  2LJR A;  3ZVJ D;  5C00 A;  1GSY A;  4E8H A;  3FZ5 A;  3H79 A;  3IV4 A;  5H5S A;  3DVX A;  2M46 A;  3TKP A;  3ZYW A;  2IMF A;  2PER A;  3DIE A;  5F06 A;  3Q19 A;  4MJE A;  2IPA A;  1W89 A;  2L6D A;  5IIZ A;  2HSM B;  14GS A;  2CZ2 A;  3LFL A;  1H4O A;  3GIX A;  1TRS A;  3UL3 A;  2HXK A;  1FAA A;  1ABA A;  3MSZ A;  4HUA A;  3IK9 A;  6GSW A;  2I4A A;  1T4Y A;  4O5R A;  2FHE A;  4MJA A;  1LU4 A;  2HRN A;  3P7X A;  4BVY A;  4FQU A;  1EOH A;  2O87 A;  4ILF A;  5A4V A;  4L5L A;  3MAK A;  1U3A A;  1U88 A;  4YAP A;  4OFN A;  1A2L A;  2F51 A;  1X9S B;  1WMJ A;  1FVK A;  2NTO A;  3CMI A;  2DJ3 A;  3UMA A;  2H0G A;  3D4M A;  1TI1 A;  3CRU A;  2KLX A;  1XWB A;  5G31 A;  4HJM A;  3TKS A;  5EY6 A;  1T4Z A;  4YH2 A;  1A2M A;  4PUF C;  3ZFL A;  5CYY A;  2B6M A;  3IPZ A;  1NSW A;  4NHZ A;  2TRX A;  5F05 A;  1X9W B;  1OVN A;  1TJD A;  1DUG A;  2WS2 A;  3LYK A;  1A0R P;  4TR0 A;  1TK0 B;  5G30 A;  1KNG A;  5B6N A;  5JCW A;  5ECM B;  2H74 A;  1OC8 A;  3A5W A;  4NPB A;  3KZQ A;  5CRD A;  2ON7 A;  1XVQ A;  3HVX A;  1GTU A;  1EWX A;  18GS A;  1JHB A;  1A8L A;  1WRY A;  2VIM A;  3NZN A;  1K3L A;  2XC2 A;  3CBU A;  2GVP A;  3KGK A;  2CAI A;  4IVF A;  1J08 A;  4E8E A;  2VCV A;  3IC8 A;  4KA0 A;  2JAD A;  1PMT A;  4MF7 A;  1R7H A;  4N30 A;  2VD1 A;  2C3T A;  3KD0 A;  1M99 A;  2L5L A;  3IAM 2;  1A24 A;  1BYE A;  2DLX A;  2IFQ B;  13GS A;  2RM6 A;  2D2Z A;  3C8E A;  1U3I A;  4TN8 A;  1PL1 A;  2WFC A;  4ZIL A;  1F6M C;  4KH7 A;  3EYT A;  5EPF A;  3US3 A;  17GS A;  1G0T A;  3ZZX A;  1T8E B;  4IHU A;  1XXU A;  3N5O A;  3TRX A;  2O89 A;  1KTE A;  2HRA A;  1EZK A;  4RI6 A;  4Z7X A;  1B9X C;  2JSY A;  1AQW A;  3KEB A;  2HSN B;  5G5E A;  1M9A A;  3J7Y b;  5HFI A;  1TK8 B;  3C71 A;  4WF4 A;  2NVL A;  3CRT A;  1LJR A;  4TVE A;  4I2T A;  2P0G A;  3RPP A;  3QAV A;  1V58 A;  1WWJ A;  4NHW A;  3F0I A;  2VM1 A;  3HCZ A;  1GNE A;  1A8Y A;  3ERF A;  1KEB A;  2R5G A;  3P8W A;  2VL3 A;  1O73 A;  4NWY A;  4K2D A;  1FW1 A;  3M8N A;  3KMO A;  3U6V A;  1UC7 A;  4IBP A;  2YWM A;  2E2G A;  1E2Y A;  3VI7 A;  3UVH A; 
#chains in the Genus database with same CATH topology
 2VCQ A;  4ISD A;  1X5C A;  2A2P A;  4ML1 A;  5HFG A;  4F9Z A;  2LJA A;  3TJG A;  3A2V A;  4HZ2 A;  2H72 A;  2O7K A;  2DSA A;  3KM6 A;  4CW9 A;  3DML A;  4J57 E;  1Z3E A;  3FKF A;  2XBI A;  1SKS B;  2WJU A;  2XPE A;  3WGX A;  3A2X A;  1V57 A;  2L59 A;  3UOM A;  9GSS A;  3FW2 A;  5A5H A;  4PHZ C;  1UN2 A;  3GX8 A;  1XPV A;  2H70 A;  2EIO A;  4MF6 A;  3HA9 A;  5D93 A;  3KXO A;  1TRV A;  3CTF A;  2HRK B;  1U6T A;  3VWV A;  3EC3 A;  4A5P A;  1G6Y A;  2R2J A;  5IQY A;  4FXY P;  2DMM A;  5IOX A;  3C7M A;  4KDU A;  3WYW A;  5HR3 A;  5J5N A;  3CTG A;  3PR8 A;  1A0F A;  2A2R A;  3LGC A;  5B8A A;  3G7Y A;  5J40 A;  1MEK A;  4AJ7 A;  2H75 A;  1TTZ A;  1SKW B;  3DXB A;  2FGX A;  3ZIT A;  1Z6M A;  2HSM A;  2M72 A;  5ECN B;  2CX3 A;  2KHP A;  4I2U A;  1TU8 A;  2XBQ A;  1DE1 A;  6GSU A;  4BVX B;  4JE1 A;  2FUG 2;  2MMN A;  1F9M A;  2A4V A;  2H73 A;  1PX7 A;  5INY A;  3ZIJ A;  2OBK A;  4K7O A;  1GNW A;  2VO4 A;  2OAD A;  3ERW A;  3C73 A;  5CRE A;  2NDO A;  1SK0 A;  2I1U A;  2ALB A;  1Z7R A;  1XFL A;  1YEW C;  4I97 A;  3QAW A;  2K18 A;  5D9T A;  3KIJ A;  1K0O A;  5DBQ A;  3TKS E;  2FY6 A;  5IMA A;  3TCO A;  2X4A A;  5H5Q A;  3CHX C;  4HU7 A;  1OKD A;  1Y25 A;  4OCE A;  1QXH A;  4JRR A;  5A1N B;  4OFM A;  3KMN A;  5G1L A;  4ZB7 A;  5DQY A;  3I6A A;  2H6Y A;  2OE1 A;  2PVQ A;  2MMZ A;  1RQM A;  3H4K A;  1GSU A;  1O8W A;  2LRN A;  2IN3 A;  2H71 A;  2GSQ A;  4GWR A;  4K0N A;  4AGS A;  2DJJ A;  3FRC A;  4GSS A;  4TKY A;  5KN0 A;  2L4Q A;  5IO2 A;  3KP9 A;  4HEA 2;  1EV9 A;  4LMW A;  4YAV A;  1GL8 A;  1W4V A;  4WBR D;  3ZRD A;  3ZML A;  2O85 A;  3E3E A;  2YPM A;  1EOG A;  1PX6 A;  4I5Q A;  1SL2 B;  4EO3 A;  1VF1 A;  5E4W A;  1G6W A;  6GST A;  2H1B A;  1F3A A;  1AAZ A;  4F82 A;  3R3E A;  19GS A;  2K6V A;  4TR1 B;  4K5R A;  1XWC A;  4MZB A;  1M2B A;  1TP9 A;  3O3T A;  2NPB A;  5IOW A;  4O5Q A;  4N3Z A;  4RUV A;  3CSH A;  4D73 B;  3W8J A;  4GDF A;  1BF5 A;  8GSS A;  4USS A;  2PBJ A;  2P31 A;  1XZO A;  2H66 A;  1OC9 A;  2H01 A;  4G9H A;  1SL0 B;  2WW1 A;  1WOU A;  5HFK A;  4PQ1 A;  2HQT A;  3DRN A;  2QKE A;  4KSO A;  3IOS A;  2YNX A;  5GAN D;  1ACV A;  4JED A;  1QFN A;  3K8N A;  3HYP A;  4MJC A;  5BMU B;  4PGT A;  2G2Q A;  3GUS A;  3MDK A;  4HZ4 A;  3QDN A;  5KN1 A;  1AQV A;  2X99 A;  2F8A A;  3Q74 A;  4G0K A;  4IQA A;  5J9B A;  2IMI A;  3UVT A;  4NMU A;  1ZYQ B;  1XOB A;  3GH9 A;  1YEP A;  5LCZ A;  2GZY A;  2HZE B;  2GLR A;  4IN0 A;  2DKI A;  2X64 A;  3PGT A;  3IRA A;  3HJP A;  2WCI A;  11GS A;  2RUE A;  2IWT A;  3P2A A;  4EF0 A;  1PGT A;  4K9Z A;  2F8F A;  4I8B A;  2EFD A;  1GRX A;  2RM5 A;  3KCM A;  3DGQ A;  1Z7P A;  2FD3 A;  4EVM A;  2GTU A;  2JL4 A;  1UVZ A;  2XPD A;  5ELG A;  2HFD A;  3I9V 2;  4HJ2 A;  5IM9 A;  3GTU A;  2WVZ A;  2C3N A;  3M1G A;  3ED3 A;  2H30 A;  3QCP A;  3A5I A;  5CNW A;  4AKG A;  2EIR A;  3I43 A;  2H1L A;  4KAE A;  2CV4 A;  3EE2 A;  2VCX A;  2LKU A;  2KP2 A;  2VCW A;  2C3Q A;  2C0G A;  4LA1 A;  5AN1 A;  1UA5 A;  4NV5 A;  4O7H A;  1O6J A;  3ZIV A;  3IE3 A;  2YZH A;  2CAQ A;  4HQS A;  4ZBD A;  1EGO A;  4MP4 A;  3GH6 A;  4F2I A;  4OD7 A;  3L9V A;  1XWG A;  3TOT A;  5JWO B;  3MYD A;  1GSS A;  2WZS A;  4MA9 A;  2HRK A;  2UZ8 A;  2O8V B;  1I9D A;  1B4P A;  1EGR A;  4LL1 B;  1MD4 A;  2GQK A;  1BED A;  4PUR A;  2LRC A;  3U5R E;  4POB A;  5AIS A;  4J2F A;  1EP7 A;  2FWF A;  2LUS A;  1R26 A;  4TXO B;  3VWW A;  1SL1 B;  3G7J A;  4BL7 B;  5J3R A;  2C0F A;  1FHE A;  1EV4 A;  2L4C A;  2ZCT A;  5JCU A;  3GUR A;  4NV2 A;  4JR6 A;  2VLU A;  3RGB C;  3TKS C;  3TKQ A;  3UJ1 A;  1NW2 A;  3GYK A;  4GQF A;  2LQQ A;  5A34 B;  4HU9 A;  1V98 A;  3FYG A;  2C1Y A;  2J9H A;  4QL9 A;  4K1F A;  5J41 A;  2AUV A;  2C0E A;  4EUY A;  2DJ1 A;  3IHQ A;  1GUL A;  4G10 A;  3D5J A;  1GTA A;  4DVC A;  2RII A;  3EUR A;  5AIV A;  1ZL9 A;  6GSY A;  3BJ5 A;  1T3B A;  4K7N A;  3ZTL A;  1HD2 A;  3IR4 A;  5A1N A;  3HHV A;  3C1R A;  4ZL9 A;  4O92 A;  2LQO A;  5EVO A;  2B1K A;  2WW0 A;  4ML6 A;  1A2J A;  2IIY A;  1SJI A;  5FHI A;  3F4T A;  5F8B A;  2P5Q A;  4AF2 A;  2VD0 A;  4V1A g;  4ECC A;  1M2D A;  1QK8 A;  5D96 A;  3TJF A;  2DJK A;  3FZA A;  1SVO A;  1YF0 A;  5ECL B;  4KGI A;  4OMV A;  2YCD A;  1ERU A;  2DC5 A;  1F37 A;  4RQX A;  4FH8 A;  4ZB9 A;  2PPT A;  3M9J A;  12GS A;  2FWG A;  2R0G A;  3PH9 A;  3GSS A;  2V6O A;  3WD6 A;  5CRG A;  4KCA A;  3Q18 A;  1GSD A;  3GV1 A;  2EFC A;  1AIU A;  1OE8 A;  3NOF A;  3OR5 A;  3LG6 A;  4TR1 A;  1YVL A;  1M9B A;  5C04 A;  4XRA A;  3UBK A;  1URM A;  2HNL A;  1ZMA A;  2KOK A;  4G0L A;  1RW1 A;  3W8S A;  3CYN A;  2JZS A;  4YQV A;  4D73 A;  2B1L A;  1MDK A;  3BCI A;  2I81 A;  2B7K A;  2QSI A;  3FZ4 A;  2OA7 A;  2X49 A;  2K8V A;  2AB6 A;  2PMT A;  3R2Q A;  2GSS A;  4KB3 A;  1FOV A;  4L5O A;  4EDY A;  1Z5Y E;  2HRF A;  2N5F A;  2AV4 A;  5ECS A;  2R0C A;  2C0D A;  5DVB A;  1SK2 A;  4OO5 A;  3EU4 A;  4POK A;  4K8M A;  3LSZ A;  4PNG A;  1JZR A;  4PI2 C;  5D9X A;  1JZO A;  5DJL A;  3F8U A;  4OWY A;  3H8Q A;  2E2M A;  2EIQ A;  4EDZ A;  1H75 A;  4F0B A;  5FT3 A;  4WR4 A;  5J9C A;  1MTC A;  2OAC A;  2YAN A;  1X5E A;  2H1D A;  3HVN A;  4JBB A;  5DAK B;  2HT9 A;  3PIN A;  2BJX A;  2PU9 C;  1GLQ A;  1Y6E A;  3RDW A;  2RLI A;  4QL7 A;  4P3Y B;  4FYB A;  3QAG A;  2HI7 A;  2C4J A;  2H8L A;  1X5D A;  4YKF A;  1V9W A;  2VLV A;  1B8X A;  3M9K A;  3GX0 A;  1VF4 A;  3RBT A;  5ELA A;  5IPH A;  5EL8 A;  1XG8 A;  4HDE A;  3KH9 A;  1JFU A;  3RPN A;  5ENU A;  3D0Z A;  3MWH A;  4JZQ A;  3A3T A;  3GKN A;  4V1A p;  1SEN A;  5AGY A;  1A23 A;  4IJI A;  1HYU A;  3FZ9 A;  4N11 A;  4WXT A;  3CXG A;  4MPF A;  3IAS 2;  3EU3 A;  3GKX A;  4CY8 A;  3ME7 A;  2DBC A;  1NHY A;  4IKH A;  3FEU A;  2FNO A;  4PXO A;  3EWL A;  2O3E A;  1QMV A;  3MNG A;  4QMK A;  4RI7 A;  3ZMK A;  3SBC A;  2ZUP A;  3S9F A;  2XHF A;  4F0C A;  4X43 A;  3TOU A;  3TJJ A;  2CZ3 A;  1GLP A;  2V6K A;  3LQ7 A;  1S3R A;  3CSI A;  2YJ7 A;  2OJL A;  3L78 A;  4LMV A;  1V40 A;  1JZD A;  2FWH A;  3CWG A;  5ID2 B;  4OFT A;  1K0A A;  4Q5F A;  1XOA A;  4TXO A;  1MDJ A;  3L0H A;  4BL7 A;  1G7E A;  2LJK A;  1N2A A;  1XW5 A;  4DSS B;  1AQX A;  1VRS D;  4GCI A;  4G19 A;  2MZC A;  4OCF A;  3O6T A;  2O5V A;  2WB9 A;  3DVW A;  3DYR A;  4ID0 A;  4FO5 A;  4WKW A;  4HQZ A;  4NXI A;  3D4T A;  5A34 A;  1IYI A;  1AUC A;  4BA7 A;  4ZBB A;  5ECQ B;  2PN8 A;  2E7P A;  1K0N A;  2QC7 A;  3RHB A;  1O85 A;  5A5K A;  3G9B A;  3DWV A;  4POL A;  1EEM A;  4IP6 A;  4WBJ A;  1JLW A;  1BJX A;  4KSM A;  4MNN A;  4XS1 A;  1TW9 A;  4EKZ A;  4WET A;  3WT1 A;  2GS3 A;  3F3Q A;  3F4R A;  2YN1 A;  2X8G A;  4ACS A;  2M80 A;  2R37 A;  4X1U A;  3EVI A;  4PX1 A;  3VUR A;  5D73 A;  5ECR B;  1MD3 A;  4IEL A;  2CA8 A;  1XBS A;  3H1N A;  1DSB A;  3TJB A;  4GSN A;  4MPG A;  2E0Q A;  1SK1 A;  3GNJ A;  2PGT A;  4GLT A;  1XW9 A;  2X8H A;  1ZCP A;  1QQ2 A;  3TDG A;  4MZW A;  1CQG A;  5F07 A;  1PSQ A;  4MLY A;  5IMV A;  3AY8 A;  5ECP B;  4IJ3 A;  2IJY A;  4Z2U A;  5J4V A;  1R5P A;  4TXV A;  1Q4J A;  3GMF A;  3ISO A;  2IFQ A;  2LTK A;  4KUN A;  4KDY A;  4PQI A;  2HZF A;  1PKW A;  4N0Z A;  4MZC A;  3O76 A;  2HSY A;  3VI5 A;  1GSE A;  2B7J A;  1ON4 A;  3LEF A;  1T7P B;  2DML A;  2A2S A;  5CAX A;  2FCH A;  2N5B A;  1YEX A;  4DSQ A;  4G0I A;  4TW5 A;  1XCC A;  3HD5 A;  2EC4 A;  2HSN A;  3FR3 A;  2JZR A;  4EXJ A;  5IMZ A;  1C72 A;  5F0G A;  2P5R A;  1FB0 A;  4ECI A;  2IMK A;  1WE0 A;  2JZT A;  2L6C A;  3ZFB A;  2R6K A;  1TK5 B;  1Z9H A;  3QPM A;  4XTS A;  3CSJ A;  5COH A;  3LXT A;  4O32 A;  3APO A;  2J23 A;  2G0F A;  3ERG A;  2OE3 A;  1TU7 A;  1E6B A;  2MMO A;  5DAK A;  2OKA A;  3D22 A;  2L5O A;  4XS4 B;  1WJK A;  3ZL5 A;  3L4N A;  4MH3 A;  3G7I A;  4PNF A;  2GST A;  2VKZ G;  2WVX B;  2N5A A;  5AIX A;  4OO4 A;  1S3D A;  3D21 A;  4HSC X;  4MF5 A;  1AW9 A;  3WT2 A;  1WPI A;  4GXZ A;  4EL1 A;  5ECK B;  5GZZ B;  2B5E A;  1YJ6 A;  2A4H A;  1SYX A;  4O5U A;  4K6X A;  5JWQ B;  3GFK A;  3TRP A;  7GSS A;  4N10 A;  1B9Y C;  3F9U A;  5A5H B;  4XHM A;  3GN3 A;  2GQM A;  4ZBA A;  4DSR A;  4GTU A;  4KDX A;  1I5G A;  1SKR B;  5DJM A;  5HR0 A;  1MDI A;  3VLN A;  1FOH A;  5CRW A;  1X9M B;  1T1V A;  4RQR A;  1OAZ A;  1OE7 A;  3UBL A;  2VAF A;  4MH2 A;  1J0F A;  2LNT A;  1AC1 A;  5B8B A;  1PN0 A;  4G2E A;  4GST A;  2H0I A;  1OC3 A;  4IW9 A;  2L57 A;  1PL2 A;  5IMD A;  2DIY A;  2GSR A;  3D6I A;  2VCT A;  4PQH A;  4FIW A;  5ID2 A;  4BVX A;  2Z9S A;  2F3M A;  2YZU A;  2HLS A;  3EIN A;  6GSX A;  1PRX A;  3DKS A;  5KEJ A;  3EMX A;  3F6F A;  2V41 A;  3ZVJ A;  3A2W A;  4DSS A;  1SD8 A;  3VPT A;  3LOR A;  4FYC A;  1GUM A;  1AXD A;  2WDU A;  5BRT A;  1VF3 A;  4QQ7 A;  3BD2 A;  4TR4 A;  3LWA A;  4HS1 A;  3TRQ A;  5IMC A;  3FR9 A;  4ZB8 A;  5LNK e;  2MYG A;  4HI7 A;  4K7I A;  3JCM L;  1FO5 A;  4AKI A;  4WEY A;  1XWA A;  2C8U A;  4DEJ A;  3QFB C;  1K0M A;  1HNB A;  1SVM A;  1TRW A;  1M7T A;  2H76 A;  1O7U A;  4ZXG A;  4CHS A;  2H1A A;  2YWO A;  3GKK A;  4J56 E;  1U87 A;  1ERT A;  1O81 A;  2VL9 A;  5DCH A;  1GUH A;  3F3R A;  3BBY A;  1YKC A;  2AHE A;  1WP0 A;  4Q5Q A;  1IYH A;  2WRT A;  1V2A A;  2ON5 A;  4YQM A;  5IMF A;  3TKR A;  4LLR A;  3V1W A;  2CVB A;  3FMW A;  3KTB A;  3UAP A;  3BOA A;  5A4U A;  4XS6 A;  2DIZ A;  2LST A;  3GRX A;  4ICY A;  3VFI A;  1XW6 A;  4BIK A;  2TIR A;  1TXU A;  3HZ8 A;  3APQ A;  1SU9 A;  3QMX A;  1YF1 A;  2FLS A;  4W66 A;  1T00 A;  1GH2 A;  5E59 A;  2B5Y A;  4ECJ A;  20GS A;  3QOU A;  2H6X A;  3L9U A;  1RK4 A;  3I69 A;  2CT6 A;  2JSZ A;  5JWR B;  3FR6 A;  3QR6 A;  3GST A;  1OC9 B;  3VK9 A;  3IHG A;  4E68 A;  3KTL A;  3VPQ A;  5A4W A;  1TOF A;  5DAL B;  1GWC A;  1Y1U A;  4PTS A;  4KE3 A;  4N0V A;  1K0D A;  1FB6 A;  5D8I A;  2LS5 A;  2AAW A;  4HOJ A;  2WVY A;  5ECH B;  3EMP A;  2GDR A;  5BMU A;  4FYU A;  3Q6O A;  4PUA A;  3M0F A;  1YKA A;  4XIH A;  1SJZ A;  3J7Y k;  4ULX A;  2VLT A;  1G7O A;  3LXZ A;  4JU5 A;  1GTB A;  4TOP A;  2F9S A;  4YKG A;  4BPY A;  4EIP A;  2LEG A;  2HZE A;  3WGD A;  1TDI A;  1FG4 A;  4TRX A;  1WIK A;  1R4W A;  5ABR A;  2C80 A;  2B3S A;  6GSS A;  1I1I P;  1OYJ A;  1THX A;  3BCK A;  2DJ2 A;  2CQ9 A;  3HDC A;  3HY2 A;  4XS4 A;  4MMM A;  1DBY A;  5B6M A;  5DQS A;  1YQ1 A;  3TGZ A;  1M0U A;  2MBT A;  3TUE A;  2EFH A;  1K3O A;  2HYX A;  5JCG A;  2I9H A;  5G1K A;  1XVW A;  3GTU B;  1K0B A;  3UAR A;  5DDL A;  2FWE A;  1FVJ A;  5D9W A;  3LJR A;  1CQH A;  1F3B A;  1LBK A;  3UIW A;  5GST A;  2R4V A;  4KW6 A;  1F2E A;  2GT5 A;  2VOC A;  1BX9 A;  4CY6 A;  2PVO C;  3GL3 A;  2KP1 A;  3GHA A;  5ECI B;  3VWX A;  3PPU A;  2RUF A;  1TXX A;  4CDO A;  2GZZ A;  5DCG A;  2FA4 A;  4L0W A;  2VUP A;  4PI0 C;  4WF5 A;  4K0G A;  2YOI A;  3HKR A;  1ERW A;  2NBS A;  1EEJ A;  4K5S A;  1GUK A;  1Q98 A;  1HNA A;  4EIQ A;  3DEX A;  2VL2 C;  5KN3 A;  3HXS A;  1K0C A;  4L8E A;  5KOW A;  1ST9 A;  2YV9 A;  2VCZ A;  1QGV A;  3QFA C;  1YZX A;  2I3Y A;  3KP8 A;  1M3J A;  3F63 A;  4Z2T A;  3N9J A;  2LRT A;  1ERV A;  3F6D A;  5J4U A;  2PWJ A;  1S4B P;  1VF2 A;  5H5R A;  2H19 A;  2VL2 A;  1TI3 A;  5FWG A;  5LD0 A;  2H0H A;  1OKT A;  4BVY B;  3IK7 A;  1N8J A;  4KND A;  3GL5 A;  3CQF A;  1B48 A;  1NM3 A;  5B7C A;  2X8C A;  4I6X A;  1JLV A;  1PKZ A;  3FY7 A;  3LYP A;  1ZYN A;  1ZGN A;  1PD2 1;  4ZL8 A;  3M3M A;  2AJQ B;  2QA1 A;  1DE2 A;  2MBS A;  2V2G A;  1S3C A;  2GQL A;  5HQP A;  4IS0 A;  1YDK A;  1ZZY A;  1XWK A;  2O36 A;  5J47 A;  3IDV A;  4ZIJ A;  2DJ0 A;  3H93 A;  4LL4 B;  5D9V A;  2CX4 A;  1GTI A;  1SD9 A;  3E9J B;  1X0R A;  1PA3 A;  3TJK A;  1HNC A;  1VGL A;  1PQN A;  5ECO B;  2OE0 A;  2K8S A;  4Q5N A;  1BQ7 A;  4XCS A;  3ZRE A;  3L9S A;  5IPG A;  2IL3 A;  1QUW A;  2CVK A;  2B5X A;  4POM A;  5J4Y A;  1ZOF A;  4ECB A;  1K3Y A;  3GKM A;  5L71 A;  1B4Q A;  5HR2 A;  2YJH A;  4F03 A;  4V2M A;  4WR5 A;  2REM A;  3IC4 A;  4IQ1 A;  2YWI A;  2ES7 A;  4X0X A;  4KCE A;  4IGJ A;  2IMD A;  1BG1 A;  2PUK C;  1R5A A;  1BAY A;  3WGE A;  3NIV A;  1GSF A;  1SYR A;  5G2Z A;  4AKH A;  3GA4 A;  2R3X A;  1TRU A;  10GS A;  2LNS A;  4X4J A;  4GQC A;  3HZ4 A;  3W6G A;  4GF0 A;  4V2N A;  3TB2 A;  3FHK A;  3KH7 A;  4JR4 A;  3KJY A;  5HR1 A;  1TKD B;  2OBI A;  1SJ6 A;  3P90 A;  4MDC A;  1GSQ A;  3DD3 A;  2WW3 A;  3ME8 A;  2KUC A;  4EE0 A;  1GP1 A;  1NHO A;  3SWL A;  1JZW A;  2JAC A;  2IME A;  4ZL7 A;  5DAL A;  5IO0 A;  16GS A;  4Q5R A;  2K9F A;  3F4S A;  1ZYE A;  3IBH A;  3HJM A;  2HE3 A;  4MK3 A;  5G5F A;  2JU5 A;  2WZ9 A;  2CVD A;  4BWQ A;  2YWN A;  5CRH A;  3HMJ G;  2YV7 A;  1EP8 A;  4EC0 A;  22GS A;  2H1G A;  4TR3 A;  1ML6 A;  2V1M A;  5CP1 A;  3QD9 A;  6GSV A;  3IXR A;  2ZNM A;  1PN9 A;  2BTO T;  4AJ8 A;  1BG5 A;  4AJ6 A;  2WGR A;  1M2A A;  3MIX A;  3UEM A;  4GRF A;  1Z6N A;  2GGT A;  2GT6 A;  4MJB A;  2MMA A;  4BWS A;  1XIY A;  1THO A;  2AYT A;  2TRC P;  2GZP A;  4MCU A;  3HJO A;  3VWU A;  4KF9 A;  5GSS A;  3C1S A;  5CO3 A;  2VM2 A;  2QGV A;  3HVS A;  3E0U A;  1KBN A;  2FA8 A;  4V2L A;  5GAP D;  4YQU A;  4ZB6 A;  1ILO A;  4IP1 A;  1S3A A;  2H6Z A;  3HVV A;  5KN2 A;  1J9B A;  3EPT A;  2WW2 A;  1PFO A;  1HQO A;  4L0U A;  1YY7 A;  4NAX A;  2HSH A;  2V32 A;  4MAB A;  3IA1 A;  4Z2R A;  3RHC A;  3ZLP A;  4KX4 A;  2OT3 A;  1O8X A;  3FK8 A;  4XRD A;  1USB A;  3RAZ A;  3LW9 A;  2WUL A;  3APS A;  2LV3 A;  2BMX A;  2YP6 A;  4H86 A;  2LJR A;  3ZVJ D;  5C00 A;  1GSY A;  4E8H A;  1SVL A;  3FZ5 A;  3H79 A;  3IV4 A;  5H5S A;  3DVX A;  2M46 A;  1M3I A;  3TKP A;  3ZYW A;  2IMF A;  2PER A;  3DIE A;  5F06 A;  3Q19 A;  4MJE A;  2IPA A;  1W89 A;  2L6D A;  5IIZ A;  2HSM B;  14GS A;  3TU3 B;  2CZ2 A;  3LFL A;  1H4O A;  3GIX A;  1TRS A;  3UL3 A;  2HXK A;  1FAA A;  1ABA A;  3MSZ A;  4HUA A;  3IK9 A;  6GSW A;  2I4A A;  3RFR C;  1T4Y A;  4O5R A;  2FHE A;  4MJA A;  1LU4 A;  2HRN A;  3P7X A;  4BVY A;  4FQU A;  2EFE A;  1EOH A;  2O87 A;  4ILF A;  5A4V A;  4L5L A;  3MAK A;  1U3A A;  1U88 A;  4YAP A;  4OFN A;  1A2L A;  2F51 A;  1X9S B;  1WMJ A;  4K2X A;  1FVK A;  2NTO A;  3CMI A;  2DJ3 A;  3UMA A;  2H0G A;  3D4M A;  1TI1 A;  3CRU A;  2KLX A;  5KOX A;  1XWB A;  5G31 A;  2DKH A;  4HJM A;  3TKS A;  5EY6 A;  1T4Z A;  4YH2 A;  1A2M A;  4PUF C;  3ZFL A;  5CYY A;  4AKX B;  2B6M A;  3IPZ A;  1NSW A;  4NHZ A;  2QA2 A;  2TRX A;  5F05 A;  1X9W B;  1OVN A;  1TJD A;  1DUG A;  2WS2 A;  3LYK A;  1A0R P;  4TR0 A;  1TK0 B;  5G30 A;  1KNG A;  5B6N A;  5JCW A;  5ECM B;  2H74 A;  1OC8 A;  3A5W A;  4NPB A;  3KZQ A;  5CRD A;  4AI6 A;  2ON7 A;  1XVQ A;  3HVX A;  1GTU A;  1EWX A;  18GS A;  1JHB A;  1A8L A;  1WRY A;  2VIM A;  1K3L A;  3NZN A;  2XC2 A;  3CBU A;  2GVP A;  3KGK A;  2CAI A;  4IVF A;  1J08 A;  4E8E A;  2VCV A;  3IC8 A;  2JAD A;  1ZYP A;  4KA0 A;  1PMT A;  4MF7 A;  1R7H A;  4N30 A;  2VD1 A;  2C3T A;  3KD0 A;  1M99 A;  2L5L A;  3IAM 2;  1A24 A;  1BYE A;  2DLX A;  1N25 A;  2R0P A;  2IFQ B;  13GS A;  2RM6 A;  2D2Z A;  3C8E A;  1U3I A;  4TN8 A;  1PL1 A;  2WFC A;  4ZIL A;  1F6M C;  4G01 A;  4KH7 A;  3EYT A;  5EPF A;  3US3 A;  17GS A;  1G0T A;  3ZZX A;  1T8E B;  2UV8 G;  4IHU A;  1XXU A;  3N5O A;  3TRX A;  2O89 A;  1KTE A;  2HRA A;  1EZK A;  4RI6 A;  4Z7X A;  1B9X C;  2JSY A;  1AQW A;  3KEB A;  2HSN B;  5G5E A;  1M9A A;  3J7Y b;  5HFI A;  1TK8 B;  3C71 A;  4WF4 A;  2NVL A;  3CRT A;  1LJR A;  4TVE A;  4I2T A;  2P0G A;  3RPP A;  3QAV A;  1V58 A;  1WWJ A;  4NHW A;  3F0I A;  2VM1 A;  3HCZ A;  1GNE A;  1A8Y A;  3ERF A;  1KEB A;  2R5G A;  3P8W A;  2VL3 A;  1O73 A;  4NWY A;  4K2D A;  1FW1 A;  3M8N A;  3KMO A;  3U6V A;  1UC7 A;  4IBP A;  2WVX A;  2YWM A;  2E2G A;  1E2Y A;  3VI7 A;  3UVH A; 
#chains in the Genus database with same CATH homology
 2VCQ A;  4ISD A;  1X5C A;  2A2P A;  4ML1 A;  5HFG A;  4F9Z A;  2LJA A;  3TJG A;  3A2V A;  4HZ2 A;  2H72 A;  2O7K A;  2DSA A;  3KM6 A;  4CW9 A;  3DML A;  4J57 E;  1Z3E A;  3FKF A;  2XBI A;  1SKS B;  2WJU A;  2XPE A;  3WGX A;  3A2X A;  1V57 A;  2L59 A;  3UOM A;  9GSS A;  3FW2 A;  5A5H A;  1UN2 A;  3GX8 A;  1XPV A;  2H70 A;  2EIO A;  4MF6 A;  3HA9 A;  5D93 A;  3KXO A;  1TRV A;  3CTF A;  2HRK B;  1U6T A;  3VWV A;  3EC3 A;  4A5P A;  1G6Y A;  2R2J A;  5IQY A;  2DMM A;  5IOX A;  3C7M A;  4KDU A;  3WYW A;  5HR3 A;  5J5N A;  3CTG A;  3PR8 A;  1A0F A;  2A2R A;  3LGC A;  5B8A A;  3G7Y A;  5J40 A;  1MEK A;  4AJ7 A;  2H75 A;  1TTZ A;  1SKW B;  3DXB A;  2FGX A;  3ZIT A;  1Z6M A;  2HSM A;  2M72 A;  5ECN B;  2CX3 A;  2KHP A;  4I2U A;  1TU8 A;  2XBQ A;  1DE1 A;  6GSU A;  4BVX B;  4JE1 A;  2FUG 2;  2MMN A;  1F9M A;  2A4V A;  2H73 A;  1PX7 A;  5INY A;  3ZIJ A;  2OBK A;  4K7O A;  1GNW A;  2VO4 A;  2OAD A;  3ERW A;  3C73 A;  5CRE A;  2NDO A;  1SK0 A;  2I1U A;  2ALB A;  1Z7R A;  1XFL A;  4I97 A;  3QAW A;  2K18 A;  5D9T A;  3KIJ A;  1K0O A;  5DBQ A;  3TKS E;  2FY6 A;  5IMA A;  3TCO A;  2X4A A;  5H5Q A;  4HU7 A;  1OKD A;  1Y25 A;  4OCE A;  1QXH A;  4JRR A;  5A1N B;  4OFM A;  3KMN A;  5G1L A;  4ZB7 A;  5DQY A;  3I6A A;  2H6Y A;  2OE1 A;  2PVQ A;  2MMZ A;  1RQM A;  3H4K A;  1GSU A;  1O8W A;  2LRN A;  2IN3 A;  2H71 A;  2GSQ A;  4GWR A;  4K0N A;  4AGS A;  2DJJ A;  3FRC A;  4GSS A;  4TKY A;  5KN0 A;  2L4Q A;  5IO2 A;  3KP9 A;  4HEA 2;  1EV9 A;  4LMW A;  4YAV A;  1GL8 A;  1W4V A;  4WBR D;  3ZRD A;  3ZML A;  2O85 A;  3E3E A;  2YPM A;  1EOG A;  1PX6 A;  4I5Q A;  1SL2 B;  4EO3 A;  1VF1 A;  5E4W A;  1G6W A;  6GST A;  2H1B A;  1F3A A;  1AAZ A;  4F82 A;  3R3E A;  19GS A;  2K6V A;  4TR1 B;  4K5R A;  1XWC A;  4MZB A;  1M2B A;  1TP9 A;  3O3T A;  2NPB A;  5IOW A;  4O5Q A;  4N3Z A;  4RUV A;  3CSH A;  4D73 B;  3W8J A;  4GDF A;  1BF5 A;  8GSS A;  4USS A;  2PBJ A;  2P31 A;  1XZO A;  2H66 A;  1OC9 A;  2H01 A;  4G9H A;  1SL0 B;  1WOU A;  5HFK A;  4PQ1 A;  2HQT A;  3DRN A;  2QKE A;  4KSO A;  3IOS A;  2YNX A;  5GAN D;  1ACV A;  4JED A;  1QFN A;  3K8N A;  3HYP A;  4MJC A;  5BMU B;  4PGT A;  2G2Q A;  3GUS A;  3MDK A;  4HZ4 A;  3QDN A;  5KN1 A;  1AQV A;  2X99 A;  2F8A A;  3Q74 A;  4G0K A;  4IQA A;  5J9B A;  2IMI A;  3UVT A;  4NMU A;  1ZYQ B;  1XOB A;  3GH9 A;  1YEP A;  5LCZ A;  2GZY A;  2HZE B;  2GLR A;  4IN0 A;  2DKI A;  2X64 A;  3PGT A;  3IRA A;  3HJP A;  2WCI A;  11GS A;  2RUE A;  2IWT A;  3P2A A;  4EF0 A;  1PGT A;  4K9Z A;  2F8F A;  4I8B A;  2EFD A;  1GRX A;  2RM5 A;  3KCM A;  3DGQ A;  1Z7P A;  2FD3 A;  4EVM A;  2GTU A;  2JL4 A;  1UVZ A;  2XPD A;  5ELG A;  2HFD A;  3I9V 2;  4HJ2 A;  5IM9 A;  3GTU A;  2C3N A;  3M1G A;  3ED3 A;  2H30 A;  3QCP A;  3A5I A;  5CNW A;  4AKG A;  2EIR A;  3I43 A;  2H1L A;  4KAE A;  2CV4 A;  3EE2 A;  2VCX A;  2LKU A;  2KP2 A;  2VCW A;  2C3Q A;  2C0G A;  4LA1 A;  5AN1 A;  1UA5 A;  4NV5 A;  4O7H A;  1O6J A;  3ZIV A;  3IE3 A;  2YZH A;  2CAQ A;  4HQS A;  4ZBD A;  1EGO A;  4MP4 A;  3GH6 A;  4F2I A;  4OD7 A;  3L9V A;  1XWG A;  3TOT A;  5JWO B;  3MYD A;  1GSS A;  4MA9 A;  2HRK A;  2UZ8 A;  2O8V B;  1I9D A;  1B4P A;  1EGR A;  4LL1 B;  1MD4 A;  2GQK A;  1BED A;  4PUR A;  2LRC A;  3U5R E;  4POB A;  5AIS A;  4J2F A;  1EP7 A;  2FWF A;  2LUS A;  1R26 A;  4TXO B;  3VWW A;  1SL1 B;  3G7J A;  4BL7 B;  5J3R A;  2C0F A;  1FHE A;  1EV4 A;  2L4C A;  2ZCT A;  5JCU A;  3GUR A;  4NV2 A;  4JR6 A;  2VLU A;  3TKS C;  3TKQ A;  3UJ1 A;  1NW2 A;  3GYK A;  4GQF A;  2LQQ A;  5A34 B;  4HU9 A;  1V98 A;  3FYG A;  2C1Y A;  2J9H A;  4QL9 A;  4K1F A;  5J41 A;  2AUV A;  2C0E A;  4EUY A;  2DJ1 A;  3IHQ A;  1GUL A;  4G10 A;  3D5J A;  1GTA A;  4DVC A;  2RII A;  3EUR A;  5AIV A;  1ZL9 A;  6GSY A;  3BJ5 A;  1T3B A;  4K7N A;  3ZTL A;  1HD2 A;  3IR4 A;  5A1N A;  3HHV A;  3C1R A;  4ZL9 A;  4O92 A;  2LQO A;  5EVO A;  2B1K A;  4ML6 A;  1A2J A;  2IIY A;  1SJI A;  5FHI A;  3F4T A;  5F8B A;  2P5Q A;  4AF2 A;  2VD0 A;  4V1A g;  4ECC A;  1M2D A;  1QK8 A;  5D96 A;  3TJF A;  2DJK A;  3FZA A;  1SVO A;  1YF0 A;  5ECL B;  4KGI A;  4OMV A;  2YCD A;  1ERU A;  2DC5 A;  1F37 A;  4RQX A;  4FH8 A;  4ZB9 A;  2PPT A;  3M9J A;  12GS A;  2FWG A;  2R0G A;  3PH9 A;  3GSS A;  2V6O A;  3WD6 A;  5CRG A;  4KCA A;  3Q18 A;  1GSD A;  3GV1 A;  2EFC A;  1AIU A;  1OE8 A;  3NOF A;  3OR5 A;  3LG6 A;  4TR1 A;  1YVL A;  1M9B A;  5C04 A;  4XRA A;  3UBK A;  1URM A;  2HNL A;  1ZMA A;  2KOK A;  4G0L A;  1RW1 A;  3W8S A;  3CYN A;  2JZS A;  4YQV A;  4D73 A;  2B1L A;  1MDK A;  3BCI A;  2I81 A;  2B7K A;  2QSI A;  3FZ4 A;  2OA7 A;  2X49 A;  2K8V A;  2AB6 A;  2PMT A;  3R2Q A;  2GSS A;  4KB3 A;  1FOV A;  4L5O A;  4EDY A;  1Z5Y E;  2HRF A;  2N5F A;  2AV4 A;  5ECS A;  2R0C A;  2C0D A;  5DVB A;  1SK2 A;  4OO5 A;  3EU4 A;  4POK A;  4K8M A;  3LSZ A;  4PNG A;  1JZR A;  5D9X A;  1JZO A;  5DJL A;  3F8U A;  4OWY A;  3H8Q A;  2E2M A;  2EIQ A;  4EDZ A;  1H75 A;  4F0B A;  5FT3 A;  4WR4 A;  5J9C A;  1MTC A;  2OAC A;  2YAN A;  1X5E A;  2H1D A;  4JBB A;  5DAK B;  2HT9 A;  3PIN A;  2BJX A;  2PU9 C;  1GLQ A;  1Y6E A;  3RDW A;  2RLI A;  4QL7 A;  4P3Y B;  4FYB A;  3QAG A;  2HI7 A;  2C4J A;  2H8L A;  1X5D A;  4YKF A;  1V9W A;  2VLV A;  1B8X A;  3M9K A;  3GX0 A;  1VF4 A;  3RBT A;  5ELA A;  5IPH A;  5EL8 A;  4HDE A;  3KH9 A;  1JFU A;  3RPN A;  5ENU A;  3D0Z A;  3MWH A;  4JZQ A;  3A3T A;  3GKN A;  4V1A p;  1SEN A;  5AGY A;  1A23 A;  4IJI A;  1HYU A;  3FZ9 A;  4N11 A;  4WXT A;  3CXG A;  4MPF A;  3IAS 2;  3EU3 A;  3GKX A;  4CY8 A;  3ME7 A;  2DBC A;  1NHY A;  4IKH A;  3FEU A;  2FNO A;  4PXO A;  3EWL A;  1QMV A;  3MNG A;  4QMK A;  4RI7 A;  3ZMK A;  3SBC A;  2ZUP A;  3S9F A;  2XHF A;  4F0C A;  4X43 A;  3TOU A;  3TJJ A;  2CZ3 A;  1GLP A;  2V6K A;  3LQ7 A;  3CSI A;  2YJ7 A;  2OJL A;  3L78 A;  4LMV A;  1V40 A;  1JZD A;  2FWH A;  3CWG A;  5ID2 B;  4OFT A;  1K0A A;  4Q5F A;  1XOA A;  4TXO A;  1MDJ A;  3L0H A;  4BL7 A;  1G7E A;  2LJK A;  1N2A A;  1XW5 A;  4DSS B;  1AQX A;  1VRS D;  4GCI A;  4G19 A;  2MZC A;  4OCF A;  3O6T A;  2O5V A;  2WB9 A;  3DVW A;  3DYR A;  4ID0 A;  4FO5 A;  4WKW A;  4HQZ A;  4NXI A;  3D4T A;  5A34 A;  1IYI A;  1AUC A;  4BA7 A;  4ZBB A;  5ECQ B;  2PN8 A;  2E7P A;  1K0N A;  2QC7 A;  3RHB A;  1O85 A;  5A5K A;  3G9B A;  3DWV A;  4POL A;  1EEM A;  4IP6 A;  4WBJ A;  1JLW A;  1BJX A;  4KSM A;  4MNN A;  4XS1 A;  1TW9 A;  4EKZ A;  4WET A;  3WT1 A;  2GS3 A;  3F3Q A;  3F4R A;  2YN1 A;  2X8G A;  4ACS A;  2M80 A;  2R37 A;  4X1U A;  3EVI A;  4PX1 A;  3VUR A;  5D73 A;  5ECR B;  1MD3 A;  4IEL A;  2CA8 A;  1XBS A;  3H1N A;  1DSB A;  3TJB A;  4GSN A;  4MPG A;  2E0Q A;  1SK1 A;  3GNJ A;  2PGT A;  4GLT A;  1XW9 A;  2X8H A;  1ZCP A;  1QQ2 A;  3TDG A;  4MZW A;  1CQG A;  5F07 A;  1PSQ A;  4MLY A;  5IMV A;  3AY8 A;  5ECP B;  4IJ3 A;  2IJY A;  4Z2U A;  5J4V A;  1R5P A;  4TXV A;  1Q4J A;  3GMF A;  3ISO A;  2IFQ A;  2LTK A;  4KUN A;  4KDY A;  4PQI A;  2HZF A;  1PKW A;  4N0Z A;  4MZC A;  3O76 A;  2HSY A;  3VI5 A;  1GSE A;  2B7J A;  1ON4 A;  3LEF A;  1T7P B;  2DML A;  2A2S A;  5CAX A;  2FCH A;  2N5B A;  1YEX A;  4DSQ A;  4G0I A;  4TW5 A;  1XCC A;  3HD5 A;  2EC4 A;  2HSN A;  3FR3 A;  2JZR A;  4EXJ A;  5IMZ A;  1C72 A;  5F0G A;  2P5R A;  1FB0 A;  4ECI A;  2IMK A;  1WE0 A;  2JZT A;  2L6C A;  3ZFB A;  2R6K A;  1TK5 B;  1Z9H A;  3QPM A;  4XTS A;  3CSJ A;  5COH A;  3LXT A;  4O32 A;  3APO A;  2J23 A;  2G0F A;  3ERG A;  2OE3 A;  1TU7 A;  1E6B A;  2MMO A;  5DAK A;  2OKA A;  3D22 A;  2L5O A;  4XS4 B;  1WJK A;  3ZL5 A;  3L4N A;  4MH3 A;  3G7I A;  4PNF A;  2GST A;  2VKZ G;  2N5A A;  5AIX A;  4OO4 A;  1S3D A;  3D21 A;  4MF5 A;  1AW9 A;  3WT2 A;  1WPI A;  4GXZ A;  4EL1 A;  5ECK B;  5GZZ B;  2B5E A;  1YJ6 A;  2A4H A;  1SYX A;  4O5U A;  4K6X A;  5JWQ B;  3GFK A;  3TRP A;  7GSS A;  4N10 A;  1B9Y C;  3F9U A;  5A5H B;  4XHM A;  3GN3 A;  2GQM A;  4ZBA A;  4DSR A;  4GTU A;  4KDX A;  1I5G A;  1SKR B;  5DJM A;  5HR0 A;  1MDI A;  3VLN A;  1FOH A;  5CRW A;  1X9M B;  1T1V A;  4RQR A;  1OAZ A;  1OE7 A;  3UBL A;  2VAF A;  4MH2 A;  1J0F A;  2LNT A;  1AC1 A;  5B8B A;  1PN0 A;  4G2E A;  4GST A;  2H0I A;  1OC3 A;  4IW9 A;  2L57 A;  1PL2 A;  5IMD A;  2DIY A;  2GSR A;  3D6I A;  2VCT A;  4PQH A;  4FIW A;  5ID2 A;  4BVX A;  2Z9S A;  2F3M A;  2YZU A;  2HLS A;  3EIN A;  6GSX A;  1PRX A;  3DKS A;  5KEJ A;  3EMX A;  3F6F A;  2V41 A;  3ZVJ A;  3A2W A;  4DSS A;  1SD8 A;  3VPT A;  3LOR A;  4FYC A;  1GUM A;  1AXD A;  2WDU A;  5BRT A;  1VF3 A;  4QQ7 A;  3BD2 A;  4TR4 A;  3LWA A;  4HS1 A;  3TRQ A;  5IMC A;  3FR9 A;  4ZB8 A;  5LNK e;  2MYG A;  4HI7 A;  4K7I A;  3JCM L;  1FO5 A;  4AKI A;  4WEY A;  1XWA A;  2C8U A;  4DEJ A;  3QFB C;  1K0M A;  1HNB A;  1SVM A;  1TRW A;  1M7T A;  2H76 A;  1O7U A;  4ZXG A;  4CHS A;  2H1A A;  2YWO A;  3GKK A;  4J56 E;  1U87 A;  1ERT A;  1O81 A;  2VL9 A;  5DCH A;  1GUH A;  3F3R A;  3BBY A;  1YKC A;  2AHE A;  1WP0 A;  4Q5Q A;  1IYH A;  2WRT A;  1V2A A;  2ON5 A;  4YQM A;  5IMF A;  3TKR A;  4LLR A;  3V1W A;  2CVB A;  3FMW A;  3KTB A;  3UAP A;  3BOA A;  5A4U A;  4XS6 A;  2DIZ A;  2LST A;  3GRX A;  4ICY A;  3VFI A;  1XW6 A;  2TIR A;  1TXU A;  3HZ8 A;  3APQ A;  1SU9 A;  3QMX A;  1YF1 A;  2FLS A;  4W66 A;  1T00 A;  1GH2 A;  5E59 A;  2B5Y A;  4ECJ A;  20GS A;  3QOU A;  2H6X A;  3L9U A;  1RK4 A;  3I69 A;  2CT6 A;  2JSZ A;  5JWR B;  3FR6 A;  3QR6 A;  3GST A;  1OC9 B;  3VK9 A;  3IHG A;  4E68 A;  3KTL A;  3VPQ A;  5A4W A;  1TOF A;  5DAL B;  1GWC A;  1Y1U A;  4PTS A;  4KE3 A;  4N0V A;  1K0D A;  1FB6 A;  5D8I A;  2LS5 A;  2AAW A;  4HOJ A;  5ECH B;  3EMP A;  2GDR A;  5BMU A;  4FYU A;  3Q6O A;  4PUA A;  3M0F A;  1YKA A;  4XIH A;  1SJZ A;  3J7Y k;  4ULX A;  2VLT A;  1G7O A;  3LXZ A;  4JU5 A;  1GTB A;  4TOP A;  2F9S A;  4YKG A;  4BPY A;  4EIP A;  2LEG A;  2HZE A;  3WGD A;  1TDI A;  1FG4 A;  4TRX A;  1WIK A;  1R4W A;  5ABR A;  2C80 A;  2B3S A;  6GSS A;  1OYJ A;  1THX A;  3BCK A;  2DJ2 A;  2CQ9 A;  3HDC A;  3HY2 A;  4XS4 A;  4MMM A;  1DBY A;  5B6M A;  5DQS A;  1YQ1 A;  3TGZ A;  1M0U A;  2MBT A;  3TUE A;  2EFH A;  1K3O A;  2HYX A;  5JCG A;  2I9H A;  5G1K A;  1XVW A;  3GTU B;  1K0B A;  3UAR A;  5DDL A;  2FWE A;  1FVJ A;  5D9W A;  3LJR A;  1CQH A;  1F3B A;  1LBK A;  3UIW A;  5GST A;  2R4V A;  4KW6 A;  1F2E A;  2GT5 A;  2VOC A;  1BX9 A;  4CY6 A;  2PVO C;  3GL3 A;  2KP1 A;  3GHA A;  5ECI B;  3VWX A;  3PPU A;  2RUF A;  1TXX A;  4CDO A;  2GZZ A;  5DCG A;  2FA4 A;  4L0W A;  2VUP A;  4WF5 A;  4K0G A;  2YOI A;  3HKR A;  1ERW A;  2NBS A;  1EEJ A;  4K5S A;  1GUK A;  1Q98 A;  1HNA A;  4EIQ A;  3DEX A;  2VL2 C;  5KN3 A;  3HXS A;  1K0C A;  4L8E A;  5KOW A;  1ST9 A;  2YV9 A;  2VCZ A;  1QGV A;  3QFA C;  1YZX A;  2I3Y A;  3KP8 A;  3F63 A;  4Z2T A;  3N9J A;  2LRT A;  1ERV A;  3F6D A;  5J4U A;  2PWJ A;  1VF2 A;  5H5R A;  2H19 A;  2VL2 A;  1TI3 A;  5FWG A;  5LD0 A;  2H0H A;  1OKT A;  4BVY B;  3IK7 A;  1N8J A;  4KND A;  3GL5 A;  1B48 A;  1NM3 A;  5B7C A;  2X8C A;  4I6X A;  1JLV A;  1PKZ A;  3FY7 A;  3LYP A;  1ZYN A;  1ZGN A;  1PD2 1;  4ZL8 A;  3M3M A;  2AJQ B;  2QA1 A;  1DE2 A;  2MBS A;  2V2G A;  1S3C A;  2GQL A;  5HQP A;  4IS0 A;  1YDK A;  1ZZY A;  1XWK A;  5J47 A;  3IDV A;  4ZIJ A;  2DJ0 A;  3H93 A;  4LL4 B;  5D9V A;  2CX4 A;  1GTI A;  1SD9 A;  3E9J B;  1X0R A;  1PA3 A;  3TJK A;  1HNC A;  1VGL A;  1PQN A;  5ECO B;  2OE0 A;  2K8S A;  4Q5N A;  1BQ7 A;  4XCS A;  3ZRE A;  3L9S A;  5IPG A;  2IL3 A;  1QUW A;  2CVK A;  2B5X A;  4POM A;  5J4Y A;  1ZOF A;  4ECB A;  1K3Y A;  3GKM A;  5L71 A;  1B4Q A;  5HR2 A;  2YJH A;  4F03 A;  4V2M A;  4WR5 A;  2REM A;  3IC4 A;  4IQ1 A;  2YWI A;  2ES7 A;  4X0X A;  4KCE A;  4IGJ A;  2IMD A;  1BG1 A;  2PUK C;  1R5A A;  1BAY A;  3WGE A;  3NIV A;  1GSF A;  1SYR A;  5G2Z A;  4AKH A;  3GA4 A;  2R3X A;  1TRU A;  10GS A;  2LNS A;  4X4J A;  4GQC A;  3HZ4 A;  3W6G A;  4GF0 A;  4V2N A;  3TB2 A;  3FHK A;  3KH7 A;  4JR4 A;  3KJY A;  5HR1 A;  1TKD B;  2OBI A;  1SJ6 A;  3P90 A;  4MDC A;  1GSQ A;  3DD3 A;  3ME8 A;  2KUC A;  4EE0 A;  1GP1 A;  1NHO A;  3SWL A;  1JZW A;  2JAC A;  2IME A;  4ZL7 A;  5DAL A;  5IO0 A;  16GS A;  4Q5R A;  2K9F A;  3F4S A;  1ZYE A;  3IBH A;  3HJM A;  2HE3 A;  4MK3 A;  5G5F A;  2JU5 A;  2WZ9 A;  2CVD A;  4BWQ A;  2YWN A;  5CRH A;  3HMJ G;  2YV7 A;  1EP8 A;  4EC0 A;  22GS A;  2H1G A;  4TR3 A;  1ML6 A;  2V1M A;  5CP1 A;  3QD9 A;  6GSV A;  3IXR A;  2ZNM A;  1PN9 A;  2BTO T;  4AJ8 A;  1BG5 A;  4AJ6 A;  2WGR A;  1M2A A;  3MIX A;  3UEM A;  4GRF A;  1Z6N A;  2GGT A;  2GT6 A;  4MJB A;  2MMA A;  4BWS A;  1XIY A;  1THO A;  2AYT A;  2TRC P;  2GZP A;  4MCU A;  3HJO A;  3VWU A;  4KF9 A;  5GSS A;  3C1S A;  5CO3 A;  2VM2 A;  2QGV A;  3HVS A;  3E0U A;  1KBN A;  2FA8 A;  4V2L A;  5GAP D;  4YQU A;  4ZB6 A;  1ILO A;  4IP1 A;  1S3A A;  2H6Z A;  3HVV A;  5KN2 A;  1J9B A;  3EPT A;  1HQO A;  4L0U A;  1YY7 A;  4NAX A;  2HSH A;  2V32 A;  4MAB A;  3IA1 A;  4Z2R A;  3RHC A;  3ZLP A;  4KX4 A;  2OT3 A;  1O8X A;  3FK8 A;  4XRD A;  1USB A;  3RAZ A;  3LW9 A;  2WUL A;  3APS A;  2LV3 A;  2BMX A;  2YP6 A;  4H86 A;  2LJR A;  3ZVJ D;  5C00 A;  1GSY A;  4E8H A;  1SVL A;  3FZ5 A;  3H79 A;  3IV4 A;  5H5S A;  3DVX A;  2M46 A;  3TKP A;  3ZYW A;  2IMF A;  2PER A;  3DIE A;  5F06 A;  3Q19 A;  4MJE A;  2IPA A;  1W89 A;  2L6D A;  5IIZ A;  2HSM B;  14GS A;  3TU3 B;  2CZ2 A;  3LFL A;  1H4O A;  3GIX A;  1TRS A;  3UL3 A;  2HXK A;  1FAA A;  1ABA A;  3MSZ A;  4HUA A;  3IK9 A;  6GSW A;  2I4A A;  1T4Y A;  4O5R A;  2FHE A;  4MJA A;  1LU4 A;  2HRN A;  3P7X A;  4BVY A;  4FQU A;  2EFE A;  1EOH A;  2O87 A;  4ILF A;  5A4V A;  4L5L A;  3MAK A;  1U3A A;  1U88 A;  4YAP A;  4OFN A;  1A2L A;  2F51 A;  1X9S B;  1WMJ A;  4K2X A;  1FVK A;  2NTO A;  3CMI A;  2DJ3 A;  3UMA A;  2H0G A;  3D4M A;  1TI1 A;  3CRU A;  2KLX A;  5KOX A;  1XWB A;  5G31 A;  2DKH A;  4HJM A;  3TKS A;  5EY6 A;  1T4Z A;  4YH2 A;  1A2M A;  4PUF C;  3ZFL A;  5CYY A;  4AKX B;  2B6M A;  3IPZ A;  1NSW A;  4NHZ A;  2QA2 A;  2TRX A;  5F05 A;  1X9W B;  1OVN A;  1TJD A;  1DUG A;  2WS2 A;  3LYK A;  1A0R P;  4TR0 A;  1TK0 B;  5G30 A;  1KNG A;  5B6N A;  5JCW A;  5ECM B;  2H74 A;  1OC8 A;  3A5W A;  4NPB A;  3KZQ A;  5CRD A;  4AI6 A;  2ON7 A;  1XVQ A;  3HVX A;  1GTU A;  1EWX A;  18GS A;  1JHB A;  1A8L A;  1WRY A;  2VIM A;  1K3L A;  3NZN A;  2XC2 A;  3CBU A;  2GVP A;  3KGK A;  2CAI A;  4IVF A;  1J08 A;  4E8E A;  2VCV A;  3IC8 A;  2JAD A;  1ZYP A;  4KA0 A;  1PMT A;  4MF7 A;  1R7H A;  4N30 A;  2VD1 A;  2C3T A;  3KD0 A;  1M99 A;  2L5L A;  3IAM 2;  1A24 A;  1BYE A;  2DLX A;  1N25 A;  2R0P A;  2IFQ B;  13GS A;  2RM6 A;  2D2Z A;  3C8E A;  1U3I A;  4TN8 A;  1PL1 A;  2WFC A;  4ZIL A;  1F6M C;  4G01 A;  4KH7 A;  3EYT A;  5EPF A;  3US3 A;  17GS A;  1G0T A;  3ZZX A;  1T8E B;  2UV8 G;  4IHU A;  1XXU A;  3N5O A;  3TRX A;  2O89 A;  1KTE A;  2HRA A;  1EZK A;  4RI6 A;  4Z7X A;  1B9X C;  2JSY A;  1AQW A;  3KEB A;  2HSN B;  5G5E A;  1M9A A;  3J7Y b;  5HFI A;  1TK8 B;  3C71 A;  4WF4 A;  2NVL A;  3CRT A;  1LJR A;  4TVE A;  4I2T A;  2P0G A;  3RPP A;  3QAV A;  1V58 A;  1WWJ A;  4NHW A;  3F0I A;  2VM1 A;  3HCZ A;  1GNE A;  1A8Y A;  3ERF A;  1KEB A;  2R5G A;  3P8W A;  2VL3 A;  1O73 A;  4NWY A;  4K2D A;  1FW1 A;  3M8N A;  3KMO A;  3U6V A;  1UC7 A;  4IBP A;  2YWM A;  2E2G A;  1E2Y A;  3VI7 A;  3UVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...