5F1KA

Human cd38 in complex with nanobody mu1053
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
244
Chain Sequence
b'TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 80
structure length 244
sequence length 248
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f1kA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f1kA02
3H8VA 2JFGA 4L73A 4PG5A 3T7EA 2Q49A 2IE0A 3PLNA 2EW8A 3KYDB 5AXCA 1ZH8A 3SEFA 1O6ZA 5I7VA 4E32A 4J9UE 5KWEA 1ZJZA 1X13A 4XQEA 4CR8A 1DAPA 4ZD6A 2G82A 1XKQA 3I9NA 4CM9A 3GGGA 4JCOA 3ZNQA 5BQFA 4XEHA 1HLPA 3JD0A 4JP2A 3EYWA 1CQIA 3VKVA 5I9LA 3PIDA 4RZHA 3PYXA 5FWNA 2Y0EA 1G0OA 1N7GA 4CUZA 2VHXA 3CUKA 1LSSA 1UH5A 3OIDA 4NBVA 1C0KA 5COQA 3EHEA 4CL3A 1U28A 3JQEA 2ZCVA 1DC5A 1NAHA 2ET6A 4OQZA 1JU9A 2FSVA 4OXKA 3VAZA 1X14A 4YJFB 1BXGB 2HAEA 2GYYA 3D0OA 1YBAA 3CKYA 1XWFA 2GNAA 2EERA 3G79A 4JBIA 3WSVA 4DXHA 5G4KA 1LDYA 3M2TA 3VZQA 3JCZA 2Y1EA 4KZPA 2W4QA 1QV6A 1VSUA 4R5MA 3UCFA 3ROKA 1DB3A 1GYQA 1HETA 2UV8A 1D1SA 1PQPA 4GMFA 2NLOA 4XR9A 3ZZNA 1E3IA 2UDPA 2EJWA 3AFNA 1LLDA 2VNAA 2FSSA 4RPGA 1EVIA 1HDXA 2X5OA 2C82A 3B6ZA 4B8WA 3K2BA 3PWZA 4FGWA 3VH1A 5L9AA 5AQ1A 3CTMA 3O8QB 3ETEA 2BF7A 5EMHA 3U9LA 1DOHA 2EG9A 3IUSA 3OA0A 4IJKA 4OKIA 4DIFA 4CM8A 3U62A 1HSOA 1UXJA 1PX0A 3MJCA 4RQUA 1Q0HA 4AJLA 4CLOB 1DC6A 3AY3A 3P2YA 2G5CA 1DBVO 3NYWA 4OYRA 4EJ6A 2ZB3A 1I33A 4IZHA 2VN8A 3C1OA 4M49A 5IG2A 3ASVA 2FY8A 4BNXA 4R9RA 3RIHA 2NTNA 1I01A 1ADGA 5L4LA 4CLEA 3TOZA 3SBOA 4EJMA 1ZZEA 1UAGA 1HYHA 2WE8A 3GRPA 4LMPA 3WOHA 1ZFNA 1HKUA 3A1NA 3IIEA 3JQAD 2J6IA 4LCEA 4CLXA 2NQTA 2R2GA 3BAZA 4RF2A 3TL2A 2B5VA 5IDXA 3WGTA 2QRJA 1BTOA 4DBZA 3W8EA 3UH1A 1DAOA 3DQPA 1B15A 3IAHA 3W6ZA 4N7RA 1NNUA 1NHWA 3G0OA 3JYNA 3T7CA 3GPIA 1ZW1A 3PK0A 4RDHA 5JY1A 3HADA 4NJOA 4DYDA 1NPDA 3RBXA 4DTIA 2Q1TA 4DBVO 1NYTA 3ST7A 5TLSA 1S7CA 2B69A 3GOHA 3ANMA 5JC8A 4EZBA 4FW8A 4BNHA 2X7HA 4DPKA 4WCFB 1U1IA 5DCYA 4BNUA 3S55A 2DUWA 1I30A 2X9GA 1IHXA 4OOEA 3Q9NA 4JLWA 1LDGA 2ZQYA 4IPTA 1LLCA 5EPOA 3KSUA 1MFZA 3MTJA 1RYDA 1XHLA 4WCDA 3UCEA 1ISJA 1IL0A 3L6EA 4N5MA 5T67A 3DXFA 3DMYA 2BFOA 3ORFA 1PIWA 3QY9A 4DVJA 1YVEI 1Z45A 3HN2A 3DBVO 3IJRA 2X6TA 3DOCA 4QTZA 4WGGA 4W9NC 5G4KB 1ZXBA 4PLFA 5ENVA 5GMOA 1LSUA 3AI3A 1B14A 3CMCO 2FMUA 3SLKA 4QT0A 3U3XA 2VRCD 1QG6A 3D64A 3A06A 4WEOA 4NR0A 3KEQA 1L7EA 3F4LA 1NFRA 5LDHA 3FNHA 1KBZA 2Z1MA 1GQ2A 1ML3A 3AOEC 2UUPA 2IYPA 2WYVA 1VJ1A 4PLWA 5DT9A 2OXIA 1FJHA 1XLTA 2Y0CA 2BKAA 4D46A 3BTUA 1Y5RA 5LCXA 4J0EA 2ZB4A 2X0RA 3GN1A 3DZIA 1X15A 2AW5A 1YKFA 4CM8B 5MDHA 4NJMA 3DR3A 2E82A 4FJ2A 4IMRA 1AXEA 3QVTA 1HRDA 2Y68A 1E1LA 2Y1FA 3OJFA 4J7XA 1PS9A 4J16A 3TZCA 2Q3EA 4J43A 1H0KA 4OXYA 2B36A 4L75A 4ND5A 4LN1A 3HQ4O 1I10A 1GAEO 3ZH2A 4B8ZA 3DTYA 4RPLA 1GQQA 3BMNB 4J4TA 1RYEA 1K5HA 3I1JA 3RCBA 4D43A 2HO5A 5KJCA 3BMCA 4JN6B 1P77A 3DC2A 3FRJA 4PZDA 3W4IA 3LC2O 4OQYA 5C7IO 5DF1A 1IPEA 1PZHA 1ZO8A 2OBNA 5I9MA 1Q0QA 2QG4A 1FDTA 2Z1NA 3S2GA 3D1LA 2EXXA 5LDGA 3W4JA 4WEQA 2FPIA 3TFOA 1Z75A 3M1LA 3NTRA 4FS3A 1E1MA 2AEJA 4M89A 4Z0PA 4AJ1A 4AJOA 1JKFA 2DBVO 1MA0A 3JQAB 4Z3DA 1AXGA 3ASUA 1NWHA 4FFNA 4DLBA 4NDNE 3RKRA 1J5PA 3ADOA 4BNJA 2NNLD 1FDSA 2NVBA 4EUHA 1VPDA 4BB6A 2Q2QA 2VQ3A 3FN4A 3AI1A 3GGPA 2BFMA 5A4DA 3LT2A 4WLUA 4RPHA 1R4MB 2GR9A 3AI2A 3WYEA 1JVSA 1QLJA 1MFPA 1E3JA 2CNBA 3WYCA 3ZWAA 1LLUA 4Y6PA 3QRWA 1GV1A 4GX5A 1GFSA 3RC7A 1EK5A 4CV1A 5JAIA 4OM8A 1F17A 3O4RA 4NNJA 3OA2A 2DBZA 2A9FA 3UOGA 1I3MA 4Y6RA 4E12A 1PJTA 2OHXA 1IULA 4CMCA 3RC9A 4YT5A 3WS7A 3WMWA 5KOIA 4NHEA 3HDHA 4OKNA 2AE2A 1U3TA 1A5ZA 1DHTA 3O38A 2IEDA 4J1SA 2QZ9A 3MOGA 1U7HA 3WIDA 4Y6SA 3MJSA 3PDJA 4QECA 3WQSB 1WW8A 3C7AA 1IYZA 4A26A 3NJ8A 3RAJA 2O50A 3TFQA 1MGOA 1UP4A 3DL2A 3FSRA 3STHA 4C4OA 4Q3BA 5HA5A 4PN3A 3V8BA 3N58A 2Q99A 1GZ3A 2Y67A 3CH6A 3AWDA 3OQ1A 3DAPA 1ZMTA 4NJMB 3CMMA 3PHLA 4IZIA 2YV2A 1DIRA 1ONNA 5G0TA 2V6BA 2OBYA 2WWRA 1IE3A 2NSDA 4ZHSA 3E9QA 1VL0A 1GZ6A 4DRYA 2VYVA 2O23A 3ANLA 2GSDA 4BNWA 3LT0A 3EZLA 4JQCA 4UULA 4FGSA 2C2XA 3HJAA 3H2SA 4DQUA 3JQFC 2W2LD 4IDFA 1YS4A 4W9NA 1BDBA 4J90A 3JD1A 4GKBA 1B3RA 4IJWA 4MINA 4DPMA 3ROQA 3GZ4A 4FR5A 3D5QA 1V8BA 3IDSA 3P19A 4ILKA 5CPBA 4FJ0A 5IF3A 4RF5A 4BGVA 1KEWA 3DZKA 3U4HA 1E7YA 3FHLA 5F3RA 3GEGA 3I3OA 1XIVA 4CQLA 1A9ZA 1Z6ZA 3H4VA 4RL6A 1ENPA 5KNLA 3PQFA 1FK8A 3QWBA 5JDIC 4QQRA 1QMGA 3WWYA 5KIAA 2YZ7A 5COAA 4CMGA 3IS3A 3IP1A 1NQOA 3B1JA 1HXHA 3UHAA 2Q1UA 2QHXA 2GN8A 4H7PA 3K8ZA 2ZATA 1N8KA 3VDRA 4DREA 4ND4A 1SBYA 5A9TA 1GUZA 2H9IA 3VTFA 4M54A 2Q1SA 3K2EA 5B12A 2UVDA 1JN0A 2PLAA 4GMGA 4CM4A 3KHUA 1NFFA 2G0TA 4WLOA 1XU9A 4GSLA 4FC7A 4PIVA 4BKPA 2ZK7A 3LVFO 1PL6A 1MG0A 3OF2A 3LT1A 1A72A 1E3LA 1U5CA 1ZIDA 1P3DA 2I99A 5DBGA 4BV9A 2PZMA 3I4FA 2ZYGA 4JNKA 3RVDA 4LK3A 1GUFA 2O7SA 1C1DA 3D4PA 4PGFA 5IXSA 3L6DA 2P9GA 1Q0LA 3DTTA 2GDZA 1B26A 4DIOA 1G1AA 3GVHA 4PZEA 4DLAA 1MG5A 1YONA 4BL5A 2BI7A 1LDMA 5JS6A 1PZEA 5CG1A 3M2PA 2A35A 4BNYA 1UXKA 2JCVA 4D0RA 1JAYA 5TQVA 1ZK4A 1JDJA 4AL4A 4Y67A 3IMFA 4RLSA 4HY3A 5TGDA 7ADHA 1KY5A 4ZQGA 3GZNA 3H9QA 2HCTA 4O5OA 4YRBA 1Y6JA 3LC1O 3GAZA 5FI3A 2D3TA 1LRKA 2IRWA 2X58A 3K73O 3TDKA 5K9ZA 2PH5A 1EQ2A 3GT0A 3INTA 2QZZA 3OJEA 4B7XA 3I5MA 1LDBA 2HMUA 1I3KA 1DC4A 1KYQA 1QYDA 1T26A 1DLJA 3GPDG 1ORRA 4GGOA 5TNXA 3VVBA 1PGNA 4B4UA 2X9NA 1KEPA 2Y66A 3BMOA 4I9HA 2CDBA 3DZGA 3G1TA 3LU1A 1HE3A 4WJZA 2NADA 3TSCA 1Y1PA 4KDFA 3W8FA 3WSWA 5H82A 4CV2A 1KERA 1XG5A 5I7FA 5ILGA 4NIMA 4CQMD 2EGGA 4PG6A 3PFFA 1OOEA 4TZKA 1B8UA 4ZA2A 4CQLB 4G81A 1HEUA 3GRKA 4FIZA 3DAFA 4A73A 3G17A 2YV3A 1QORA 4IJUA 4IDBA 1AGNA 1T1RA 3DFZA 5BSEA 1LLQA 5ITVA 1DO8A 2ZTVA 3AK4A 4YYZA 3NDRA 4DMLA 4BQRA 4FC6A 4ZGWA 1GTMA 4CLRB 3BIOA 3GNSA 1D1TA 1HYEA 4U7WA 1F06A 4R68A 3COSA 1U2GA 2DFVA 3DMTC 4YJGA 3PGJA 3PI7A 4D41A 2EF1A 3IOYA 4D3FA 4LSWA 3WLEA 3SLGA 1EMDA 1DJQA 3AY7A 5KJ6A 2DU8A 4WCFC 1I3LA 2GUGA 3NKLA 5CEFA 1SNYA 1ONPA 4UVGA 2Q46A 5EQDA 1C1DB 4NU5A 2PD3A 4OL9A 2EWMA 4IIVA 1BVRA 1DRVA 4P4LA 4RZIA 4LVCA 4WKGA 1O9BA 4YR9A 1E77A 1SAYA 1UXHA 1GPDG 2WDZA 1O95A 2PZKA 1LDEA 5CEJA 3NX4A 5DNAA 2WM3A 5JDIA 1PJSA 3U4CA 4D44A 4R3NA 3GK3A 1LTHR 1EFLA 2O3JA 4BNKA 1KETA 4D45A 4CMIB 1YQGA 3GZNB 4GI2A 1X7DA 1LBEA 3ZV5A 3Q6IA 3ZNNA 2NU7A 2GPTA 1CEQA 3UUWA 5FYDA 4YACA 3H9EO 2PGJA 1YJQA 2CF6A 4CR6A 1HZJA 1N7HA 3AUAA 3FD8A 1LA2A 4MP6A 4OSOA 4ZU3A 1WDLA 5AXAA 1EK6A 1KVQA 1GL3A 4MVJA 2AMFA 5TF4A 4A0SA 1QKIA 3BHIA 4TQGA 2EKQA 2UAGA 5JMWA 3TZ6A 1X7HA 1VE9A 4OAQA 4E21A 3WWZA 2QW8A 2HK8A 2VOEA 1DIAA 4MVJM 4Y98A 3SC6A 3SX2A 4BV8A 5A04A 2LDBA 4KP7A 3WICA 2Z5LA 3QW2A 4CV0A 4KUEA 3E03A 1B16A 1LQUA 2BRUA 3ZWNA 3EDMA 5B4VA 1EVJA 3ONDA 1PJCA 4LCJA 1ZSVA 4XB2A 3JV7A 4NBTA 3U4IA 4AJIA 4RVHA 3KM0A 4IY1A 1E3SA 2HRZA 2IXBA 3GVPA 5JW6A 4KQXA 4PRLA 5AOVA 1CERA 1RM5A 4YWJA 4DL9A 1D4FA 4ITUA 1PWZA 2JD1A 4FQ8A 3RBVA 1HSZA 4PFJA 2Q50A 4UEOA 3JQ7A 2RIRA 5K0ZA 3DFUA 3E18A 3PQEA 3NRCA 2C7GA 4E5PA 3O26A 4Q3DA 4W82A 1YOVA 3S2EA 4E2XA 2PZLA 4BS9A 3F9IA 2ZTMA 3L6OO 3F47A 2VUTA 3LSYA 1GCUA 2Q45A 3N74A 1DDOA 3K92A 2A92A 3PP8A 5L4SA 3S2FA 4IDDA 1R4NB 4HXYA 3DBRA 4CODB 4NH4A 3JQ8B 2R00A 1YB5A 2JD0A 4R5HA 4CMHA 5IZCA 2GN4A 1V3VA 4CM9D 3HWRA 1M67A 4BUCA 1SOVA 3PEFA 1HT0A 2PKQO 1VKOA 4DUPA 3GA0A 2HK7A 4HFNA 1PL7A 2HJRA 2EGHA 3O9ZA 4A10A 4CLDA 1H6BA 2GASA 1XQ1A 1P1HA 2XPCA 1J6UA 2IZZA 3GGOA 1H6CA 1E92A 4RLHA 5B1YA 3K9QO 4FOSA 4R9SA 2ZIZA 4IUYA 1XDWA 4IIUA 3ZW8A 3JD4A 4MIYA 4OHUA 4WOKA 4PLZA 2VNSA 3OICA 2ZYAA 2VUSA 3JQ9A 1MC4A 3ADPA 5JCJA 3WJAA 1TLTA 2DM6A 2I5PO 3IQDB 3FNGA 2O48X 4M55A 3PWSA 2B37A 4C7KA 4YAIA 1QXSA 3IKTA 4X54A 1PJQA 2O4CA 3UFXA 4AJ4A 4RCVA 2GO1A 1KOLA 4F46A 1HZZA 5CFZA 1I3NA 1MXFA 4I5EA 5BNTA 1P31A 1LI4A 4HX5A 5HS4A 5ADHA 4YT4A 5TIIA 4IBOA 5TT0A 4YJDA 5A06A 3GEDA 1L7DA 4FDAA 3BA1A 1ZUD1 2I65A 1PEDA 3DAGA 4QXMA 4Z3KA 4ALJA 1SB9A 5T8KC 1SO8A 1U9JA 4OMUA 1TXGA 3CZRA 1L1FA 2BGLA 1U2DA 5AVOA 2GRAA 1MB4A 1ZEMA 3AJRA 1K89A 4YQZA 3ZWPA 1VC2A 1NVGA 1LNQA 1LSJA 2VYNA 3C85A 2HUNA 3DBLB 1WMAA 3WFJA 3FR7A 1WAMA 1AHHA 2X5KO 3ITKA 5G0UA 3ETGA 1IB6A 4PLPA 2VHZA 5BSHA 4A7PA 4CMAA 4URFA 3RUFA 2B83A 5HBRA 2C20A 1X0VA 2NVWA 2GN6A 3JQ7B 1DSSG 3ZHBA 3Q11A 3QHAA 2ILTA 2VWQA 3FCOA 4YEDA 1JLLA 1H93A 4CM7A 2RHCA 3W8DA 1P44A 1YOVB 4ESOA 7MDHA 1Q7GA 5I7EA 1PU2A 4BIIA 3ROPA 3ZNPA 4BNIA 2RBEA 1IZ9A 2DBQA 4OGWA 1CDOA 4GH5A 1N1EA 2GN9A 3C1TA 4TZTA 1PR9A 5L7YA 3RWBA 4EI2A 4R41A 3M1AA 4EGFA 3OIGA 4JK3A 3KETA 3X2EA 1QLHA 3HDJA 3RC1A 3TZQA 3MWEB 1PJ3A 2HSDA 1RJWA 2P2SA 3QWHA 4MVJF 5CEEA 2O7QA 4OIMA 3H5NA 1RKXA 1VKNA 4A27A 2VUUA 1UP7A 4J2OA 1R0KA 1WNTA 1ZCJA 4JJFA 5DN9A 1GQYA 3NTOA 1MP0A 3PZBA 1NWCA 1QYVA 4NZ9A 3VPFA 3LDHA 4CMEA 1HLDA 3PPIA 4ALLA 5A3VA 5KVQA 1EVZA 3PXXA 4L76A 3IJPA 3RQSA 4FFPA 1LDNA 4W7HA 2DUUA 4E30A 4I5FA 2RHRA 1T2CA 3E1KA 4Q3AA 5KTKA 1MLDA 3FR8A 3MOIA 3EGOA 3GDGA 4R1NA 4N5NA 2RCYA 2OL4A 3AM4A 4ALIA 4E5NA 5A3JA 1P33A 3LF2A 3TPCA 5G0WA 3AU9A 4PLGA 3MEQA 5KKAA 5CG2A 2X22A 1LRLA 3TQHA 3EMKA 4YCAA 5AXBA 2TMGA 5EN4A 3PDUA 1UUFA 1NP3A 2VWPA 3QVSA 2VHYA 1E0DA 4GBJA 5JNLA 1PQWA 1LEHA 1E6UA 3IUPA 4P4NA 2D2IA 3UXYA 2O3SA 1PZGA 3FNEA 3N7UA 4GSKA 4JBHA 1U4SA 4ROSA 3NJ4A 4GVXA 2IDZA 2AXQA 1YDWA 3HNPA 4BMVA 4PZCA 4WECA 4FPXA 1XSEA 1ISGA 3AU8A 4D3DA 1BWSA 4AFNA 4PLVA 1DLIA 1WPQA 3A4VA 4GGPA 5I8WA 4XYGA 1H2HA 4TWRA 4UVHA 1R6DA 2Y93A 1UZMA 2OZPA 1T1SA 5EQFA 1EBUA 3HN7A 4XQCA 1I2CA 3RSHA 3GC6A 3QSGA 4GKVA 3Q0EA 3EY4A 4IINA 3I9OA 3D3WA 5KVVA 1H94A 4IXTA 4AJPA 3VDQA 4W99A 3W4KA 4E4YA 2VRCA 2YHIA 1BGVA 2O2SA 3LK7A 1EUZA 2V65A 1DRUA 3V1UA 4BNZA 1WZIA 2PZJA 4MIOA 3GHHA 3HHPA 2X0JA 5JO0A 4JXKA 1LJ8A 4JJIA 4TKLA 4BO7A 2X1HA 4W7IA 2HKIA 1V0JA 4UUOA 5EINA 1UXIA 1BRMA 4MP8A 3I9LA 1B7GO 2Q2WA 2VOJA 2XAAA 3JYLA 4UUMA 3ICPA 2ZJ0A 5TC4A 2FR8A 2GZ1A 4EEZA 1KVUA 2QYTA 3H65A 3R3SA 4U0JA 2O3UA 4TRMA 1EFKA 1QV7A 1WXDA 1V3TA 5BSGA 2OMEA 2A94A 3DHYA 1UAYA 2H63A 3KYCA 5C37A 3WGGA 4O0LA 4E2ZA 3GH3A 4R16A 3HDQA 2NTJA 5IN4A 4B7UA 3FWNA 3ON5A 2G76A 4UEJA 3GQVA 2ZB7A 3E8XA 5FFFA 1OAAA 3GN2A 1TB4A 2I3AA 4UUPA 3BTOA 2HDHA 4NI5A 1NASA 4IS3A 3R0IA 4F6CA 4ZQHA 4TMFA 1PR3A 1GY8A 1J4AA 1P9LA 3L77A 3O03A 4PG7A 5JDCC 5EL0A 1HDRA 4E5MA 4EITA 4F6LA 5KJFA 5JAMA 3ANNA 4O6VA 3KOUA 1EE9A 4R69A 5L4NA 1P1FA 3T4EA 3B1FA 2YUTA 4YDRA 1DJNA 1FDVA 4DPLA 3E9MA 5F5LA 1N1GA 4HKTA 3KYBA 3MJVA 1GUYA 3PHJA 2JD2A 1IPFA 2POQX 2FOIA 1EEHA 1WMBA 2BHLA 4NG5A 3RC2A 4WUVA 3DWFA 5MGBA 4UUNA 1NXQA 2HMTA 3UCXA 4YAJA 4BVAA 4AG3A 3L4SO 4BKOA 5JAQA 4R4JA 3CSDA 1PWXA 4MKZA 4J1TA 5C3MA 5JCXA 3PJEA 3GDFA 1F8GA 4GAEA 5DBFA 3PGXA 1MXHA 4KDEA 4CL8A 3ZWWA 2VYVD 2PKRA 2XF8A 3OSUA 4IDEA 4J2HA 1SEPA 4GWGA 2ZQZA 4KTTE 1B8VA 1EBFA 3DHNA 3OP4A 5KKCA 4BNLA 1T25A 4WOJA 3WGQA 1OC2A 4TSKA 2O4UX 4QFDA 5IXYA 4J7UA 1KVSA 4J4BA 2CF5A 2W90A 3AM5A 4MJLA 1M75A 1ZK2A 1LQTA 1IZ0A 3ZU2A 3FNFA 2AE1A 3DBHA 3D7LA 3H3JA 1R12A 4B4OA 4XIYA 4Q39A 3NT5A 1Z7EA 2DBRA 3BMCB 1VRWA 5BT9A 2PNFA 2QIOA 5DOVA 5T64A 3NAQA 2Y1OA 1P0FA 1YB4A 2PY6A 1O8CA 2VZ9A 4JP3A 2O3QA 5U9CA 3QP9A 2C7VA 3C24A 3ZHYA 2P5UA 4E13A 3QWIA 3WBBA 3KV3O 3NDIA 4KWHA 3QVXA 3AOEA 1EUCA 3WTBA 5JE8A 4I9NA 1XEAA 3TJRA 2WMDA 4HUJA 4XB1A 1WP4A 3K31A 3UICA 2PD6A 4XIJA 2OORA 5BNFA 2JFFA 1PQUA 2D59A 5DP2A 1BSVA 1H2BA 4NPCA 4ZN6A 5GZ1A 2JKVA 2OGUA 5JPIA 1VLLA 1A4UA 4E0BA 4LISA 1C0IA 4OO3A 1TVEA 1GD1O 3BZUA 2DTXA 4ALMA 4S3MA 3VPXA 5T57A 1A4IA 3HG7A 2Q2VA 3GNTA 4PLHA 2BMAA 1GU7A 2Y05A 4OOFA 1ZK0A 3GG9A 4BO4A 2C0CA 4YBZA 3WNVA 3PJFA 1H5QA 4YXFA 4KQWA 1KVTA 1ISIA 2J5RA 3D3EA 4I5DA 5KVSA 4PLYA 4M1QA 3E5MA 3RUIA 1ADBA 2CVZA 2BELA 3WJ7A 5DULA 2WD7A 1BVUA 2NV6A 2Y1DA 3DONA 3FWZA 3V2UA 3WQQA 4BO9A 4DQVA 4XYBA 4JROA 1N92A 3U5TA 1H6AA 3HSKA 2BI8A 2OUIA 4MVJE 4XYMA 4B4VA 2QYSA 2WEKA 1Y5MA 3EW7A 3RU9A 3KRTA 1Y9AA 4RV9A 4PG8A 1N2SA 3G3EA 3F6YA 1N9GA 2ZB8A 4H16A 5TSDA 1AUPA 4MIEA 4RORA 1K6XA 3R3JA 2WYWA 5AXDA 5I7SA 1Y8QA 1Z82A 1E7QA 1Q7CA 3DEYX 3A9WA 1U4OA 3H7AA 1ADFA 1CRWG 2BGKA 3JQBC 4ZQEA 1DXYA 3AM3A 2J3JA 4BB5A 2FRDA 4YQYA 3TN7A 4ZRNA 1EQUA 5C7OO 2J3HA 2HMSA 3C7DB 4BGEA 4MVJG 5U1PA 3WYBA 2GGSA 4AVYA 3U09A 1A7AA 1PS8A 2EP5A 5L51A 1NPYA 2JHGA 4B3IA 1U7TA 4P22A 2C5EA 4KWIA 1JKIA 4BO3A 4L4RA 3RASA 5G4LA 1U8FO 3PQDA 1DFGA 4CJXA 4XGKA 2QQ5A 3VH2A 5F5NA 1HE2A 1T2AA 3BTSA 2ZYDA 4FFMA 2EP7A 1QYCA 5JYEA 1SEVA 2UUOA 2YW9A 2OFPA 4EDFA 1OBFO 3WIEA 1AN9A 2DTDA 2GZ2A 2AA3A 3V1YA 1P1KA 4G65A 3WGIA 1M6WA 4R1UA 1R37A 2H6EA 1O94A 1V3UA 1E3WA 3AOGA 3KO8A 3WDSA 1HDGO 1PSDA 4CUJA 1H9BA 4BNTA 3CINA 1E1NA 1CQJA 3DZHA 1NBOA 2DQ4A 5K6AC 1E7RA 5G2OA 1ENOA 2XOXA 2Y99A 4BMSA 4Q3NA 4BNVA 4GL4A 3PZRA 3DDNA 3ETDA 5BR7A 3GVXA 5A9SA 1PTJA 5A5FA 1C0PA 4EUEA 4IJVA 4UVDA 3B1KA 3PRJA 2VWGA 3SJ7A 1LC0A 4UVEA 4MDHA 4CM4B 4Q3CA 4WLFA 4IDAA 4BO5A 1H6DA 3PHHA 3JQFA 4BKUA 3RJ9A 1Y8RA 2OP0A 1T2DA 1BW9A 1Q2XA 2WJPA 4MVJI 5JMPA 3KEOA 3HUDA 1GV0A 3FBGA 1P1RA 4HFJA 4LRSB 4J6FA 4HBGA 1SZJG 2WD7B 5L7WA 1I2BA 1HDYA 2DLDA 3LLSA 1XR3A 2PD4A 1BHSA 2PK3A 4B3HA 4GVLA 2J5KA 4KOAA 1TT5A 4FFRA 1IHYA 4Z9YA 1HF3A 2VHWA 4LRTB 4U5QA 4U6SA 2YDXA 4YJHA 3RFVA 3F5QA 9LDBA 1CYDA 1P0CA 3Q2IA 3TZKA 4MVJH 4K6FA 4N5LA 1GYPA 4MVJD 3DB2A 3JYPA 3JSAA 4DLLA 2V6GA 1B2LA 1D7OA 3EAGA 3VZPA 4XR4A 3WGZA 1DRWA 4IDCA 4DA9A 5JFOA 4XRGA 1HE4A 1IY8A 2I3GA 1TEHA 3LC7O 4RVGA 3GEMA 4J4HA 3ZU5A 3QV1A 1HE5A 4OSPA 4PVCA 2X4GA 3KYDA 3ULKA 3SVTA 2G1UA 2LDXA 4HNGA 4WNIA 2O3RA 4XGIA 1BG6A 1PGQA 1WDMA 3OJLA 1GEGA 2JAPA 2XXBA 3OHSX 3QIVA 5JSFA 1UZNA 1EUDA 3CXRA 3HFGA 2X23A 4GLLA 2FP4A 4Q9NA 2CMDA 5F1PA 4OH1A 1SCUA 2FR1A 3BMOB 3UAGA 4NQZA 2VT2A 3PYMA 1U8XX 1ENYA 5THQA 3D5TA 3E6AA 4QSMA 3ZNOA 1PL8A 1N5DA 1NQAO 5KJ1A 5T5QA 1ID1A 4YJFA 1BXGA 1U3WA 3LLVA 4NFSA 1JWBB 4XWYA 2Q4BA 4L4XA 1XA0A 3MWDB 3E5RA 3HZZA 3PTZA 3TOXA 3ABIA 4E5KA 2W2KA 1HDOA 4O63O 1ISMA 2D5CA 5H81A 2VRBA 1XCBA 3LQFA 1XU7A 1NX6A 4JGBA 2WYUA 1YXMA 4JJGA 1M66A 3ZI0A 4MP3A 1E1KA 2PA3A 2E6UX 1P45A 1E3EA 3V2HA 1DIGA 4CV3A 4YJGB 4K6CA 2NU6A 4YRDA 3OQBA 5FI5A 2C59A 5JY6A 3CEAA 2YQ4A 1JA9A 1JQBA 3WTCA 5L40A 1NFQA 5ES3A 1I2ZA 2QX7A 3L4BC 1SC6A 1Y8RB 1QP8A 4CLOA 2I67A 1BW9B 3C8MA 1UJMA 4K9DA 1LX6A 2E48A 4KUHA 1M2WA 1DIBA 2H1SA 3WGYA 2D8AA 2WE7A 4RQTA 4CM1A 2YFHA 2G17A 2CDAA 2F00A 3PYLA 1M6HA 4J0FA 1R15A 4NBUA 4W4TA 1FDUA 5TJHA 3PJGA 3ICCA 2FHSA 2P91A 3H9UA 3KLPX 4OJNA 1SPXA 1ZJYA 5ER9A 1KS9A 3A14A 5CAEA 2FPPA 1PGPA 1SOWA 3E9NA 4TRRA 1ONOA 5JCJD 1J0XO 3KSDO 2D1YA 4A5OA 1I8TA 4R51A 3MZ0A 1YBVA 1EDOA 2FWMX 5CDUA 3RUAA 1A27A 3BHJA 1EVYA 4WLVA 1VJTA 2P9CA 3I9KA 3GUYA 2DKNA 3DMTA 3FPLA 2BGMA 4E5YA 5G0SA 4XKJA 3ROMA 2Y1CA 4C7JA 3U49A 5THKA 3ZV3A 4WLEA 4B3JA 4BO8A 1QSGA 4M8SA 4LGVA 3VKUA 1ZEJA 1NAIA 3BMQA 4INAA 1E7WA 4II2A 5LC1A 4WCFA 1ZKMA 1YL5A 1GCOA 3H2ZA 3NUGA 3DOOA 3LYLA 4D42A 4J49A 4JBGA 4ONEA 1F0YA 4IDGA 2VYND 4CM3A 3H9JA 2EV9A 1A71A 1K6IA 4RGBA 4BNGA 3FBTA 5BSFA 2HU2A 1XYGA 5FF9A 2X86A 4I9UA 1W4ZA 5L53A 4D0SA 3NDJA 2C5AA 2O2YA 1MUUA 4J7CA 5BNIA 4E31A 2D5AA 4U8GA 3F3SA 4I8XA 1YJ8A 1DFHA 4H3VA 1C3VA 4E3ZA 3KVOA 1WLYA 5AYVA 4NMHA 3I9JA 4AJEA 5F1KA 4ALNA 4K1LA 2NUAA 2W2KB 3QQPA 4GWKA 2NU9A 1QYWA 3RUDA 3VPSA 1UZLA 5C7LO 2CUKA 5IFLA 4CPDA 1E5QA 1CETA 3KXDA 2IZ0A 1HWYA 3CPSA 3SC4A 2B5WA 2DFDA 4R1TA 1NPTO 3OJOA 1LSOA 2GCGA 1DPGA 3ONEA 4FSHA 2AEFA 4HFRA 2FZWA 5T6BA 2B4TO 3GMDA 4J1NA 2NU8A 3EZYA 1R0LA 1C1XA 2JCYA 1A7KA 3ZHXA 3KBOA 2HMWA 4CM6A 5HRUA 9LDTA 2I76A 4E6PA 4YAGA 3S1LA 1KIFA 2Z95A 3WR5A 3HB4X 4FBGA 1ZK1A 4XYEA 1BXZA 5HS6A 2I9PA 1MC5A 3DBRB 1W6UA 4ZICA 5A9RA 1BXKA 5A1TA 5ITWA 1RPNA 2JL1A 5JBIA 1NR1A 3P7MA 4BKRA 1BDMA 4YAEA 4NU6A 5CDTA 3ONFA 3BMNA 2IZ1A 8ADHA 1K6JA 1NTOA 3W6UA 1AE1A 2SCUA 3JQ6A 5L3ZA 4J3FA 4S1VA 2BLLA 1IUKA 2YFQA 4PLTA 1CF2O 1NVTA 2X0IA 3VPHA 1ZXLA 3WGHA 3P5SA 3WXBA 4QUKA 3WX0A 3L9XA 2CDCA 1FF9A 1P1IA 4I1IA 2IYOA 4NFHA 3OBBA 4XGNA 3HDYA 1UP6A 4L9RA 4BKQA 2V7PA 2PTGA 5TX7A 3IP3A 2VZ0A 3L0DA 1ARZA 1LC3A 1F8FA 3B20A 3JQAA 4MOWA 4XDZA 4FCCA 1T2FA 4DQXA 2I6TA 3NT4A 4RJTA 3NTQA 1X1EA 4FN4A 4IQ8A 1WVGA 4H15A 5TRTA 2HMVA 1HDZA 3TRIA 3L4BA 3JQCA 2Y0DA 3MCVA 1R4MA 4XQ9A 3BMQB 4YTEA 1VI2A 4Z6KA 2RH8A 2YYYA 2NTVA 2VZ8A 1J49A 2EW2A 1T4DA 4FFLA 1FDWA 3UGKA 4II3A 1GR0A 2Y1GA 4P8RA 3ZWXA 3U4DA 1ZMOA 2IXAA 1ZSYA 6LDHA 2E37A 4O59O 5EESA 2P4QA 4FD3A 1YQDA 3E48A 1V9LA 3RFXA 3VPGA 3ZHZA 3WG9A 4DC0A 3VC7A 4EEXA 2EKPA 3I9MA 3ZCXA 3SJUA 1YWGO 5CDSA 3OMLA 2GD1O 1SMKA 4GQAA 4NK5A 4BHTA 5IZ4A 3GNQA 4CLHA 2EKLA 4OXNA 1SB8A 3QWFA 4D3SA 1GZ4A 3DZFA 4XQGA 4WE3A 4R3WA 2C54A 3AUUA 3LT4A 1KEUA 5ICSA 4XDYA 3VZSA 3NEPX 3AFMA 2ZKLA 1JAXA 3AY6A 4TVBA 5IDYA 4DIBA 2E4AA 2A4KA 1C1XB 4BOYA 1YB1A 5DDIP 1VM6A 4IQ0A 2B4QA 3T4XA 4CMBA 2OOSA 2AQHA 2WTBA 2CZCA 4J91A 4L8VA 1GDHA 1RWBA 1VL6A 3QWAA 4J9VA 2OP1A 1T2EA 4RF4A 3WQRA 1FXSA 1CWUA 2CD9A 3UF0A 5CHEA 1IOLA 3VH4A 1HYGA 1NVMB 2PR2A 2J5QA 3SXPA 4O1MA 5T8KA 2PGDA 3EVTA 3GUCA 4L0QA 3G1UA 3RJ5A 3EUWA 4AJJA 3RI3A 2PH3A 4W6ZA 2EIHA 4Z9FA 4YPOA 4YVFA 4CMKA 3K30A 1LXCA 1M76A 4J1QA 4RVDA 5HM8A 3BHMA 3HB5X 1BMDA 4RDIA 3D4OA 4MKRA 4IXWA 2X8LA 1W8DA 3GHYA 3RBZA 3D4NA 4GX1A 4WK6A 3S8MA 3UN1A 5JC1A 3OIFA 4XA8A 3JTMA 5I9NA 1DFIA 2D4AA 5COBA 4ALKA 4ND1A 4RO0A 2PKQP 1UR5A 2C2YA 2D0IA 4TVOA 1GADO 3AW9A 5L45A 4HADA 3K96A 4LVUA 1H9AA 4PVDA 4DMMA 2ZTLA 1MV8A 1JVBA 1ISHA 2EJVA 3RUCA 4NBRA 5TT1A 4R01A 2AG8A 3GY0A 5F21A 1F14A 3QVWA 2AQIA 4RF3A 4GPD1 2Q4EA 3CIFA 3PWKA 4XX0A 3V5NA 1S6YA 1X7GA 4AJKA 4I08A 4ZRMA 4FB5A 2QRKA 3FF4A 3TF5A 3I6IA 2GZ3A 5JAZA 5CDGA 4A2CA 1B0AA 3I6QA 3L07A 1PJ2A 2ZJ1A 3JQDA 4XJSA 3EC7A 1W0CA 5JYDA 2YDYA 3OEWA 4XYLA 3ENKA 3BXXA 3FTNA 2VHVA 3JQGA 2DC1A 2R6JA 4QO8A 2P68A 3K6JA 5IAAA 2DT5A 3ZWBA 1EE2A 3NT2A 3VH3A 1TI7A 4A03A 4YA6A 3DZJA 4WASA 1Y81A 2HK9A 1OFGA 3LZ6A 4PCVA 1CIVA 2NM0A 3M6IA 5CDYA 3DHEA 3D3WB 3KSZO 4BNFA 1ZVMA 2P4HX 1YL6A 4IMPA 2VCYA 3KUXA 5HTOA 2YHIB 3OQ6A 3Q2KA 3ENNA 4ZVVA 3OETA 5CP8A 4BO1A 2HRBA 4JIGA 4XD2A 4E33A 3RFTA 2J8ZA 3CE6A 1ZSNA 3GFGA 2O3TA 3VHRA 2CY0A 5IJZA 5A03A 4G5HA 1YRLA 2HJSA 1E5LA 3K5PA 2PFGA 4TKMA 3WMXA 5ILOA 2P9EA 3F5SA 1LU9A 1RM0A 1LRJA 3GAFA 3GDOA 4BO6A 5TS3A 2BFAA 1PJBA 5JO9A 3KB6A 4RVUA 3JYOA 5KVCA 1DHRA 2TMDA 3F46A 1XQ6A 4EYEA 3PHIA 1VSVA 2J3IA 3KYCB 4YT8A 1DEHA 5B4UA 5IDQA 5EERA 5JLAA 1GPJA 2FR0A 4Q3EA 5DCWA 2JHFA 1ADCA 1K2WA 2YQ5A 1K3TA 3IC5A 4M86A 5G0VA 5B37A 5L7TA 1ULSA 2W2LA 1U3VA 2I66A 2NVUA 1GEEA 4N54A 1ISFA 3IL2A 1O5IA 5ER6A 3Q1LA 4BQPA 2YJZA 4EBFA 1GYRA 1AHIA 3B70A 3OH8A 4BNNA 2GLXA 3PIIA 1QYXA 1KC3A 3KTDA 4QO7A 3F4BA 4CLRA 1E6WA 4U6QA 1ENZA 3ZV6A 3V1TC 5KCZA 4WPGA 2JAHA 4ZQBA 4MO2A 2C29D 4E2WA 3S2IA 3ZV4A 2F1KA 1Q7BA 2HQ1A 3GF4A 1KY4A 3BYZA 4LMRA 1PGJA 1F12A 5DCUA 2AQ8A 4IS2A 4NK4A 4CR7A 3DZBA 2XXJA 3H9GA 1EZ4A 3UVEA 4G2NA 4AJHA 4U0KA 8LDHA 2UYYA 1XELA 4UREA 3RROA 1Y9EA 4CUKA 4IGEA 3VVCA 3WGOA 1PGOA 3JQGB 5I8ZA 3GMSA 5GZ3A 1T24A 3OJ0A 2JCXA 3QLJA 3VOSA 1I32A 2DAPA 3PVZA 3R1IA 4RPJA 4K28A 1YO6A 2VTDA 4HNHA 4UVIA 4B7CA 1C0LA 3KZVA 3F1KA 2GF2A 5ENDA 1HDCA 3RU7A 1MX3A 3I52A 1DIHA 1Q1NA 5DOZA 4R1SA 2H5LA 5C5IA 5JDCA 3A28A 3UKOA 4CMIA 3DBHB 4MKXA 1B3BA 2B35A 1X1TA 2IODA 2WD8A 1VL8A 5J23A 2BH9A 2VWHA 5KJEA 2FPGA 3W1VA 1I5RA 3MJTA 2IEBA 3HE3A 3QE3A 4RVFA 1VJ0A 4XCVA 1YH3A 1KC1A 3DO5A 5DZSA 5FEUA 4IQGA 2CFCA 2V6FA 2X5JO 3MTGA 5DBIA 4B79A 2CSUA 4Y8VA 5U4QA 3C3XA 2QRLA 2PV7A 4PRKA 3G49A 4Z0TA 4EUFA 4QFCA 2JJYA 1FMCA 1NHGA 5JXWA 2AHRA 2Q1WA 2NQ8A 1ULUA 4DC1A 1Y7TA 4IM7A 5A02A 2NWQA 1R0SA 1UDBA 1RM4A 1XGKA 3GFBA 3OFSA 2ZCUA 2EEZA 3GG2A 4F45A 3HFSA 2ZTUA 4MVJP 4XJTA 4DWVA 1TT7A 2R00C 3FPCA 3R6DA 1YBMA 3ZDFA 5IZCC 2BFPA 3H3FA 2W8ZA 4L4SA 2YV1A 4LW8A 1YDEA 1X0XA 1UDAA 3NGXA 4N18A 2RAFA 4NFYA 2NVUB 3U0BA 1OI7A 4ID9A 4RVSA 2JFHA 4JX8A 1O0SA 3VZRA 4M87A 5IN5A 5F1OA 2V6MA 4KTVE 4UAGA 3FTPA 2EHDA 3OEYA 3ZW9A 1OZAA 2YY7A 4HFMA 3ZU4A 4CMJA 5GZ6A 3LF1A 4CQMA 4BMNA 4XZ3A 3GLQA 4KMSA 5EIOA 5L95A 4L74A 5GY7A 4KUGA 3JQ9C 4RPKA 2RH4A 4E2YA 2WSBA 3MJEA 4IGFA 5CPFA 3ZWOA 1LUAA 1JW9B 2DVMA 4GX2A 3WNQA 4P38A 3EVNA 3NV9A 1HL3A 2VTEA 1ZBQA 4TRJA 3AUSA 1R4NA 3VTZA 1N9GB 3TNLA 1E7SA 3GR6A 3JQ8A 1C14A 2DPHA 2J3KA 3AUTA 1NQTA 1Y8QB 1JWAB 2YHUA 2CVOA 3BTVA 4R54A 1NM5A 4ND3A 4FFOA 4I5GA 3UW3A 4EW6A 1ZNQO 3JD2A 4EJ0A 4PLCA 4ZJUA 1P74A 3NGLA 4YB8A 4HP8A 3ZN2A 2AQKA 2FN7A 4PG4A 4BO0A 1YL7A 3Q3CA 1PJLA 3IKVA 4BO2A 3ZU3A 2DPGA 1NR7A 1O89A 3JYQA 4AICA 3H5AA 1OC4A 4MPDA 4UEKA 2HLPA 2NACA 5IDWA 1R66A 4GX0A 2X0NA 4FJ1A 4CM5A 3H6KA 4HWKA 4BGIA 4P4GA 4Z9XA 5DP1A 2AEMA 4LSMA 2GERA 4WNCA 2B0JA 2B4RO 1OMOA 4ND2A 4BNMA 1DC3A 2DTEA 5HWSA 3V2GA 3Q9UA 3EK2A 1I0ZA 1P1JA 1KVRA 4DGSA 1PJ4A 3INGA 2PWZA 2VT3A 3C1AA 3PLRA 4DYVA 3WLFA 1B8PA 1E3WB 2E49A 1EDZA 4FOOA 2AG5A 3C7CB 3PJDA 4NBWA 2X9VA 1G6KA 1KEVA 3QVOA 5B4TA 1TA4A 3RKUA 3JQBA 5H83A 4F3YA 1I36A 3CZMA 1U3UA 4ZQFA 3I23A 1Z74A 4XRRA 4HV4A 5A9SB 1CJCA 1G0NA 1YE3A 3KLMX 4AJNA 3GVIA 1D8AA 2P5YA 5TJ9A 3I4CA 4YRAA 3WBFA 1JKJA 3INRA 1Z73A 3H5RA 3I83A 3PHGA 3QJ5A 1D3AA 1RM3A 4TROA 4AJ2A 4TRNA 4QEDA 3O8QA 2PGLA 3WB9A 3L9WA 1PS0A 4YT2A 3DBLA 1HTBA 4CMEC 4QX6A 1JTVA 3RD5A 3FI9A 5A05A 4Y9DA 2C07A 1T4BA 2W98A 1U5AA 3OM9A 4K26A 1E6EA 1NQ5A 3MJ4A 3E82A 2BD0A 4D7AA 1YGYA 3X2FA 2FZEA 4CQMB 1UDCA 4Z0HO 3WFIA 3ZWVA 4GLOA 3GVCA 1WDKA 1K0UA 4BGUA 3PFWO 1PZFA 3RUHA 4YAKA 1ZK3A 3TZHA 5EJ2A 4D79A 4B4WA 1E7MA 3F1LA 1TT5B 1W73A 1YQXA 4YJHB 3JD3A 5ICMA 1Z7BA 3P2OA 1QRRA 1WWKA 3ITDA 1R16A 1QR6A 1V6AA 3DOJA 3QA9A 4WLNA 3TWOA 1I24A 3ZGYA 5A5EA 5K6AA 2OO5A 6ADHA 3TL3A 3ZWCA 1UXGA 1A9YA 2CVQA 3OECA 1V35A 3RUEA 3ZWMA 3ZWYA 1WZEA
chains in the Genus database with same CATH superfamily
1T5TA 3H8VA 1O87A 1YB7A 2JFGA 2X6QA 3A6FA 4PG5A 3T7EA 2C8KA 2IE0A 2Q5JA 5HIIA 3LGSA 3NHSA 2WVJA 1SULA 1E9FA 1B23P 1TMKA 2EW8A 2QYOA 2IKSA 2DEUA 1WKVA 1X13A 4IHAA 4HWGA 4XQEA 3SFTA 1MQ8B 2AC2A 5K3DA 1XKQA 3LHFA 1L6IA 3VU8A 4JDUA 3GGGA 1CG6A 1P4GA 5BQFA 2G6TA 3LP8A 3HVKA 4OJMX 4RZHA 4G0ZA 1OPRA 2NSLA 1SCUB 5DKFA 5FWNA 4L8YA 4CUZA 4I66A 3OIDA 1LSSA 4UNNA 5FO0A 1RCUA 5CYOA 4D4GA 2O52A 4ZYUA 4HH1A 2EP8A 5C1PA 4OHKA 1Q0SA 4YI5A 3GQBB 1JU9A 4Z0NA 3VAZA 4C29A 3Q72A 4HAVA 1AVTA 1G20E 2CW5A 4M7PA 4LBZA 3LRXA 1RLJA 2MR6A 3G79A 2R7NA 2I0FA 3WSVA 5B7PA 4G3XA 5G4KA 5DLYA 4YQFA 2XYVA 2Q3CA 3UOWA 4RK7A 5K8TA 4WXPA 1Z26A 1G6HA 4B6OA 2XXAA 2BDTA 4UBJA 2IELA 4US1R 4KZPA 4O4LA 2W4QA 3TZLA 2A9OA 1XCLA 2PRJA 2WP0A 3UCFA 1IM2A 4H6PA 5KYGA 5CCEA 2HJVA 2EFHB 5JS1A 3C15C 4F2DA 2EAUA 1HETA 2I4IA 3PS9A 4MR9B 3HSYA 4GMFA 5F1YA 3IMEA 3UT5B 4G0WA 3A4YA 4F3CA 1E3IA 1JHPA 2GEKA 3EFEA 3KWFA 3BMXA 4MI6A 3RRMA 4M83A 2PUBA 1N34B 1JSLA 2X5OA 3F2IA 1QGUB 2A3NA 1AKUA 3EPHA 3ZTYA 4YS6A 3NWEA 3PC8A 3VH1A 5L9AA 4C0BA 4HZIA 5AQ1A 2FMFA 3TKYA 4UCXA 2VP3A 4LJ5A 3U9LA 1DOHA 2HDNB 3U9SA 4DIFA 2BEVA 2UU9B 5P8WA 1UXJA 3QBTA 4AJLA 1Q0HA 3A9RA 3LMKA 5AI0A 1TM3E 1TKCA 5AJWA 2WB2A 1VP9A 3I28A 4PINA 2G5CA 1T9BA 2BFCA 3H11B 3NYWA 4XARA 3SEQA 4EMUA 4UOEA 2FMTA 1YRHA 3MLEA 3OZEA 1ZH2A 5J2TA 1KNQA 2OENG 3VU1A 221PA 2VN8A 1DVRA 3C1OA 2XTNA 3DQQA 4M49A 4LFCB 2PGAA 4J3NA 4UDOA 4BNXA 3IJ5A 2NTNA 4Q19A 1KYWA 1P0MA 5LN1A 4QUBA 1FL9A 4DDKA 2XUFA 1MTZA 2WE8A 1U02A 1Y8CA 4TV9F 4OB8A 5CLIA 3VRHA 1YVDA 3VSCA 5EIXA 4UAJA 2FPPB 5CIWA 2ZRKA 3M9LA 2VAMA 4HWOA 3ZVLA 3HN6A 4PYRA 4CLXA 1Q91A 2AZTA 2R2GA 2PQ6A 1YQEA 4TTSA 4XEUA 3TL2A 5DO9A 4K9QA 1MPTA 5JJKA 3TOSA 4DLVA 1TU3A 1FUKA 5PNTA 2QRJA 5TB5A 2FG7C 3TQTA 4LRUA 5H02A 2YXEA 2R8RA 4ZVPA 3W8EA 4ZJZA 3W6ZA 3WYAA 1YJCA 3G0OA 1OR8A 3HBLA 4MB2A 4NZZA 1ZW1A 2EX4A 3PK0A 4IO1A 3VGJA 1FS4A 4A1FA 4CL0A 4RDHA 4DYDA 4NJOA 4NKRA 3MGCA 3KQLA 2IS6A 1FUIA 1OHHA 1Z8FA 3ST7A 2OWDA 2WSIA 3TTWA 4W6QA 2HLDA 3HKCA 3ZV7A 4D25A 1PWYE 3Q2OA 1XJQA 4H17A 4E1VA 5IM4F 5DCYA 4OLAA 3KQKA 3NHLA 1KBQA 1I30A 2DUWA 1IHXA 3Q7TA 3FZEA 4OOEA 4PZYA 4C5AA 9GPBA 1ZS9A 3ZWKA 2ZQYA 3NQ41 3TAXA 2EKDA 2YYAA 5F9HA 5DBHX 5EPOA 1MFZA 3UCEA 4OJTA 4E5DA 3L6EA 4OATA 4N5MA 1I1QB 3NBZC 1PIWA 2JHPA 2MJLA 4G85A 4ND8A 2FMKA 4IV5A 1YVEI 1DDIA 1Z45A 3HN2A 3PNVA 4Y2TA 4A6EA 1XZFA 4RW0A 1IHOA 3P94A 5FV4A 1EFHA 1M6YA 1PNTA 4FEAA 4F5DA 3GCWA 1CHDA 1XDZA 2E89A 4HNAB 1GSOA 1LSUA 1PSWA 2ZU6A 5AM5A 2P2ZA 3TKAA 2DYKA 5E7IA 3U7IA 3VU0A 3U3XA 3LYAA 2PU7A 2VRCD 1QG6A 1IPHA 4G4SP 1P5JA 2EKBA 1CUWA 3RUIA 3W7AA 3Q12A 1N3BA 3A06A 4WEOA 3QYPA 2EGUA 1QQTA 3F4LA 4OUDA 1NFRA 4RA9A 5LDHA 4N5DA 4YMGA 3DUFB 5B6PA 1X1CA 4DUYB 3TIVA 1VHJA 2R8XA 2CMFA 1H2FA 3AOEC 4MR8B 1AGYA 1PCXA 2GK4A 5KNDA 3AETA 4LTNA 3V8VA 4D9CA 1UEIA 1VJ1A 2WYVA 3RS0A 2YKGA 5KHOC 4KQ9A 1GARA 2QV0A 4TMVA 2PFSA 1E3QA 2Y0CA 2ZDHA 1ORTA 3LO8A 5HOEA 2BKAA 2GBGA 3A1TA 4EKNB 3U3KA 1NC3A 3KR9A 1TMOA 3DZIA 1GA4A 3KQMA 1QO7A 4Y2RA 5BSUA 3NBFA 3DR3A 3O7WA 4V0ME 3PT9A 3UNXA 1SHJA 3TMKA 5KU1A 3COZA 4Z7NB 1OZ0A 3ZQ4A 3GCGA 4XXHA 5A5DA 2FWBA 2TECE 1UM8A 1CUIA 4KXMA 4RL4A 4TLMB 4Y6QA 1NSTA 2FB9A 2VPTA 4ZEOA 4J16A 5BW4A 3TZCA 2BGGA 4XD7A 4X97A 3PICA 4OXYA 4LC1A 4MUJA 2FVXA 5FFMA 1KTIA 2FQ1A 4GLJA 2C5SA 4ZJPA 3L05A 4NECA 5FTJA 4MX8A 3DTYA 4DMFA 3RCBA 3IV7A 4MGHA 4EGQA 1ZOLA 2SCUB 2WG1A 4MCIA 2FQXA 3FRJA 4MYSA 3W4IA 3JPWA 3LC2O 5T6MA 1E94E 4PSCA 5FAXA 1PUXA 1VYVA 3KHKA 3ROTA 4HZUA 4B2PA 5HUQA 2ZP1A 4LTDA 5BWNA 3BRWA 4I4IA 2QG4A 2M6KA 3IEMA 3A1VA 2EXXA 5LDGA 2C4UA 1EB9A 1LPBB 3W4JA 5BN5A 3TFOA 1RPAA 3M1LA 2UUBB 1TUBA 4FS3A 4HO1X 2ZE8A 1E1MA 1D6NA 1OKKD 4Z0PA 5IUNC 3Q4GA 1J5EB 1JKFA 3QF4B 1MA0A 1C3OA 4KGDA 4Z3DA 1WR8A 2OWEA 3M5CA 1PT6A 4DLBA 3RKRA 1HV8A 3IUQA 4D57A 2P6MA 1V47A 3FFBA 2YXLA 4KIFA 5FLEX 2A1TR 4MWCA 4YONB 1H4VB 3VNBA 2L69A 2QD1A 1JQ3A 5A4DA 4KK3A 4LC9A 3BFVA 2GR9A 4OYLA 4WLUA 5LA6B 1JVSA 3USZA 1Z34A 3WYEA 1FYWA 4K9KA 2CL0X 3WYCA 1R0XA 4GZ5A 3WMEA 2OXEA 1LLUA 1SCNE 3K0EA 4QOJA 5ALFA 3V33A 1GV1A 4GX5A 3RC7A 3HUEA 4CV1A 4LUCA 4IV0A 3KVYA 3GFVA 5BYBA 4NNJA 5EPUA 4Q4DA 4B48A 3SXUA 1JG7A 3C6YA 1G8SA 1PDOA 2ZWVA 3P0IA 1ZQ9A 4AQYB 5CGQB 2J9GA 1V7ZA 1C8LA 1IULA 3P9SA 2I1VB 1YRYE 4YT5A 1HDEA 1K7SN 4WHMA 3HDHA 5TMPA 4RGVA 5D1NA 2R6R1 3EXHB 3KPVA 4E88A 1TZKA 2XTZA 1SBQA 2MSLA 1VB3A 1L5FA 2IY7A 4IH1A 4PIPA 2ISQA 3TRKA 4ADSG 3JR3A 1DCFA 4J1SA 1QPBA 2NTYC 1QCZA 1XDDA 2QZ9A 1RQ2A 1JI0A 1VCIA 5IXJA 4QECA 3IIMA 3T3HA 2IVFA 4H3KB 4MQEA 1IYZA 1UPUA 3GP5A 3QG1A 4KPGA 4P36A 4AKSA 1UP4A 1CS0B 3PFBA 3OKAA 3O2JA 1BJTA 3IMKA 1VJRA 1XVVA 1MOQA 2FTKE 5HA5A 4IO0A 3A1WA 4PN3A 2D1SA 3OQJA 2Y67A 3CH6A 2IP2A 5FOTA 3AWDA 4DV1B 4UBIA 3UB3A 4HNTA 2O6HA 1QF9A 2WK1A 4WWHA 1PSZA 2WUEA 2FN3A 2D6FA 4WCVA 1J2RA 4ENTA 1EWRA 5JJIA 1RWOA 2VQSA 3CMMA 4NJMB 4O4HB 1CY8A 1WCIB 3B3JA 3ITNA 3O47A 4KQEA 5AVUA 2FUCA 4KE8A 1ONNA 3B6MA 1DQSA 1E60A 2OBYA 3NBQA 1C0EA 4O2AF 5DEOA 4AT1A 4BN5A 1HORA 2WWGA 3HVRA 2FN4A 3DFKA 1G5RA 4R2LA 3I34X 3RREA 4ETMA 1TVKB 3QY0A 2QV7A 3I1YA 4DSAA 4Q18A 3PQ7A 5BRJA 3R4CA 3KT0A 2AJTA 4BNWA 3TUZC 1F3LA 4HXEB 3AF6A 4KXLA 2C2XA 3H2SA 3HL0A 1ECLA 4ZO4A 1D1PA 2BHSA 2G63A 4W9NA 1BDBA 5CNKA 3TTVA 1QHHA 2WSYB 2A9VA 2W4IA 4IJWA 3ROQA 1QHXA 2HSWA 2NW6A 5AUNB 5CR9A 3PRYA 2ANCA 1B42A 1ZJ4A 2UYQA 2WJVA 5BVGA 1VBNA 2RGWA 3H1AA 2CCGA 1Z13A 1HTTA 2QT9A 5DTIA 4KJXA 2H17A 3R5SA 2VP6A 4RF5A 1U3CA 1JR3E 2WF6A 4HQRA 2PS3A 3RE1A 3U3JA 3QVVA 3MTIA 3LHKA 3LCUA 4A27A 3SBEA 4C4AA 1MHTA 4KR6A 3HCBA 4JIMA 4QBTA 1SXJD 4XPIA 1DNPA 3EIWA 3I3OA 5LQJA 1XIVA 4EFLA 3TO5A 2ZWAA 1A9ZA 1Z6ZA 3H4VA 4N82A 4X85A 2VJCA 1ENPA 4ZDKA 2ZLBA 5M5BA 3USES 5ALNA 5BOVA 2PLWA 3R9WA 3FWKA 3BSFA 3WWYA 2YZ7A 4CMGA 3IS3A 2QRPA 4EPYA 3KUKA 4P81A 2OESA 4GPIB 4I19A 4IIFA 4B74A 1RLTA 1HXHA 4LBVA 1YR8A 5TY0A 2GN8A 4H7PA 4MVWA 3U1VA 2ZATA 5DNYB 1RI1A 1LBQA 4QNRA 1XRRA 1SBYA 3ZY2A 1GUZA 2PPLA 3VTFA 3G2OA 2Q1SA 5LU8A 4G86A 3E9EA 4XX0B 3WYDA 1T4GA 2VNHA 3PDCA 1AIPA 2ZBFA 3AHIA 3TGWA 3W5VA 2FPOA 2Z2YA 4GSLA 1ZD4A 4PIVA 3PD0A 2GPWA 1MG0A 1QHNA 3OF2A 4N49A 3RYFA 3IRUA 1U5CA 1P3DA 2XUKA 3VX4A 3ODPA 4IVNA 3DMNA 2NMVA 3RVDA 2QR3A 4G01B 1M0SA 2DCMA 2O7SA 3O3OB 5EC8A 2XVMA 4PZAA 7YASA 3MTAA 5JVDB 3L6DA 4GSYA 2A14A 1Q0LA 1E1RD 2P9GA 1B26A 3D3NA 3EC1A 4LYJA 5A4AA 3RK1A 1KWGA 5DX1A 2IK8A 3OZWA 3ZDDA 4PZEA 4MUIA 3GT3A 2JF0A 3EMVA 4A8HA 4BL5A 4AYTA 1LDMA 2YHAA 3CUVA 2WOJA 4RKFA 5CG1A 1J2UA 4TM7A 5BY2A 4LOJA 1U65A 1JAYA 3IAAA 4ZOEA 4BEWA 3QLUA 1OIXA 3ZLUA 2Q1XA 1IFXA 7ADHA 4FNGA 3EY9A 3PD7A 2YWFA 4XM1A 3URMA 2A0UA 1QHIA 5FI3A 3E9YA 4LXQA 4QT4A 1XJCA 3SJAA 2R60A 2OXRA 3A25A 3RT9A 2PH5A 2Z43A 4MCJA 3CYFA 2QY9A 1ESNA 4CIVA 4L6AA 3BN3A 1EQ2A 3GT0A 5IU6A 3ECSA 2SKCA 1NW3A 3C5EA 1W46A 3CLTC 3ESQA 4GYJA 4ND6A 5AKEA 3A2KA 4JL5A 2GPJA 2RKBA 1GHTA 4J0DA 1LDBA 3SE0A 2HMUA 3CRMA 1I3KA 3Q7RA 1QYDA 3STVA 1ORRA 3MINA 4HWTA 5TNXA 4ZOQI 3TG8A 1E0SA 1P39A 4LK2A 4B4UA 2RGXA 3PTAA 1FC0A 1X7YB 3D6HA 1KEPA 3GPBA 4NE9A 4EB6A 1GN8A 1M8FA 2YTZA 3QPUA 2ZWIA 1HE3A 4XOIA 1ZUNB 4AMYA 2PA0A 4D97A 2YVKA 2R1UA 2A58A 2NADA 4DCCA 4L51A 1A9TA 3WV5A 1RLIA 4GC5A 1V9CA 4O0MA 1TYEB 1YZQA 2BZ1A 3EISA 1LH0A 1Z6YA 2C1XA 4QUJA 4CV2A 2QD4A 5I7FA 2WM8A 2I2XB 1IM8A 4G97A 4MWSA 4OB7A 5B30A 3RSFA 2P2CA 2WAMA 2J6HA 4XWGA 4CG3A 4YRCA 5E6RA 1S1MA 4ZYWA 4S2UA 1OBHA 1XI2A 1HEUA 1G5HA 3DAFA 1CR1A 5KHAA 1ZHHA 2PJDA 3K3PA 1AXRA 2QROA 3Q7QA 4IDBA 1T0UA 3RVQA 4DLPA 3ZD8A 3S4YA 3MS7A 3D6UA 3DFZA 3FCSB 3DVAA 2OC4A 4ARZB 2DFLA 1LLQA 4H1TA 1VOTA 4QEKA 2ROQA 4HQLA 2ZTVA 5BUCA 3A10A 1T6XA 2LWIA 1GGNA 4FC6A 4IIYA 4W8GA 3IGFA 2P75A 3BIOA 4WY8A 4NXMB 1WUTA 3GNSA 2R44A 4C0LA 4HVLA 1DGQA 1D1TA 3IHWA 1K4YA 4V1CI 3AONB 2P79A 1QO0A 4TL6A 2PGNA 4R68A 3M3PA 2DFVA 3DMTC 2PH7A 4YJGA 4DNOA 1JEJA 3V4ZA 2QBYB 2VBGA 5CCDA 1XNHA 1Y1TA 4M1ZA 3FJOA 4S24A 3WLEA 3B60A 2HADA 3RSCA 1NU8A 5A0FA 3OAAA 4L4UA 1IXRC 2L18A 4K86A 3D0RA 3AY7A 2Y9MB 2DHRA 4KI0A 1FTWA 1NMSA 3OWOA 4UXIA 2GUGA 3NKLA 3QBDA 3ROXA 5BWLA 1C1DB 4CVNA 8OHMA 4Z4IA 2DWUA 5DIZA 5LNK1 3FBWA 3MFQA 2G71A 3OQIA 2QZPA 5JASA 1FTQA 5KOHA 2VTBB 3FMOB 1N3LA 4LVCA 1Z29A 3ZCTA 1KFEB 2X3UA 3KFLA 1UK6A 2PWAA 4PPQA 5AYVA 2ADFA 1UXHA 5HDBB 2W6MA 4BRUA 1JPNA 2WDZA 3QOFA 5EJIA 4FLEA 3LA8A 4HAIA 1PNQA 5I9BA 4B3DA 1J99A 1D4AA 3TQQA 1R3UA 2WM3A 1MO5A 3WK6A 1YUBA 4H6WA 3SZ3A 2H2DA 3ORSA 3FXAA 1O97D 4D44A 1QKKA 4CMIB 4JT2A 2IHJA 3TB4A 3ZV5A 3ZNNA 4YC7A 4PTLA 4LJYA 1FVFA 1YCGA 4OLFA 2QG9A 2XQJA 3UUWA 4TZ0A 4FBLA 1QH1A 1C7JA 4S04A 1UBKS 2V74B 4Y1RA 1O6FA 3H9EO 2QJWA 4ZU3A 4MP6A 4X6UA 4CEIA 3EZ2A 4CI0B 1EK6A 4F3TA 1QDUA 4B31A 3HWSA 1OYOA 2B7BA 3TTXA 4N03A 2PANA 4A0SA 3NBYC 1UPCA 2TS1A 3UPTA 2J1LA 2ZXUA 4PX5A 1JKMA 2FJPA 1TTPB 2XYRA 2CGEA 1ZIOA 3AF5A 3TZ6A 1AKQA 1AY0A 1E2EA 1CQWA 4TKVA 1XOIA 4AAYA 2QUBA 1DIAA 1T9DA 2C3PA 3GJ5A 1XZMA 4UTNA 1FE8A 2C4KA 1V1MA 2JFZA 3EAQA 3G2NA 2LDBA 4PCAA 2YYSA 2PIDA 1VYTA 2Z5LA 5JSYA 4R71A 4QUIA 3UGTA 1Z7WA 2CWDA 2VDNB 3BWXA 1ZN8A 3MMSA 1Q1GA 5LZ4A 1M83A 1ORDA 2JJMA 2BRUA 3L82B 4LI0A 3ZWNA 2FFAA 5K09A 5A4FS 4LCJA 5J3JA 2Q07A 3KAQA 4EJ2A 3DEAA 4N12A 1A76A 2BVNA 1M6VA 3MWKA 4CIXA 3A31A 1UKCA 4RVHA 2OAGA 1Q19A 4HS9A 5IKPA 1WRBA 3NBKA 3KM0A 1ZD9A 3ELDA 4OLBA 9MHTA 4BP8A 2IXBA 2CT8A 5FUVA 1JG2A 1NN1A 5JW6A 4KQXA 2BFEB 5AOVA 4C2AA 1YC5A 3C5HA 1H9CA 1HT2E 1D4FA 2JEZA 2IYYA 4FQ8A 2BHRA 2NO4A 4A0HA 4HPWA 2RIRA 1JIKA 1GNSA 2XA2A 3A27A 3DFUA 3E18A 4Y0NA 2C7GA 4W82A 4WXRA 2MU1A 4DABA 4RTSA 4BFTA 4TYNA 4K8RB 3HV0A 3VR2D 4E2XA 4IIEA 5EP4A 3U31A 2ONKA 2V9PA 4QULA 4KPYA 4GOOD 5LXTB 3J80A 3HWX1 4AROA 4C0JA 2A92A 4S35A 4HTFB 3ND9A 1XJ0A 1FLAA 2ZZKA 2H1CA 4LXHA 3L49A 3ZQKA 3EA5A 1Y4ZA 3DBRA 2GFQA 3WAKA 4LBWA 4NH4A 1DJOA 2R00A 4R5HA 1GLVA 1LPAB 1SU6A 4NV1A 2ZSKA 5FWXB 4MV1A 1M67A 5AVYA 5K0CA 2O8DB 2JIMA 1VKOA 4NVRA 3T1YB 5JHHB 1PJZA 3DCNA 1PL7A 2HJRA 2JJ2D 2O07A 3RS8A 3ETHA 4YGYA 3P0HA 1GKUB 1C3LA 5AI8A 3WK7A 1H1LA 2JIBA 4PAGA 3GGOA 5GWXA 3N05A 1E2BA 5HKLA 1CSEE 1HDIA 1H6CA 3ZDRA 4RLHA 5B1YA 3DW1X 4R9SA 3S5JA 2ZIZA 1XDWA 3TLYA 4IIUA 1KQFA 1XTVA 4Q4AA 3WYNA 4MIYA 3BIJA 4M0FA 3THYA 1CUDA 3CCCA 3IT0A 4F8JA 4PLZA 2MMCA 2XBLA 3HV2A 4EG5A 1OXUA 2NPOA 4Z4EA 3JQ9A 4JLOA 1J07A 4XPZA 4I1VA 1EM8A 1G8MA 1TCAA 2ID8A 4RTQA 5KNCD 2O48X 2HIGA 3CRRA 2GWRA 2IPLA 3VPAA 1SU7A 2P9BA 5HQ3A 1RZVA 2Q5CA 1WQ3A 1PR4A 2R8EA 3H2IA 2O4CA 4Y18A 3R8FA 1ABFA 1D2RA 1E1CB 3K72B 4LZPA 5FWYB 4AJ4A 3MPOA 5CFZA 3K70B 4X66B 5FOWA 3N1UA 3AX6A 2GS9A 2ARKA 1O6BA 3PGMA 3ZHUA 4BU0A 1LI4A 3E8SA 1XRJA 4HX5A 2XDQB 5D5PA 4UTXA 2C96A 5CT6A 3WLPA 5A06A 1JYEA 1LW7A 2XAUA 1ZUD1 3BA1A 3EEYA 1RPTA 1PEDA 2HDOA 4PGMA 5T4BA 4US0R 1CJSA 1XZBA 3SJCA 5H3LA 3IPXA 4QXMA 4Z3KA 5DIFA 2YXPX 4ALJA 1SO8A 1I1HA 2AYZA 4UNIA 3UWMA 4F3KA 2HREA 2BGLA 4PN7A 5AVOA 4F3NA 1PD1A 2FR8C 4UCWA 3SN6A 3RHTA 4ZCPA 4B87A 1D6SA 5AHWA 1ODIA 1P1BA 3CX7A 1SKYE 2HUNA 2WTAA 1WMAA 3T5TA 2WNSA 3KR0A 4QXOA 1EAYA 5F51A 4BCBA 4H77A 3KU1A 3ITKA 3R5KA 4EO7A 3L4JA 5BSHA 1AKRA 1MAWA 4A7PA 2JFWA 2B83A 5I4KA 5BP7A 2JGEA 2BGIA 4C0QC 1X0VA 1AT1A 2NVWA 4NQRA 4PC6A 2FW0A 3A9UA 4CKBB 2GZSA 2ZE7A 1NIJA 3EWIA 1NP7A 3NEYA 2VWQA 4YEDA 5IASA 3DDCA 2QK4A 3FVRA 4PXYA 2RHCA 1FTNA 1P44A 1YOVB 4LSGA 4XCQA 4LE2A 3OOWA 4IUDS 1PU2A 1B8OA 4X71A 3ROPA 3KKKA 1ZKDA 3ZGLA 1SKUA 2OV8A 7AT1A 4NC9A 2RBEA 5ALZA 4OGWA 2D2FA 3L7MA 2W2MA 1CKEA 4TZTA 1N1EA 2GN9A 4GM0A 2VQEB 1BDJA 1ZM9A 3A6DA 3FYUA 3FPSA 4EGFA 3TD6A 1YIOA 2R97A 3X2EA 4NDAA 2MINA 2XOKD 1RHUA 3IXQA 4LX0A 1QLHA 3H2GA 4RBNA 1PJ3A 5KNBH 1SKMA 1DL5A 5E6UB 1CUHA 1IXYA 1OLXB 2P2SA 4UD6A 1G63A 3LUJA 1T3ZA 3QWHA 5CEEA 1KH2A 2H4JA 2BE7A 2RARA 2YOGA 1A9OA 4OIMA 2W11A 3HCCA 2UUAB 4LZZA 2R65A 3IOCA 4J2OA 1FXUA 1WNTA 4XIIA 3OESA 4JJFA 3MK31 5AI6A 3NTOA 1Z2EA 3CG4A 2JFVA 4M37A 4P83A 4G0UA 1NWCA 1M2GA 1H3FA 4CF7A 5IS2A 4CMEA 3LDHA 4Q1BA 5CD1A 1HLDA 4EB3A 5LQSA 1PI3A 1CUEA 3ELUA 4ALLA 2PIAA 3GBSA 4BVHA 5K20A 2ZWMA 4LYYA 1K9VF 2V5UA 2WU4A 3QOXA 2R84A 1OYWA 5DHFA 3B3FA 4MEJA 4FFPA 1LDNA 1EFAA 4GO1A 4HNSA 2H2HA 3KSMA 3UMGA 3BRQA 2LV8A 3HYTA 3NETA 4XFJA 4Y3UA 5DNEA 4P4TA 2GCNA 3QE0A 4XVCA 3TLGB 1KDRA 1JF8A 4OHOA 4OU5A 2OGWA 3O92A 4D2IA 4D99A 4F11A 3FR8A 4R1NA 5ELLA 3EGOA 1QK4A 3GDGA 2I4TA 4R2HA 3W90A 4N5NA 2RCYA 1OXTA 4FFVA 5JJ5A 4ALIA 5A3JA 5IJ0A 2PXXA 1PFUA 3UFXB 4PLGA 3MEQA 4J0CA 1OGYA 2XXAB 3E3OA 2PPVA 4O4LB 2G06A 4JI3B 3TQHA 3R8XA 3X0DA 4OA5A 2JGKA 3A9VA 1NP3A 3PDUA 2VHYA 1E0DA 4ZT5A 5JNLA 1CJUC 1PQWA 1E6UA 4RJLA 1RYHA 2XYQA 1PZGA 1YTUA 3LBFA 3K35A 3I2GA 3D43A 2P6OA 3EGWA 4Q01A 5TV2A 1ZHFA 3RJMA 3T1VA 4EHJA 6Q21A 4PZCA 2J67A 4WECA 1D2MA 1XSEA 1RXVA 1YI8A 4P0QB 1WPQA 3D8SA 3OEHD 4GGPA 3GJ0A 4L50A 1RWKA 4OYYA 4XYGA 3R6TA 4UVHA 1UZAA 1WEHA 2Y93A 1V7PC 2BEVB 2O0MA 1DKPA 1ZL2A 2GJ4A 1NQXA 2ZVJA 3VNSA 2FMHA 1DZIA 1RJDA 1TJNA 1CZOA 2NYRA 1C81A 2PCLA 2QX8A 3IUJA 1C9EA 2QTLA 2QTTA 1EBUA 1EAMA 3L04A 3RAFC 3OO1A 4KE7A 1KKMA 2O8BB 3GC6A 3QSGA 2V0CA 2DLCX 2XTAA 2BFCB 3JTEA 2P62A 3PGVA 5CA0F 4IH9A 3FTFA 3CKKA 3E3AA 5T4HA 2HA3A 4I4LA 5GJWC 4MW0A 3C5CA 3CU5A 3LM8A 1NP6A 2X3FA 4MQFB 2I4RA 3VDQA 2J3QA 1TTTA 4LF8B 1TJPB 4DR6B 2VRCA 3SJBA 2YHIA 2WIBA 3FSGA 1VGVA 2O2SA 3UZUA 3R4VA 2PUCA 3UXHA 3WSTA 3GRYA 4I14A 5KYTA 2GN1A 1NURA 4JLVA 4MIOA 3GHHA 3TJZA 4JXKA 5JCPA 3EVCA 4RABA 4ZAWA 1E9VA 4D9MA 3HCDA 3EZXA 3K0BA 3F96A 1UXIA 1SHZA 3AYZB 2ZR0A 3PE6A 4UE3S 3MW8A 3BT7A 4MP8A 3JQRA 3VR6A 1FJXA 3I9LA 4JA0A 1FRZA 1CUSA 2H1FA 2X1LA 1KI9A 1UKAA 1UKYA 2HK6A 3R3VA 4FT2A 4P0TA 3ENQA 4OIFA 5TC4A 4QFBA 2C2OA 5BQXA 4M4SA 2I62A 1HQCA 1VBKA 2RC6A 4F1WA 2ACEA 1DEXA 4ECEA 4NE2A 2AZXA 2CXSA 4JAVC 4K9PA 3UMVA 2OK8A 1WXDA 1ZI9A 3ME5A 3N28A 4GIBA 2OMEA 5DN6A 5C37A 3MF4A 3KTAA 1Q57A 3P32A 1UC9A 1BEUB 3HKCB 4ZYTA 2Q62A 2BMVA 4EFMA 3IKMB 1TKRA 2ZVQX 3MJHA 4R9VA 3I6MA 3RARA 2G67A 1WZUA 1IH8A 3GQVA 3GUVA 3NXKA 2IOFA 3E8XA 3OOSA 5E1MA 1MA3A 3A1SA 2FRDC 4NI5A 3VAAA 4E51A 1NBME 5JNTA 1QYRA 4M53A 4CCYA 5JQGA 4NZYA 5LDDC 3T34A 4NWIA 1HK7A 4TMFA 5DM1A 2J6CA 1TPZA 3TW8A 5LUBA 2B1JA 1HX7A 4ND8B 5EL0A 1F38A 1OZGA 4E5MA 5JAMA 5H16A 5IAEA 3GLGA 3KOUA 1EE9A 1P4AA 2JGNA 4BFVA 3S70A 4DMGA 1XNQB 1FDVA 5KSZA 1BHJA 1K92A 1VG9B 1OKKA 1N1GA 3E9MA 3MNFA 3U4MA 4UU7A 2AI2A 1GTJ1 4C6SA 2NYUA 2POQX 1Q1QA 1EEHA 1WMBA 3F3KA 4NG5A 1P0PA 1NOKA 1P7CA 2FGKA 3QBEA 4WUVA 4I36A 3KJXA 3RC2A 3IR5A 4RA9B 1NXQA 1QRDA 2HMTA 4QRHA 4X6LA 4GDFA 1VE7A 3RU3A 1SHLA 3JVVA 4R4JA 1TAHA 5A3QA 3CSDA 5C3MA 4MKZA 5JCXA 3AETB 3HR7A 4YRMA 1VLMA 4QPDA 2PYIA 2GUWA 1MXHA 1NT2A 3VSDA 4G8BA 1P5FA 2VYVD 3HA3A 3N8HA 1PT7A 1IXZA 3N8IA 4DGSA 5K8UA 4BMYA 1OTXA 2HCBA 5AMXA 4PNEA 4KI7A 4RJIA 1E66A 3F6RA 4B47A 3DHNA 1Y1SA 3DNMA 4FW9A 5KKCA 1FTSA 1P4HA 4WOJA 5LMCA 4C3OB 3BFPA 5LL6P 4DM3A 4WZAA 3WGQA 1MABA 4PYNA 4QGFA 5E9WA 3W9YA 4Y9SA 4HQFA 1H3EA 2O4UX 1NI3A 3F5DA 1DAHA 4QFDA 4V0QA 5IXYA 1QQAA 2HZBA 1HO3A 1LQTA 1DX6A 2P3LA 5JQWA 1RADA 2AE1A 1YZGA 1UPBA 3H3JA 2DY0A 5ITSA 4OQFA 3KL4A 4XJVA 2Y8EA 5J2UA 4XIYA 4X5OA 3FUVA 4ARSA 2ZBQA 1CT9A 2C7RA 2EC5A 4Q39A 3A32A 1Q20A 3CZ4A 1VRWA 2VDQB 4M9QA 5DOVA 3NVKI 3IAFA 1P19A 1CXZA 2Y1OA 2VZ9A 4U7JA 4HZUB 4FYXA 2I8AA 1K75A 1MU0A 2ZVPX 4QTXA 3QP9A 4OLHA 5CNMA 1SBZA 5TVKA 4E13A 1ZOOA 3JPYA 2IZOA 1QH8A 1L7OA 1C4KA 3AOEA 1TUBB 1JEAA 5DTMA 1G66A 3ZQJA 2BM8A 1N2JA 1ML4A 1BRTA 1OX5A 1XEAA 3R0ZA 1C3OB 4HUJA 3QI2A 5FQNA 1U9YA 5LA6F 3VR5H 1M8PA 2IBSA 1TJ3A 1M74A 4ACBA 4B84A 3DQZA 2BTEA 2N46A 1VRVA 3V9PA 1HEYA 1WXIA 2I4NA 1SCDA 5DP2A 4YX9A 1KOFA 5E4YA 2P9FA 1RMYA 3RRZA 4QPPA 5JPIA 3A1UA 1N0VC 3DFFA 1VLLA 1MD9A 4S2EA 4A8TA 4E0BA 2QMHA 2V8BA 5FORA 2I4OA 3BA6A 3BXEA 4EUSA 2F8TA 3H99A 4LVOA 1TVEA 1EG2A 1PV2A 3A3PA 1QC5B 1B0UA 1ZIXA 2ERYA 3H2YA 4S3MA 1BHO1 2QJFA 3VPXA 3WQHA 4D4HA 3A1CA 1LFDB 2VNIA 4N41A 3SXUB 2AG0A 3CO0S 2Q2VA 3GNTA 1DXQA 3QBJA 4OHMA 3T1NA 2LGJA 2WG2A 3II6X 1Y6GA 4NMMA 3LUGA 2R1VA 1R6XA 2FX2A 2EWWA 4OOFA 2C0CA 4YBZA 1Q0UA 1FZQA 5GONA 1ZN7A 3HEAA 1MO6A 5K7SA 2JAWA 4C1BA 1KIMA 3EF3A 3WB0A 4U4AA 4QYSA 5CD9A 3I04A 4Y7CA 4M1QA 4BZWA 3O8BA 2O54A 2ZJ8A 1ADBA 3O75A 5E7MA 2C42A 1BVUA 3QYFA 4JENA 3VBCA 4D9IA 1I13A 2Z58A 2ZKIA 4Y1GA 5TMBA 3TSOA 4BO9A 4DDTA 1QZTA 2JI4A 4XYBA 4F12A 1XVUA 1M2OA 2VDVE 4TWZA 3BGIA 4MQEB 2OUIA 1R4ZA 2RAVA 4D3XA 4Q1VA 3N0VA 3EW7A 4ZDIA 5I3CA 5BR4A 4PX2A 1Y9AA 4A16A 5IM5A 4RV9A 4W5RA 2XDYA 1N2SA 1HQKA 4KXWA 1GP2A 1GLNA 2HBQA 2ZB8A 2ZIGA 2J30A 4KQCA 5TSDA 3A2NA 1T15A 3R74A 2OFWA 2QUKA 4Z1OA 4KO3S 1CYEA 1TL7C 3P9ZA 1Z82A 3QU9A 1QCYA 2YY5A 1U4OA 2R5FA 1ADFA 1FDIA 2BGKA 2VNJA 4ZQEA 4EPWA 5AUPB 5KWJA 4DJAA 4EQ6A 1H1DA 2X14A 3BWEA 1SIUA 2J3JA 2BPOA 3E0QA 3N76A 1BJRE 4RJJA 2Q5IA 2HMSA 4R40A 4BGEA 1XPJA 1BEEA 1JFFA 3KBBA 1FP6A 3B9RA 3U09A 4S05A 1JB9A 1GPWB 3JAKB 2JCBA 2Q6OA 4LF5B 1Q11A 2YINC 3IBCA 3O3CA 4FFDA 5DGXA 4JA2A 4B3IA 1U7TA 4P22A 5D3ZA 4UDXX 1QHHB 2XCSB 3JRXA 2ONYA 1QCDA 2W2XA 2VDMB 1QBGA 1AKVA 2V7UA 1KNXA 3C4VA 3GXOA 4OBEA 3LKDA 2UZ0A 2QQ5A 3KZKA 3W3AH 4BX8A 3OJXA 3IQGX 5A5VA 4YRPA 5F5NA 1TJYA 3M4NA 5AUQA 5G1PA 4WKOA 1SEVA 5JHGB 1IBCA 2DTDA 4XPIB 1BJKA 2GZ2A 4RZSA 3UM9A 1II0A 3B38A 1NJFA 1V4NA 2SKDA 3CRQA 3L0BA 3WGIA 4DM7A 3D8BA 3RF7A 4BFUA 2VF7A 2X15A 5FADA 3KO8A 1TGYA 4BNTA 1T5LA 1FX0A 1E1NA 2FZKA 4FI3C 2J3EA 5JD6A 4EDHA 5DX8A 2CBGA 2DQ4A 5F7JA 5G2OA 4B6JA 4EABA 1HMYA 3SU8A 4BMSA 4Q3NA 3DDNA 4D4MA 1WCV1 1T0JB 1Z5GA 5EKDA 2CHGA 4AQDA 2GD6A 3SM9A 4F9EA 1JNXX 5IK2D 1MMFB 4F4IA 5A5FA 1RKQA 1RRPA 2OSBA 1YNSA 1XALA 1ONBA 3B1KA 4LY0A 4TMTA 5AK6A 3W2FA 3OMWA 2H2IA 1P62B 5BW5A 2LRHA 1UM9A 3HVJA 3J7AC 1QTNA 5HF9A 1FEZA 4MWDA 1TKAA 1F0KA 1AZSC 2XE6A 2JBAB 3BWBA 3RYFB 3O8RA 1HFWA 4QU8A 1J97A 2UKDA 4BQNA 2RGUA 1T2DA 1BW9A 3FKSA 3R24A 2Z8YM 1AZWA 3B8EA 4MGEA 3ESXA 5CB6A 4A91A 4EENA 2XNDA 4Y2PA 3QPDA 2JLVA 3IE2A 1IXSB 1E6MA 5EGNA 3TNYA 3ICOA 4CCAA 3IE1A 4HFJA 4KODA 3IKJA 4RPIA 1XU4A 1BU5A 1O9GA 2GZRA 5I7WA 4KXYA 1JPVA 1I2BA 4G67A 2PU5A 3UHPA 1T0PA 5LKRA 5FUYA 2JLSA 2W6CX 5AW6A 3BUSA 1N2BA 1AM4D 4GVLA 4RGYA 3P9XA 4E11A 1GUAA 3R3WA 4N48A 2GAIA 1X9HA 2QD2A 2WJ3A 4U63A 4OMCA 2BKUA 2OV1A 2VHWA 3OO0A 4LRTB 4U5QA 4U6SA 4Z9YA 3VR3D 2A84A 2W8BB 3PB3A 4QA9A 5D85A 4ZK2A 4JS0A 1FNCA 1S8FA 2WU8A 3KOXA 2KM1A 3NAGA 1ZPDA 5B1EA 1T36A 1AUVA 4K6FA 5GOTA 4C7BA 3NWOA 1US8A 1TMGE 4MVJD 3JSAA 2OBXA 2PUHA 2OD9A 4DLLA 1U8EA 2ZRIA 1TMYA 3DDWA 1MW8X 2V6GA 1IZ8A 6YASA 3DZDA 2C2HA 2CXQA 5FJIA 3EAGA 3MS4A 1W5FA 2NO5A 4H3SA 4DA9A 4NOKA 4XRGA 4IXMA 4FOPA 1TEHA 2QUAA 2HCRA 3FYCA 3LC7O 4J4HA 3GGJA 3PEEA 3FRIA 4ZO9A 5A62A 1HE5A 1XCPA 1T9GR 3IESA 3JAMA 4P31A 2MWMA 3FTDA 2B7CA 2LZ0A 2NUPB 2R6DA 2G1UA 2F90A 2SBTA 3FSEA 2DP4E 3ZCSA 4XGIA 4B83A 1BG6A 4ETNA 3KEFA 1K3FA 2ODPA 3DHVA 1T4CA 2O1SA 3UYLA 4B17A 4MYUA 3CXRA 1QOQB 2D7CA 3BRCA 2FP4A 1RQRA 3MINB 5CDFE 1D4OA 1BKSB 1L8OA 1TZBA 3D4IA 1H23A 1TKBA 4QASA 4E70A 4I55A 2JZOA 5MF6A 4I9GA 4YPVA 4EB6B 3GRAA 3PYMA 2VUIB 2XGGA 5THQA 1I7LA 1NVEA 3E6AA 4QSMA 1Z18A 2A1UA 3ZNOA 2CJWA 4AWAA 1N5DA 4JUCA 4MGKR 1UIMA 2QM0A 3ZDZB 1Y3BE 3T7IA 2RSLA 4RY2A 1AQJA 1J0BA 4IHJF 4YJFA 3U80A 3MMZA 4Y6GB 3OPYI 4LRYA 4NFSA 1RHMA 3N0TA 3ILXA 5K4AA 4LJ8A 4LQDA 1M9NA 5E6RB 2H1IA 3L1HA 1QG2A 2H5EA 3KUDA 4LDZA 5AK3A 1H4TA 3TOXA 1SQGA 4ZHQA 4AZWA 2H0QA 1LBIA 4O63O 4H7DA 4EMTA 1GCIA 1T2VA 1D2EA 1XZGA 3DVAB 3OC0A 2IBMA 4G37A 5H81A 2HHHB 3K4PA 2JCGA 1QRAA 5LIPA 3BE5A 4DIKA 1KRWA 3W5IA 4RE5A 3TXXA 4NCNA 1NX6A 2NUBA 4PRYA 3SC2B 4JJGA 4JVMA 4AXXA 4KX5A 4LE1A 2QRQA 3SY8A 3ZI0A 3L0ZA 2E6UX 3ABRB 5JBNA 3AJEA 3VTKA 5EWLB