5F1KA

Human cd38 in complex with nanobody mu1053
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
244
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 80
structure length 244
sequence length 248
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f1kA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f1kA02
2J5KA 3HFSA 2B36A 1EQ2A 1I2BA 4AJJA 3HNPA 4BO2A 1KERA 5FFFA 2J3IA 4F6CA 1WWKA 3TL3A 2AQHA 3LVFO 3QLJA 1HKUA 2OP1A 3TZKA 1MXHA 3AY6A 3DHEA 3NUGA 1LSOA 4U0KA 4DL9A 3X2FA 4YVFA 3D3WA 5JW6A 1P0FA 4GWGA 4IDDA 4QTZA 4MO2A 1KOLA 4HV4A 3WJ7A 4ALMA 3NT4A 1PS0A 4OM8A 3KYDB 1OOEA 2HSDA 4FFLA 2HLPA 1P44A 3IQDB 3O4RA 4OXNA 4UUPA 3WGOA 4D3DA 3HG7A 5ADHA 1JTVA 1LSUA 2B4RO 3ONEA 5DCWA 1AUPA 1Y9EA 4LVCA 5ENVA 3VH3A 4ALIA 1VSUA 2XOXA 4CM4A 4GGPA 1C0IA 3JQBC 3VZSA 1T24A 5BNFA 2HMSA 2P2SA 3BIOA 1FDWA 1C0KA 4GLOA 4MP6A 5TC4A 3FBTA 5I8ZA 1SOWA 1Y9AA 1WNTA 1KC3A 4LRTB 4EEZA 1YH3A 1RM0A 1HDXA 3PVZA 4IDAA 1YO6A 4WCFB 4UVHA 1I0ZA 1WDKA 1VL0A 2PA3A 4XYGA 4KDEA 4J1QA 1BW9B 1ZVMA 3DAFA 2WEKA 4DLAA 5JY6A 2CDCA 1Y7TA 3IL2A 2NVUB 3PHLA 1ZO8A 4BGUA 4IPTA 2ZCUA 3DR3A 1DB3A 3H9GA 4ALJA 4YYZA 4U5QA 4CQMB 5C3MA 3ORFA 2Y1OA 3HN2A 4B7XA 2BGMA 2CSUA 2I6TA 4GX0A 1U4SA 4FC7A 2P9EA 3VDRA 5BSFA 3QWBA 4Q3NA 3SJ7A 3QP9A 1GL3A 3IMFA 3FTNA 1LC0A 4YR9A 1EE9A 1DRUA 5G4KB 1XDWA 4CJXA 3P19A 1LSSA 2PK3A 2ZK7A 3AU8A 5EJ2A 5JLAA 5C7IO 2VYND 4ND3A 1F0YA 1XEAA 2SCUA 4DC0A 1RM5A 1DPGA 2CF5A 1IUKA 3O38A 3U4CA 1TLTA 1KEPA 2HDHA 4UVGA 4XZ3A 4I1IA 4YBZA 4K26A 2G5CA 4L9RA 4WUVA 4RO0A 5U4QA 1K6JA 3IC5A 3BMCB 1ZUD1 2HMUA 3M6IA 4IXWA 3NRCA 1ONPA 2HMVA 2X22A 2OBYA 4YJGB 3I83A 2E82A 3DHYA 4L74A 1EFLA 2WE7A 1G6KA 3H9EO 2EP5A 4GX2A 5KJ6A 4D42A 1NBOA 1H94A 2JD1A 4CLRA 4E2XA 3RUCA 1WW8A 2HCTA 1VL6A 1Z7EA 1XGKA 3AJRA 3R0IA 2BFPA 4HADA 4W9NA 3B1KA 4PG5A 3CKYA 4DIOA 2WDZA 4E32A 4ND4A 3I1JA 3SC4A 3HN7A 2PKQP 1G1AA 3GN1A 3AU9A 4BKPA 1WPQA 1NXQA 2GPTA 3CXRA 4BNZA 4DTIA 1A27A 3ETEA 4YT5A 2UYYA 3C1AA 3INRA 5EERA 3U9LA 4E3ZA 5CDUA 3CZRA 1ZIDA 3DHNA 3HJAA 5JMPA 3NT5A 3ADOA 3TRIA 1J0XO 1M2WA 3G17A 4GKVA 3PPIA 5F5LA 1U1IA 5A9SA 2EKQA 5A04A 2DBRA 3UGKA 3GVXA 1J6UA 5L4LA 1I5RA 1PSDA 1K5HA 1ZZEA 5JC8A 1PL6A 4E2YA 3JYLA 4UUMA 4TMFA 5IG2A 3T4EA 2DTEA 3DOJA 1QLHA 2JJYA 3QWAA 1DIRA 3RVDA 4Y6RA 1IY8A 1HDOA 2O7QA 1E3WB 5J23A 4NZ9A 4YJHB 3BZUA 3LT0A 4CM3A 1E7WA 2YW9A 5TRTA 3QWFA 1SB8A 1CRWG 3BMOB 1V6AA 1I3KA 3A28A 2PV7A 2ZJ1A 2IYOA 3WNQA 5CPFA 2WD7B 2AEMA 2DVMA 4CR8A 4YRBA 4A7PA 3ICCA 4JJGA 1QMGA 3I52A 4XB2A 4BO4A 4IZHA 3JQGB 3FNGA 4YTEA 3FWZA 3BAZA 3V1TC 2BD0A 3ZWWA 1T2AA 3PLRA 4AJNA 4MDHA 5FEUA 2DKNA 3C24A 4RPKA 2FSVA 5HM8A 2GSDA 3BA1A 1EVIA 2YY7A 1JA9A 2ZQYA 5A3VA 2H63A 4FBGA 3E48A 3NJ8A 1QYWA 3KTDA 3OHSX 3K31A 7MDHA 2EHDA 4PRKA 4K9DA 3RUIA 3RU7A 3F5QA 3DQPA 1SCUA 2XXJA 1FF9A 4I9HA 1R0SA 2Q1TA 3GZNB 3CE6A 1NQ5A 3L4BC 4NHEA 2JAHA 3KO8A 3H5RA 3RC7A 5CEEA 5JNLA 4QEDA 4PG6A 1B16A 3RBVA 2LDBA 5T6BA 4C7KA 1WMBA 2CFCA 3DBVO 4ZRNA 3TOXA 3ENNA 1Y1PA 4RORA 2R2GA 2PD3A 2WYVA 4BNLA 1E7SA 3DWFA 5JSFA 1UP7A 4ZQHA 3WMWA 5JFOA 1Y6JA 1DIGA 3MZ0A 4ZHSA 1JAYA 2X0JA 5A9TA 2YV3A 3R3JA 1H6CA 5FI3A 1PGOA 1P45A 4FGSA 5G0WA 1HYEA 4EDFA 1H2HA 1Y8RA 1V3TA 2OXIA 2ZYGA 1GU7A 3Q9NA 4CM1A 1R0KA 3LLVA 2X1HA 3S55A 1DAOA 1LRJA 4O63O 3ROMA 2QZ9A 2Y0DA 4PLZA 1MB4A 1PJTA 2HK9A 2NSDA 3C7DB 1WMAA 4D0RA 4OSOA 1OI7A 3G1TA 4WNIA 5KTKA 3QQPA 2O23A 1TB4A 1B26A 1DC5A 3JYPA 5EMHA 4PRLA 3AFMA 2AE1A 4JGBA 3V2GA 4CMHA 2VT3A 2BF7A 4RVSA 1YJQA 3H65A 1C1DB 1NX6A 3DTTA 3GVPA 4AJ4A 5B12A 2JFFA 4PZDA 3WGZA 4EUHA 3PJGA 4PZCA 2GZ1A 3DEYX 3H9UA 3TNLA 2AG5A 3BTVA 1XWFA 1GUFA 1ZH8A 3WOHA 2FRDA 1HYGA 4OL9A 2X0NA 1F14A 4CL3A 4XD2A 3WFIA 4L73A 1LSJA 3JD2A 1LLUA 3W4JA 3VVBA 1MG0A 4Q3AA 3WGHA 3E8XA 5BQFA 4R4JA 5DCUA 4FOOA 1AXEA 3NKLA 1SEPA 4TQGA 2X9NA 2Z5LA 4GKBA 2Z1NA 1A7AA 3H6KA 1ADCA 2EJVA 4RF3A 3ZW9A 3C8MA 4NU5A 4CV1A 4YJFB 1EBFA 3M1LA 4D7AA 2HAEA 4FFMA 2FWMX 5T8KA 1EK5A 4BNKA 1NAIA 4CMAA 3GDOA 5U1PA 3L9WA 1R4NA 1NHGA 3W4KA 2GASA 2X4GA 2Y66A 4RF4A 3C1OA 4DRYA 3B6ZA 2EKPA 2VNAA 4NFSA 5COQA 4XJSA 2YFQA 1DLIA 2VZ0A 1XHLA 2P4QA 4BGIA 2FHSA 2Y68A 4LSMA 3I9LA 4ZQBA 5H82A 4F3YA 1YDEA 1ZMOA 4NBUA 3VTFA 4DWVA 4J1NA 1PWZA 1T25A 3ETGA 2VHZA 1DHTA 1BXGB 1O8CA 4PG7A 4BO6A 2Q4BA 2BELA 3B1FA 1XIVA 4OSPA 4OKNA 2QZZA 2C2YA 3SEFA 1ZK0A 5JAZA 5KVQA 4G81A 4TWRA 4GSKA 3VTZA 1U8XX 3NYWA 3PWSA 4Y67A 1DOHA 5TIIA 1HE2A 1E3EA 2Y1FA 3QVSA 4CMIB 5T5QA 5I7EA 5IFLA 5CDYA 3TFOA 2VRBA 4Z0HO 2D8AA 4CR6A 4RL6A 1RM3A 3PYMA 1ADGA 2Y1DA 3KHUA 2GERA 1VJ1A 1Q7CA 3WS7A 1A5ZA 1NVGA 1Q2XA 4BO8A 1TVEA 4R5HA 4LMPA 4JBIA 3ZW8A 2IZ1A 1ISGA 4FFRA 4DLLA 5CDTA 3GEMA 1XU7A 3D3EA 4E0BA 5KVVA 1O0SA 2AQKA 4TZTA 1DIAA 1E0DA 3Q9UA 4RGBA 1A71A 3IP1A 4PG4A 4CM8A 5BR7A 5KOIA 4Z3KA 3VC7A 1VJ0A 2JHGA 1BRMA 1AE1A 1GDHA 4L4SA 2AQ8A 2AQIA 3OBBA 4NR0A 4XCVA 4Q3CA 4L76A 1PJ2A 3WBFA 2O3QA 4J4HA 3MJTA 4MPDA 4JIGA 3SXPA 3WXBA 1SB9A 1LQUA 4RV9A 4CV2A 1MX3A 3OQBA 1H2BA 4YPOA 4MIOA 1OZAA 1DO8A 3E18A 4WLEA 4GBJA 3JQFC 3VDQA 3A06A 5DOZA 1YQXA 3PHIA 1HETA 1SBYA 3WTCA 2BHLA 1NFFA 2FPIA 3JD1A 1N1GA 1W8DA 5BNIA 1PJBA 2X0IA 1EE2A 1WXDA 1E6WA 3RFXA 5ICMA 3AUTA 3KM0A 2PZLA 2HQ1A 4J9UE 3QVWA 2O3TA 1RYDA 4IM7A 1JDJA 5G0UA 3U5TA 3LC7O 1NR7A 3VVCA 3D3WB 3GUCA 5H83A 4R1SA 5LCXA 3ICPA 4MVJM 1H5QA 4FFNA 3U4DA 1WLYA 1T1RA 3U09A 5L7WA 5JCJD 3JD3A 3NDRA 4RDIA 2RIRA 2YFHA 3NGXA 1T2EA 1NYTA 3OF2A 5JXWA 3WNVA 3OETA 4I5DA 2O2YA 4TSKA 4PLPA 1CIVA 3MOGA 1EFKA 1MLDA 1ONOA 1FDSA 1D4FA 2OOSA 3E03A 1Z82A 4MKRA 1KVUA 3NV9A 4CL8A 3BMQA 4NK5A 1UUFA 3DBLB 1V0JA 2QHXA 4KUHA 3BMNA 4FCCA 5ENDA 3WGQA 4MVJP 1TT5B 5F3RA 4FSHA 4W7IA 3KVOA 3JQCA 4JROA 2J6IA 5A03A 4OKIA 1E7RA 1Y81A 4NK4A 4IDGA 3ZU3A 1GZ4A 4XA8A 3K6JA 2C7GA 1TXGA 3QSGA 4O59O 3TDKA 1KY4A 1DC6A 4UULA 4GI2A 4E5YA 3SJUA 2R6JA 5IXSA 4D41A 2OORA 2NACA 3S1LA 4BO3A 2BI8A 3ZHZA 4IQ0A 4E6PA 3PIIA 3OA0A 3D4PA 4XX0A 3ZHXA 4TROA 5C7OO 4W4TA 3DFZA 8LDHA 3RC9A 3WG9A 4NNJA 2H5LA 1NNUA 4JP2A 3GNTA 4BNJA 2ZYAA 4P22A 4ALNA 1QSGA 1LI4A 1I2ZA 4DBVO 1HE5A 4RQUA 3JCZA 5IN4A 1EVZA 4MP3A 5L4SA 5ILGA 4B4WA 4I08A 1VKNA 2O7SA 4B4OA 1X1EA 1LEHA 2GN9A 1ZSYA 4TRMA 4J7XA 3COSA 2V65A 1LBEA 4J2HA 5EPOA 1X0XA 5KKAA 3H2ZA 1ENYA 4AJEA 4E5PA 3UW3A 1AHHA 3WQRA 1YBVA 3OFSA 4XR9A 1E5LA 4CLDA 4U0JA 5T57A 4N18A 5I7FA 3IKTA 1EEHA 4E33A 4XQCA 1M6WA 4M8SA 1ISHA 4Q39A 3WGTA 2FN7A 1SOVA 3DZHA 2Y1CA 3F6YA 4CLXA 1HYHA 4YB8A 2YV2A 5JY1A 4KQWA 1H6DA 2CVZA 1EVJA 1AN9A 1W0CA 2EV9A 3WIEA 4JP3A 5EL0A 4D45A 1UZLA 1M66A 1VE9A 1XYGA 3ZI0A 1LC3A 4UEJA 5CEJA 3VZQA 3NEPX 1DEHA 3DBHA 5B1YA 1B2LA 3WDSA 5I9LA 4R5MA 1CERA 3GNSA 3C7CB 1I32A 2YZ7A 8ADHA 2WYUA 1K3TA 2I9PA 4BQRA 3LF2A 4D79A 1JWAB 2QYSA 3HE3A 1PGQA 3WMXA 5BT9A 4R16A 5DP2A 1X14A 3OICA 4KOAA 1B3RA 2VUTA 2ZYDA 3L07A 4J0FA 4KTVE 4Q3DA 2A9FA 1YL5A 1NPTO 2WMDA 3QIVA 3GHHA 1X1TA 4ALLA 5ILOA 5A06A 2BI7A 4R3WA 3KLMX 3IKVA 4NFHA 5TJ9A 3ZU4A 4PLVA 2YV1A 3S2IA 1DLJA 3F9IA 4EW6A 2B5VA 4BMNA 4NBRA 4NJMB 1P1HA 5KCZA 4RF2A 1DC3A 1QYDA 3KLPX 3CZMA 2I76A 3I9MA 1ISMA 2I5PO 2ZTVA 3SLKA 1I30A 1ISFA 2C0CA 4ZQFA 4UVIA 3NTOA 2FR0A 4F6LA 3ZV3A 1PQPA 3U62A 5CFZA 1R37A 3BTSA 1P31A 1B15A 1WP4A 2J3HA 1YBMA 4AJKA 4DVJA 5IF3A 2UVDA 3V2HA 2FZEA 3ZN2A 1GAEO 4XQEA 4E13A 3WGYA 4CQLB 4AVYA 1PX0A 3CEAA 4JJIA 1ENZA 4CV3A 2E49A 1YB1A 4KQXA 4FPXA 1SZJG 5JO0A 1A72A 1GQQA 1H6AA 4A0SA 5EQFA 5JYEA 2PH5A 4E2ZA 1QP8A 3GDGA 1YDWA 4HXYA 3TWOA 1NFRA 1UXHA 4PLTA 1ZCJA 4PLHA 3R3SA 3WQQA 5KVSA 1BDMA 1WAMA 1HSOA 3LT2A 4N7RA 1C1XB 2JCYA 2CD9A 3MEQA 5K6AA 3WJAA 1YB4A 1U28A 2NVWA 4WLNA 2EKLA 4RZIA 3ZWVA 2C20A 4EI2A 4KDFA 1NR1A 3GAFA 5LDGA 4LK3A 1KVTA 4UEOA 1PS9A 3V1UA 4ND5A 3AUSA 5KWEA 1KIFA 2EW8A 3FBGA 1FK8A 2OFPA 1IB6A 1YOVA 3D5QA 4II3A 3GG9A 3V5NA 3OJ0A 3JQ8B 1BHSA 1NWCA 1QV6A 2PD4A 2HUNA 1X13A 2X8LA 1KYQA 2VQ3A 3NT2A 2DT5A 4BNIA 4OO3A 1KC1A 1CF2O 4WEQA 5IDYA 2AE2A 1ZK2A 1MFZA 3EVNA 4RPJA 5FF9A 4YT2A 1NP3A 1ZK4A 2P9CA 3Q6IA 2Q46A 1N9GB 3EZYA 1CQIA 5DZSA 1M75A 1ENPA 2QIOA 5L45A 2Y1EA 3EYWA 1NAHA 2FOIA 2NWQA 2LDXA 1V9LA 2G82A 5TSDA 2B5WA 1YVEI 4K6FA 5IXYA 2DFDA 3KSDO 4BO7A 1LDNA 3RBXA 1G0OA 1PR9A 4NQZA 3UUWA 2DBQA 4WK6A 4LISA 2GUGA 2EP7A 1XELA 1ZW1A 4NI5A 3PQDA 3DOOA 1W6UA 2W2KB 3KXDA 5KJ1A 4EJ0A 2BH9A 2EJWA 1QKIA 4ZU3A 3S2GA 3L6EA 3IUSA 3K92A 2DTXA 4XR4A 1R4NB 4CLOA 3HQ4O 3PFFA 2FPGA 3L6DA 2HU2A 3H5NA 2FZWA 1P1FA 3GFGA 3GEDA 1FMCA 1Q7GA 1WDLA 1UH5A 2QG4A 1LNQA 2IRWA 2QRKA 4B4VA 4NBVA 1O5IA 3D1LA 3K73O 3WTBA 5ITWA 1U3TA 2PGDA 3BXXA 3M2TA 1YONA 3JD0A 3PQEA 3MJVA 5KVCA 1VC2A 1O6ZA 4B8ZA 4E31A 1RM4A 3PYLA 3Q0EA 1SC6A 3KYCA 3KBOA 2FR8A 2WYWA 4WLOA 3RROA 5LDHA 1UXIA 4FFPA 1HF3A 4ND1A 5CHEA 3FR8A 3Q1LA 3K5PA 2W8ZA 3UICA 4Y8VA 1JKIA 4BV9A 1GQ2A 1LDGA 4W99A 4CMCA 4JBHA 3JQDA 3JQFA 3PEFA 1OC2A 3JYNA 4JLWA 4YEDA 1HE4A 4B7UA 3K9QO 4PGFA 1QLJA 5TT0A 3ZWAA 1LTHR 2IDZA 3FI9A 4FJ0A 1PJLA 1SMKA 5HS6A 1I3NA 2BGKA 1WVGA 3FNEA 4DC1A 4CMBA 4ITUA 4R9RA 1H93A 2IXBA 3RU9A 3I4FA 3GFBA 1U9JA 2NTNA 2HKIA 2JKVA 4R1TA 1S7CA 3AK4A 3KEOA 3LQFA 5DBIA 5EESA 4II2A 1D8AA 4DBZA 3DL2A 1C3VA 3WBBA 3MJEA 2VOJA 5L51A 4OXYA 1HTBA 3E9QA 2WJPA 1NQTA 5I9MA 2ZCVA 1TA4A 5EIOA 3R1IA 4XRRA 3DTYA 3JQAB 4QO8A 4EZBA 1PZGA 1NM5A 3PGJA 1OC4A 1LDBA 1BSVA 2GN6A 3Q11A 3GPIA 3ZV4A 3DMTC 5ES3A 1LUAA 5JAQA 2VZ9A 1U4OA 2HRBA 3RUEA 5TT1A 2D59A 3PK0A 1ZXBA 4KMSA 4CR7A 4ZVVA 1T1SA 2XAAA 5CEFA 1D7OA 4FOSA 3ON5A 4IQGA 4J16A 1E77A 3VHRA 3GDFA 5JDCC 1RKXA 3AI2A 3RC2A 3NDJA 1VSVA 3K30A 5A9RA 2Y05A 2BGLA 5BSGA 1HXHA 3TL2A 4KWHA 4EGFA 1A9ZA 2FY8A 3TZHA 4YWJA 1ZKMA 2HMTA 4M89A 1ARZA 4EJ6A 1ZSNA 5CG2A 2X86A 2I65A 1BWSA 4D46A 4URFA 5JCJA 4BVAA 4XGNA 1UP6A 2NLOA 3PRJA 4JNKA 1A4IA 2CDBA 3D4OA 3E82A 4IJUA 3W1VA 4A03A 5A3JA 3N7UA 4NG5A 4NBWA 1OMOA 3LT4A 1MFPA 3ZU2A 5K9ZA 5A1TA 1E7YA 4FS3A 4RQTA 3OSUA 3JQ7B 1K0UA 1U5CA 1B14A 3KYDA 3I9JA 1XLTA 4LMRA 1ZJZA 4MVJG 2OP0A 2ZQZA 4S1VA 3MJCA 2HO5A 3MWEB 1B8VA 1GPDG 4IY1A 2B4QA 4NFYA 3EDMA 2O4CA 3M1AA 4GAEA 5DBFA 1MC5A 2PZMA 2O3UA 2GD1O 4D0SA 4HBGA 2AXQA 1GR0A 3TF5A 4KTTE 1MA0A 2O2SA 3KUXA 3OEYA 4M86A 4KP7A 1YB5A 4GH5A 3ULKA 3GGPA 4GPD1 1NVMB 1SAYA 3GMSA 4BNWA 3ONDA 5DNAA 5FYDA 3E6AA 1EMDA 4NU6A 1KS9A 2FSSA 1O9BA 1F8FA 3O26A 2NVBA 4B8WA 3OQ6A 3PJFA 3QVOA 1LU9A 4WCFA 3ZHBA 5B37A 1A7KA 1P0CA 5AQ1A 5DF1A 5BNTA 1E3SA 4IJVA 1BW9A 1KVSA 4OJNA 1DJNA 4ZD6A 1IHYA 1CETA 5TX7A 2YDXA 2NVUA 3F1KA 1ONNA 1YQGA 1B0AA 3FR7A 2ZJ0A 3GY0A 1R66A 4CQMA 4HFMA 4EUEA 4HX5A 5COBA 1DDOA 4N5MA 2JCVA 2Q2VA 4WCDA 1SPXA 4CMJA 2AW5A 4E5NA 2EEZA 3RUDA 4NMHA 4LCEA 4BIIA 5K6AC 3STHA 4D3SA 4MKZA 5FWNA 1R4MB 4XQ9A 1J4AA 1M76A 2X9GA 3NDIA 4DYVA 4R69A 3QWIA 5G2OA 2YYYA 2RCYA 3JYQA 3QV1A 2Q2WA 3W8EA 1MXFA 2EXXA 2V6GA 2NU8A 4CM6A 3DFUA 3RQSA 4O6VA 3GN2A 1H9BA 4Q9NA 5HRUA 1Q0HA 2TMDA 4J0EA 4XIJA 2GDZA 1QRRA 1MUUA 3AOEA 1JVBA 2WE8A 4R9SA 1IL0A 1NTOA 5L95A 2GN4A 2UUPA 3FCOA 4P4LA 3HDJA 4Y9DA 1IPFA 2ZB4A 3L4SO 1I3LA 2VWQA 1E1KA 3M2PA 2Y1GA 4YJGA 4TKMA 1BVUA 1QR6A 3VZPA 4XGKA 5KJFA 1YGYA 4WLUA 4TVBA 5JC1A 1UAYA 3B1JA 2C82A 1ZEJA 4D44A 4IDCA 2NTJA 3IS3A 1ZK1A 2EERA 3BHJA 3GAZA 1ZEMA 2ZATA 4EJMA 3N58A 5AOVA 3DZIA 2BKAA 2QQ5A 3G49A 2G17A 2NV6A 3AM4A 3PFWO 4DA9A 4N5NA 4M55A 5AVOA 1GQYA 2CVOA 1E3JA 3K2EA 4OMUA 3GGOA 3FPLA 2EGGA 1LX6A 1EUZA 4UVEA 4WE3A 1S6YA 4MVJI 1UAGA 3ZHYA 4CM7A 1T2CA 4YAEA 2QRLA 2D5CA 5HA5A 3ZWYA 4AICA 3LF1A 4CUZA 4MVJH 5TJHA 2OMEA 2I3GA 3IJPA 4J49A 2X0RA 1IOLA 2EIHA 3GHYA 2X6TA 3HFGA 5T64A 2J3KA 3FN4A 3OJFA 4BGVA 3I6QA 1UZNA 4IJKA 3ANMA 2NU6A 2D4AA 3DBRB 3DXFA 3QVXA 3VH4A 1P74A 4G2NA 2WSBA 4PLCA 2CDAA 3NJ4A 5I9NA 1QG6A 1MGOA 2PZJA 3RI3A 1HRDA 4AJLA 4YJHA 4PVCA 5IDWA 3EK2A 1I01A 3AW9A 3BMOA 2QX7A 1ZK3A 4A27A 3FSRA 3GA0A 3UXYA 3WYEA 2WD7A 3ZWMA 3DZFA 4ONEA 1HL3A 1TI7A 3JTMA 3W8FA 3PXXA 4ZGWA 4H15A 3GK3A 3EGOA 4YT4A 4DPLA 1EZ4A 2DFVA 3JQGA 6LDHA 3ZNQA 3OJEA 4CODB 1XG5A 4A10A 3GNQA 1M6HA 3EVTA 1LLDA 1ZMTA 3MOIA 5AXAA 1UXKA 2YHIA 1HSZA 3IIEA 3SX2A 4AJ1A 3ZV5A 2X58A 2IZZA 1EBUA 3RJ5A 1FXSA 3KB6A 1KY5A 1IE3A 1PJCA 4J1TA 3V2UA 1JQBA 2YJZA 4MVJE 2C29D 4N5LA 2C07A 4OXKA 1KEWA 2Z95A 1PEDA 3SLGA 4FDAA 4QECA 4BB6A 2NTVA 3GZNA 5ICSA 2VHYA 1P9LA 3QWHA 1HE3A 3HB4X 4NIMA 3LC2O 4XIYA 5JE8A 4EUFA 2J3JA 2VUUA 4J4BA 3TOZA 1IHXA 2EWMA 2D3TA 2JD0A 4CM4B 3F46A 3GQVA 2CVQA 3UOGA 5ER9A 1JKFA 2OBNA 2AA3A 4ZN6A 3F1LA 4I5EA 2JHFA 1XA0A 2UV8A 1HDCA 1A4UA 1XCBA 4BB5A 2W4QA 4XYMA 2BFAA 3HWRA 2QYTA 1MG5A 1Y8QA 3EUWA 3NGLA 4OH1A 2B69A 4BNUA 4FGWA 4BGEA 4BQPA 1ZXLA 3AUAA 1L1FA 1YRLA 3AOGA 4UREA 1AHIA 3U4HA 1CQJA 1Z75A 1V3UA 4GMFA 4O5OA 4J1SA 4WLVA 2P68A 3SC6A 4O1MA 2C59A 4RJTA 2Y0CA 3N74A 2IODA 4Y6SA 3PI7A 5T67A 1H6BA 5GY7A 5CAEA 4BO9A 2VYNA 3TPCA 2Q1SA 4M87A 1DXYA 5F5NA 3UN1A 3O03A 4DPKA 3ZCXA 3A1NA 4YQYA 4CM5A 4DGSA 2O50A 3ZWNA 5L4NA 5C5IA 4QT0A 3L0DA 4PLYA 2CY0A 5IAAA 2D1YA 1P1RA 1PGNA 4RVHA 4FN4A 4Z0PA 3ABIA 4DUPA 3WYBA 1RYEA 1E6UA 4OOEA 4RVFA 5A02A 4K6CA 3UCXA 3ZNOA 1U3WA 3GRPA 5KKCA 1PR3A 2DQ4A 5TGDA 2VN8A 1NASA 5A5FA 2V6MA 3OECA 9LDBA 5G0SA 2PH3A 1E3LA 2BFOA 1J49A 2JFGA 2OL4A 3WGGA 2W90A 4LGVA 1I10A 3VAZA 1QV7A 2Q49A 3RJ9A 2H1SA 3RSHA 3W6UA 2WD8A 3Q2KA 3AM5A 1NWHA 3VOSA 4CLOB 4DYDA 1WZIA 5H81A 2PTGA 3PDJA 4P8RA 4CLRB 2GGSA 3UHAA 4WCFC 4W7HA 1FDVA 4IXTA 3VPGA 4CUJA 3PZBA 2HJRA 1F12A 2F1KA 1HWYA 3DMTA 4HNGA 4BHTA 1CYDA 2C7VA 3D5TA 1XSEA 1PJ4A 5GZ6A 1GY8A 2DPHA 4HFRA 1SO8A 2CNBA 1GV0A 4XGIA 1PS8A 2X9VA 3P5SA 4S3MA 5IZCA 1JW9B 1PZFA 1N5DA 5L40A 1DRWA 3DO5A 4QQRA 2B0JA 1BXGA 5JDCA 3CMCO 4M54A 3ZV6A 3UF0A 2HK7A 2YHUA 4PCVA 2HJSA 5A9SB 4FJ2A 5L3ZA 3CINA 1E1MA 2EGHA 4YRDA 7ADHA 1PZEA 3H8VA 4PVDA 4GQAA 4C7JA 2E37A 1HEUA 4WOJA 3RKRA 4OQYA 4YQZA 3ZWXA 1JKJA 3QE3A 1YE3A 4P38A 3JYOA 4Y98A 3PP8A 4IIUA 2WWRA 3ZNNA 1F8GA 2NM0A 2VNSA 3AOEC 3K96A 4P4NA 5KJCA 4G65A 4XKJA 3E9NA 4CMGA 2I66A 1N1EA 1JVSA 4LVUA 1EQUA 2W98A 1DAPA 4FIZA 4MIYA 2ET6A 2H6EA 1ID1A 2GZ2A 3JQ9C 2NQ8A 1B7GO 1HDGO 1I3MA 1PJ3A 2RBEA 3WFJA 3ENKA 3EW7A 3PLNA 5THQA 3DONA 1EK6A 3FF4A 2GO1A 4AJHA 1E1LA 4E5KA 4IINA 2PFGA 4CLHA 3ZH2A 4IBOA 1O94A 4IMRA 2ZKLA 5GMOA 3TZQA 1DRVA 2O48X 2V6BA 4J4TA 5DOVA 1PWXA 2DBVO 5HBRA 2B35A 5DN9A 5GZ3A 2P5UA 4BO1A 4YXFA 1QYCA 3U3XA 2GR9A 2CUKA 3I23A 2GYYA 4KUEA 3RFTA 1ZBQA 1X0VA 2FMUA 3JQAD 5L53A 3BHIA 3RKUA 3WLFA 3DAGA 2VHVA 3UFXA 3TSCA 3MWDB 4R51A 4BNHA 3TZCA 4J43A 1X15A 2IEBA 2E6UX 3ITKA 4B4UA 4X54A 2GN8A 3O8QA 4PZEA 4ROSA 3U4IA 4RPGA 1XQ6A 4PG8A 1HDYA 2PWZA 1NQOA 1K6IA 2P91A 3HDYA 4M49A 1VRWA 1IULA 3ZNPA 5L7YA 2Y67A 1Y5RA 1B3BA 4GWKA 3LYLA 3GZ4A 4INAA 4WASA 3WSVA 5C37A 4QFCA 2AG8A 3F4BA 1BGVA 3U0BA 3A4VA 3AI3A 3GC6A 1Y8RB 3SBOA 3DC2A 1GUYA 3FRJA 2X23A 3LK7A 1HZZA 4GL4A 1V8BA 5LC1A 3VPHA 3GF4A 2Q1UA 4JN6B 3P2OA 2VRCD 4IDFA 5TNXA 4DQVA 2YQ5A 2JAPA 3DAPA 4E4YA 3ANNA 3UAGA 4WECA 4I8XA 3GT0A 1EUDA 3QA9A 3OA2A 2OHXA 3JQ6A 3VH2A 5JO9A 1DFIA 5TF4A 1GEGA 3ETDA 4OIMA 3DBLA 1R15A 2NNLD 3WX0A 2EW2A 2RH8A 4FB5A 3EC7A 1LDEA 1TT5A 4J6FA 2BRUA 3AY3A 5HTOA 3HB5X 3LDHA 4QSMA 3VH1A 1YXMA 4EEXA 1E92A 2NADA 4UUOA 4DQUA 5DT9A 4D43A 1B8PA 4RPLA 4CM9D 4RVDA 3CMMA 1PGPA 3PWKA 4YDRA 3JSAA 3PHJA 1U5AA 1N7HA 3D0OA 2VWGA 3PWZA 2XF8A 4E30A 5FI5A 2VYVD 2CF6A 3T7EA 5CPBA 4O0LA 5A5EA 4EYEA 2H9IA 3V1YA 3PHHA 2X5KO 4BKUA 4I5GA 3UCEA 3CIFA 3BYZA 3DZJA 1PQWA 3WQSB 3ITDA 1GV1A 4J91A 4L75A 2WTBA 3EMKA 4A5OA 2JD2A 5AXCA 4XWYA 1N7GA 4E12A 1G0NA 2Z1MA 5JPIA 4L8VA 4YAKA 3EHEA 2IZ0A 5HS4A 3B70A 4ZQEA 2ZTLA 1RJWA 3IOYA 2BLLA 3RAJA 1JAXA 1UDBA 3CSDA 3BHMA 5IN5A 1NFQA 2I99A 4R01A 3FWNA 5F1OA 1F17A 2JL1A 4R41A 4N54A 4XYEA 3DMYA 4BNFA 2VOEA 4GMGA 1DFHA 1H9AA 4RDHA 1T4BA 4GLLA 4UEKA 5AYVA 4BO0A 1ML3A 2R00C 4IMPA 3NTQA 3RUFA 4BNXA 2RHRA 3H4VA 2B83A 2CMDA 2IE0A 3LZ6A 3RFVA 1HLPA 3LC1O 3OIGA 3ST7A 3V8BA 1OBFO 2IXAA 4DQXA 2A94A 5DP1A 3SVTA 4MVJD 5MGBA 1M67A 1YJ8A 2X5JO 2XPCA 1P1KA 1LRKA 3S2EA 2DC1A 1XU9A 3LT1A 3KETA 4DIBA 4ILKA 2PZKA 3EZLA 1O95A 3G3EA 1IPEA 1LDMA 4WLFA 2OO5A 1PL8A 2HK8A 3QY9A 3WIDA 4GSLA 3FHLA 4A2CA 2P5YA 2DPGA 3I9NA 3UH1A 4TVOA 4YAGA 1W4ZA 4GX5A 3PZRA 4R54A 3O9ZA 2GZ3A 1L7DA 3CPSA 5ITVA 3TN7A 3KZVA 2Q2QA 4BKOA 3GR6A 1XR3A 4GVXA 3L9XA 1E6EA 4BKQA 3GVCA 2VCYA 4Z0TA 3C1TA 2EF1A 2EG9A 4FQ8A 4CMKA 1T26A 4Q3EA 3DZBA 1DIHA 1P77A 2RHCA 1HZJA 5I7VA 2UDPA 3H3JA 1T2DA 1Z73A 5THKA 5A4DA 4Q3BA 1Q7BA 2C5AA 4CM8B 1O89A 4KUGA 4CMEC 2PKQO 1LJ8A 1GYPA 4BNTA 4TZKA 4YJDA 2OZPA 4QXMA 1DC4A 2W2LD 3MCVA 5JAMA 4P4GA 1GZ3A 4J9VA 4PLFA 3VZRA 3ZWCA 2NU9A 1FDTA 1FDUA 4JQCA 3ZWOA 3JQEA 5IZCC 1YBAA 1GYRA 4IIVA 1QXSA 2DAPA 3HADA 4LCJA 2DLDA 4NJMA 5G0TA 3KRTA 4NH4A 3ADPA 4UVDA 4RLSA 3AM3A 3H9JA 4B3JA 1U7TA 2GRAA 2AEFA 2AHRA 4B7CA 1WZEA 4XYBA 3T7CA 4CLEA 1VKOA 3IAHA 5U9CA 2YHIB 2ZB7A 3UKOA 1JLLA 2IEDA 1CJCA 3ANLA 3BTUA 5EINA 2WM3A 4AJ2A 4BO5A 2Q45A 3UVEA 4CUKA 4ESOA 5JDIC 2G1UA 3GRKA 1R16A 3HHPA 5JAIA 4CQLA 4NDNE 5CP8A 4DIFA 5TLSA 4MJLA 2NU7A 4IGFA 3GGGA 5KJEA 4KZPA 4U6QA 1UXJA 4WPGA 3RASA 4IGEA 4ZA2A 4YCAA 4DPMA 5B4TA 1HDRA 3PYXA 4WGGA 3W4IA 3GEGA 3GG2A 3GVIA 5C7LO 1C1XA 1QORA 4H7PA 3DZGA 3DDNA 1NVTA 2RAFA 3AFNA 4IQ8A 5F1PA 1SEVA 2P4HX 1A9YA 1SNYA 3P2YA 3FNFA 4J7UA 4J90A 2PLAA 2J8ZA 3NTRA 3FPCA 4XQGA 3WR5A 4YRAA 5KIAA 5MDHA 3C7AA 1HLDA 3H9QA 1N92A 4IS3A 2VTEA 4AJIA 2P9GA 2UAGA 1Y8QB 3BMQB 2VHWA 3VKVA 3KEQA 1I33A 3BMNB 1C14A 3WSWA 3B20A 4A73A 4GGOA 3GUYA 1BXZA 4QUKA 1OFGA 1Z6ZA 4JX8A 5EQDA 5B4VA 3T4XA 5IZ4A 2D2IA 2DTDA 3EAGA 4DREA 3JQ8A 1AGNA 3E9MA 2PR2A 3VPSA 4ID9A 4LN1A 5JCXA 2PGJA 2F00A 3GH3A 3R6DA 4BNGA 1GUZA 1U3UA 3AWDA 2VZ8A 5JMWA 2GCGA 2GNAA 2ZB3A 3PIDA 1P3DA 4FJ1A 4J3FA 4JJFA 3S2FA 2C54A 3FD8A 4J2OA 2Y93A 4EITA 3PJEA 5CG1A 1N9GA 5JS6A 4RZHA 5G4KA 1ZFNA 1Z74A 4MVJF 1I8TA 1CDOA 4B79A 1MC4A 3HDHA 3WICA 5DDIP 1LLCA 2ZTMA 1DJQA 1QYXA 3E5MA 4BS9A 4CPDA 3AUUA 1YL7A 4YAIA 5CDGA 4LRSB 4PLWA 3L77A 1DFGA 4YT8A 4OGWA 1HT0A 1QYVA 1GADO 1MP0A 1DHRA 3TFQA 3BMCA 2YQ4A 2W2KA 4PFJA 3RIHA 1GD1O 1KBZA 1KVQA 2O3RA 1GYQA 3JQ9A 1K6XA 1D1SA 2JFHA 3PDUA 3ASVA 2GF2A 3X2EA 1IYZA 1PZHA 3HSKA 4A26A 5COAA 2DUWA 3PHGA 4BL5A 3VPFA 1Q0LA 4L0QA 1GPJA 4YACA 2PY6A 4RPHA 5AXDA 5BSEA 1C0PA 4TKLA 1U2DA 3CTMA 3QW2A 4HUJA 4AL4A 4WOKA 5K0ZA 4MOWA 4RCVA 1NQAO 3ZDFA 3ZZNA 2VT2A 3INGA 3OP4A 4ND2A 1BG6A 1P1JA 3GMDA 1PQUA 4YA6A 4BNNA 4R68A 2VHXA 3VPXA 3HDQA 4QFDA 4BNMA 3PQFA 4BV8A 3DB2A 1RPNA 3ZU5A 2VTDA 4F45A 4AJOA 4L4XA 1VJTA 4NPCA 3RC1A 3OEWA 1NPYA 4JCOA 4KWIA 3DBHB 1JWBB 4K28A 1D1TA 4UUNA 4BUCA 5DULA 2J5QA 3I4CA 2E4AA 1BVRA 1E7MA 1LRLA 2VUSA 4HFJA 3KSUA 2NUAA 1T2FA 1ZNQO 2QRJA 1DIBA 3IP3A 3QRWA 3PTZA 1V3VA 1R12A 1HDZA 2ILTA 1UXGA 1E3WA 1PJQA 4MIEA 2Q50A 3H7AA 3QHAA 4HP8A 4UAGA 5F1KA 3A14A 2JCXA 4OYRA 4FFOA 2O3JA 1E7QA 1IZ0A 2YUTA 3IJRA 5G0VA 4DXHA 1YS4A 3G1UA 1ZJYA 1E5QA 3FNHA 4RVGA 4WKGA 1K89A 3RWBA 3OJOA 4TRJA 2GLXA 3JQAA 5IJZA 3MTJA 4HWKA 4MP8A 4Z9YA 2TMGA 1DBVO 3TQHA 2O3SA 2XXBA 4W9NC 3JQBA 1YQDA 3TZ6A 4U8GA 4XJTA 1AXGA 1UR5A 4IUYA 3DZKA 3WB9A 2HMWA 4MKXA 2FPPA 3KOUA 1L7EA 1LA2A 3KSZO 1W73A 4K1LA 4H16A 4PLGA 3VKUA 1F06A 2J5RA 5L9AA 4Z9FA 5CDSA 2DU8A 4GX1A 3OM9A 3GLQA 4ZQGA 5B4UA 3LSYA 2O4UX 1LQTA 2V6FA 4R1UA 4DMMA 1PU2A 4E21A 3HUDA 3WYCA 3HZZA 2Y99A 5L7TA 3LU1A 2BFMA 2OUIA 3MJ4A 4OQZA 1KEVA 1KEUA 3OMLA 5A05A 4FC6A 5AXBA 3O8QB 1X7GA 2BMAA 4B3IA 5I7SA 1GCUA 4TRNA 3C85A 3GPDG 2Q3EA 1T4DA 4GVLA 3U49A 4CV0A 2B4TO 3BTOA 1VLLA 4Y6PA 4BOYA 2D0IA 5GZ1A 1C0LA 1H0KA 4ALKA 1N8KA 4RLHA 2Q99A 1GTMA 4W6ZA 2X5OA 3WWZA 5DBGA 1BMDA 2Q1WA 3JV7A 4OAQA 1J5PA 3S8MA 4R1NA 2Y0EA 1ULUA 2VRCA 2E48A 2C2XA 3I6IA 3H3FA 3IUPA 4FD3A 5G4LA 1PIWA 4AFNA 2B37A 3GOHA 4HFNA 1Q1NA 1CEQA 2G76A 1U3VA 1N2SA 3JQ7A 1YL6A 4NJOA 4L4RA 3I9OA 5IDXA 1ADFA 4I5FA 5JYDA 4FW8A 4RF5A 4XB1A 1XQ1A 3W8DA 1GZ6A 2QW8A 2YDYA 1I36A 1Y5MA 3IDSA 1VI2A 1YOVB 2ZB8A 4JBGA 4ZICA 1TT7A 3I3OA 3FTPA 4R3NA 3F47A 3INTA 3ZWPA 1R6DA 1XKQA 4ZRMA 4W82A 3OIDA 4Z3DA 2DM6A 1ORRA 2ZTUA 5F21A 4JXKA 4CM9A 3RUHA 1I24A 1WDMA 3D64A 3OJLA 2R00A 1Z7BA 2A4KA 3G79A 3E5RA 1C1DA 2PKRA 4XEHA 4F46A 1VPDA 2VYVA 4B3HA 4Z6KA 2DBZA 4HY3A 3AI1A 2POQX 1V35A 1GEEA 4C4OA 1JU9A 3P7MA 3ASUA 3PJDA 1FJHA 4LSWA 4E5MA 1U8FO 3RD5A 5DCYA 3QJ5A 4BNVA 4J7CA 2ZIZA 3Q2IA 1U2GA 3GVHA 4D3FA 4FR5A 4WJZA 3E1KA 3NAQA 5TS3A 3JD4A 1UJMA 4ZJUA 2OGUA 9LDTA 4LW8A 3CH6A 1R4MA 4IS2A 2NQTA 2G0TA 2A92A 1LLQA 3WWYA 3A9WA 4YJFA 3WGIA 1KETA 3KYBA 4BNYA 4CQMD 3F3SA 3F4LA 2AMFA 3OQ1A 2PNFA 1UZMA 3UCFA 1LDYA 4QX6A 3MJSA 2PD6A 3OH8A 4HNHA 3W6ZA 4WNCA 1NPDA 3RCBA 4OHUA 1R0LA 1GCOA 5EN4A 5ER6A 4BKRA 4IZIA 2X7HA 3I9KA 4PN3A 4DLBA 3NX4A 1DSSG 1PTJA 1UDAA 2VWHA 3H2SA 3QVTA 1EUCA 4IJWA 4MINA 4XYLA 1JN0A 4CMEA 4DMLA 3CUKA 4MVJA 1P33A 3G0OA 1BDBA 3I5MA 3C3XA 4YAJA 1ZSVA 5KNLA 1UP4A 4E2WA 3KYCB 4H3VA 1Q0QA 3ONFA 4TRRA 1D3AA 2A35A 4Z9XA 4I9UA 1ADBA 2AEJA 1ULSA 4WEOA 1E3IA 1IZ9A 2HRZA 3ROKA 2D5AA 3D4NA 1VL8A 4NBTA 1EDZA 4JK3A 4QO7A 4CMIA 4XRGA 5JDIA 3ZGYA 1K2WA 1GFSA 1PL7A 5I8WA 3Q3CA 3ROPA 4U6SA 3H5AA 2DUUA 2IYPA 2RH4A 4IDEA 1ISJA 4OOFA 1X7DA 1B8UA 5BSHA 6ADHA 1TEHA 2FP4A 4G5HA 1KVRA 4XDYA 3TJRA 2UUOA 5T8KC 1X7HA 3L4BA 2W2LA 3F5SA 2I3AA 2PGLA 1BTOA 1BXKA 5IDQA 2I67A 4BMSA 4U7WA 1P1IA 1YWGO 1U7HA 4PIVA 4IDBA 5TQVA 2VWPA 4M1QA 3DBRA 3LLSA 2Q4EA 1CWUA 3K8ZA 2CZCA 3RUAA 1MV8A 3WLEA 4I9NA 4AG3A 1PGJA 1ISIA 4BMVA 3ZWBA 1OAAA 3AY7A 1I2CA 3DOCA 3L6OO 5JBIA 3ROQA 1E1NA 5HWSA 4XDZA 3OIFA 1EVYA 4HKTA 1LXCA 3RBZA 1EDOA 1UDCA 4EBFA 1NHWA 1ENOA 1PJSA 3KV3O 3EY4A 4RVUA 1RWBA 3MTGA 2FR1A 3K2BA 3D7LA 1YKFA 2V7PA 1Z45A 3PGXA 1VM6A 2C5EA 4AJPA
chains in the Genus database with same CATH superfamily
4JKOA 1KIAA 3NR2A 1JNYA 1S8OA 2KW5A 3GCXA 3HWX1 4KE8A 4MPRA 4N65A 3TTWA 4W5QA 4XOUA 2E4WA 2D5BA 3G0IA 3QLJA 4OGLA 3HXMA 4WBXC 1WHSB 1MXHA 4Z7NB 4FE3A 5C1PA 1JFSA 4U2DA 5HZGA 1COWD 3MTDA 1S9DA 4D99A 4YVFA 1KRWA 4IDDA 4RADA 1P3JA 4QARA 1IM5A 3D6UA 2WHYA 1ZGGA 3VV2A 4ALMA 3VR3A 2NO6A 4NXMB 3QFTA 4KBYA 4JLVA 3LNCA 2UYHA 2MOKA 2Q3HA 4LRUA 4HVLA 1SXGA 4WDQA 4H7FA 3NHJA 4N82A 3DL4A 5LA6B 3WYDA 1LSUA 2B4RO 2FUEA 1Z15A 4OLJA 3IPCA 3PIRA 5FWXB 1PR0A 2EHJA 5E2BA 5FLXA 3KHTA 3IV9A 1B0PA 3N2EA 3L05A 2IYNA 2SECE 1GKYA 2CUZA 3VZSA 3TL6A 1Y6FA 2HMSA 2IPNA 3BIOA 3R6WA 3USES 1C0KA 4MP6A 3RAGA 1QP4A 5I8ZA 4DV5B 4FZJA 4XM1A 5C4MA 1WNTA 4M0MA 5CD9A 1PK9A 1RQXA 4EPRA 1YH3A 3QLUA 4KXNA 2XOEA 2OHVA 4WKCA 1YIAA 2E89A 3NB0A 3PVZA 1ORIA 3N7AA 4R83A 1T0IA 3IBCA 1IHUA 2AN5A 1I0ZA 2UU9B 2ES4A 1PBNA 2FK8A 1GZ5A 1AHNA 1BW9B 3LPDA 2HHJA 3DAFA 2AF4C 2WEKA 1IY9A 5FNVB 1MDBA 2CDCA 4RSHA 3SFZA 4ZCTA 3TTUA 4WZ6A 5H9WA 3IL2A 2QRMA 2NVUB 4G4GA 3SKVA 9ATCA 1JPUA 1Y6QA 3A6DA 4KI7A 4DKJA 1DB3A 1II9A 3H9GA 4YYZA 1WSAA 2XLBA 4U5QA 4CQMB 1V1RB 2BTOA 1P3Y1 2Y1OA 1MOZA 3IJ5A 2H0QA 4FLEA 2IUFA 4EVSA 3QYPA 1EXWA 2CSUA 1K75A 2FDRA 4E1BA 1EWYA 1YZFA 3JPYA 4UNPA 4GX0A 4ZHQF 3QKIA 3RRYA 1C0EA 2HSZA 3PQCA 3VDRA 3CUUA 3NHPA 3T7SA 2JGEA 2B3TA 2FG7C 2XVAA 2XMPA 4PWYA 5FV7A 1Z56C 3K2QA 3IMFA 3FTNA 1LC0A 1Z6YA 4IRMA 5EIHA 5B4UA 5F2NA 5EWLA 4UHFA 1SKYE 2PBLA 2R8RA 4UJ3A 3UW1A 1AX9A 2ZRMA 1F3OA 2DR0A 3K1ZA 5EJ2A 5C7IO 3GJYA 1ESDA 2NTEA 3N2GA 3AEQA 3LHIA 1BS1A 2SCUA 3S6JA 1DPGA 1CY1A 1KI6A 4D3XA 5JH7B 4KMRA 1TLTA 2Q6OA 2HDHA 2PKYX 4UVGA 5M7EA 1FRZA 4ZYWA 1RWXA 1X1RA 5FI1B 4C21A 5FWDA 1DAIA 2XYQA 1SK9A 2CDRA 2O2ZA 1D2MA 2V03A 3LDFA 2QUIA 2XMGA 3BMCB 4ARZA 4H6VA 2CV0A 3KVNA 4B6EA 4IXWA 1MTZA 1EFRA 2WFLA 1IWBB 2XA9A 4YJGB 2WTUA 2KB0A 4UE6A 2WE7A 1TO6A 1G6KA 1NC1A 1XAIA 2E7ZA 5KYUA 5HXAA 3U81A 2LW7A 1JMKC 1KHTA 2DQKA 2GHIA 1EK1A 1W0KD 3EARA 4E70A 4KQJA 4CLRA 3PT5A 3RUCA 1WPXA 3L49A 1EG2A 2HCTA 4B5KA 1VL6A 1P5FA 3AJRA 3EFEA 2QUKA 1DNPA 5ELMA 4DIOA 1A2BA 2BFBA 2GJ4A 2R6ZA 4WH0A 4F84A 3I1JA 4YUZA 5JANA 3LCRA 4YY3B 3SC4A 2FFQA 4WOCA 3QKRB 1K7SN 4BKPA 3AU9A 1WPQA 2GPTA 2KWIA 3ZE7A 3QM1A 1U7OA 3PUVA 4GBMA 1QGAA 5K5EA 4S24A 3IPYA 1H4VB 1UWLA 2GNPA 1MBZA 3C1AA 3K9NA 1KBOA 3A2MA 5ALEA 5DYTA 3R3XA 4E3ZA 1DV1A 2EYUA 3N2ZB 1VCNA 3PPWA 4ISBA 3UUFA 3H6GA 3DHNA 4O2AA 4QBKA 5J59A 1U90A 4MI9A 4DSZA 1XKTA 2YNMA 2C8KA 2P4SA 4G8CA 4JH0A 4Z8XA 3TRIA 4U7HA 1J0XO 1MOQA 4JI1B 3QU4A 4OB6A 3PPIA 1JVNA 4XLZA 1KSHA 1RJGA 3LUAA 2OG1A 1CUSA 1G8SA 2PSHA 1RRPA 2J9XB 4BWGA 4CN9A 4IKEA 1I5RA 2EATA 2J4CA 5K3AA 5E38A 4EPVA 4J7AA 4YDQA 2NYVA 1GRVA 5IARA 4F4HA 2ST1A 2WWWA 2JARA 2QJRA 3HP7A 3DOJA 3TRFA 2ZUFA 1QU2A 1L3BA 3QWAA 1DIRA 1CY4A 1HFEL 3A8TA 1IY8A 2IE8A 4E4TA 1NXTA 1XL1A 2D2VA 4DV4B 3KEGA 2TECE 3LT0A 2V1UA 3NOQA 5EE5B 5CYGA 3EIOA 1H0RA 1M34B 1N8TA 4FGUA 4D74A 1W35A 4Z5XA 1RBMA 1JFTA 4JI8B 1IMOA 4LF8B 3A28A 2WPDA 3T0GA 4B6FA 3OKFA 1L8AA 4K7JA 5CPFA 1O77A 4R8SA 1OB2A 2DVMA 3W8RA 2CNLA 4MWGA 2ZRFA 1S2GA 4IWYA 4MVWA 4YRBA 1JPJA 2ZM6B 4JJGA 4MUEA 5IAEA 3COJA 1QMGA 4LA4A 1G38A 3AKYA 1XZ8A 3R8CA 2PMDA 1G3RA 2GBLA 4KFUA 3OOJA 3HB0A 3HYLA 4LHYA 3NLLA 1CUBA 1SVUA 1VE3A 2VJAA 5HFJA 3V1TC 4DZTA 3C48A 4RMJA 4B3XA 1E5VA 3NBFA 3THSA 3VR6H 4DCNA 4EBBA 3FCYA 2A5YB 2VEDA 4Q16A 4QVGA 5KTPA 5FTWA 2J59A 4MGYR 4B2LA 4TV8B 3G8DA 2B4YA 3M70A 1FRFS 2ZQYA 5A3VA 4TLDA 1JHZA 2CLLB 1IXKA 1XUOA 3CRMA 5IK2D 2GJAA 3NJ8A 1JYSA 4MS1A 1QZUA 1PWEA 1Q92A 2P1DA 1U3CA 3RYCA 3CONA 3P9NA 1OPRA 3LRTA 4L1KA 3UT6A 1BOOA 4A8JA 4F6RA 4G5YA 4PO9A 3EXFB 3G2HA 3VC3A 2X15A 4UU0A 3RUIA 3RU7A 4UM9B 4HQKA 3W3AD 5CUQA 5F4BA 5DYYA 5AUNB 3CE6A 1U7XA 1NQ5A 1CUFA 3EH1A 3L4BC 4NHEA 4CN8A 4DLYA 1CK4A 3Q3HA 5JNLA 4QEDA 2GHQA 3QXCA 3CLRC 2NZXA 4C7KA 2APJA 3JY6A 3TRJA 3ZR4B 1NJSA 1Y1PA 4QDJA 1P62B 1RYBA 3G85A 4K3VA 4Z4IA 2R2GA 2WYVA 1E7SA 1KXZA 3DWFA 3NWPA 1UP7A 1ZD8A 3WMWA 4CMGA 1Y6JA 4ZHSA 2PHZA 4K03A 4Q4HA 4JJ6A 5BSRA 1N2CB 4ENRA 2JHCA 3R3JA 4QHYA 2BM1A 3C41J 3CTPA 4EAAA 5FI3A 3HKEB 4RA9A 4FGSA 1HYEA 4EDFA 2R44A 1H2HA 1I2DA 1Y8RA 3E3AA 2IS2A 4AY5A 2ZDGA 1EYZA 1Q3TA 2YXNA 4M8NE 4OUDB 3RSQA 3ZZUA 2JJQA 2X1HA 4F8JA 3AVPA 4U7PB 4ROTA 2I2XB 3SX4A 3O8RA 3PUWA 4LOAA 2XOKA 1NIJA 4PC3A 2YRFA 1Z8HA 3K1JA 4PLZA 4HDOB 5H3LA 1MB4A 3VU9A 1WU7A 2C9ZA 3ZE8A 2ODQA 3G1TA 4Q1BA 4M0EA 1WCIB 3QQPA 1J9GA 2P6PA 2ZIXB 1O58A 3CPHA 3JYPA 3NVAA 4MSUA 5HTKA 4PRLA 5IPFA 3A3YA 5JAUA 3E35A 4CMHA 2BF7A 1U0JA 4ILEA 3H65A 1JEOA 3GVPA 1B1CA 2B94A 4I1YA 4DW8A 4FYMA 1DBSA 1RQGA 1TQDA 3N9IA 1T3GA 2X7XA 4N6OA 4WNAA 1LTQA 2IXFA 4EUHA 3PJGA 2HX1A 2AB0A 3H9UA 4UXJA 3L8ZA 2AG5A 3F78A 3HU2A 2JLCA 1GUFA 5KU7A 4PYKA 1UCFA 3WOHA 4AXBA 2FRDA 4ZTUB 1HYGA 2CFIA 4L08A 3TB4A 3ZJTA 4MUAA 4DMKA 3EF0A 2OAP1 2YYSA 3SSMA 5KC9A 3O94A 1DCMA 4JQOA 5HG0A 3WGHA 1MB9A 1HNNA 5DCUA 4GC5A 4U7TB 1Y3HA 3SSAA 1TD9A 3EIXA 4YPVA 2GZRA 2X9NA 2Z5LA 4V02A 1X8XA 4X64B 3HJTA 2AOXA 4I50A 4TXMA 2WJ3A 4RF3A 1ADCA 3O84A 4WXRA 3ZW9A 1BIFA 2ZCJA 4KRFA 3PQ5A 3RK0A 4I2NA 4DT1A 2PSEA 1QONA 4HTAA 2IOYA 2HA5A 1O96B 3BKXA 5SV2A 4DMUB 4BNKA 1C3OB 3LOQA 5IBQA 3S28A 3KQUA 5DRTA 4Y30A 1NHGA 4IOMA 2GASA 2Y66A 5F64A 2QMYA 5LB2A 2CYCA 4C7BA 4S0ZA 2IYSA 1A5AB 2F8MA 4TKZA 4OL0A 3EASA 1HC7A 1NF2A 2A84A 1CJUC 3C1OA 5AKLA 5FADA 3QKUA 4DRYA 3ZE2B 5F7XA 3E15A 1Q7RA 2EKPA 2UUBB 1NBWB 3VR5A 3R09A 2OHJA 3PKIA 5HSGA 3K71B 3IODA 2PZ8A 4R2JA 5HMMA 2CFOA 4M1TA 4LDPA 3UKDA 4DLTA 5GVSA 2YASA 2GVNA 2VDMB 3DSRA 2Y68A 4LSMA 1YDEA 4LJAA 4MUKA 4RKQA 3VTFA 3BD7A 2XMZA 2AC7A 4M1WA 1PWZA 3CYFA 4OJMX 4ZT7A 1AKYA 3IP6A 4IGAA 5E6SB 3V55A 1U80A 1DHTA 3CX8A 4Y1GA 5EEGA 1O8CA 4PG7A 4F92B 5DLPA 4EG0A 3PGKA 2C5SA 4OSPA 1HT2E 2QAGB 1FSFA 1QZ3A 3RM3A 4IV0A 3SEFA 3CISA 4JLAA 5FR2A 1DT5A 1U8XX 3A6JA 4PM4A 3NYWA 3PWSA 4EB6A 4ZYTA 3HMKA 1NY5A 5HQTA 5TIIA 1NP7A 2Y1FA 5CVCA 5KNDD 5T5QA 5CDYA 3TFOA 2HNBA 2QVGA 1GQFA 4JI3B 2D8AA 1HI9A 1O4VA 4K6OA 1RM3A 3GRVA 4W8HA 1FNSA 1B0ZA 5SY6A 5HOQA 2ZE5A 3KHUA 4YI3A 5K03A 4MDFA 2X4IA 4OYLA 5CTAA 4O4JA 2R7KA 2BFEB 2VF2A 4GOKA 1MX9A 3WGNA 5GJWC 1AUQA 5C81A 2RGRA 3ILXA 4FHDA 1YFJA 4IVQA 4GE3A 4PPFA 4JMLA 1UBLS 5CW1A 4DV7B 1G8YA 2H1IA 4RGYA 2EP8A 4JYCA 5GOTA 4UARA 4Y6GB 4MHOA 3B5IA 3HYTA 5ALSA 1J7KA 2P6OA 1ISGA 1KP2A 4URZR 5EFZA 1P75A 4L0CA 4HDMB 4LEIA 3WB0A 1Z5VA 5CDTA 1UBOS 1D9XA 4R0MA 4WESB 1DKUA 1JRLA 1II0A 2Y0PA 5SY4A 3U7GA 5C5CA 1DIAA 1WY5A 3ANSA 3PXUA 4QGAA 3UT0A 3PC8C 4BX3A 2HQOA 2W58A 4HXEB 1JILA 4TS1A 1E8NA 4L27A 4BFSA 1FFGA 2BY4A 5CNMA 1QQAA 2PLNA 2YHBA 2TMKA 1XDZA 4WJKB 4L4SA 3JALB 2BEWA 2CLSA 2UKDA 3T4PA 3FNQA 1V16B 2AQIA 1P9RA 4L9AA 1JG4A 1XLUA 4XCVA 3RHTA 4Q3CA 3UJDA 2CV1A 4LF4B 4CKXA 4J4HA 3MJTA 3EUFA 3HL4A 3NG1A 3PC3A 4MPDA 1J39A 3AVWA 4O33A 1LQUA 4RV9A 1MX3A 4YPOA 1AK1A 4N7MA 4BAUA 1M54A 1OZAA 2ERCA 3NHKA 4HR7A 1JEYB 5BN5B 2ZYIA 2HK6A 4ZOLA 2HSEA 3EZ2A 3PEWA 1NYRA 1YIDA 3AR5A 4YREA 1ZR4A 1X1SA 1NFFA 2FPIA 3JD1A 3EODA 3NONA 3NW9A 1OYYA 3LDAA 1UMCA 1MGPA 3PEEA 4FWIB 4AX8A 2TRSB 1RTKA 4I55A 1JDBB 3RFFA 5HILA 4DBLC 1NOJA 2ZJ2A 3EXEB 1N0HA 3OUUA 1DZ3A 3PSAA 3MHPA 4HRXA 3Q72A 2O3TA 2PMKA 3I30X 3MMXA 3QVWA 4TLBA 1N77A 2OCGA 4GBED 4RIEA 2A9VA 1YE8A 4HPXB 2PSJA 3VZCA 3IVAA 3ZY2A 5LCXA 3FTFA 1U8YA 4MVJM 2WU3A 3W3AH 3I2YX 4FFNA 3U4DA 3SHVA 1U0TA 3D8RA 4JMPA 4KQGA 1Z4PX 4MB2A 3ZH9B 3IE2A 2KJQA 2AFHB 4MLPA 3JD3A 3NDRA 4V0QA 4LI0A 1QANA 1XVUA 4XVCA 3NGXA 2GJ9A 2QL5A 4G0NA 3TLXA 3PUYA 1YHZA 1TOAA 3EXHC 3I2HA 3UA3A 3IDOA 1E64A 4KSYA 3OETA 4JVNA 3WWEA 3RTAA 3GPBA 4R05A 2O2YA 4P83A 1BE0A 5KYVA 5TDHA 4COKA 1VBFA 2V7TA 6ABPA 1Z4IA 5DK6A 2ZPTX 2O8CA 2GO7A 2WKWA 2K6GA 1S1CA 4KBFA 4EL5A 1L5LA 2LR0A 1F9EA 1N2HA 4GOMD 1ZUIA 4EJSB 2WAXA 5F1YA 1DAGA 3A6EA 1B73A 4MKRA 5PGMA 3PFHA 2PXCA 4JL5A 5UKDA 1KVUA 1NQVA 3U7FB 3KAQA 1KAGA 1UBJS 4Y9TA 3NTUA 5AK4A 3NV9A 3BMQA 5FR1A 5CJPA 2X13A 3ZOKA 3PRKE 4DMGA 5EHGA 1Y7PA 1ZVJA 3UJ7A 3BMNA 1IJEA 2Z09A 1KPIA 2VL7A 4FCCA 5ENDA 4X1YB 1TT5B 4EENA 4KJZA 5D7BA 1YKSA 2J6IA 3NEAA 4MPPA 3G2KA 2YINC 2RSLA 1XA3A 4OKIA 1E7RA 1Y81A 1M2HA 3B1VA 3L8EA 4RFSA 4S1PA 1RJFA 3ZU3A 4X8LA 5HRAA 2C7GA 3QSGA 4K6GA 5BXQC 3DKVA 3MAGA 1E9FA 1L4LA 4JASB 4W5RA 1EHYA 4H4CA 3E4CA 1CVRA 2A5LA 4X3OA 1JIIA 5H02A 3SJUA 2OSBA 3TIGA 5IXSA 4D41A 3DKRA 1OIXA 1SUPA 4NNOA 4F5DA 3G68A 4Y2XA 4QDXA 1T6BY 1JDTA 4A0FA 2C1XA 1CR6A 4EY5A 3OA0A 4REQA 4KQ2A 4XD7A 1OREA 4G1CA 5C4IA 3PCXA 1KQNA 4NOJA 1GTJ1 4X71A 1GPH1 4W4TA 3SC2A 5C7OO 5LNK1 2GM9A 1VBKA 4FDLA 1QF9A 3GBSA 4BNJA 3RG8A 2D62A 5MFZA 2CJYA 2VDKB 2OK7A 1OZFA 4JBNA 2J09A 1VLJA 3OD1A 3PPXA 2IPOA 3LLCA 2WKRA 3PKZA 5JRJA 2CB0A 1M9NA 1MH9A 1THTA 3LNTA 4MAAA 2LGJA 4JCCA 1EVZA 4L5BA 4MP3A 5E1MA 4WBNF 1E6CA 2ODWA 1ZD3A 1CHDA 1NVBA 4JI5B 2A57A 2WTMA 4B4OA 3MOSA 1U1EA 5B6JA 4TRMA 3VMFA 5A4JA 3GUHA 4AJ9A 3U1TA 3RTCA 1CJMA 3UW3A 2CXRA 2GNOA 2AN9A 1YDHA 3FA2A 4DLUA 4MA5A 5J1SB 3AR3A 3IKTA 1EEHA 1EM6A 5DLQC 4AT1A 8ABPA 2P3LA 2GYUA 2XW6A 6NULA 3F73A 1PF7E 4YP6A 4M8SA 1MC8A 4P7BA 4JEIA 4Q39A 3BAFA 3OM8A 3NAGA 3Q9SA 4LRYA 1YUBA 2V4UA 2ANCA 4KXFB 5F3WB 1OBCA 3NIGB 1EUYA 2YV2A 3EC1A 3RG2A 4CEJA 2MYTA 4KQWA 5FKJA 1H6DA 4DA0A 1U8TA 1T2UA 2VNJA 2XZTA 4FVTA 3WIEA 1W0CA 2QRVA 5AVJA 3WL4A 2UZAA 3KKOA 4FCVA 4JP3A 5BMVA 1IAQA 3PT9A 4AKSA 1UZLA 1TMKA 3L6BA 2HQBA 1VE9A 3QFHA 3WGVA 1JJBA 2GPYA 5EWJA 3QFCA 2HGZA 4GMHA 3X1DA 3QMMA 3NEPX 2RBKA 4ZANA 5CIWA 4ZCLA 2H2FA 2OCYC 4AMYA 1Y1SA 2D0DA 4YCNA 3WDSA 4ZEVA 5I9LA 1JB9A 1CERA 2ORVA 1FTSA 2V96A 4MWTA 4DDWA 5DK4A 1I32A 2IHBA 1QK5A 3ER8A 2PLRA 1M2JA 2I9PA 2ZI4A 3NNNA 2UZ3A 1X38A 4OMCA 5HP4A 1FLNA 1Q20A 5CGZA 4D79A 1M1YB 4ZVRA 3ESYA 4AK9A 4H7IA 4OHFA 3ZHCA 3THWB 2PH7A 5BT9A 2GWHA 1E5DA 3SEAA 5DP2A 2W6CX 4M7WA 4KOAA 1OJ7A 3OU2A 3KOWA 3VBEA 4O4LB 5KX5A 3G8AA 4KEAA 4LPKA 1KOGA 2G1JA 5E2IA 1HR0B 1NPTO 3DKPA 2OD7A 4UFNA 3G88A 1YI1A 4NBNA 4HATA 1BEEA 1KY3A 4ALLA 5KWJA 5BN4A 4LMAA 3L1UA 3UXMA 5A06A 2PSSA 5ILOA 1KRXA 1XFAA 3IKVA 3NM5A 3R6TA 3QF4B 1UC4B 3QUQA 1TM2A 4KKVA 4MS3A 4NFHA 4RIFA 1RZ3A 3ZU4A 5AVWA 3Q88A 1DLJA 4JSYA 2Q41A 2XJ4A 1I4LD 4EW6A 4F96A 2RK3A 4BPBA 1RQRA 4ZDKA 3DEHA 4TMYA 5ALTA 3TR0A 1DC3A 5IKOA 3CZMA 5KU1A 2XWSA 1G8PA 2ZTVA 4QU9A 1UK7A 4L3OA 4CFZA 2C0CA 5ARCA 3AKDA 1D4ZA 5LP6A 1RYFA 1W46A 4KWCA 4B1FA 1DAEA 3BICA 5ED4A 5CFZA 1F7VA 3BTSA 2V45A 1J2YA 2QM0A 4Z7OB 5JI2E 1NRJB 4DVJA 3RS8A 3B2NA 4YRSA 5A4AA 3ZY3A 3MSXA 5ED0A 3W2IA 5IF3A 3V2HA 1F1JA 4NLLA 1MC1A 1RSZA 4RWEA 2C2GA 2WW8A 3QQ5A 3AHEA 3S8YA 3WGYA 4XJVA 4EKGA 5EJEA 1J0DA 3ETJA 1GN9A 2Z8YA 4LYGA 5KTSA 1Q7EA 2EKDA 1ENZA 2NU7B 3QGMA 4F5YA 1SZJG 2QVLA 2FW9A 2J3QA 3QW4B 4O08A 2E85A 4OI4A 5DGCA 4EO4A 3M5WA 5FX2A 2HH9A 1QP8A 2VBCA 3TSOA 1YDWA 2OENG 4HXYA 4URUR 4XVUA 4YIHA 3G8YA 1H2ZA 1NFRA 1BDJA 4LCBA 1TLFA 3C3CA 2GXQA 2FQWA 3QU5A 3REQA 2PL3A 4DCUA 2X5NA 1BDIA 1R1DA 2XNCA 2XNHA 2CD9A 3A0UA 3MEQA 2B25A 1G2IA 5HUQA 5KNBD 4RELA 4RTKA 3A37A 1BCSA 4UM9D 1L7VC 2QJTA 4BQSA 4JFRA 1V7ZA 2EKLA 3DZ8A 4ZYVA 3VNRA 3TR5A 4KL8S 1DWUA 2F43A 5B7NA 2F8TA 3EN0A 3ZBTA 4EI2A 3ORQA 4AUEA 4BZXA 5B7PA 4YONB 4LQDA 2IBSA 1UADA 3ELYA 2WHEA 5LIPA 1GGHA 2O6LA 5TMPA 1G8MA 3B6IA 5EZYA 1MAVA 1PEYA 3TZBA 3DCJA 1BH2A 3W7AA 5J63A 3K53A 1G5QA 2OFPA 5KBYA 2WIFA 3UHOA 1YOVA 4RD1A 1MEJA 3IDAA 4II3A 4UBMA 3STUA 3V5NA 4DDKA 1YKGA 2G07A 1CZLA 2ZJ8A 4IWNA 5B7GA 4M7OA 1ZUWA 3GD7A 4RTPA 1X13A 5DCLA 1CDZA 3HEBA 3I0ZA 4QVIA 1KWKA 2UYCA 3TQCA 4W6QA 2PT9A 4XIFA 3RC3A 1WF3A 4JI7B 1CF2O 5IDYA 4QJ3A 3EVNA 4OJYA 1MFZA 1J1UA 1FQJA 3ADKA 2Y4OA 4JJ4A 4P81A 4F1WA 2XXAB 1TRKA 3Q6IA 4N3AA 3EZYA 1CQIA 5LM3A 3CVXA 1E79D 2ZI7A 1OAKA 5L45A 1IWOA 4HVTA 4RSGA 2WM2A 2C57A 4Z2YA 1C29B 1KR2A 3FKQA 3MCTA 1OFHA 3SIWA 1OH7A 2G82A 4LKOA 4PYRA 5TSDA 2ZRQA 2XQVA 3OLQA 2B8JA 4K6FA 5FTMA 3TPFA 5LD2B 1XZGA 4MI3A 1QKKA 1UIMA 1GA6A 2DFDA 2JEOA 3WLPA 4BO7A 5LQDA 4BVBA 4IQ4A 2B1GA 1Z6QA 3KLOA 3FMGA 4FSXA 3NQ41 4KE7A 1V4BA 3ZCSA 4XWTA 3UUWA 2VDUE 1WG8A 3V4OA 2DBQA 2IPAB 3AHIA 3CGGA 3IMCA 1IVSA 1XTKA 2M6RA 1XELA 2P78A 3WE7A 1W6UA 5ALNA 1VXRA 3BJEA 3C6BA 1CNFA 5E3IA 2EJWA 5EP1A 1QE3A 4TWBA 5FT9A 2PFKA 3UH0A 1M1ZA 3KL2A 2Q4OA 1OIWA 4ZU3A 4F4UA 3FMOB 3KSAC 5AVTA 4IG4A 3HQ4O 4ZHQB 4B75A 5E6UB 4P58A 3E1SA 1L2TA 3AF1A 4LY3A 5K0BA 3M6WA 4BNDB 3C6XA 3OLCX 4FYXA 2C4VA 2X2PA 2G3YA 3K73O 3I32A 3JD0A 1KORA 1PP4A 4K8OA 5ICCA 3RUPA 4C2UA 4PPNA 2HLNA 4B8ZA 4XWGA 1SC6A 4IYJA 1P4SA 2OORC 5AVXA 3H2JA 1CY7A 1Q50A 4WLOA 4DMHA 3RROA 4AP6A 2K4MA 2IP1A 1NVKA 2WWTA 4ND1A 2IS6A 3EEQA 1WF6A 3P4XA 4QYMA 2QVXX 1EK2A 4GPIB 2W8ZA 1LDGA 4DGQA 1OHHA 3PE6A 4O4IB 1SVOA 1XZHA 3PEFA 1OC2A 3JYNA 4B7UA 2N9UA 2JVIA 3GRAA 4DUGD 4F0JA 2ZUVA 5JJ5A 2WINI 2VZLA 3K9QO 3ZDXB 4MHSA 3QEOA 5A0VA 3HJNA 5CFNA 1SMKA 5EKDA 5KWIA 3GQBA 5K8JB 3C5VA 1XZCA 1I3NA 4U2GA 4JI4B 1PG0A 1IQRA 1E3QA 4M1SA 4XUEA 5HJ2A 5BN3A 2QI9C 3ITNA 3FH0A 2YOGA 5J2TF 3FJYA 4R9RA 3I4FA 1ULBA 1S2IA 3DVLA 1FBTA 2IYZA 1VI6A 2NTNA 2ZWAA 3HEAA 4IH4A 4Q34A 4FX2A 2XYRA 1PNOA 3KEOA 4Q47A 1UBHS 1BE1A 3ROXA 1Y1QA 1I5EA 4II2A 3LYUA 4B81A 4DBZA 2JH9A 2D7CA 4RK7A 3BULA 4U7JA 3STYA 3IPAA 3WBBA 4GDFA 1FQWA 2C4TA 1OWPA 4OXYA 1HTBA 4ERNA 5IANA 3R23A 4XARA 4A2WA 5I9MA 5EJAA 1GHTA 3AHDA 1S4QA 4J0HA 5CLJA 1Y6ZA 3R1IA 5AHXA 3JQAB 3C4JA 4IX1A 5T4BA 4E6EA 4I19A 2YX1A 1NM5A 1SWVA 4LXGA 1LDBA 3GPIA 2Q6IA 3DMTC 3NMUF 2VZ9A 4UTZA 4UATA 1QM5A 3DBOB 2GUWA 3F6CA 4M83A 1NBEA 1QF6A 1MD9A 4NCHA 1ZXBA 4KMSA 1KKLA 3FKJA 4MW5A 5IYZF 3C16C 1OXTA 4JKIA 4MEAA 1W36B 5CEFA 3O3NB 2HT1A 3BJIC 4YK7A 2VPYA 1GNTA 3DAHA 3NC1C 2XUPA 4D0LB 2RHDA 4K0RA 5BVHA 1E77A 1G6Q1 4QWWA 1XLWA 1DBPA 3AI2A 1AS3A 2J08A 3IAUA 2EKZA 1T34A 4LBVA 1VSVA 2OKCA 3OSZA 5AVQA 1BHQ1 4M0FA 4BN5A 3S8EA 1QBKC 1XTTA 1UFVA 5BSGA 1R0ZA 1HXHA 4HMOA 4C07A 3RJTA 1A8PA 3IV7A 2GMWA 5EIEA 2G0AA 1JG7A 4EMSA 5JARA 3HR4A 3KQSA 1AF7A 4M89A 2I65A 4HG2A 5LXTA 3W7BA 1K98A 4AZ3B 1Z0AA 2HCRA 2VF7A 5JCJA 3UAZA 4BVAA 1A9TA 2BLNA 4TZ6A 5CXSA 3L7MA 4EFMA 2VTKA 1GSHA 4HYTA 4OHBA 2VA8A 4YP0A 2QEQA 1NP6A 1TCUA 3EOZA 3D4OA 2AR9A 1XJQA 4EGSA 1PYDA 1MT0A 2IZ7A 3CX3A 1G7TA 3ORYA 1QRUA 1UZAA 2WNIA 5BWMA 3LT4A 4S05A 3OQJA 3NNDA 4V0MA 5K9ZA 4C87A 1E7YA 4PHFA 4ZC8A 3IDQA 3KXPA 3R20A 3LECA 4RC9A 4KAAA 1LPPA 2D0OB 4UBJA 3S7ZA 1E4OA 3DW1X 5EZSA 1B14A 5DASA 1TTHA 4S1VA 2P9QA 1VLQA 3T6KA 2QLMA 1KS2A 1QIKA 2ZR7A 4TWJA 5DW3A 2YZ2A 2H7YA 4IY1A 4AN4A 1DGQA 1UOQA 3B82A 3CJRA 2YWHA 4IUDS 3VPCA 2GD1O 5TGTA 1BS2A 3PFBA 4KTTE 2O2SA 3O5AA 3OEYA 4KP7A 1YB5A 4IHJA 2QB5A 3L7YA 3ZK7A 2XUIA 3GGPA 3KSMA 1KY2A 1NVMB 3ACCA 3RS3A 3HC7A 3UMFA 3V80A 4BNWA 4AAYA 3W5JA 4NBSA 2D6FA 4RJKA 4YBRA 1XMQB 5LPNA 4M6WB 2I33A 2WHPB 4AB1A 4G36A 1EWRA 3R76A 4BLVA 4BFYA 3OQ6A 3FGNA 2OAGA 4BBPA 2AK3A 1ES9A 1I13A 3MUNA 4OJQA 3Q7PA 1E3SA 3DE4X 4IJVA 1OGIA 5CJJA 1DJNA 1K9VF 3D6NB 5DTIA 5E8JA 4DCOA 1V11B 1LBTA 3E7WA 3T34A 4C0JA 2WQZA 2NGRA 1V8ZA 1YQGA 1B0AA 3IIMA 1CQPA 2Y6VA 4JIMA 5WRFA 1NKVA 5IAGA 1YF3A 1DDOA 1NU8A 1Z4JA 4G0WA 2JCVA 2RHWA 1X39A 4WCDA 3HJUA 1CJSA 4TLLB 4FDUA 2H92A 2AMJA 2WHRA 1MKYA 3JVVA 3OZAA 5E0KB 4LXUA 4DJDC 4BIIA 3HBNA 4X92A 1Z28A 1R4MB 3VU1A 3QX8A 3QFSA 1M76A 2X9GA 1O57A 4RCYA 2VTBA 1ZC4A 3QV1A 3W8EA 1MXFA 4R2KA 5CA0B 4JLBA 2K7FA 2EZTA 2JFQA 2V5UA 3K9BA 3RQSA 4O6VA 2BKVA 3IR5A 3QEKA 4U2EA 2AOTA 4WZBE 1EGMB 3ROGA 3W5HA 4CFYA 4B9AA 1TDJA 2Z4SA 2Z6VA 1HE1C 4FZ5A 2QN1A 4Q9NA 4DB4A 1YZLA 2XNDD 2LD4A 4QL3A 4CYMA 5CFRA 1XPUA 1Q0HA 2TMDA 5HUHA 3K0AB 3HRKA 3LRPA 4PCUA 1Y3CE 2WE8A 1QCZA 5L95A 2F4VB 2GN4A 1HYBA 2J87A 3FCOA 4P4LA 1LF5A 3HDJA 4L8GA 3D02A 2YJTD 3HACA 1QWSA 2VWQA 3AY0A 3D6MA 3DE2X 4QM6A 1PFKA 2Y1GA 5CT4A 4TKMA 3QH4A 1PHRA 3D8HA 4K9KA 2F1JA 2FTKE 1U1DA 5I01A 3CW8X 4ZIRB 5JC1A 1UAYA 3PHBE 1GPUA 1ZEJA 3GJZA 4P93A 4RA6B 4TOIA 1N2CE 1QGED 4D44A 5SYNA 1DKMA 3H9BA 4AF6A 1DXQA 1ZK1A 3NHSA 2BDUA 4JLJA 1RLOA 3UV7A 3GAZA 2DFKB 4EJMA 3N58A 4DKXA 1M7BA 1WA5A 2Z2YA 3UV3A 3W5DA 3ZDBA 1XF1A 1SQ0A 4F4CA 3L4KA 1FFAA 4II7A 2NN3C 3ZJVA 2E4ZA 2JGFA 4KAXA 4DA9A 3MQ4A 3USZA 1AO3A 2YWXA 5BWNA 2AUTA 1JKMA 1E3JA 3PGA1 4MWZA 4ZCPA 4EGJA 3ND8A 1WV0A 1EUZA 1U04A 2V9CA 2FSPA 2WMYA 4MUGA 1U0FA 4UVEA 4YLGA 1RJ9B 3D2BA 4MVJI 2WF8A 1ZUNB 1T2CA 3R5FA 4YAEA 4AICA 3GJQA 1U3DA 1JHOA 1US8A 1ZH4A 2JCBA 3Q3JB 2X0RA 3ZJ5A 2PL9A 3OCYA 3HFGA 5T64A 3LQKA 3QXHA 4M0UA 3W5IA 4KR2A 1MABB 3TI7A 2A14A 2C3UA 1II8A 2PS1A 2HQSA 2Z8ZA 3HFJA 1UZNA 3NH9A 3OZWA 4KFTA 3QVXA 1L7MA 4GM4A 4UCFA 1XXHE 4G2NA 4PLCA 2WSBA 4YC7A 2CDAA 2BW0A 1S0UA 1QG6A 1MGOA 2JNWA 4TL7A 3RI3A 4YJHA 3U31A 3ZDEA 4CVNA 3QNWA 4U2BA 1E2HA 5AESA 4KQMA 1D1PA 4AQ7A 5ITZB 3O7WA 4XPZA 1VGQA 1QVWA 2QX7A 4ES6A 3J81k 3GA0A 3IMEA 3QEMA 4G1EB 2CFSA 5EKXA 3UXYA 5DNUA 1VCHA 2YMLA 2WD7A 1NMZA 1VHWA 3ZWMA 2PS0A 4ONEA 3L40A 4LQ4A 1XAHA 1XFDA 2V8BA 3CURA 3DJFA 3EG9A 4KQEA 3QTBA 3E0QA 3DLPX 4PXYA 3GK3A 4GP9A 3DLIA 4TYPA 3EGOA 4W5HA 4Y1RA 1ORWA 4P0PB 1QGUB 3FYCA 2F9LA 1OWOA 3D3NA 1VSBA 2OV2A 3JQGA 3RLFA 2L18A 4LVNA 1AZTA 4YV2A 1OLXA 3QU7A 1LBSA 1LLDA 1ZMTA 1ZYUA 2XGGA 5AIAA 5AXAA 3EPJA 1OI2A 2JS7A 1MIOA 3SX2A 3A1CA 3U3JA 1K7FB 2Q5JA 1XZQA 4IWXA 4LJ8A 4NBLA 4MYCA 4UU8A 4WW0A 5CCDA 3ZV5A 2H3EA 1GPBA 1WETA 2IZZA 4UQPA 2DCMA 1Q1GA 3RJ5A 1DBIA 1MJNA 2HF7A 4WVFA 5AH0A 1PJCA 2B8TA 2AUNA 4J1TA 1T9BA 2RONA 3FOAA 4H59A 1FDRA 1QVAA 1U65A 3V2UA 1J8YF 2JK0A 4G8JA 2V7VA 5I4BA 2Z95A 1NA5A 1OYOA 1CB7A 3I28A 1CZKA 3SLGA 4DA7A 3BDAA 3LQQA 4WBSA 3SS9X 2RE8A 1OTHA 2NTVA 4GPBA 3GZNA 3LCJA 4C4ZA 4WK4B 2PJUA 1O8BA 3L7BA 4RK0A 4OMFG 1P7PA 3L93A 2ZWOA 4NIMA 4XIYA 4BDTA 2ZRKA 2CD7A 2V3WA 3O4JA 5F23A 2VUUA 3E23A 4DCCA 1MJGA 4EJFA 2F3SA 1KGDA 2O2DA 3UOGA 3GQVA 2CVQA 1N7IA 3PR3A 1JKFA 2HSGA 2I7DA 2OB1A 1DXHA 2I2WA 3F1LA 4CG3A 3AQIA 4ZN6A 1XA0A 4OG2A 4INPA 1HDCA 5KYTA 5CLHA 1IBSA 2I6XA 1SKQA 3FCUB 4XYMA 2ZP1A 4RD3A 3TX6A 2ZIVB 2MJLA 1MG5A 3PEUA 4H0FA 4CEIB 4OH1A 5C52B 1PTKA 4UUAA 4BNUA 4X00A 4FGWA 4UNNA 2QE7D 3UA4A 4UJ5A 2ZYWX 3ZQJA 5EMLA 4DIKA 4HXFB 1ZXLA 2VKQA 2ZRJA 3ZK9A 4LF6B 1VJDA 1SA0B 2NUPA 2NZJA 5JZVA 1Z75A 2QVBA 1RRCA 4O5OA 1VECA 3O8CA 1SXQA 1UBEA 3FPAA 1M1NB 4FXOA 1P5JA 4K9RA 1FSPA 2IODA 3UXEA 5B7QA 4JEHA 2PQ2A 4R8VA 1FNBA 1CR4A 1H6BA 1J00A 3BWXA 3IA7A 1RC1A 2LV8A 3K0HA 1MZVA 4KV9A 4PONA 1Z33A 4R7GA 3GAMA 5CAEA 5FTLA 2PXAA 4O8CA 4FKZA 3LXUX 2I54A 2X2EA 5F5NA 4DPKA 1M2NA 1FZQA 1QPGA 4GKAA 2EARA 4YAWA 1GL9B 3VR4A 1CLEA 2EBUA 4EHDA 1M1XB 3ZWNA 5L4NA 1QIFA 4BAZA 1Y3IA 2QTAA 1NJ1A 3LBHA 1CRQA 2D54A 2MSLA 4AO8A 1B4DA 1TUEA 1H85A 3PXCX 1NVEA 4EF6A 4Z0PA 3ABIA 3PEVA 4P2GA 1CY0A 1DEOA 2PZGA 1F6BA 2GB4A 1VSQA 2RHGB 1ZUHA 1NNLA 3AEQB 2JIZD 1LCIA 3ETNA 1V96A 2PRSA 3V46A 1KI6B 4RVFA 5A02A 4C2AA 1WB4A 4MCIA 4K6CA 1ZM9A 2W6IA 3UCXA 3CH5A 3GRPA 4WZAE 3ZNOA 5BNZA 4MR9B 2O05A 1MU0A 1PR3A 1VHQA 4MW6A 1JDZA 2FE1A 4EF4A 4UCWA 5C31A 9LDBA 2H48A 2DHDA 3RU2A 1E3LA 2BFOA 3EEFA 5AOBA 4Q3KA 4ARZB 3AW8A 3HYSA 3CR7A 4LGVA 1I10A 2R6CA 4FB4A 2ZJ7A 3FPSA 5ALPA 2WFLB 2WC1A 3IXLA 2J7PA 4ER0A 2Q49A 3RJ9A 3BCRA 3RSHA 2PWAA 1KFKB 5KYUB 3A4YA 3FW1A 3VOSA 4EPWA 4DYDA 4M53A 4FW9A 4P8RA 3UIEA 2GGSA 4CLRB 4CIAA 1FDVA 3PWTA 4WX2B 3QELB 3FZEA 2WU0A 1H3FA 2BFBB 3IEMA 5A5DA 1EFPA 1TZBA 2M1ZA 3BWMA 4HZIA 2AFHE 3ZQKA 1PJ4A 1HY3A 4P3YA 2Z6AA 2OM2A 3QU2A 1P6UA 1CUWA 3C2QA 3LCCA 3PXDA 1NYLA 2GEUA 3EIHA 1X74A 4NE2A 3VKFA 1JW9B 1OI3A 5ALGA 2R97A 5K7SA 3J80A 1U31A 3DO5A 4QQRA 4ED9A 1BXGA 5JDCA 1D0SA 4M54A 3ZV6A 3CZ9A 1HORA 2XTAA 3FHJA 4MQ5A 2YWDA 4OA8A 4F2PA 5KZMB 2PT6A 5JTUA 3PNLA 3TLGA 1KQGA 2VQFB 1S96A 2HC9A 1KAQA 2EGHA 2MHCA 1CUYA 4YRDA 2IF2A 4J76A 1H2FA 5DNDA 4MGZR