5F1KA

Human cd38 in complex with nanobody mu1053
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
244
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 80
structure length 244
sequence length 248
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f1kA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f1kA02
5JXWA 2Y1FA 3GF4A 3HG7A 1A7AA 1TA4A 3R6DA 2ZTLA 2NV6A 4CMIA 2FOIA 3JQGA 3GHHA 3SVTA 1HDRA 2OZPA 4N5MA 4CPDA 2WWRA 2HMVA 4RVFA 1GZ4A 9LDTA 4J91A 4RLSA 5L53A 2JHFA 2P68A 2V6BA 3U0BA 3PIIA 4II3A 3ZWCA 2NVUB 4DLAA 4M89A 1TI7A 3OIFA 3H5NA 5TC4A 5JYDA 4BKRA 1G1AA 5THQA 2OXIA 1GYQA 1I3MA 5H82A 3CXRA 5C7LO 5KTKA 3OJEA 2Y1DA 4NU5A 2FRDA 1EFLA 3HN7A 4QXMA 1D8AA 1KC1A 1HT0A 1NFQA 4CMHA 3WMWA 1CETA 1YE3A 3OICA 2O4UX 3JQ7B 1NXQA 1Q0LA 3WQQA 4FGWA 1LDBA 4ZVVA 2FPGA 2VHXA 4O6VA 2VWPA 3ZU2A 3JQBA 2BMAA 5ITVA 3B6ZA 2Z1NA 4OJNA 4HX5A 2J3KA 5DCWA 3T7EA 4BMSA 1SB8A 1ZMOA 2FZEA 2HU2A 3ROMA 3TPCA 4TQGA 3GQVA 1KC3A 4AVYA 5L40A 1DB3A 4PRLA 5A9SA 1QP8A 4DMLA 3W4IA 2O50A 1SB9A 1SCUA 4CLEA 4KQWA 2EERA 3GNTA 3PHLA 3KSDO 4HXYA 3ZWBA 1PGJA 4FJ1A 3DDNA 3T4EA 2X7HA 2JFHA 2Y05A 3H4VA 3W8EA 4PIVA 2VOEA 3GDGA 1E3EA 4MPDA 1PGQA 1E92A 5ER6A 1I2CA 3ZI0A 2Y0DA 5CFZA 4F6LA 4Z9XA 5CG2A 1SZJG 4YT5A 1PQPA 1OC2A 3AW9A 4OOEA 5CHEA 3M2TA 1VE9A 4XDYA 1Q7GA 3KM0A 4MKXA 4YAJA 5JMPA 3TSCA 1VI2A 2HJRA 4S1VA 2EGGA 1E1KA 2NWQA 3GC6A 2PWZA 4NK4A 4IY1A 3WGHA 1JKIA 4IIVA 1DIAA 4NH4A 5JDIC 3R0IA 4MIEA 1NWHA 2O4CA 1OI7A 1LRJA 2OFPA 3LT1A 3QWFA 3INRA 4U6SA 4BNWA 1ZK0A 2GYYA 4RF3A 1NVGA 3U9LA 3RI3A 4YAIA 2I3AA 3E5MA 1HDXA 2NVUA 4GWGA 1AUPA 2X86A 3L6DA 4C7KA 1DBVO 3W6UA 5IXYA 3WYBA 5JBIA 4YEDA 2X1HA 2JKVA 1G0NA 3R1IA 2B4QA 2WD8A 5JMWA 5JNLA 3I9MA 5TS3A 2FP4A 3L6EA 3ZN2A 4BNNA 4ALJA 2VZ9A 2B37A 4IZHA 5JW6A 3N74A 1U3UA 1DAPA 2OOSA 4L0QA 2HCTA 4D44A 5CAEA 5L7YA 4GPD1 4IDAA 3JQ7A 4IZIA 3TWOA 6LDHA 1DOHA 5I7FA 1WVGA 1YQXA 4RQUA 4FSHA 2I66A 2AEJA 5JY6A 2IE0A 1KBZA 5H83A 4D7AA 5KNLA 4OSOA 2BGLA 2D4AA 2QRKA 5BSHA 1N8KA 3H8VA 5G0VA 1ISFA 2EF1A 3SXPA 4ZQEA 1WXDA 3JTMA 4AJIA 1XR3A 1XU9A 4Y67A 1VC2A 3RUAA 3GVHA 4Q3EA 3FNFA 3STHA 1E0DA 1PJTA 4ZGWA 3ICPA 2NQ8A 2DFVA 1C0KA 3HDQA 1PJ3A 4AJKA 5TT1A 2ZB7A 1IPFA 4E33A 1EE9A 1E7WA 4K28A 5KJCA 4CLXA 1I32A 3WYEA 4R69A 4U6QA 4R9RA 1FXSA 4L4SA 1DJNA 5DP1A 5F5LA 4M87A 2NU9A 1YBMA 5ENVA 5I9MA 3BYZA 1FF9A 1U5AA 1WMAA 1OZAA 3RBZA 1F12A 3U4DA 4D43A 4TZKA 4FFNA 4D3DA 4WOJA 1P1IA 1XEAA 3JD1A 3DQPA 2D8AA 3V8BA 2ET6A 1LLDA 3GFBA 2IXBA 1I5RA 2VUUA 5A06A 1EEHA 4XEHA 1YXMA 2CUKA 4FB5A 2VNSA 1M2WA 3GZNB 4OQYA 1JAXA 4LMRA 4WEQA 3RIHA 3V5NA 4B4OA 4OL9A 3C24A 4RF5A 3ZWWA 2FN7A 2AA3A 2R00A 1HXHA 2ZYAA 5DT9A 2EKQA 1JLLA 2J3JA 2PZKA 2EEZA 3G49A 5ILGA 2BF7A 3EHEA 5COQA 5G0TA 1LDYA 1X7HA 4WCFB 3CINA 5L3ZA 4MINA 4JJGA 3GVIA 1DEHA 2OBNA 3WJ7A 3KEOA 4FFLA 1BVRA 3DHEA 1ADFA 1DRUA 4E0BA 2YZ7A 1ZVMA 3DR3A 4FW8A 1WAMA 3GNQA 4YAKA 2AQIA 3B70A 2IYOA 4Z0TA 1T4DA 1P3DA 1P74A 2X6TA 4M86A 4YJGB 3UFXA 2YFHA 3H9EO 3QY9A 2RHRA 3OBBA 4GX0A 4BNMA 4GLOA 1PJLA 4BNXA 5GZ6A 2PZMA 3S1LA 1Z74A 1O89A 1XLTA 1H2BA 4G81A 4PG4A 4B4UA 4NBVA 4R9SA 4B7CA 1E1MA 1Y8QB 3H2SA 2JCXA 1UZMA 1M67A 4IXWA 4IMPA 4YTEA 1AGNA 1T1SA 2HK8A 4GH5A 4MOWA 3WOHA 2AEMA 3QV1A 1V35A 2J3IA 2NU6A 4TMFA 4ND4A 3D64A 3ZU4A 2CFCA 3TJRA 5IDWA 4KDFA 5KKAA 2D3TA 3DL2A 3S55A 4XGKA 1E3LA 3LVFO 4OH1A 4J7XA 2DPGA 3K8ZA 4A03A 4D41A 2JAPA 3X2FA 3ETDA 3HNPA 4R4JA 2FPIA 2CF5A 1QYVA 3RC9A 1YRLA 4KWIA 5G0WA 2QIOA 1TVEA 4FFOA 4R3WA 3C7CB 3Q9NA 1NWCA 1D4FA 1U8FO 1GEEA 2DBVO 2WM3A 3BZUA 4L73A 5LCXA 4PLHA 3ZNPA 4NK5A 3GG2A 3S2GA 1N9GA 3LC1O 4BNJA 1HLDA 5DBIA 5KVSA 3GZNA 2GZ1A 3EUWA 1IY8A 2Q50A 1LBEA 3AFNA 5G0SA 5TSDA 4DLLA 1X14A 3G0OA 2V6MA 4J9UE 5EIOA 5KKCA 4HUJA 2C2XA 3JV7A 3WGTA 4E31A 7MDHA 1HDGO 5EINA 3O9ZA 3OIDA 3WLFA 4D79A 2OP0A 4AJPA 2NVBA 4Y6RA 3TFOA 3TZCA 1YS4A 2CF6A 4ZQBA 3HWRA 3H7AA 1RPNA 2QZZA 3S2FA 2G76A 4I1IA 2ZKLA 3INTA 3DZKA 4KUEA 5I7EA 3K96A 1YL6A 5GZ3A 4BNHA 5JAIA 5KIAA 1N92A 1T2CA 4R01A 1KEPA 4O59O 5L95A 4YQYA 3QWHA 4J2OA 4YJGA 3TZQA 2ZQYA 4M54A 2VYND 3ETEA 4E30A 4MKZA 5A5FA 4J0FA 1PR3A 2X0NA 3W4JA 3GGGA 2VZ0A 3PYLA 1DLIA 3GEMA 4BO2A 3I23A 3WGIA 2H6EA 1MX3A 1Y8QA 4H3VA 4NJMB 1U5CA 4O5OA 3F4BA 4TKLA 3PJGA 5BSGA 5JDIA 2I67A 2Y1CA 4MP8A 3L9WA 4LCJA 2J3HA 4AJ1A 3MJTA 2OORA 3H9JA 4K6FA 4BO3A 5A5EA 1Y1PA 4CMEC 4BHTA 1XGKA 1GDHA 4D45A 4ZD6A 1LDNA 1IULA 4RPHA 1KIFA 1HYHA 1PGOA 3S2EA 3C1AA 2A4KA 2PK3A 3OF2A 3OSUA 3FR8A 5ILOA 4EJ0A 1DHTA 4E32A 5JLAA 5JYEA 5A1TA 1O0SA 1ULSA 3BMQB 3L4BA 4WEOA 3MJ4A 4ZJUA 1QKIA 3D1LA 3VPXA 4YRBA 3PP8A 3ZNNA 4DUPA 4NBRA 4YJHB 3QVWA 4OO3A 4EUHA 3GPDG 1GPJA 3KUXA 4BNZA 4AJ2A 2EP5A 3PWSA 3ZV5A 3RU9A 3FNEA 3KOUA 2EW8A 3HE3A 3L07A 4RO0A 2HMSA 1NHGA 2PLAA 1Y7TA 4DPKA 3FN4A 3NX4A 4JQCA 4PZEA 5IF3A 1DFIA 2Q4EA 1WZEA 1IOLA 2H63A 1H93A 1JA9A 1CJCA 1HDYA 2DM6A 3FCOA 4ND1A 1K5HA 1O95A 4FDAA 3DBVO 4BMNA 1KY5A 3OECA 3HDHA 1BG6A 1Y5MA 3RUEA 1H6DA 4IS2A 4Y98A 4QO7A 3L4SO 1FJHA 1Y9AA 2J5KA 4L8VA 1SBYA 1C1DB 2Y67A 5HRUA 3JQAD 3AY7A 2E37A 3GEGA 3WQRA 1DIRA 3D3WB 3EYWA 4IJUA 2HRZA 4L4RA 4XA8A 2VHWA 3HDJA 4NJMA 1JWAB 1IUKA 1YBVA 3IMFA 2I5PO 4IGEA 3OHSX 4P38A 3I9NA 3O26A 3CIFA 1T2AA 3D5TA 3LC7O 1ULUA 2VYVD 3RASA 4UVDA 2W4QA 2BHLA 1P9LA 3MWDB 4PLTA 4Q39A 1VKNA 4YQZA 3OIGA 4ALKA 4CUZA 3PPIA 3GMDA 2YUTA 3GDOA 3QE3A 4IDBA 4IQ0A 2VTEA 5K9ZA 4J1TA 3CPSA 2ZQZA 3I9KA 1I24A 4FD3A 4ZHSA 1ZSNA 4GVXA 4RF2A 4LCEA 3DZIA 4CM3A 4PLFA 3UHAA 5HWSA 1ZZEA 1SEPA 3BHMA 3RJ5A 4YA6A 3BMQA 3N7UA 3GY0A 1VL8A 1Z75A 1KETA 1C1XB 3RC7A 1AXEA 1JWBB 1CERA 3ROQA 2DU8A 3K5PA 2BFMA 1IPEA 4YJHA 1LDEA 1T2DA 4DVJA 3DHNA 5CDGA 2HDHA 1KOLA 3ICCA 1UXJA 2EIHA 2LDXA 2UVDA 4PGFA 4XB2A 3WSWA 1YB5A 4YYZA 2W2KB 4FOSA 3I9OA 4GX1A 4IDDA 1HL3A 3CMMA 4IDGA 1BVUA 5COBA 4E2XA 3KYDB 4CJXA 1K2WA 2AQ8A 4EDFA 5ADHA 4JIGA 4I9UA 3FR7A 4HFMA 3Q2KA 1CQIA 2AE2A 3QIVA 4KZPA 4D3FA 4BMVA 4E6PA 1TXGA 2DKNA 2ZB3A 3B1KA 4UULA 4UAGA 4PZDA 2VHZA 3ZU5A 5F5NA 2J6IA 2POQX 3GH3A 5I8ZA 3ZW8A 2X5KO 2B5VA 4X54A 1YH3A 4LGVA 5A05A 4BNLA 1ZMTA 3QLJA 1MFZA 3IP3A 1C1DA 4HY3A 2O3JA 1ONOA 3NJ4A 2BI8A 2VCYA 3D3WA 2ZB8A 4EEXA 1P0CA 3RWBA 4GX2A 2FR8A 3C1TA 1BRMA 5B4TA 4BO0A 5KVCA 2BELA 3F46A 4MO2A 1KVRA 1BDBA 4NMHA 4RPKA 3OP4A 1YVEI 4BNIA 3KYBA 3Q9UA 4OQZA 3ANNA 4DGSA 1R16A 3DBHB 1QG6A 5JSFA 3IKVA 3SBOA 3D4OA 4OKNA 2G82A 1HDOA 4BIIA 5KJ1A 3F3SA 2NQTA 2XOXA 5DF1A 2Q45A 1GU7A 4PLWA 1T4BA 4RF4A 2JD2A 3GZ4A 1NASA 5AQ1A 1H94A 1BW9B 3OMLA 4PLZA 5KVVA 3MZ0A 3PYMA 4FFRA 1DSSG 4GSKA 3ZHBA 1BTOA 4GGOA 4PLGA 2EG9A 1FDTA 3FBTA 3HZZA 3MOIA 2O3SA 4ONEA 1C1XA 4CLHA 3ONEA 1V6AA 4R41A 3JD4A 5BNIA 2CD9A 4MIOA 4BKUA 2O7QA 3PFFA 3DAPA 1F8FA 3FBGA 1PL8A 3BA1A 1DRVA 2IZ1A 3IC5A 4DQVA 3C8MA 2QZ9A 2R00C 4MKRA 3DB2A 2DPHA 1I3LA 4WGGA 3W1VA 1N1EA 4Y8VA 3WFIA 1B14A 4EEZA 2DAPA 3EC7A 1NQAO 1R37A 2WE8A 2G0TA 2W2KA 3NKLA 4FOOA 2WMDA 3RUIA 2EXXA 4ND2A 1VSUA 3KYDA 5HS6A 5HM8A 2DUUA 3WG9A 4CLOB 2DBRA 1P44A 4CMEA 2ZK7A 3GDFA 1WZIA 4OAQA 1WLYA 3WWYA 4R1SA 4W82A 1QR6A 3VPGA 2C7VA 5A9TA 5G4KB 1UAGA 4W6ZA 1Q7CA 4BKQA 3DAFA 5THKA 1GEGA 4ITUA 3INGA 3PHIA 1PL7A 1PJBA 4OHUA 4P4GA 4UEJA 5EERA 4QEDA 5I8WA 5TF4A 1DC4A 4XQGA 5T64A 2J5QA 3D4NA 1CF2O 5ENDA 3RFTA 3ZWXA 1XQ6A 2EJVA 1C0LA 5FFFA 3BHJA 4A7PA 4ALLA 3K2BA 1NTOA 2PKQP 3DBLB 3I83A 4EYEA 1NPTO 3ITDA 2NLOA 2NNLD 2VWHA 5DULA 4DBZA 1X0XA 1BMDA 1YQDA 3DBHA 1LX6A 4K1LA 4MDHA 4MP6A 1SO8A 3CZRA 3K31A 1QLJA 2RHCA 1NAIA 3E5RA 2GPTA 4OIMA 3V2HA 1UP4A 1E3SA 1U4SA 1ZBQA 1ZK2A 3TQHA 4HV4A 4OGWA 5AXBA 5JAQA 2R6JA 5F1KA 5TT0A 5HTOA 1BW9A 1D1TA 3E1KA 4H7PA 5L9AA 2Y68A 3DZHA 5KOIA 1HE5A 5CDSA 1PS0A 1K89A 4RQTA 1Y5RA 1HDCA 1LRLA 3OA2A 4XIYA 5T8KA 5IXSA 4B3JA 4J7CA 1PZEA 1P0FA 1W0CA 2RH4A 1YBAA 1UDBA 5KWEA 3KLPX 4DYVA 1HTBA 1W73A 2VRCD 3QWAA 5K0ZA 1I3KA 1T25A 2GD1O 5JFOA 2GCGA 5CDTA 3KB6A 4E5YA 4AJJA 5FYDA 4WCFC 1A4IA 3G3EA 5BSEA 1GCUA 4NFSA 3D3EA 3SLGA 1DJQA 5JCJD 2CMDA 3E48A 5K6AA 3VPHA 3OQ1A 3AI1A 5ER9A 1R0KA 1IZ9A 2D0IA 4G65A 4CLOA 4B7XA 5FF9A 5T57A 5DBGA 4AG3A 4R16A 2GSDA 2C5EA 3H3FA 4IJWA 1IE3A 2HUNA 3HFSA 4YT2A 4XD2A 1KVSA 1YB1A 3KEQA 5IN4A 1MLDA 5G4KA 3PRJA 1OAAA 4J1NA 4XYBA 3WSVA 4W7IA 4LW8A 5BR7A 2GLXA 1PJQA 3H5AA 3WNVA 4CM9A 2W2LA 4JBHA 1GPDG 3I4CA 3UCFA 1BWSA 4BO1A 2YY7A 3IJRA 4GKVA 5TIIA 3N58A 1M76A 3GVXA 1K3TA 4WLUA 4AJLA 1NM5A 3CSDA 5MGBA 3GGOA 4PN3A 1B2LA 1LRKA 4MVJD 4YRAA 4ROSA 2PGJA 4TRMA 4WUVA 3DBLA 3PK0A 1XKQA 4Z3DA 5HA5A 3ZU3A 3LK7A 2DBQA 5L7TA 1WW8A 3MJCA 2JD0A 4LSWA 4XYMA 2PZJA 1GD1O 3RUDA 1ZH8A 5DCYA 3PHHA 1HKUA 3ON5A 2QRLA 4DYDA 1BHSA 3NDJA 3Q11A 3FNHA 2O23A 4CUKA 3HQ4O 3QWIA 3RFXA 3P19A 2X9GA 2YQ5A 3A14A 3TZ6A 3Q2IA 2C29D 2IXAA 3L4BC 1ORRA 1DIBA 3DWFA 1WDLA 1RM0A 3KSUA 1CEQA 4YACA 3V2UA 1Z7BA 5EESA 4NQZA 3ZGYA 1E5LA 1SPXA 3JYLA 2F00A 3QRWA 4IJKA 4GMFA 4LRTB 4MVJH 4ZA2A 5F1PA 4N5LA 1CWUA 3NEPX 1LEHA 3DFUA 5B4VA 4ZQHA 5C37A 1V3VA 1B0AA 4MVJM 3MTJA 2FWMX 5JDCA 1X13A 1IYZA 2Z1MA 4D0SA 1GV0A 4BOYA 3VH3A 4UEKA 4KMSA 3X2EA 1EDOA 4K9DA 4FBGA 2Q3EA 3MJEA 3GN1A 1PGPA 3F9IA 2UV8A 1JTVA 1VLLA 3U09A 1N7GA 2C59A 2A35A 1B3RA 3B1JA 4YDRA 2PGLA 4UEOA 1EVYA 1JU9A 4U8GA 1VPDA 2EV9A 4KTTE 2PD3A 1E7RA 1GADO 1V8BA 2Q1TA 2IYPA 3EVNA 3WWZA 4DLBA 1C3VA 4BKOA 4XJSA 1P1FA 4J90A 4JK3A 4JBGA 2A92A 3PGJA 3PLNA 3LT2A 2V6FA 2XPCA 3M1AA 4YVFA 2O3UA 1VSVA 3UVEA 3WYCA 4BGUA 1MGOA 4BNKA 5C3MA 1PX0A 4XWYA 4FJ2A 4DIBA 4I5DA 1NFFA 2Y1EA 2HRBA 4BB6A 1HE2A 2BD0A 4NR0A 3PZBA 1KYQA 1H5QA 3I4FA 3PZRA 5AXCA 5I7VA 5TGDA 3DOOA 3FWNA 1S6YA 5DP2A 1YONA 5BNFA 2EJWA 4J3FA 4WKGA 4AL4A 4JNKA 4WE3A 3UAGA 2IDZA 5JC1A 3I5MA 3SLKA 3JQ8B 4BO8A 1SMKA 2O7SA 1QMGA 3GHYA 4PLVA 4RGBA 1Z7EA 4RLHA 4Q9NA 1SOWA 2WDZA 3H6KA 3I9LA 1W4ZA 4DIOA 2I99A 2Q1WA 4K26A 3FTPA 4RPGA 3EDMA 4XQ9A 3C85A 3UCXA 1IZ0A 2IZZA 2FSSA 4ALNA 2GN9A 2B4RO 3U3XA 1S7CA 2AG5A 2YW9A 4JXKA 4MP3A 3LF1A 4Y6SA 2AW5A 4BVAA 4LK3A 3CE6A 4TRJA 5JAZA 3VTZA 2GN6A 4D0RA 1M6HA 4YXFA 2FR1A 1LQUA 2HJSA 2OL4A 4GQAA 3AU9A 4UUMA 2WSBA 1QV7A 4XR9A 4ID9A 1ENOA 4XZ3A 2I6TA 3TOZA 1VJ1A 1EFKA 4IPTA 4BGEA 5TLSA 3BXXA 3QWBA 1O9BA 5CDYA 4CQMD 1I01A 3ABIA 3F1KA 5EQDA 2YDXA 3V1YA 1M66A 3ULKA 3ZCXA 4XIJA 1UP6A 2QYTA 1IHXA 1H6BA 4WPGA 4EBFA 2E48A 1JDJA 3V2GA 1A7KA 4CMCA 1LLCA 4P4NA 3COSA 4N54A 3M6IA 3WIDA 4MJLA 3GT0A 1YJ8A 2IODA 3U49A 2C82A 5JAMA 4YCAA 4C4OA 1HZZA 2O48X 1NPDA 2UUOA 4PVCA 3ZWOA 3ZW9A 4CL3A 5ICMA 4CLDA 1JQBA 4NG5A 4Z6KA 1HE3A 1ONNA 5DDIP 3AI3A 2PY6A 4YB8A 3VH4A 1EQUA 4NJOA 1LXCA 4O0LA 5T5QA 2CZCA 1MUUA 3ASUA 1ARZA 4LSMA 1K0UA 1LC3A 3WXBA 1RYEA 1SOVA 1HYGA 3HHPA 4ZU3A 1ONPA 4URFA 3QVTA 4FQ8A 4WLEA 3WDSA 2DQ4A 1JVSA 3I52A 4OXNA 1U7HA 2O3TA 3WBFA 4XCVA 1MXHA 3UXYA 4BO5A 1PU2A 3JSAA 4JP3A 3DMTA 4WCFA 3DOCA 4HNHA 5BSFA 2QQ5A 2BRUA 3JQ8A 4CV2A 2AG8A 1U3TA 1B3BA 3FNGA 2BFOA 2Q1SA 4AJHA 3ZV6A 3RUFA 4DC1A 1U1IA 2H5LA 4JCOA 4ND3A 3GOHA 2FPPA 1GUFA 1TT5B 1I3NA 5F1OA 1BDMA 2JL1A 2Z5LA 3A06A 4I9NA 4UVIA 3TDKA 1EE2A 1Y6JA 5IDXA 3HDYA 4EGFA 3H65A 2XXJA 5T6BA 1PSDA 1JKJA 2PKRA 3JYPA 3UOGA 4ND5A 5EPOA 3QW2A 3WLEA 2PR2A 3TZHA 3WQSB 5CP8A 2JHGA 1A4UA 4C7JA 3P5SA 3VPSA 4CM8B 1B8VA 2HMTA 3ZWYA 2IRWA 1K6XA 3H5RA 3OQ6A 4DPLA 2PA3A 1M75A 5L51A 1P31A 1ZEJA 3LLSA 5JO0A 1HDZA 4PLCA 4MVJI 1L7DA 3WGYA 4B3HA 4N5NA 5IZ4A 3RC2A 4WECA 4BO4A 3MOGA 1NYTA 5CEEA 2ILTA 2HKIA 3ZH2A 3VKUA 2GF2A 3RC1A 1LJ8A 5IDYA 2Y1GA 3OJFA 4CL8A 1ISGA 1ZW1A 2GASA 3JD2A 4RDIA 4Y6PA 3KSZO 1JN0A 4CLRB 4OSPA 5IZCC 3PGXA 2RAFA 4E5KA 4J4HA 2VNAA 3PEFA 1I10A 3ZWVA 3ENKA 4WLVA 5KCZA 3WTBA 2O3QA 3AM3A 3E6AA 1LSOA 1ZSVA 5G2OA 4I08A 4WJZA 5CG1A 1XELA 3KTDA 1ZCJA 3C3XA 4GSLA 1UDCA 3JD0A 1NVTA 3GVCA 1AN9A 4DIFA 2B35A 1HWYA 1YKFA 1A72A 3MEQA 4IDFA 1Z45A 4W99A 2OP1A 2YYYA 1KVUA 4QO8A 1GQ2A 2CSUA 1J49A 1NR7A 1OMOA 1R4NB 2WD7B 4J2HA 5LC1A 4Q3AA 3DFZA 3DO5A 2GERA 4CMBA 2PH3A 1LDGA 5CPFA 3TF5A 5F21A 3H3JA 4NBWA 3VDRA 1EUZA 3AOGA 3LDHA 1Q2XA 1QORA 1BSVA 3BAZA 1TT5A 2GN4A 3RSHA 4EUFA 1EK5A 1QYCA 3A4VA 3PYXA 5T8KC 3ADPA 1VL0A 2DTEA 2X9NA 3WGQA 2YHIB 4UVGA 2JCYA 4GKBA 3RAJA 1PIWA 4CV1A 1HSOA 4O63O 4Z0PA 5A02A 4BUCA 1FK8A 5U1PA 5GY7A 1Q1NA 1I2ZA 5JC8A 1U7TA 2VHVA 4CM8A 3ZV4A 4L4XA 4ESOA 3AUSA 3RROA 1EUDA 5K6AC 3AUTA 1LSUA 2P5UA 1DPGA 2D5AA 5IDQA 1QYWA 1B8PA 3VTFA 2B69A 3H2ZA 1GFSA 4WLNA 5AYVA 5L4LA 9LDBA 1A9YA 4QTZA 3MTGA 1W8DA 3RUHA 5CDUA 1PS9A 4FN4A 4DREA 4BGVA 2E6UX 4GAEA 4H15A 3PQDA 5DOVA 2CDCA 1VJ0A 3ZWAA 3DTTA 3OA0A 4NDNE 4XDZA 2HQ1A 2DVMA 3P7MA 1E7SA 4IGFA 3FD8A 2TMGA 2BGMA 1KY4A 3U5TA 3LU1A 1HF3A 3DZJA 1DLJA 5LDHA 1ZKMA 3LC2O 1A27A 4XJTA 1ZXBA 1WDKA 2VWGA 1A71A 5FI5A 2Q2WA 1UXGA 1ENZA 4UVEA 3LF2A 4JP2A 2BFPA 4Z9YA 1E3WB 3ST7A 4A26A 3NDIA 3RCBA 3D0OA 3QA9A 4I8XA 1ML3A 1VRWA 4EZBA 4N7RA 4BV8A 1R4NA 2WD7A 3HUDA 4B8WA 3PJFA 5G0UA 1LDMA 2FR0A 3KO8A 4KDEA 5DCUA 3IOYA 4YJFB 3NGXA 4JGBA 4KQXA 5AXDA 4F3YA 5I9LA 2I9PA 3PTZA 3EMKA 1D3AA 2P9CA 4S3MA 4AJEA 5I7SA 3KZVA 4UUOA 5T67A 4TZTA 4PCVA 4XYEA 5A4DA 3NTRA 2B4TO 4DWVA 1KEWA 3Q1LA 4CMGA 2IEBA 2JJYA 1GYPA 2VTDA 4BV9A 4UVHA 3VVCA 1YJQA 1H0KA 1HZJA 4E2YA 4NFHA 2YHIA 1V9LA 3OEWA 2X5OA 4ALMA 2GGSA 3RKRA 1Z6ZA 3VZQA 3RU7A 2X4GA 5JDCC 2W8ZA 3R3SA 3GN2A 4R5HA 1GAEO 2NVWA 2VZ8A 4J6FA 3SC4A 4IDEA 1HYEA 4FJ0A 4IXTA 4AJNA 4WCDA 1P1HA 4IS3A 2OGUA 4L9RA 1RM4A 5EL0A 4D42A 3FSRA 2EWMA 2VYNA 4R1NA 5J23A 1PQWA 5DBFA 2J5RA 4NBUA 4A73A 2VN8A 3JQAB 2NADA 4CM6A 4FGSA 3RBXA 2G1UA 4TROA 4E3ZA 3SJ7A 4BNYA 4BB5A 4B4VA 1PEDA 1E1NA 4L74A 3U4IA 5TX7A 2O3RA 5CEJA 1PZFA 1PJSA 1EZ4A 2PNFA 2VHYA 1EQ2A 1IL0A 1DDOA 2DBZA 4MVJG 3WICA 4BNGA 1SNYA 5L45A 3IKTA 3BTSA 3RQSA 4O1MA 3F5SA 4HFJA 5H81A 3O4RA 4HNGA 4JROA 1NP3A 3JQDA 3U4CA 4MVJF 3ZHYA 3DC2A 3ANLA 4E5NA 1PTJA 4IIUA 2VOJA 1U3WA 4B4WA 3V1UA 3AI2A 4RVSA 4M8SA 4XRRA 3TN7A 3ITKA 5JY1A 3DZBA 3WNQA 2GNAA 2WJPA 5DZSA 1XHLA 4XR4A 4FC7A 3LZ6A 1E3WA 2X8LA 3TL2A 3E03A 4M55A 4WLOA 2FMUA 1CIVA 3H9GA 2CVQA 4DPMA 3BMCB 4CR7A 2AHRA 1AHHA 5L4NA 4TVOA 3AFMA 4YJFA 1P45A 3TZKA 1DIGA 3EY4A 2ZIZA 2BFAA 4QFDA 4RVGA 3RBVA 2Q49A 1ZK4A 1P1RA 2B5WA 3GFGA 4YAEA 3HADA 3W4KA 2D5CA 5TNXA 3M2PA 2DT5A 3W6ZA 4PVDA 1NNUA 3WMXA 1JW9B 3AM5A 3K2EA 3JQ9A 3QVOA 1CQJA 1BXKA 4N18A 2DUWA 4FIZA 4YJDA 2RBEA 2ZTVA 1LLUA 2C0CA 2FSVA 2Q2VA 3FHLA 2HAEA 4XQEA 2JCVA 3EGOA 4XGNA 4YR9A 2X0IA 1PWZA 3GGPA 3VHRA 3PI7A 4M49A 3EZYA 1KVTA 5JO9A 5IZCA 3JQFC 3ZWMA 1JKFA 2X23A 1F8GA 1U3VA 1E6WA 6ADHA 4LMPA 1PJ4A 1XDWA 5KJ6A 4CUJA 4F45A 4I5GA 1F0YA 2NUAA 3AUUA 3JQAA 3BMOB 4Q3DA 3WGZA 1ADGA 5A3JA 3DTYA 4J49A 1ZEMA 4GI2A 1DC5A 1UH5A 3SJUA 4EJ6A 1QXSA 3UN1A 4XKJA 1ZIDA 3T7CA 5U4QA 2P4QA 3QVSA 4G2NA 5F3RA 5B37A 3ORFA 1ZUD1 2VYVA 1TB4A 3HSKA 1HE4A 5AOVA 1ZK1A 1LLQA 4YRDA 2WTBA 4HADA 4GGPA 1UP7A 2PH5A 1U4OA 1I0ZA 1PWXA 1PZHA 1UUFA 1O6ZA 4RZHA 4XGIA 1E3IA 1PQUA 1YB4A 1GQQA 1Y8RB 3PHJA 2O2SA 1MV8A 4GWKA 2YJZA 3KVOA 5EJ2A 5JE8A 4LRSB 3IL2A 4PLPA 3S2IA 1HETA 3UCEA 1C0IA 1R0SA 3QHAA 3F1LA 1XCBA 4B7UA 1T26A 2D59A 3JD3A 8ADHA 3DMTC 2Y66A 5A04A 3BMCA 4R68A 1UZNA 1QLHA 4J43A 4I5FA 3E8XA 3U62A 1LNQA 3HB4X 4I9HA 2ZJ0A 1J5PA 3FI9A 3JCZA 4EI2A 4WASA 5U9CA 3P2OA 1PS8A 1OFGA 4P4LA 4PG8A 3PDJA 3PFWO 3O03A 1HLPA 4II2A 1Q7BA 1GTMA 2ZB4A 1LI4A 3B20A 5KJEA 2VUTA 2VT2A 1I33A 2NTVA 3SC6A 1J0XO 4CV0A 3CTMA 1PJCA 3AY6A 4RVDA 3KYCB 4DTIA 1ZFNA 3BIOA 1K6IA 3IDSA 4CM7A 3CMCO 1IHYA 3QSGA 3K92A 4R5MA 1KS9A 1RYDA 1N5DA 3AU8A 3I1JA 4Q3CA 4BO6A 2YV3A 5DN9A 1H6AA 3GA0A 2BI7A 3Q6IA 4INAA 3PHGA 2VT3A 2YDYA 3L0DA 4TRNA 1VL6A 3NTOA 1PJ2A 2CVZA 3BMOA 1RM5A 2Y0EA 1V3TA 1WP4A 2BKAA 4KUGA 1L7EA 2EHDA 4CM1A 1E3JA 3G1UA 5G4LA 5C5IA 3GMSA 5CPBA 3E82A 3QP9A 3F6YA 2ZYGA 3Q3CA 3IUPA 1F14A 4RCVA 4RJTA 1CYDA 1ZJYA 2QRJA 3KHUA 3MWEB 4HKTA 4GLLA 4B3IA 3NT2A 3DHYA 4J9VA 1ZXLA 4UREA 5ICSA 3H9QA 1F17A 1GZ6A 4XYGA 1P1JA 3G17A 2BLLA 4FC6A 4F6CA 1Y8RA 2JD1A 2GUGA 2AEFA 1C0PA 2O2YA 5A03A 1LQTA 3AOEA 3AY3A 2VWQA 3OFSA 3OETA 1KERA 2P91A 4LN1A 4B79A 1LSSA 3ZWPA 4ZQFA 1XIVA 4IUYA 5CEFA 2W90A 2WYWA 3E9NA 3CUKA 4JBIA 3QQPA 3RJ9A 3I3OA 1DC3A 3VPFA 2X5JO 4NNJA 2A94A 4DC0A 1GYRA 1WMBA 2X58A 1D7OA 2WE7A 4IDCA 4W9NA 1SEVA 3EW7A 3VH1A 3WGOA 1DAOA 4E2WA 2DFDA 2GZ2A 2QG4A 4TWRA 1QYXA 4KWHA 1I8TA 4R54A 2CNBA 2P2SA 1RKXA 2Y93A 3KV3O 3ZNOA 3KYCA 5ITWA 3ZV3A 2H1SA 3BTVA 4GL4A 4U7WA 1HRDA 3PLRA 1YWGO 3WBBA 1FDUA 4NFYA 3LLVA 2G17A 4JJFA 3U4HA 1U2DA 3OH8A 4Y9DA 3QJ5A 3D4PA 3DAGA 2EGHA 3A1NA 4BNUA 1NQTA 4P8RA 1E5QA 2NTNA 3PJDA 4YWJA 4BKPA 4DMMA 4XRGA 1JVBA 4XYLA 3VZPA 7ADHA 5KVQA 3RVDA 3AUAA 2J8ZA 2JFFA 2A9FA 5EQFA 5C7OO 3CZMA 1P1KA 3EVTA 2P9GA 4RL6A 1ZSYA 1AE1A 1N9GB 2V65A 1R4MB 4A27A 5IAAA 2AE1A 2W98A 4J1QA 1J6UA 5IN5A 1EUCA 1LA2A 2HLPA 5AVOA 4TVBA 4J7UA 3EK2A 3L9XA 3UH1A 4G5HA 2GRAA 3IIEA 1CRWG 3ETGA 3TNLA 1A9ZA 3GUYA 3NUGA 3UW3A 2IEDA 2V6GA 1ENYA 3LT4A 2EKPA 2YFQA 1YO6A 1NBOA 2V7PA 2E82A 3ZWNA 1RM3A 2C5AA 4R51A 4Z0HO 3K9QO 1WDMA 4YBZA 2XAAA 3VZRA 3JQFA 2GZ3A 1YQGA 3AM4A 2ZYDA 3NV9A 4CODB 4PG6A 2I76A 1DHRA 3GRPA 4R1UA 4DQXA 4DRYA 4E13A 2E49A 2Z95A 1PGNA 4CV3A 2VRCA 2OUIA 2RCYA 1WWKA 4J0EA 3KRTA 3PXXA 4AJOA 4K6CA 3IS3A 2P5YA 5EMHA 2PFGA 3HJAA 3ZZNA 1OBFO 1ENPA 5JCJA 4BS9A 4DL9A 4MVJP 4RVHA 3IUSA 1K6JA 3K6JA 3DBRB 4XQCA 5TQVA 3AK4A 3A28A 1GUYA 2FHSA 3O38A 2CVOA 5EN4A 1M6WA 3TRIA 2I65A 1UDAA 1LSJA 1Q0QA 2BGKA 4FS3A 4IQ8A 4U5QA 2NTJA 1QV6A 4OXKA 4QFCA 4UUNA 4A10A 3NT4A 4CMKA 4A5OA 3GLQA 1XG5A 2EW2A 2HSDA 1Q0HA 1QYDA 1N1GA 4PG7A 4L75A 4RDHA 4DBVO 2B83A 3E18A 4QUKA 3WJAA 3NT5A 2CDBA 1ZNQO 2EKLA 2YV1A 3LYLA 2P9EA 4HFRA 2ZJ1A 3MJSA 4MVJA 3GRKA 1MP0A 2PKQO 1TT7A 5TJ9A 2OBYA 3VKVA 1KEUA 4TKMA 1IB6A 3NYWA 1NVMB 4PZCA 4J1SA 5TRTA 3E9MA 1UXIA 3LQFA 1X15A 1R4MA 5C7IO 4D46A 3RKUA 3ADOA 4OXYA 1ID1A 4Z9FA 4IM7A 1F06A 1H6CA 3CH6A 1MC5A 5MDHA 1B26A 4JX8A 3I9JA 1EVIA 4ZQGA 1X7DA 4JN6B 1GV1A 4CQLB 3BTUA 2F1KA 4RORA 2ZCVA 2P4HX 1H9AA 1ADCA 3B1FA 4CMAA 1NHWA 3GEDA 1X1EA 2NM0A 3WS7A 3F47A 3I6QA 1ISIA 1C14A 3HFGA 2EP7A 1PL6A 2HK9A 4U0KA 2AQHA 1JAYA 2QX7A 3VVBA 3ONFA 4AJ4A 5L4SA 4RZIA 4UUPA 1U9JA 3DEYX 2PD6A 1E6UA 1FDSA 2VRBA 4I5EA 3NRCA 3ROKA 1B7GO 3OJ0A 2FY8A 3JQ9C 3NTQA 1EVZA 1R0LA 2HMUA 4IBOA 4PLYA 2OHXA 1I36A 3ROPA 5IFLA 1EDZA 4KOAA 1CDOA 1E6EA 4J4BA 1R6DA 1FDVA 1DRWA 3DBRA 4OOFA 1ISMA 5GMOA 3GR6A 1R15A 4MVJE 4GX5A 4CQMB 3W8DA 1AXGA 3GG9A 1LU9A 4E5PA 2RH8A 1J4AA 2NU8A 1T24A 1NPYA 4L76A 2YQ4A 2HMWA 2Q46A 3Q0EA 3C1OA 1DC6A 4XX0A 4E2ZA 3JYNA 2WYVA 3MJVA 5COAA 1GY8A 2PGDA 2B0JA 1UXKA 3IAHA 1VJTA 5TJHA 3GK3A 3EAGA 1O5IA 1MFPA 2UDPA 2LDBA 1SC6A 3HN2A 3IJPA 5B4UA 1PR9A 3OQBA 4NHEA 2GO1A 2PZLA 2C20A 1MXFA 3R3JA 1HEUA 4TSKA 3ZHXA 2Q2QA 2PD4A 4QSMA 3JYOA 4HP8A 3OJLA 1QRRA 1UZLA 4RPLA 2D1YA 2Y0CA 3VAZA 1ADBA 1NR1A 3CEAA 3RFVA 3RUCA 1Y81A 3PVZA 3WB9A 4GVLA 4BO7A 1KEVA 3O8QB 4LVUA 3FPCA 2DLDA 3K73O 2PTGA 4NI5A 5DNAA 1R66A 1MB4A 1NAHA 2GN8A 4IQGA 3S8MA 4CQLA 3OJOA 3BTOA 4WNCA 3WGGA 2Y1OA 4WNIA 3PWZA 4GBJA 1EK6A 1VKOA 2R2GA 4IINA 1HSZA 2UAGA 4RV9A 1W6UA 4CMJA 4CR8A 2YV2A 1PZGA 4AFNA 2X22A 2AQKA 3L77A 5BT9A 4HFNA 2SCUA 2D2IA 2HO5A 2XXBA 3JQBC 3PJEA 1E77A 3NAQA 3FF4A 3UGKA 1O8CA 1NX6A 4CM4B 1E7QA 4NPCA 3TOXA 1X0VA 5FEUA 3FRJA 3G1TA 3PWKA 4A2CA 1EBFA 2XF8A 1YOVB 1V3UA 3DZGA 1YL5A 2QYSA 3ZHZA 3GVPA 4OMUA 4E12A 4EJMA 3W8FA 1YDWA 4P22A 4RVUA 1XA0A 1U2GA 4FR5A 1A5ZA 4WOKA 2YHUA 3NGLA 4Q3BA 4BNFA 5I9NA 4BNVA 3WIEA 5B1YA 4CQMA 4CLRA 1RWBA 1OC4A 3BMNB 4YT8A 1N2SA 1Y9EA 4R1TA 2HK7A 3GAFA 4HWKA 3ZNQA 4BQPA 5GZ1A 3SEFA 4XB1A 4ZRNA 5A3VA 4Z3KA 3CKYA 3DZFA 4OKIA 3VDQA 4WLFA 5IJZA 4F46A 4E4YA 3IQDB 1TEHA 2NSDA 2UUPA 5B12A 5FI3A 1DXYA 5JCXA 1FMCA 2E4AA 3NDRA 8LDHA 3VC7A 2VUSA 5FWNA 2AMFA 5LDGA 1GL3A 1O94A 3JQCA 4H16A 1WNTA 1T1RA 1T2EA 3JYQA 3MCVA 1RJWA 5JS6A 5L7WA 4W4TA 3A9WA 1G0OA 4EW6A 4JJIA 3TFQA 4ZN6A 1BXZA 5BQFA 4W7HA 4ALIA 3FPLA 3ANMA 3H9UA 1UXHA 1EBUA 1XU7A 4DA9A 3KETA 2C7GA 1R12A 1H2HA 1MG5A 5BNTA 3VOSA 5HS4A 3ASVA 1LTHR 2OO5A 5AXAA 2NU7A 2UYYA 4PRKA 2Y99A 3GAZA 2QW8A 1U28A 1G6KA 2DTXA 3O8QA 4DXHA 4WK6A 1I30A 3FTNA 4CR6A 1OOEA 3AJRA 3AOEC 3E9QA 3JQEA 4OM8A 3PDUA 3IP1A 3WR5A 1EMDA 1KVQA 2WEKA 4CM9D 2W2LD 5IG2A 1GQYA 3UF0A 4PFJA 4GMGA 1BGVA 1I2BA 4FFMA 2C2YA 2DTDA 3F4LA 3JQ6A 3KLMX 4BO9A 3UKOA 4A0SA 3L6OO 1Z73A 2RIRA 1XQ1A 2ZTUA 1DFGA 1EVJA 3KXDA 1UJMA 3LSYA 4W9NC 1BXGB 2Q1UA 1NQOA 1XWFA 3V1TC 4CM4A 1B8UA 1N7HA 3WTCA 1YL7A 3NJ8A 1SAYA 3OEYA 4HBGA 4QX6A 3SX2A 2G5CA 2Q99A 3PQFA 1E7YA 3KBOA 1YOVA 1ZK3A 3PIDA 3FWZA 4IJVA 3TL3A 2GDZA 3GNSA 4YPOA 4CMIB 1H9BA 2X0JA 5JPIA 4AICA 3JQGB 3C7AA 5ES3A 3BHIA 4QT0A 2VQ3A 1UR5A 3PQEA 4YT4A 4BNTA 4EUEA 4E5MA 5KJFA 4KTVE 1GCOA 2X0RA 3BMNA 3DXFA 3D5QA 4NIMA 3DOJA 1FDWA 1ZJZA 3OM9A 1DO8A 1QSGA 4OYRA 1VM6A 4FPXA 4NU6A 5A9RA 1XYGA 3RD5A 1P33A 1YGYA 4J4TA 3QVXA 3AWDA 4BQRA 2PV7A 2I3GA 2Q4BA 4FCCA 1Z82A 1GUZA 3EZLA 4NZ9A 1V0JA 4E21A 2CDAA 2C07A 4J16A 1B15A 1XSEA 4YAGA 1WPQA 1AHIA 1GZ3A 3VZSA 1LC0A 2BH9A 3ENNA 4KUHA 4NBTA 3ZDFA 4ZICA 3DONA 1X1TA 1GR0A 4EITA 4LISA 3WX0A 1MC4A 2IZ0A 1ISJA 2AXQA 3DMYA 4DQUA 1D1SA 1DIHA 3HB5X 3ONDA 3UICA 2FZWA 4B8ZA 3VH2A 2ZATA 2JFGA 1P77A 2ZTMA 1E7MA 1U8XX 4KP7A 1L1FA 4D3SA 4BL5A 4QQRA 4U0JA 4QECA 3WFJA 2DC1A 4TRRA 3UUWA 4CM5A 3T4XA 1LUAA 1ISHA 3F5QA 5A9SB 2CY0A 2QHXA 2OMEA 1ZO8A 1TLTA 2C54A 4R3NA 4RPJA 1UAYA 1X7GA 3GUCA 5DOZA 1E1LA 1MA0A 2ZCUA 3I6IA 2GR9A 2NACA 3P2YA 4ILKA 2TMDA 2X9VA 3GPIA 5HBRA 1NQ5A 1T2FA 2B36A 1YDEA 1B16A 2H9IA 4FFPA 4ZRMA 2WYUA 3LT0A 4M1QA 3G79A 4PG5A 3K30A 4LVCA 4BGIA 3C7DB 1BXGA 1DFHA 3M1LA 1NFRA 4IMRA 4JLWA 4Q3NA 3D7LA 4MIYA 2JAHA 1MG0A
chains in the Genus database with same CATH superfamily
3G2IA 3Q10A 1IC6A 2Y1FA 3GF4A 3EVFA 5BYAA 4YCLA 5BVGB 2G9VA 5KNDD 2FSIA 3TJMA 4ZI7F 4HVTA 1JR3E 4ITVA 2ACWA 4C7MA 4CMIA 1FCJA 3S1SA 4GIBA 5HOQA 1SC3A 5C1PA 4ZXPA 2JFQA 1NGSA 1T4MA 1N2HA 4FHGA 4KN5A 2YZ2A 5F78A 3H8JA 4DCSA 2IE8A 5B36A 1DMSA 5AK0A 1JFTA 3M5CA 3PL1A 3S29A 1SHJA 3MILA 4FEYA 4J91A 1GIAA 3UYKA 5FD8A 5L53A 3ZKAA 3B6KA 3U0BA 4II3A 2NVUB 3ND5A 3R0ZA 3V7FA 3UV3A 4ZJZA 4GKJB 3BM5A 5YASA 2I3ZA 5EOVA 1MMFB 1B6SA 2XMSA 5CFRA 5F98A 5JYDA 4RXMA 4QKQA 3ABOB 1K66A 3D2CA 3IIKA 5KC8A 1XCGB 3CXRA 5KTKA 4NCKA 3HJNA 2WFLB 4NU5A 4ZDWA 3HJFA 1EFLA 4QXMA 5GP1A 5HRAA 2KHZA 2ZSFA 1KC1A 1L5WA 1YVUA 3Q87B 4I1UA 3AKEA 3F8TA 2NP6A 4D4JA 1E79D 2BFCA 3A4IA 1U8AA 3AF1A 5FWAA 1ZUIA 2M6KA 4YO8A 1J42A 1GSIA 2P2LA 1Q0LA 2ZUEA 3UHFA 4IZ6A 2R8RA 3WQQA 2ABWA 1AQUA 4OBWA 5EXXA 3MB8A 5BW6B 3K09C 1I2AA 4JH0A 3ZU2A 2BMAA 2ZGVA 2MMCA 2PS9A 3B6ZA 3NP9A 3LBFA 5CJPA 1TCUA 4MDFA 2I2WA 2P65A 2B21A 3OPVA 1JHMA 4AURA 4U7TB 3I6YA 4GP6A 4B2IA 3ROMA 1CVRA 1R8SA 1Z5NA 1UJ5A 1KC3A 4NOLA 4KR9A 5L40A 1DB3A 4DCGA 5A9SA 1E61A 2XV1A 3MWGA 4WHMA 1P39A 3W4IA 2V5UA 3LXXA 5LU9A 1SCUA 1Y37A 1LF5A 1S2IA 2FG5A 2RFLA 2ZE7A 3U48A 3PNBA 3VU3A 4FB4A 2AN5A 1BXRA 1MO3A 2VIIA 4WBSA 4LF7B 2C78A 1KNXA 1PGJA 1K7FB 3GJ8A 2ZAOA 1JIJA 3DDNA 3R5SA 2BP7B 4W1QA 4GOJA 3T4EA 1XCMA 4MUEA 2J4CA 1T0BA 2PAAA 4EYKA 3D6VA 3MGGA 4IJMA 2YYZA 5C2JB 4PIVA 3WL6A 3RWMB 3MPUA 1U98A 4D9FA 1OWNA 5ER6A 1RHJA 5K3CA 4GKKB 3OVMA 2P77A 1ACJA 1G55A 3RS5A 1ZGJA 2R97A 4Z9XA 1Y7LA 1PQPA 2NV2B 3GEBA 3ZUPA 4OOEA 2OHOA 2WHXA 2J7PD 3PXDA 1L7RA 1RYMA 3KM0A 2BCGY 3NEYA 1AUOA 2HJRA 4MGZR 4JI3B 1BQ4A 3WGHA 2H16A 1PRYA 4QNMA 2OD9A 4HO1X 2KYRA 3JQQA 4MIEA 4HBZA 2H07A 3AVWA 2O4CA 3MB5A 4FYHA 4RD4A 1OI7A 4I4TA 2APJA 2OFPA 3CB4A 1Y34E 2JGMA 4JJ7A 1IOVA 1LV8A 4RF3A 1G2QA 2DOKA 3P26A 3U9LA 3RI3A 2O6LA 4FHDA 1ZZGA 2VTVA 4RJIA 1AUPA 4C7KA 3PEVA 2D2FA 2CXUA 5D01A 1E2DA 2XB2A 1CJBA 1T9GR 4V0KA 3STTA 2AFVA 1Z3IX 4L4YA 2WD8A 5JMWA 2VA8A 5JNLA 1G2IA 5TS3A 2A1IA 2FP4A 5F2EA 3ZN2A 2FETA 4E5SA 1O08A 4IHKA 1VDZA 4I6GA 4FT4A 4LECA 3AFIA 2UZ1A 3C1UA 2WG2A 3T99A 3V4LA 4HMOA 2HCTA 1EQAA 2R6FA 2SHKA 5L7YA 1VKRA 5SY4A 4GM4A 2HJHA 1YR2A 1C3EA 4IZIA 5HQTA 3BGSA 1DOHA 1JEEA 2QRMA 3C41J 1NV9A 4RQUA 2I66A 1GGVA 1DT5A 1SUAA 4HNQA 4Q05A 1FFYA 1E4OA 1EFPB 4OSOA 2BGLA 1N9KA 3LVQE 4QU0A 1GDTA 3LQ1A 1N8KA 1A7UA 3G8CA 1N0WA 5BMVF 1QB8A 4YPFA 1NVWQ 4U2DA 4V38A 4LE2A 4YMHA 3B5EA 3KQNA 4LJ5A 4ZQEA 5T4EA 5M29A 2JLAA 2DUNA 3VXKA 3GFPA 1PNOA 3L7JA 4ER3A 4NAHA 3RUAA 2TMKA 1QOQB 3C3YA 1PJTA 1MDFA 1WIWA 4C5AA 2P90A 5AUPB 5LD2C 1NLZA 2RHOA 3BBPA 1H4QA 2ZITA 2DFVA 1C0KA 3JSXA 1OTXA 4B32A 2MWMA 2ZB7A 3E8SA 1MB2A 2NU6B 2D7DA 2FWJA 4X1YA 4E33A 4MA0A 4B9AA 2I7TA 2PGIA 3AEZA 2NO7A 3B7PA 1IZYA 2PEYA 3ZZ1A 2J4DA 3WYEA 4HZUB 4U6QA 2QT0A 5F5LA 1HEIA 4HNTA 1TD9A 3T1NA 3FFWA 2JIRA 2VVTA 1PEKE 3QH4A 4PC6A 4EMSA 2Z3ZA 1F12A 5JH7B 2J32A 5K8IA 4B6OA 2FPIB 4DGQA 3QVMA 1PWYE 2WJVA 4NRDA 2PNJA 4C2BA 1U2GC 1XEAA 2IL1A 3DQPA 1G9SA 4WY2A 4F12A 2Q8NA 1X1SA 1QCCA 5FUVA 1XMPA 3KALA 4RTNA 1ATZA 3PR1A 1FX0A 2H7VA 2EOAA 6NULA 3EA0A 3L7MA 3OQHA 1M2WA 5GGXA 3J7TA 5HIIA 1G3MA 3GZNB 4JR2A 1TOAA 1C1HA 1E94E 5E6UA 3V5NA 3ERCA 1B93A 2CGEA 3FGPA 3E15A 4LK2A 5ALXA 3W9SA 2OENG 3GLKA 2P9ZA 2FN7A 4LOIA 2QVZX 3LPNA 4JVSB 4UCXA 2VAMA 1IBLB 4RY8A 4ZCQA 4JLDA 3G23A 4W9MC 1EA7A 2GHIA 2M1ZA 1WUIS 4CF4A 4J0HA 4YFYA 2IYRA 5DGIA 1U81A 4LHXA 2OCLA 4BQNA 1T8RA 3O4HA 1FFWA 4G9BA 4XX1A 1YHZA 2OBNA 3KEOA 4LY9A 4D9IA 2W2XA 4JA2A 1FUEA 1N2CA 4KN6A 3TD9A 8AT1A 4UHEA 1ADFA 1B41A 1ZVMA 2AC7A 1AKTA 3DR3A 3G88A 3V4OA 4F3NA 5HKKA 3GNQA 4MR8A 3W90A 3MS7A 3OE1A 1F38A 1Q14A 1T4DA 2JKYA 2VHTA 3BRSA 5ESRA 4E15A 4FMDF 1NXPA 5ELLA 4EF5A 1WCIB 3M9XA 3OQIB 2HIMA 4HK4A 1T35A 3AUYA 3V33A 1MAWA 4GLOA 2WFMA 2VZEA 3L02A 3PFKA 3UFBA 3ONNA 3ZE8A 1SQ0A 1RXVA 1V5IA 1Z74A 4AX8A 3GP5A 5FRDA 1NBHA 5ALRA 3ETLA 3HVHA 1V5GA 4PG4A 3O47A 4TKVB 3BK2A 2QRGA 1Q1AA 5ESXA 2OHIA 1J1ZA 1KDTA 2ATIA 2WU1A 2XVMA 1XTZA 1Y8QB 3ED1A 3FYHA 1UT8A 3BIXA 3CUUA 3H2SA 3KZKA 3M5PA 1RI4A 2QL7A 2JCXA 3O93A 1P0IA 4UPDA 2C7PA 1EFVA 2HPHA 4B75A 1PYDA 2XA1A 3ACCA 3LA8A 1T1SA 2HK8A 4GH5A 5H80A 3RYFA 2LD4A 3SNKA 1V35A 3WP1B 2EFYA 3KKMA 1SXGA 4M1WA 1R6VA 3S70A 2FF7A 3T3DA 3ZDXB 4C08A 4II7A 2F1HA 4NX2A 5FH9A 1GL9B 1K8ZB 5B53A 5HIKA 2QUZA 3EDQA 2AVNA 2W2OA 2CFCA 5K0NA 3GYBA 3PWTA 4M9QA 1QVAA 2D3TA 4I1RA 3S55A 4XGKA 4ZI7B 4V02A 2E5LB 1F8UA 1V37A 2HIGA 3MGCA 4P2GA 3DFKA 4JHLA 2WNSA 5EGSA 2BTQA 3KOWA 1JEYB 1Z2DA 3DP9A 2HWKA 3ETDA 4N0EA 1QYVA 3TRDA 1ZHFA 5G0WA 4X63A 1YIDA 3EYAA 3C7CB 1AF7A 1Y3FE 1JX6A 3Q9NA 3ER6A 4L6AA 4BLTA 1D4FA 4CGYA 4J76A 2OXEA 3IE1A 1NVBA 3K0AA 2GHRA 3NTXA 1E58A 2VSFA 4IJ6A 3UMFA 2EJBA 2H2DA 4PLHA 4Q66C 4QBFA 3OTQA 4U02A 3AF5A 4KJXA 4NK5A 1JNXX 1T9BA 2G8NA 3A4MA 3PHBE 4LPSA 3LC1O 3S2GA 1RBYA 1DCMA 1W2WB 2ZANA 1B1CA 4DB2A 2IK8A 3KVYA 2Q50A 4DZRA 2HEGA 1DEXA 3G0OA 3G5LA 2DR3A 5EIOA 1C81A 1XHFA 4C3OB 5BN3A 1OUMA 1ISPA 2D0OB 1DAMA 3H8WA 2QS9A 1HDGO 4KODA 2A57A 4ACBA 1BX1A 5GJBA 3O9ZA 1L4LA 5ALSA 1NBAA 5F7ZA 2NSYA 5BT8A 5AVQA 3ONVA 4FFDA 1UBHS 2I6QA 4GE3A 2J0SA 3ZCSA 1OWPA 2CF6A 1G3QA 2F43A 5AVRA 3NI2A 1Z47A 2PQMA 2PZ8A 3Q3IA 3V00A 3VR4A 2R25B 3LX5A 4BXOA 1JLSA 1JAZA 1ODLA 2EYUA 2QZZA 2EU8A 4I1IA 3S2FA 4UBJA 4QUHA 2VDNB 4KUEA 4LXQA 4B3XA 4D4KA 2WRZA 5GZ3A 2GJ4A 4TYWA 3ZIUA 2IDJA 2QJWA 1Y89A 4WBXC 5KYUA 5JAIA 1Q74A 3CNNA 4KACA 4C05A 5E95A 4L5AA 1V1MB 1XZNA 4MR7B 4F84A 5A1JA 3AR7A 1RKBA 1QIMA 4MS1A 2FLWA 3IQXA 4R7TA 4FYMA 5IMBA 5FTLA 1PR0A 1EFRA 5A7GA 4MA4A 2ZRGA 3BGVA 3IAUA 4CT5A 2YV4A 5AM1A 3W4JA 3EBLA 3H4TA 9ABPA 4WY5A 1K0FA 4IIYA 2IC5A 3WKDA 3LS2A 4UJ3A 4BO2A 2EQBA 4IGAA 2VHEA 3I23A 1PK7A 1U1CA 1S8AA 2H6EA 3KKZA 1BGWA 4LJYA 4OFWA 1L4YA 1V2HE 4NJMB 5E7IA 1UDWA 3F4BA 3TRKA 4Q7QA 2OXCA 5BSGA 4CFYA 3NAGA 4NMWA 1UFOA 3GBVA 3PFIA 1G21E 1MTOA 3L9WA 3LVBA 4YCCA 4LCJA 3ZQ6A 4BO3A 4K6FA 1FNSA 1US8A 3QBEA 5A5EA 4CMEC 5K09A 3PUKA 4HPXB 4QTUB 1T9KA 4A0HA 1X80B 1T5DX 4WY8A 4Y1RA 1XGKA 2PQ2A 4GPBA 4DABA 4Z7NB 5LQCA 1LDNA 2A86A 5IVHA 4LTMA 5EMMA 3AW8A 1PGOA 2WJJA 1JG3A 3BFVA 3NBUA 3OSUA 1WEHA 5DWDA 1JMKC 3R2JA 3BSYA 3FR8A 2XECA 3QLUC 5A2QA 2C97A 1UQUA 3LUJA 3T5MA 4E32A 1FMLA 1Q20A 3GGSA 1YA4A 2H85A 2FEXA 1J70A 1NU8A 1ULSA 3BMQB 3MJ4A 2DWQA 1TD1A 3EZFA 3Q2OA 1V11B 3AEUA 1ZUWA 3BEDA 3FPJA 5LJIA 4Z5XA 4LC1A 4A36A 4RUKA 5HF5A 5B7GA 4OO3A 1VGVA 3TXAA 4EOGA 4JASB 4M0MA 1IEQA 2WG1A 3GPDG 4H59A 1GPJA 4K9SA 4BNZA 3NH6A 5DKFA 2BVNA 4LJLA 3BFKA 1NONA 2DJ5A 2FEOA 1VSBA 2JFUA 1P9OA 3HBFA 2B1IA 3PWSA 5I51A 4E7OA 1I3OA 2XB8A 4U7DA 3RIGA 1CFZA 5AICA 2EKBA 5JAOA 2QQ0A 1NHGA 1BMQA 2RKOA 3OTWA 1WZUA 2BKLA 4GPEA 3AYXB 2EGUA 821PA 2GK4A 1HTWA 1DFIA 5FUWA 3E27A 5AKHA 4Z4GA 3I2IA 1XKXA 4NCHA 2DCUA 1FJXA 3AG6A 4ND1A 4CGZA 4QPZA 3TCKA 4Z4IA 1DI0A 3WIOA 3DBVO 4BMNA 1Z6TA 5LL6P 4QVIA 2ONKA 1H6DA 4Y98A 5BXYA 2XW6A 2HEIA 1FJHA 3GT7A 1AKNA 4ZAFA 1L5HA 1XD2A 2QN3A 3SDZA 4R2HA 1NRWA 4ANFA 2HGZA 3IELA 4HWSA 4PX2A 1C1DB 2Y67A 4L78A 5AHXA 3JQAD 5GIOE 3A2KA 2TYSB 3PC8C 4MYUA 1ICEA 3UKJA 1QFZA 2GBGA 2ZUSA 3D3WB 3RH0A 5CA1B 4CF7A 1TNDA 1X42A 2GARA 5JECA 1KF0A 5LXTF 1K06A 2GBLC 3HABA 4IJUA 2RGNC 4XA8A 2VHWA 1G42A 1IUOA 3RSQA 1JZSA 1YBVA 2I5PO 1FNMA 2V8OA 4RSRA 3GBPA 4ZHQF 2P2YA 4JGIA 1T2AA 5HZMA 2JEZA 1G6Q1 3GJTA 2BHLA 4CG3A 1P9LA 1O0CA 2R68A 1ODFA 4IWNA 2ODAA 4YP9A 4LF5B 1HNWB 4BQFA 4YQZA 2I6GA 4CUZA 3CRNA 3OIGA 1EUYA 4C78A 3Q40A 4WWHA 4IDBA 2YUTA 1Z0ZA 1Z7GA 1UFKA 3GDOA 4I3FA 4IVRA 2X6RA 3CPSA 3U16A 3THWB 3EXHB 4FD3A 4Q4HB 3C74A 4MVCA 3E7WA 3VZDA 4ZHSA 1IIBA 1HO3A 4GVXA 4RF2A 1PP4A 4U7FA 5LMNB 4Z51A 5FDFA 4PLFA 5GAJA 3LTEA 4KFRA 5GJWC 3TW6A 1U80A 4MO9A 3BHMA 5B1HA 1ZL2A 4CTOA 3IEUA 3SF8B 4Q9LA 5IWCA 3UNXA 5JYCA 5FB3A 2BJHA 4ZMRA 1MX5A 2AT1A 1Z75A 3GPCA 1D6JA 2XT6A 3O4IA 4NDZA 4WVFA 2GZDA 3K5HA 2DU8A 2YRXA 3DSRA 4M4SA 3K5PA 2OZKA 2QT1A 4GMDA 2BBSA 1S96A 2P9HA 2AJBA 3R7LA 2GH1A 5LMUB 2Q9AA 3U9TA 1ULBA 3SJCA 3AXSA 1HV8A 3EARA 1L8OA 2XDYA 3GUHA 3PCTA 2RDMA 4Q7JB 4URWR 5CDGA 5DHQA 2EX0A 1U0FA 5CNMA 1MENA 2P3OA 3ICCA 1KOLA 3OTOB 5C9ZA 1RJ9B 2QQEA 5FOTA 3T94A 2FE1A 3JWPA 5FOVA 1E4YA 2UVDA 4XB2A 3KIPA 1VE6A 3WSWA 3EUFA 4D6XA 3TB4A 3TGWA 1P2BA 4GX1A 1SG6A 3DWGA 1BVUA 1YSCA 2WI8A 1P81A 3KYDB 3PNYA 4FMDB 4H3HB 5COBA 4MLPA 4XVQA 3VR3A 4RTJA 4JIGA 3BK1A 4ABTA 3ECCA 5FNZA 2HCRA 3QIVA 3OZCA 2MCFA 4LDPA 4E6PA 2ZB3A 2W9XA 1YNOA 3JVUA 3B1KA 3I58A 4UAGA 3CZ4A 3QU9A 4CNBA 1J2UA 3H3XA 4OBBA 2D2VA 1XZJA 5I48A 3L4JA 3FDXA 1PZXA 1VJRA 4OGGA 5I8ZA 1VOTA 2X5KO 1YH3A 1N2GA 1KPGA 4MQ4A 4AKGA 2F90A 2VKQA 2DERA 1FTNA 2D8MA 2J9FA 4WZ6A 5EJ5A 4Z3OA 1Y0BA 2RK4A 1NSTA 2VCYA 4ENUA 4CEIB 3CE9A 5DXJA 3A9CA 3C8DA 2G72A 1KZGB 2FR8A 2ZETA 3C1TA 1BRMA 1E1RD 1TTHA 3REQA 1L4KA 2BELA 1MQ9A 3THXA 1USUA 3IQWA 3P0FA 3RWOA 3R5FA 4RD0A 3Q4GA 5TIIA 3QEBZ 2IH4A 2GDJA 2WSLA 2O7NA 2YJ3A 3KOOA 4X7RA 3ASYA 1I9CA 3ZEIA 4JYZA 2ZCJA 2FXIA 2O0MA 3K1AA 3I5YA 1N6IA 5J9FA 3KXKA 3DBHB 1QG6A 3ZKWA 3IKVA 3SBOA 3D4OA 2E18A 4R2JA 3DDHA 4YREA 3ZDQA 4X65B 2G82A 2WYIA 3LXUX 2BE9A 3WK5A 5KJ1A 1C7RA 1CUAA 2GM4A 3Q3VA 1ZA2A 1QIHA 1GU7A 1T4BA 3AJ8A 2JD2A 2A59A 5CT9A 1PUIA 5SZKB 2G0NA 4LKRA 4KLCA 5AQ1A 3OMLA 3T6KA 3L4EA 2G80A 1ES9A 3MZ0A 4GSKA 4PLGA 2EG9A 3FBTA 4ESEA 1LPNA 1HKHA 3OCCA 4L9WA 1V6AA 2FPWA 3RFUA 2O7QA 3QOWA 3HP4A 1HX7A 1NI5A 1RW4A 4WKNA 1PL8A 5HIAA 3T15A 4AB1A 2IZ1A 2AG0A 2K2QB 3IC5A 4M7PA 2QZ9A 1ZA1A 2R00C 2AUMA 2QMQA 4MKRA 4RHFA 3OPYA 4DOMA 5IASA 5J4YA 3RHSA 1WD7A 2RJOA 3BE6A 3W1VA 3R5HA 4F2GA 1XAIA 3EIHA 1DZIA 1QGUB 5K3FA 3QVGB 2XDQB 1B14A 1G8FA 2FTKE 1OLSA 1Y9DA 4EVIA 3DT6A 1TLLA 5BOVA 1ZOPA 2D3WA 1DAKA 2Q5OA 1Z7YA 3EZNA 4ZPXA 1R37A 3QZUA 3ENQA 2VTKA 1N33B 1MPTA 1BMTA 2UYGA 2EXXA 1VSUA 3WG9A 1ILEA 2DBRA 4NFLA 2UZ3A 3BJMA 3SXJA 2HCBA 4KXWA 3RREA 5H4HA 4OAQA 1WLYA 4H7KA 3BSFA 2ZSEA 3AKDA 2JGAA 4PE5B 4X8HA 5AM2A 3Q41A 4W82A 3UJ9A 2R7LA 3M4XA 2ZDHA 3INNA 5A9TA 3HKDA 3ZJTA 2IYFA 4W6ZA 4BKQA 2AL7A 2H65A 4RXTA 5THKA 1GEGA 4JUIA 4G56A 1XLTC 2IUUA 2IF2A 2VH1A 3WYAA 1U0EA 2R8XA 4Z4FA 4LJ7A 4NU0A 4YMVA 4HXFB 3TGPA 1DC4A 4XQGA 1CIJA 4GR9A 2B8JA 2Z3WA 1JPJA 4NEGA 2JIDA 1CUWA 3K2BA 1TVKA 3BWVA 4I9GA 2YOGA 4OK6A 4EYEA 2ALJA 4EG5A 5C52B 2PBRA 2QMEA 2XQKA 3ABZA 2J0UB 3CU5A 3TQCA 3ANTA 2A5YB 1QK4A 2VWHA 4OUDA 1HORA 1TQHA 3SHOA 1NJGA 1E9EA 5DLDA 4DBZA 4Z4HA 4WAUA 3GD5A 2P8SA 1TAHA 2IUTA 3IO5A 4J0JA 1MCZA 1ESEA 1Q1ZA 3WMGA 3B1VA 4ETMA 3UJPA 1ZRMA 3RVBA 1DWPA 4KVZA 3QVUA 4ZCLA 1SO8A 4JQOA 3E4DA 4CKWA 1GOTA 1JLRA 1YA8A 2BFDB 3BCUA 4MSUA 4FCWA 3TQIA 5C7YA 4JUDX 1UP4A 1F7VA 1SUEA 1E3SA 4HUQB 4YRNA 4U2CA 3T5BA 1VSQA 4J7AA 5F1KA 1IBCA 2QZSA 4RAQA 5TT0A 4RANA 1KJJA 4K8OA 4H7PA 3VVMA 3NNNA 1IBSA 1HE5A 3CONA 2ZSJA 1DAFA 1PS0A 5CDSA 5KNDH 1JKXA 4K05A 1LRLA 4HAZA 1WM1A 4XIYA 5IXSA 5JZVA 2DKFA 2PX2A 4LF8B 1BJRE 5IUKC 2RH4A 3F2VA 3NVAA 1EJ6A 3BB4A 3F5MA 3VX3A 4JOSA 3N07A 1DXQA 1HTBA 4JR1A 5KX5A 2O5RA 2BTEA 1I3KA 2WIJA 3D6NB 1OI2A 3I76A 3ID6C 5AH0A 3BIWA 5CDTA 4FM9A 4DN6A 3LPLA 1ZQ1A 4IL5A 3IILA 3TFWA 4GG1A 3TTUA 3R20A 5BSEA 1GCUA 3B52X 4MTCA 1DJQA 2O8BA 2ZYSA 3EXEA 3E48A 3B1YA 1M1NA 3R3VA 3VPHA 2EQAA 4S1NA 3W7AA 3OQ1A 4LHSA 3AI1A 2XA2A 1QWOA 3AC0A 1NI3A 3HMKA 5ER9A 1VJDA 1IZ9A 1PFWA 3QK7A 4G65A 3EWIA 2NXNA 4X6XA 4L2IA 4IDHA 2HA6A 3BRWA 2BHSA 5DBGA 5K2MA 4AG3A 4YRKA 4TWAA 2BGTA 2JK0A 4IJWA 4CG1A 4YMLA 2IU0A 3OWXA 4XD2A 4D81A 1YB1A 3C8ZA 5IN4A 3HUUA 5EUBA 3L04A 4JJZA 3GEEA 3PRJA 4LWOA 2W37A 2QMOA 2DFKB 3H5AA 1U2PA 4CM9A 1GPDG 1GPYA 2Q27A 1IXKA 5E7QA 3T3MB 3WO1A 4EA7A 2CVFA 1PDOA 1TQ2A 2HYDA 2FEAA 1M76A 3MCZA 3TEMA 3VO8A 5IVDA 1K3TA 2G0AA 3H0EA 4EHHA 1NM5A 1HM5A 4OM7A 5LYJA 3UXHA 5CVTA 5MGBA 1OBVA 2HB6A 3GGOA 4NZYA 2CE7A 3FKSA 4Q6BA 4M38A 1ULZA 1K97A 5CYPA 4ROSA 4C5BA 2OORC 3DDWA 2HF7A 2QTVA 4MHOA 4N8EA 3RVPA 3PK0A 4AO7A 5LQAA 2EFDB 4CF3A 1L5QA 4UTXA 4K9LA 1HNZB 3LK7A 3OE5A 1WUJS 4TLBA 2ZXUA 2DBQA 5L7TA 1WW8A 2JBWA 1C9EA 3CEHA 1NOIA 1AMUA 3DLBA 3MJCA 5FBZA 4LSWA 4XYMA 5IAJA 5CNIA 1GLNA 4UE6A 3RUDA 2VKTA 1K63A 1VXRA 3N59A 4CHTA 5A4MS 3H2GA 5JATA 1UC8A 1O7JA 2PRKA 1SHLA 1KORA 3BILA 1GHTA 3RS3A 2WINI 2XRYA 3GJXC 4CUKA 3G9XA 3VJRA 1WBDA 4AC9A 4MEJA 3RFXA 5HUQA 3HVKA 3O8BA 1SIBE 2G4VA 1XNQB 2V7QA 1VPTA 3K5IA 4RKYA 3CG0A 3Q2IA 2C29D 1KDOA 2F64A 3AV0B 3C98A 3G2MA 3KJHA 3L4BC 3LGSA 3SYKA 2H29A 2I87A 2PUJA 3DWFA 1WDLA 1ORVA 3KQWA 1LVGA 3B2NA 3LCRA 2G40A 2FRVA 3ZGYA 3QRWA 5DI3A 2QP3A 3LKVA 3KWJA 4I1YA 1H1DA 2Q3HA 3WISA 1E2NA 5CTAA 1WQ4A 4GU5A 5C37A 1Y3DE 5C8VA 4U2KA 2KQUA 5ALNA 2FWMX 2BM0A 5JDCA 1I2DA 3KHSA 2DRIA 2ZYTX 3MJFA 5FAXA 5HKOA 3GLGE 1RI3A 5FTNA 4BOYA 4DANA 3NXSA 5A0FA 4FBGA 4TXJA 4HDKB 4KVAA 5ALLA 3ZY4A 1WRBA 1E1QD 2FFJA 5C8YA 4RNDB 3EAFA 3VX4A 2GN2A 4D26A 5J4LA 1WXHA 4B3RB 1JTVA 2X1MA 2YY5A 1YKGA 1L8XA 1FUIA 3VR2A 2BM9A 1N7GA 1TJYA 3W3AD 1O95C 2HA3A 4ZVKA 1GG8A 1VPDA 4YIHA 3L4KA 4KTTE 5KSPA 4UZFA 1XWIA 2OQ2A 1WCXA 3T61A 4J6EA 2BW0A 2VBFA 4Z1MD 4TYYA 1T15A 1WOMA 4IH1A 1E0AA 3R40A 4J90A 3TI7A 2HZ7A 1ACLA 3C8HA 4BVGA 1U7PA 4C5CA 1ZOSA 5KDDA 3MERA 3ZDEA 3GEIA 2FFHA 5A4IS 1JEQA 3HWWA 1E2JA 3EXG2 2QL9A 1YDHA 3DW3X 4G8JA 2WZQA 1CY7A 1KP3A 1Q6YA 3DEAA 4I2VA 1JFVA 3AV3A 3L0ZA 1R7RA 5FWYB 2O3UA 1VSVA 2R2AA 2XUAA 1J0CA 4B6EA 1GAQA 2G04A 4Y6QA 1ZLYA 2JJ2D 4BFSA 1Z2PX 3HCBA 2PT5A 4CETA 4KPEC 2GPAA 5IJAA 4GM0A 4BB6A 2CFTA 1MTZA 1OH8A 1U0RA 1ZUNB 4L0DA 4NR0A 3LBAA 3QHPA 3I4FA 4DV6B 1X7YB 1UKCA 3CH7A 5AXCA 5FTJA 3W2EA 2PFKA 5C8DA 3DOOA 3FWNA 1W581 2I8CA 2IHZA 2WZDA 1SKAA 3F7NA 1LPAB 3G5AA 5BNFA 1TJNA 2AK3A 4HDOB 2EJWA 1QG0A 4J3FA 5LR6A 4Q6WA 2I29A 2IDZA 5ALWA 1Q15A 1O57A 1XZCA 3SLKA 5DM2A 1MDBA 3PPWA 4ZZ3A 4RGBA 2VDKB 1UWLA 2DSNA 4G97A 1W94A 3LY9A 4HYTA 3ZXUB 2WDZA 2O5CA 1CJKC 4OK3A 3HGTA 1UANA 1RKQA 4YI5A 2XRMA 3CPEA 1CZOA 4YJ3F 3AETB 1AS0A 1ORWA 1T9HA 4EHBA 5CIYA 4K26A 3A70A 5DPMA 4EPVA 1M6VB 1LI7A 2EW1A 3KJFA 3UCXA 4KBYA 4DT1A 2FSSA 4ALNA 2GVZC 1D5WA 5AW1A 2GILA 2M98A 4JXKA 4Y6SA 3RC3A 1Z17A 2AW5A 3GJQA 3W8RA 4BVAA 3PEEA 4TRJA 4DV2B 3G02A 1WXWA 2GN6A 1M2NA 1B0PA 1Z7WA 2OSBA 4JEMA 1RWXA 4GQAA 1LQUA 2OL4A 1F3OA 3AU9A 1QV7A 4WN9A 4UOEA 3ADBA 1Q50A 1TMKA 2XWPA 4GF5A 4QOSA 4FGLA 4FKMA 5AVVA 5EJAA 2ZJFA 3BXXA 3HVUA 4JC5A 4US2R 5CDYA 4OYLA 4CQMD 4YK7A 3SEQA 4EUKA 5LU8A 5EQDA 2C00A 3F1KA 2QZPA 3KE8A 1VHQA 4JQZA 3RK4A 4AUKA 1M66A 3ESCA 3CLTD 3ULKA 1UP6A 1WCYA 2MYTA 1IHXA 1YZHA 1XMQB 1QF9A 4FEEA 1FZTA 3LQ4A 1RBMA 3V2GA 1HUQA 2PGNA 4GRIA 1Q6ZA 3COSA 3DTNA 2OC9A 3C5VA 3M6IA 4N54A 4MJLA 2FJPA 4HMPA 5HFJA 1G5TA 1U7UA 2O48X 5CW1A 4ZWNA 1F2TA 2J85A 3JXEA 5KPJA 1UBSB 3LHIA 5ICMA 3OI7A 2QUJA 5K0TA 3D7MA 4AX4A 5DDIP 1JYEA 3KAKA 2FN8A 2PY6A 4L5JA 1APBA 3PVCA 4N0PA 4YB8A 3VH4A 1AA6A 2R1VB 5FEMA 4GI3A 1EUQA 3MOSA 1N8SA 3GARA 4KJZA 4N12A 1SIUA 4IV0A 2XGJA 3QOYA 3BE8A 3ASUA 4LSMA 2ZS8A 2P1DA 5F51A 3HHPA 1QAMA 1VMEA 2GN1A 3D8TA 4M1SA 4ZU3A 4WLEA 1W5TA 4G37A 4YQEA 4CEHA 1AK9A 2XQVA 1T3SA 2O3TA 5E4TA 1MABA 3EZXA 1MXHA 1MB9A 3DV0A 2HJWA 3EXHC 3O3CA 5J47A 1PU2A 2XTNA 3T41A 4JP3A 1GKKA 3AZQA 3DMTA 1EWKA 1JXMA 4HNHA 1FQKA 4W8OA 4HNUA 5JD4A 4KKVA 4MGIR 2BFOA 3VVLA 2PBZA 1B74A 3RUFA 2OBFA 1U7ZA 4REQA 1R10A 1THTA 2H5LA 3DTVA 3L0CA 2WFZA 3GOHA 1HEYA 4MB2A 3LMKA 5AHOA 2FPPA 3ZHSA 1M1UA 2YWRA 2O59A 1I3NA 1QF7A 1JIUA 3QELB 2Q21A 2BJWA 4HQ6A 3A06A 1MEOA 3TM4A 2A67A 4A8JA 1EE2A 5K3BA 5IDXA 1XTKA 3HDYA 3WNZA 5FTKA 1Y8AA 2ZI7A 3VYSB 2VCEA 2XXJA 1PSDA 3A3PA 2XADA 4S24A 2PKRA 2J6BA 4B43A 1TAGA 1C2YA 2HT6A 5HE8A 5EJ9A 4DW8A 5K20A 2JIPA 3QW2A 3WLEA 1FTGA 1RT9A 3D3QA 2OCIA 3IUEA 4NSNA 2VXYA 1C3LA 1ZCFA 3UK1A 3WQSB 2XYQA 1SK8A 2ZVDA 2JHGA 4UDNA 3TTWA 4OHKA 4AK9A 4D6PA 5K0CA 1GNRA 2YVAA 3I8XA 5FWXB 1B8VA 4I6EA 4QXPA 1K6XA 3OQ6A 3LM8A 3UZUA 4E5DA 5L51A 1LLFA 3HO6A 3R9KA 1M34B 1RWMA 1O6CA 1HDZA 4L8FA 4TWZA 4EGAA 1B6RA 5BOSA 5BUSA 4KGDA 4HS9A 3KT6A 3OEED 5DLPA 1I6LA 4OXRA 2ORIA 1IVSA 3NHPA 1H2ZA 2WT9A 3GELA 4U9IS 3RC2A 4O4JB 4WECA 3RW9A 2ANCA 3KL4A 2QRZA 1NYTA 2D2EA 1GA6A 2R1TB 5E9QA 3A58B 5CEEA 2NAPA 4XOUA 2HKIA 3ZH2A 1I94B 2GF2A 1L5YA 3PUZA 5DH9A 1LJ8A 4MV3A 4C30A 1YACA 1TKBA 3OJFA 1ZVVA 5JXIA 2QROA 5TS2A 5L6MB 3E7FA 1W4BA 1XEFA 4RDIA 5JG7A 2QJTA 4UZSA 5HYVA 4TV8F 1P4AA 4XSGA 3EIQA 4WK4B 1IAVA 4HLDA 4RS3A 4L3VA 2P4SA 3ZW7A 3ZQKA 2RC6A 2VNAA 1NVEA 4J4HA 3ZWVA 2IV2X 3KQKA 5JCOC 1C3XA 2O3QA 5JU6A 3V3KA 1E9FA 1VLZA 3KR1A 4WJZA 1FU4A 1L3BA 5CG1A 3KTDA 2XT0A 4GSLA 3U7JA 3UJHA 1KQOA 4D0GA 4ZP1A 4EG3A 4DR1B 3BFPA 3MEQA 1AOXA 4B3FX 1CW2B 1Z45A 2R48A 1GQOA 3ABQB 1GGEA 4WKOA 4GSYA 5C5EA 3CXUA 3LFTA 4QOGA 4QO8A 2H4WA 4DNQA 1GQ2A 1N8NA 1NDQA 4AMVA 4DSOA 4MUNA 1R6BX 4LGCA 1XALA 2IPLA 2IZ5A 3U7IA 1J49A 4KSYA 2Q6KA 1AS2A 1YC5A 2CNDA 2WD7B 4J2HA 2BGNA 2H08A 4RPIA 4C6TB 2C9DA 2QTZA 3ZI4A 2GERA 1VI6A 1WO8A 1XTJA 2WICA 4UXHA 4JVNA 1H2EA 5HXAA 4KG7A 4QELA 4OHVA 3TF5A 4YCJA 1GVNB 4WKCA 3DEIA 2OKGA 2P3LA 4Q24A 4QATA 4C43A 5IC4A 5E4JA 5FP0A 4L15A 3UMBA 5FJIA 1SC9A 1SBHA 3PYXA 1K3UB 1VL0A 2X40A 3NVKI 4EL5A 4L5CA 3KP1A 2Q41A 1MHTA 4LY0A 4UVGA 3GLUA 5CU7A 1WD5A 5IAOA 4NZOA 3G2JA 2JARA 1QE0A 1PIWA 1HSOA 4PSKA 4OQDA 1DQPA 1KPHA 3L5OA 2HWYA 3JWJA 4EYGA 4QDUA 3R3WA 3PE6A 2XUDA 3PB3A 3E22B 2J5BA 1I2ZA 1KBOA 5IF9A 5JC8A 1Y33E 5I8PA 1C3OB 3O94A 4NYIR 1AD2A 1KH2A 5HZHA 1UM8A 3RROA 1SXPA 3AUTA 3HCWA 1SUCA 3AFGA 1P1CA 4R8RA 1CY6A 3O8NA 1TRKA 3OHMA 4M1TA 1QYWA 2R60A 5HMMA 4E31A 1BRTA 4CWAA 4OXXA 2MSCB 3OPQA 1QU2A 2LZ0A 2ZSUA 2XQGA 1UMBB 3ZUGA 2G9QA 4MIKA 1CD5A 2CBXA 3R7AA 3QMMA 4XVUA 1A9YA 3L5KA 3FETA 2C8KA 1Q92A 3DVSX 3MCTA 1W8DA 3EISA 3QFRA 4DREA 1D2AA 3EW9A 2GTPA 2ZJAA 3PQDA 1GL7A 2CDCA 2QPTA 4RGYA 1OXBB 1G8JA 2A1UB 3ZWAA 2AC4A 3OA0A 1YULA 1B76A 1MHPA 2X4LA 4LYEA 2HQ1A 2DVMA 4JIMA 5LN1A 3HB7A 3G0HA 4LSGA 1E7SA 4BEJA 3OOYA 1P2GA 2TMGA 3NYRA 2I7VA 2WOOA 2PYDA 4K9KA 5I9TA 5BP7A 1LWNA 3LU1A 4IDQA 1A1SA 2WY2D 5I7UA 2QMUA 3QI7A 5EE1A 1DPFA 2OCPA 3IMKA 4J0QA 1ZKMA 2OYRA 5JASA 4LRQA 1A27A 4XJTA 1QG2A 4F92B 2GK7A 2WZBA 3DF9A 1BX0A 2IT1A 4RM2A 2BEKA 4QNRA 1ENZA 4AY4A 5B6PA 1NU6A 3EF1A 2BSAA 1G6HA 2BFPA 4QHSA 4E2FA 4TYQA 1JHQA 4OVKA 3T9AA 5JSUA 3PD0A 4BRSA 4MJ7A 4DLXA 3D0OA 3QA9A 2GAJA 3KTAA 2BEVA 4N47A 2GM3A 2ZJ4A 4EZBA 3G8BA 4LE0A 2Z0MA 3COZA 4FGUA 3QPAA 4YJ3B 2FDRA 2W22A 3JALB 1EB8A 3IAEA 1QIGA 4FCVA 3HDTA 4JGBA 3C43A 5CURA 1KNQA 2I9PA 3PTZA 4KQ9A 4A3SA 1C9YA 4GYYA 2CSXA 3KZVA 4UUOA 3M34A 5DJ5A 4TZTA 1WSDA 4XYEA 4ER5A 2WF7A 3FDZB 1M34E 1Z0IA 3UAZA 4EKDA 1XD9A 2B4TO 4F60A 1OT3A 4L7VA 5D84A 1JILA 1KEWA 1XT6A 2P7HA 3EWAA 4CMGA 4E88A 1GYPA 2VTDA 3Q7TA 4IVPA 4UVHA 3VVCA 4BV9A 1T91A 5CK5A 1A5SB 1H0KA 1HZJA 1VLHA 2ZRBA 3BSWA 4JD5A 4B82A 4E2YA 2JGDB 4ND7A 5K0SA 1X38A 2GGSA 1CHNA 4UASA 1XYYA 3BXPA 1W48A 1QVWA 3AF0A 2I4NA 3OO0A 2GSWA 1HGXA 2JBAA 2IF0A 5FLKA 2AF3C 3GN2A 1UL1X 3F6EX 4G5SA 3OKCA 1P4JA 2AGVA 2PV0A 5BV2P 4UBLA 1RM4A 5EL0A 3U7EB 3TSOA 4ASUA 3A6FA 1UQRA 1ZCBA 2A7XA 5AO9A 1AO0A 5AI0A 5J23A 1ABBA 1DBRA 1CZNA 1Z38A 3IMEA 1PQ4A 4A73A 2NUAB 3JQAB 1Y4UA 5A6SB 3RBXA 2V1UA 1ECFA 2ST1A 3H13A 1W4CA 2B5OA 4MARA 3D4LA 4X7MA 4E3ZA 3MINB 3SJ7A 3QPDA 5JS2A 2FWNA 1PV4A 3H1PA 4NPAA 1OSNA 1E1NA 2W00A 4L74A 4GICA 3OQNA 3FI0A 1ZJ6A 1Y80A 1RAAA 4WBNA 1RQLA 4LNUB 4X64B 1C7EA 4XLTA 4UXJA 3QBDA 1WX1A 2NSLA 1DEKA 3L7NA 4J3NA 1KAOA 3RQSA 3WSTA 2IHTA 4HFJA 4WK6A 5EHGA 3QTBA 3UJ8A 3W5DA 4LDNA 3U4CA 4BB0A 3JU3A 1RADA 3P5BA 3WLPA 4G1VA 1CU1A 4C4PA 1TJ4A 5A5DA 2ZU0C 2W8BB 4IIUA 2VOJA 3W5JA 3A1CA 3V1UA 4M8SA 3RSCA 4HVCA 4BMDA 1QOZA 3IKJA 3TN7A 1TQ8A 2FWAA 1JHXA 1ND6A 3DT8A 3PR2B