5F1KA

Human cd38 in complex with nanobody mu1053
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
244
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 244
sequence length 248
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f1kA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f1kA02
2YZ7A 1EE2A 3JQ8B 4W4TA 1U7HA 3W8FA 1DIHA 3DOJA 1E0DA 5DP1A 1PU2A 4DVJA 3NJ4A 1HE2A 1TB4A 4P22A 3VPHA 4P38A 1DDOA 2DBQA 3OF2A 2DM6A 3EY4A 1WW8A 1LJ8A 3DHYA 3H5NA 3P19A 3CMCO 1EVZA 3DAGA 3HZZA 2BI8A 3PJGA 4FBGA 4HNHA 5LDGA 3RD5A 4MKXA 5CDYA 3ETDA 4GSLA 3I3OA 1ZEMA 1W0CA 3AWDA 5C37A 4CR6A 5LDHA 1ZSYA 1HE5A 4N54A 5L40A 1AHHA 4QQRA 4IJUA 3OP4A 2W98A 1KETA 1R0KA 1Y81A 1I8TA 4YJGA 3DZGA 3ICPA 3KEOA 4J91A 3WGHA 4CMHA 4CQLB 1IY8A 3E9MA 4PLYA 3ZGYA 3WWZA 1I3NA 1WP4A 3DZIA 1Q0LA 1E3WB 1N7HA 3QQPA 1PQWA 1M2WA 4E2WA 2A92A 3QVWA 2X8LA 4OIMA 2Q50A 3ENKA 4ZA2A 1F06A 3HN7A 1YQXA 4DBZA 2H5LA 2AQ8A 4FJ0A 5TQVA 3BMQA 3EDMA 3WMXA 2AXQA 4Y6SA 3IQDB 1U1IA 1VKNA 1LSUA 3IDSA 3BTSA 1Z7BA 4U6SA 4JK3A 5F5NA 4IXTA 4Z9XA 4I5DA 4B3JA 1OBFO 3RFVA 1Q0HA 2FRDA 3HUDA 2O3RA 3MJVA 4LCEA 1BRMA 3MWEB 3BMCA 1MA0A 1I32A 3FN4A 3DO5A 3OM9A 3RC2A 4E3ZA 5A02A 5C3MA 3C85A 3RUDA 2Y05A 4CM9D 3PQDA 2OP0A 3JCZA 5MDHA 4WECA 4QXMA 3PQFA 2JKVA 4JJGA 2OBYA 5K0ZA 3GZ4A 3I5MA 4CMGA 3H5AA 4RQUA 2EF1A 1KERA 1UXHA 1UDAA 5CEFA 4IUYA 3F5SA 4XRRA 5CEEA 2OZPA 3LT2A 1K3TA 5FEUA 5L7YA 1W6UA 5IZCA 3VZPA 1T4DA 2IEBA 1PJ2A 3HDYA 3BMQB 1FJHA 6ADHA 3FD8A 2O3UA 4E0BA 2FWMX 1BVUA 4J1NA 4DIOA 1V3VA 3QWIA 1NPTO 1YQGA 4FDAA 5IZ4A 1ISIA 4HUJA 4K6CA 3GEMA 2VWHA 3E18A 2YV1A 5A9SA 4GKBA 1VPDA 5EPOA 2Q3EA 3OIFA 5TJHA 3GNTA 1EVIA 4R16A 3U49A 3BMCB 3EK2A 1DLIA 1JAXA 4DIBA 1LDEA 1Q2XA 1YB5A 2QRLA 3I9MA 1Q0QA 1YL5A 3V5NA 3GG9A 3WB9A 2Q2WA 1OFGA 1P1KA 3PHLA 4IJVA 3RASA 4FFRA 1H2BA 3RFTA 1D7OA 2GYYA 5FYDA 3RKUA 3U62A 3RU9A 4MIEA 1HLPA 1O8CA 2FMUA 4OSOA 3JYQA 3RWBA 1B8VA 3K31A 4EGFA 4BUCA 3FWNA 4CODB 4XWYA 1HL3A 1T2AA 1LNQA 2BFOA 4WLVA 1K89A 3TFQA 3E8XA 1XIVA 5ADHA 1LRKA 1E92A 5HM8A 3DFUA 2I3GA 3EC7A 2GLXA 5A9SB 7MDHA 3K96A 4U7WA 3T4EA 3DEYX 2Q99A 4YRDA 3Q11A 1SNYA 3QWAA 2IYOA 2Z1MA 4NBVA 4O6VA 1ZSVA 4P4NA 4Q3EA 5H81A 3WGQA 4QECA 5A04A 2PA3A 1FK8A 4FN4A 2EG9A 1YBMA 4G81A 2GZ2A 5ITWA 2GERA 2QX7A 2VZ0A 3ITDA 2DBRA 1GPJA 1IULA 5LC1A 3A4VA 3BIOA 5L51A 4XGNA 1YB4A 4WGGA 1F14A 1E6WA 1ML3A 1TT7A 1PL8A 2ZYDA 4N5NA 1P44A 2DU8A 3WJ7A 4IJKA 5CG1A 2O7QA 1HF3A 3DB2A 1BXGA 3DWFA 4CMEC 4BL5A 1MXHA 4MVJE 5ICSA 3L6EA 3MTGA 4BQRA 1NWHA 4R41A 3GAFA 4N18A 3JYPA 1XQ6A 4JLWA 4UVDA 2NU9A 4WCFA 4WKGA 4IQGA 4CQMA 1CYDA 4QSMA 5BQFA 5KKCA 4NFHA 3TNLA 3U4CA 4CLHA 2EP5A 1MGOA 2O2YA 1ZFNA 3K92A 5HS4A 3LLSA 4JJIA 4XRGA 2OFPA 1GUFA 1TT5A 3QW2A 2WTBA 3HHPA 3NGLA 5COAA 2XXBA 4D44A 3BZUA 3SJ7A 4IMPA 3GH3A 1CQJA 4NIMA 2Q1WA 2GR9A 2EV9A 4WLFA 4PFJA 1BXGB 4IINA 4EUHA 4IDAA 3T4XA 4EEXA 5FWNA 1B3BA 1E3JA 5BR7A 1LX6A 5DBIA 1SO8A 1XHLA 1YQDA 1U5AA 2G82A 4U8GA 5DT9A 4ZRMA 2E82A 3TWOA 4BNMA 4PG7A 1C14A 3PZRA 4J0FA 1VL6A 4NBTA 4WCFB 4CQMB 1CRWG 4D3FA 2E48A 3PJFA 1EFLA 3AM3A 1XA0A 1PJ3A 3WWYA 4ZHSA 1ZVMA 3WIEA 2HMTA 1ENOA 2WYUA 1E7WA 1J0XO 1JN0A 2PKQO 3CH6A 4KOAA 1XQ1A 1MUUA 1YVEI 4RPKA 3RQSA 4BB6A 4KTVE 1PWXA 1TT5B 4BO9A 4YAKA 4OGWA 5TNXA 4E4YA 3UW3A 2CUKA 1JWAB 1RM3A 2IEDA 5JE8A 4RPLA 4CMJA 5AVOA 2NTNA 1N9GA 4MINA 1B8UA 2EKQA 4YJFA 4NI5A 3H65A 3RU7A 4KUEA 5JAMA 4P4LA 3WOHA 1DEHA 3DBVO 5L53A 2NTVA 3INRA 4A2CA 1ZK3A 2HQ1A 1B14A 3GQVA 4XYGA 2TMDA 2BH9A 1EVYA 3ZHBA 1LC0A 2O3JA 4OO3A 4WASA 3U4HA 4D7AA 1Z73A 1P31A 2NM0A 4XJTA 3OQBA 1PZFA 4B79A 1MG5A 5ICMA 4AJ1A 1XR3A 3N74A 4RF4A 1HETA 1PL6A 1YOVA 2EXXA 2Z95A 2FPGA 4BMVA 4DQVA 4MVJF 4LMPA 2NUAA 4EEZA 4WLOA 2FPIA 3N58A 1MB4A 5BNTA 3AW9A 3ORFA 4CLXA 3GDOA 1UR5A 2X23A 1WXDA 2I99A 4UUOA 1N9GB 1FDWA 1HSZA 1ONNA 1WNTA 1YL6A 2GRAA 4JN6B 4YJFB 4E2ZA 4IDFA 1YO6A 1E1MA 2CVOA 3SXPA 4BNJA 4Z9FA 3WG9A 5EERA 5JPIA 4AL4A 4A5OA 1DO8A 2CDCA 1I3LA 3G0OA 3FNFA 5EJ2A 3ZV6A 4GMFA 4E5NA 3KB6A 2DAPA 2X0IA 2NSDA 2RHRA 3PTZA 2OUIA 1TLTA 4Y98A 3OJLA 1GFSA 4Q3CA 1LDBA 3AI3A 4H16A 4B8ZA 4YVFA 3GHYA 4TMFA 1YOVB 3JQCA 3WSWA 1HDGO 4W6ZA 1MFZA 4E5PA 4L0QA 2NV6A 4Z0TA 4CLDA 1ADBA 1E7RA 4J2OA 4DIFA 1PGJA 2GN6A 5B4UA 5DULA 3VDQA 1PIWA 1AE1A 1XG5A 3G17A 4F46A 2QRKA 2VN8A 2X22A 4GLOA 1QYDA 1WDLA 5JAZA 4L75A 3VC7A 3L07A 5U9CA 3PFFA 2J3HA 2NWQA 3PDUA 2Y0EA 1FDSA 4WUVA 4CL3A 4FOOA 1LBEA 1LA2A 1EFKA 3H7AA 1K0UA 3MWDB 2BHLA 5LCXA 3GFGA 5TX7A 4Q3DA 2VT2A 4FGWA 2AQHA 5TLSA 3JQ6A 4YJHA 3CZRA 3UHAA 2Y1FA 4HXYA 4QFDA 1F12A 3ZZNA 1LLUA 4NDNE 3WGYA 1JLLA 5JXWA 1H6AA 1O5IA 3I83A 5T64A 3PK0A 3RBVA 1A71A 2PLAA 1V3UA 5JBIA 2Y0CA 1LSSA 1LLDA 1Z7EA 3L4BC 5I9MA 4PLHA 3LU1A 4FFNA 2I67A 4QTZA 1KBZA 2QRJA 2B4QA 2O3TA 1WDMA 5T6BA 2AQKA 1V3TA 3M6IA 4PZCA 3FR8A 4DLLA 4MDHA 4D3DA 2E49A 3L9WA 1NQ5A 2AA3A 4MKZA 1FDUA 2I66A 4INAA 1UP6A 1PWZA 1IUKA 2WYVA 2O4UX 3UICA 3RUEA 3FSRA 1PEDA 3ZNNA 1DHTA 1DC5A 1GCOA 3DL2A 3AY3A 3LLVA 3WQSB 3ZN2A 4YT8A 3IJRA 5I7FA 4YJHB 2RH4A 2WE8A 4BNTA 2P5YA 3GG2A 3KV3O 4L4XA 1XSEA 4Z3DA 5ILOA 5IDQA 4GI2A 3DMTA 4YXFA 1VKOA 3DONA 5DDIP 3SLGA 2XXJA 1T26A 4R5MA 3MCVA 4YR9A 3HDHA 2ZTLA 4FFOA 4B4OA 1Q7CA 4IS3A 3BHIA 3G1UA 3DTYA 1TA4A 3S8MA 4D3SA 1LEHA 1B16A 1F0YA 1R37A 4OAQA 1P74A 1N2SA 1NYTA 3ZU4A 5I8ZA 4GX2A 2X58A 3C1TA 2GUGA 5ENDA 1ZUD1 4FCCA 1GV1A 3M1LA 4RLSA 1LRJA 1BW9A 4ZQFA 4ROSA 5L7WA 1R66A 2IXAA 3A28A 4GBJA 3ETEA 5IXYA 4EJ0A 1M67A 4BKQA 3TZ6A 3GOHA 1NHGA 2B37A 5IDWA 3QV1A 4Q9NA 5EQFA 4N5MA 3RUIA 1A27A 3CKYA 4K26A 4PLZA 2CDBA 3D3EA 4RZIA 2UUPA 1VJ1A 1JU9A 1ZMOA 4BNIA 4XYLA 3QY9A 3IKTA 1E1NA 4WLNA 3E5RA 4QO8A 5KKAA 1YS4A 9LDBA 1NFQA 5KNLA 1P0FA 1HZJA 2P9GA 4NZ9A 1DIGA 4XQCA 2ZJ1A 3AM5A 3GR6A 4PLTA 3M1AA 1BW9B 2X4GA 1DAPA 3JQ9C 1ADGA 5C7LO 1H6BA 5ER9A 1HYGA 4RF3A 1V9LA 4B8WA 1UZMA 1RM4A 3GVHA 2BI7A 3CEAA 4AG3A 1DRWA 3FI9A 2HDHA 4II3A 2DKNA 1ADCA 2OHXA 4OXYA 3WLFA 3W4JA 3K30A 4ND2A 1PR3A 1KIFA 2VUTA 3O03A 3BA1A 2YFHA 4XR9A 1EEHA 3V2HA 4EZBA 1WAMA 2RBEA 1YJQA 1TEHA 3IAHA 4Y6PA 3W8EA 4ALJA 2OGUA 2QYTA 4FGSA 3JYLA 1ULSA 4WJZA 1NNUA 3JD1A 2EJVA 2DTDA 1NVTA 4O0LA 4OHUA 4UREA 4H7PA 5I7EA 3WFIA 4OQYA 1G0NA 3INTA 2TMGA 4OJNA 1QRRA 1VL8A 1ENZA 3GK3A 4IZHA 2J3KA 4D46A 4KUHA 4KQWA 1HDRA 1J49A 2HK9A 2J5RA 5JYEA 2G1UA 5B4TA 5JY1A 3UH1A 1JTVA 1T2DA 1XU7A 5TRTA 1QG6A 1HDOA 2GCGA 2ZJ0A 4DUPA 5KJFA 3TSCA 5JAIA 2O3SA 4JJFA 4MVJM 1T4BA 2P4HX 5TJ9A 4D45A 3AU8A 4XQEA 4MVJI 1E5QA 3WDSA 4QX6A 3QVXA 4YAIA 1GQYA 3FF4A 3KLPX 3A9WA 4AICA 1L7DA 4WCDA 3PHJA 1T1SA 1YONA 3KZVA 5BSHA 3A06A 1Y5RA 1HEUA 1MX3A 4XCVA 2FN7A 3SC6A 2W2LA 3F9IA 4GX0A 3OJFA 3EZLA 1ISJA 4EYEA 2FZWA 5EN4A 4CR7A 3L0DA 1YB1A 4II2A 4Y67A 3FPLA 2ZB7A 2YJZA 1A4UA 1UXGA 2WSBA 4DYVA 4CM9A 1VJTA 3C7CB 3JQAD 1Q7GA 3L6DA 3VKUA 2NVUA 1NPDA 2AE2A 2VHYA 3D5QA 1SC6A 3LYLA 1BHSA 1ZXLA 4OH1A 2C29D 4IMRA 4R1NA 2GO1A 4CV2A 3GDFA 4CMEA 5ITVA 3KYCA 3I23A 4MVJD 4ALKA 3S55A 5C7IO 3HB5X 3NX4A 4W9NC 2PY6A 1NFFA 5JDCC 3S2FA 1DJQA 4RPJA 3V1YA 1RKXA 3VZSA 4MP8A 1PJCA 1PJSA 1E3IA 3DZKA 2SCUA 5KVVA 3PJEA 2BF7A 5FF9A 1C1DA 4DTIA 2DBVO 1KEVA 2XOXA 4NFYA 4YQZA 1ZH8A 5AXDA 3GAZA 4ZD6A 2IZ0A 3BTVA 3I9OA 3DQPA 5AXCA 4BMNA 4DC0A 1X14A 4BMSA 4E5YA 1O6ZA 3K5PA 3VOSA 3LC7O 2W2KA 3JSAA 1E3LA 1ID1A 3JQ7A 4NR0A 5EINA 3SLKA 4BO3A 4CPDA 3Q2KA 4DREA 2D5AA 5IJZA 1GYQA 4GL4A 2VRCD 2NVUB 3GMDA 3UXYA 5GZ3A 4HP8A 3ZWOA 4RF2A 4CUZA 1DPGA 3CPSA 3KYCB 3C8MA 1U9JA 2R2GA 2O7SA 2ZB3A 2H9IA 3CINA 4OXNA 5DOVA 4AJ2A 3JQFC 3DTTA 3C3XA 3U5TA 4D42A 1F8FA 1V8BA 1IOLA 5AQ1A 1B26A 1IZ0A 1LSOA 3PYLA 1NQAO 1C1DB 5F1PA 4MIOA 5G4LA 1E3WA 3ENNA 2VZ8A 1BTOA 1R0SA 1BDBA 4ZU3A 2X0NA 5JO0A 4J9VA 5TC4A 1HDXA 5H82A 5TT0A 1GPDG 2ZIZA 1XELA 3D0OA 4D0RA 4UEKA 4FB5A 3GGGA 2OOSA 5FFFA 2ZB8A 2I5PO 1UAYA 3GPDG 2W2KB 3JD0A 4J4HA 3JQ7B 3ULKA 4BKOA 4BKPA 4NNJA 3R1IA 3B1JA 1GUYA 2G17A 2B69A 4R68A 4XQGA 3Q9NA 3ROPA 2PD4A 3RI3A 5DNAA 2VHVA 2Q46A 1ZNQO 1NXQA 4RVDA 1YXMA 1QORA 4WLEA 4YEDA 3PI7A 4NJMA 3OA2A 4PLGA 1NPYA 3KXDA 1PL7A 4CR8A 3NJ8A 4OQZA 4BB5A 7ADHA 4S1VA 4I5FA 1TXGA 3KEQA 1YKFA 4FPXA 4WEOA 1H5QA 2GASA 2Y99A 5I8WA 4J1QA 1DSSG 1M6HA 5TF4A 2C5AA 4IZIA 2HRBA 2VTEA 3S1LA 3AUUA 3NRCA 4AJNA 4DYDA 5T8KC 3DBLA 1ZK2A 4IPTA 1NAHA 1ISFA 1ISGA 5JY6A 2FR0A 1UH5A 1I24A 4ND1A 2B5WA 4MKRA 1G1AA 3ZH2A 2Q45A 1Y1PA 4KUGA 3OQ6A 1J6UA 2I9PA 4MP6A 1T2CA 2D4AA 1H93A 1H94A 1EK5A 3UFXA 4CL8A 1GAEO 3O9ZA 2QHXA 4N5LA 4AJOA 3I4CA 4LN1A 4NJMB 1E3EA 2E4AA 1V0JA 4FFLA 3OIDA 4E30A 4DL9A 1LI4A 3PIIA 3EVNA 1GZ6A 3WYBA 5CDSA 3LF2A 3JD2A 3CIFA 4LK3A 3X2EA 1NBOA 2G5CA 4OSPA 2C59A 5B37A 4ZVVA 2DVMA 1GCUA 1LDNA 3DBLB 4YT5A 3GGPA 3F4BA 3QP9A 3HADA 3TJRA 5EQDA 3D4OA 5I7SA 4EUFA 4WPGA 5KIAA 4QFCA 1LSJA 2GD1O 1PS0A 2DFVA 4XIYA 2ILTA 4KP7A 4BNYA 3LQFA 4J1TA 4TRNA 5ES3A 3UKOA 3W6ZA 3DDNA 3Q9UA 3O4RA 4LMRA 4BNVA 1CETA 1A4IA 4HY3A 4KDFA 4BQPA 2F00A 4RGBA 5IN4A 1HYHA 3STHA 2CD9A 3RSHA 6LDHA 1HDYA 4DLBA 1K2WA 3D3WA 1PGPA 3MEQA 4JP2A 4AJ4A 1VSUA 2X5JO 3PWKA 5G0WA 3OJ0A 1ONPA 3IL2A 1P9LA 2PTGA 3U4IA 5H83A 3QWHA 1OAAA 1P3DA 2H63A 5JCJD 4NH4A 4F6CA 4F45A 1O94A 3RJ9A 4CLEA 4YDRA 3L4BA 3JV7A 2QZ9A 2Y1OA 4KTTE 3VZRA 2POQX 2EW8A 2F1KA 2DTXA 4HX5A 3AOEC 3TDKA 4BO4A 5JW6A 4AJHA 1J5PA 1WMAA 3PGXA 3PFWO 1QXSA 3GGOA 4F3YA 4RJTA 4BO5A 1J4AA 1SZJG 5COQA 2OBNA 1K6JA 1BGVA 1H9AA 1VC2A 5THQA 4GWGA 1VJ0A 3AFNA 3WJAA 3D3WB 4TZTA 2VYVD 2D1YA 3OETA 1B3RA 1R4MA 2BMAA 2VCYA 4BVAA 4K6FA 1EMDA 3JYOA 4GGPA 1I5RA 4R3NA 1GDHA 5L95A 2EGHA 1ENYA 4XYMA 4ALIA 1P1IA 1I2ZA 2J3JA 3SX2A 5DCUA 2PZJA 4E5KA 2C0CA 1Q7BA 2XAAA 9LDTA 4WEQA 5C5IA 3K9QO 5GZ6A 2BRUA 1T24A 2J8ZA 1TVEA 2Y1GA 4DMLA 5I9LA 3GC6A 1S7CA 3W8DA 4XDYA 1T1RA 1X7HA 3VVBA 2QW8A 3OICA 2VUSA 4MVJH 4NK5A 2DPHA 5GY7A 4BNNA 1DIAA 3ROKA 1SAYA 4MO2A 3W6UA 2GN8A 2HMWA 3GVCA 1XKQA 3PWZA 2JFFA 2BLLA 1GEEA 4P8RA 4W7HA 4WNIA 4YQYA 3QLJA 1IPFA 1BDMA 1R4MB 1I0ZA 2FY8A 4JQCA 3FBTA 5HRUA 3ETGA 4XD2A 1WPQA 1AUPA 1D1SA 3NTQA 1SOVA 2Y1EA 3D4NA 1IE3A 5TT1A 4OMUA 3VPFA 1HKUA 1YBAA 3W4IA 4E33A 1W73A 4ILKA 5DZSA 4Z9YA 2PKQP 4RL6A 4BO8A 3VPGA 3PDJA 2Z5LA 4NFSA 3WQRA 4LISA 5U4QA 3ZNQA 1EQ2A 3RROA 1LUAA 2WM3A 4KQXA 3DFZA 2NU6A 3HB4X 2DLDA 3JQ9A 3DBRA 1E7QA 1PR9A 4RF5A 2BFPA 5KCZA 4ND3A 2W90A 4CM8B 1SBYA 3NDRA 1FDVA 3NDJA 1HDCA 3B1FA 2V6FA 3OJOA 3UVEA 5BSGA 1Z75A 2J6IA 1OC4A 3ADOA 3FBGA 1HE3A 2CVQA 4BGVA 4PRKA 4CM3A 2Y67A 4U6QA 1U4OA 3IS3A 3LDHA 4O5OA 4AVYA 1KEPA 1Z74A 4BKUA 3ZWCA 4CMCA 4XR4A 3G3EA 4M8SA 4B7XA 2WEKA 4GX5A 4ND5A 1HT0A 5JNLA 1EUDA 2D2IA 1EDZA 3IIEA 1JVBA 4G2NA 2ZTMA 4FSHA 1LDGA 2B83A 3LC2O 5DOZA 3QA9A 4EBFA 4IS2A 4IDGA 4QO7A 3QJ5A 1U2GA 3DBRB 1NVGA 4JXKA 4GQAA 5CDGA 4B3HA 1GR0A 1E1LA 3BTUA 3FR7A 3LF1A 2I65A 1DXYA 5HWSA 2IRWA 3MTJA 3UAGA 4FS3A 3HQ4O 2VYNA 1SB8A 4CMAA 2HK7A 3H3FA 2BFMA 4E12A 1UDCA 1YWGO 3GVPA 1NR1A 2QYSA 4KZPA 3QSGA 4AJEA 3BMNA 4CMKA 3DHNA 4HFJA 4ESOA 1NM5A 3SEFA 8ADHA 3AY6A 3H8VA 2QQ5A 3AM4A 1AN9A 1IYZA 3MJEA 3MOGA 4IDEA 3IMFA 2YW9A 3NV9A 1TI7A 4JBHA 3LZ6A 1A7AA 1ZO8A 5A06A 2YV2A 3ZW8A 4ALMA 1GV0A 3UUWA 2FOIA 1SB9A 1GU7A 2O50A 3KRTA 2ZB4A 4S3MA 1U3VA 4ALNA 3R6DA 4FIZA 4IJWA 4RVSA 1DRUA 3EZYA 3MJCA 5IDYA 3WGOA 3C7AA 4BNLA 3Q3CA 3UN1A 1H0KA 3ZU2A 1JW9B 1GYPA 3BMNB 4I08A 3LVFO 5G0SA 4NBWA 4BO6A 4DMMA 1LDYA 4W9NA 8LDHA 5JDCA 2EIHA 3A14A 3I9LA 3N7UA 2JFHA 1I3KA 5EIOA 4BNXA 3VZQA 1LRLA 4R1UA 1WVGA 4P4GA 1B8PA 4XJSA 1X1EA 1O89A 4U0KA 4DWVA 1U8XX 3I6IA 3GN1A 4IQ8A 3HWRA 4Y9DA 4HNGA 3IC5A 4J0EA 4DXHA 5ENVA 5BSFA 1JA9A 1SEPA 4TROA 3RIHA 4JBGA 1Y5MA 1X0VA 2ZTVA 5A1TA 4BNHA 3F4LA 1HWYA 2Q4BA 4HFRA 3C24A 1BSVA 2WYWA 3GHHA 3RBXA 2VOEA 5DCWA 1ONOA 3I6QA 1N1GA 2RAFA 2ZYAA 4J6FA 3Q6IA 4R69A 3WICA 1EUZA 1LLCA 3JQFA 4Z3KA 2P9EA 1B2LA 3OHSX 3AK4A 1U3WA 3FTNA 2YHIA 1QR6A 5B1YA 4UVHA 2C20A 1QKIA 1NQTA 3GVIA 1P1RA 1UUFA 1ZK0A 4NU5A 3AY7A 4XYEA 1I2CA 3HFGA 4EJ6A 2RIRA 3ZV3A 4H3VA 3IOYA 5L4NA 3SC4A 3UOGA 1YDEA 4FQ8A 4CMIA 2DTEA 4E32A 1ULUA 5A3JA 3KSDO 4TZKA 5MGBA 1QV7A 2I76A 5JO9A 4O1MA 1QV6A 4BIIA 1IPEA 2HMSA 3S2GA 3ONDA 4BS9A 4PZDA 1ZXBA 4GLLA 5THKA 4CM4A 2ZCUA 1IZ9A 2JD0A 2NVWA 2C54A 1AXGA 2DPGA 4AJLA 4J7XA 4J43A 3JYNA 3HDJA 3TOXA 5EL0A 3G1TA 1UAGA 2JAHA 1KS9A 2J5QA 3BMOA 5JYDA 2G0TA 2B36A 1E77A 4MVJG 3RUCA 3QHAA 3KO8A 2YHIB 3A1NA 1X0XA 1M76A 4MVJA 3RAJA 4J4TA 3U4DA 4GH5A 1PZHA 3F1LA 3ITKA 5KVCA 4JBIA 2B5VA 1UXJA 3FRJA 4CMIB 3JQGA 3GPIA 3PLNA 3WTBA 4FFMA 5ILGA 2EKPA 1BXZA 1KVQA 1R0LA 4R4JA 3GY0A 1PX0A 4ND4A 2GF2A 4PLWA 4CM4B 3PP8A 3CXRA 4MP3A 3HNPA 1ZZEA 4C7KA 2G76A 4OOEA 3GEDA 4FFPA 2D8AA 4PCVA 2HU2A 4MPDA 4BOYA 3UCEA 2D59A 2PR2A 3KYBA 2ZKLA 3KLMX 2FHSA 3BMOB 2VRCA 2CSUA 1BWSA 3WFJA 2D0IA 4J7CA 5K9ZA 3P5SA 2AQIA 1DC6A 2B4TO 4PVDA 2P9CA 5I7VA 1LDMA 1U3TA 4NU6A 4BO7A 3U09A 4TRMA 4A03A 4E13A 3HG7A 3JQGB 4YACA 2NU8A 3VH1A 4DLAA 3K73O 1PS8A 1QMGA 3L77A 3RC9A 3H2SA 1M66A 1ZBQA 1DFHA 1U8FO 2Z1NA 4RO0A 3AUSA 3G79A 3ZWYA 3RUFA 2W4QA 3KSUA 4XX0A 1QYVA 5CDTA 4L4SA 4CJXA 4R9SA 5A5EA 3T7EA 4W7IA 5KOIA 2JCYA 3AUAA 4CV1A 5IAAA 1DOHA 2IYPA 5A4DA 4YPOA 3PJDA 1NAIA 4FD3A 3IUPA 1PJ4A 2HAEA 4RVFA 3ZDFA 4WOKA 3DZHA 4PN3A 1VI2A 4ZQEA 1EZ4A 2PZKA 2PH3A 1QYXA 3TL3A 1XEAA 1MC5A 1HE4A 1D8AA 3CZMA 4DBVO 3NTOA 2VQ3A 3WR5A 1Z82A 3RC1A 2AE1A 4NQZA 3LT4A 2GNAA 4PLCA 4BV9A 1Y9EA 2C7VA 1E6UA 1VLLA 2JJYA 1R15A 3BHMA 1RWBA 4LRTB 4AJIA 2JHGA 3OIGA 4IDBA 4BO0A 3ZWNA 4R3WA 3WXBA 3AOEA 4J1SA 1YRLA 3DAPA 4GKVA 1PTJA 3TF5A 2VWPA 4C4OA 2OORA 4IIVA 2BGMA 3DR3A 3FTPA 2PZLA 4J49A 5EMHA 1JKJA 2V6MA 4RDIA 1HSOA 1M6WA 1QLJA 4M49A 4M1QA 4UVIA 4QEDA 1RPNA 4GVLA 1WZEA 4ZGWA 3D64A 3AJRA 5CP8A 4Z0PA 3TN7A 4BNUA 4XB2A 4HFNA 2IXBA 5T5QA 5JFOA 5B12A 1V6AA 2UDPA 3P7MA 1R12A 2HKIA 1OOEA 4TKLA 3EAGA 2RHCA 1UXKA 1AGNA 4YAJA 4CMBA 2UVDA 2JL1A 1XU9A 2EHDA 3WGTA 1KVUA 4D79A 1A72A 3M2PA 1U5CA 5KJEA 1C0IA 5JMWA 5L45A 3ZWPA 5IF3A 4XDZA 1PJTA 3VH3A 3NT5A 4J16A 4UVGA 4TRJA 3C7DB 3GRKA 4YBZA 2NNLD 4R9RA 1C3VA 3ZNOA 3NGXA 5DN9A 4DPKA 2C07A 3I9KA 2HMVA 1LQUA 2EJWA 1F17A 4FJ2A 3AI2A 1NQOA 1YDWA 4R51A 1NTOA 3JD3A 4D41A 3S2IA 3KOUA 4CM5A 1KY5A 1NX6A 1SOWA 1Y6JA 4DPLA 3ABIA 2FSVA 5A3VA 4QUKA 1ZKMA 3CTMA 5JDIC 3BHJA 1PQUA 4GMGA 4B7UA 5A03A 1JKIA 3FPCA 4GSKA 1U7TA 2ZTUA 4AFNA 4B4UA 4CV3A 3OSUA 2NQTA 3C1OA 4DPMA 5JAQA 5G2OA 2VUUA 1KVTA 3UCXA 1L7EA 4U0JA 2CFCA 2HMUA 3NT2A 1IB6A 3DOCA 5F5LA 3H4VA 3R3SA 1CF2O 1WZIA 2WD8A 1I2BA 4DGSA 3KBOA 1XDWA 2V6GA 3L4SO 1EUCA 1QYWA 1QSGA 1GZ3A 3QWFA 1MFPA 3VHRA 2ZQYA 5JS6A 3DZJA 4LVUA 3EYWA 5KVSA 3MJTA 3ON5A 4ZQGA 3RFXA 1R16A 1Z6ZA 2E6UX 5J23A 2GN9A 1CIVA 2IDZA 1H6CA 4FC7A 2OXIA 2DUUA 4UAGA 2VYVA 3I4FA 3K6JA 4RCVA 3RCBA 2JFGA 2AHRA 3DZBA 4ZRNA 3DZFA 4GPD1 4RQTA 2AEFA 1LC3A 3D7LA 4XA8A 5IN5A 3DMTC 2A4KA 2O23A 2C2YA 2Q49A 1SCUA 4Q3AA 2VOJA 2PWZA 5KTKA 3FWZA 1K5HA 2BGKA 1UP4A 2EW2A 3VPSA 3UF0A 1JDJA 2YYYA 3WS7A 5TIIA 1A7KA 1N5DA 3F46A 1C1XA 3MOIA 3OH8A 3UCFA 3WQQA 3ASUA 2NACA 3V2UA 1AXEA 4UEJA 3JQBC 1W4ZA 3CMMA 2PKRA 3HN2A 4AJKA 4HADA 4M54A 3ZWXA 3H9JA 3GLQA 4J3FA 3F47A 2X1HA 4B7CA 3ZI0A 3H9QA 4YB8A 3JQEA 2PH5A 4I8XA 1UP7A 3DAFA 5G4KA 5GMOA 3AFMA 1CEQA 4TQGA 2YQ4A 3I52A 3MZ0A 3NEPX 3I1JA 5AOVA 1YE3A 2YHUA 3GUCA 1X15A 1H2HA 2DBZA 1GQ2A 3HFSA 3VH4A 4NMHA 3L6OO 4BNZA 3OFSA 1DB3A 1C1XB 1I10A 4NHEA 2W2LD 2AEJA 2X9GA 3ANLA 1HDZA 4LW8A 3HE3A 3ONFA 2Y66A 4HKTA 1RYDA 4ZQBA 4D0SA 1WMBA 4JNKA 3IP1A 1X7DA 5CAEA 4HV4A 4YJGB 1YBVA 4BHTA 5JC1A 4I5GA 1ENPA 4ID9A 3GFBA 2CY0A 4UEOA 3TFOA 5HTOA 5G4KB 1JWBB 4IY1A 4QT0A 2VHWA 3CSDA 3HSKA 3SVTA 4DC1A 1DIRA 1QYCA 2X0JA 3IUSA 1U28A 3ZU5A 4OXKA 1KC3A 4PIVA 4HWKA 2O3QA 4FW8A 4F6LA 4DQXA 5C7OO 3WBFA 2RH8A 3E03A 4W99A 3PZBA 3NYWA 1WLYA 4DA9A 3GUYA 3FHLA 4I1IA 4ZICA 1G0OA 4JROA 5HBRA 5KVQA 4OKNA 1NP3A 3GT0A 3ICCA 1NHWA 4Q3BA 4BO1A 1Q1NA 3ZWVA 2C7GA 5CDUA 5CEJA 1S6YA 4PZEA 1V35A 3JTMA 4G65A 4PG8A 2PZMA 1E7MA 3E9QA 5CG2A 4KWHA 4IQ0A 2WMDA 4BNFA 1JVSA 4PLPA 3F1KA 1CDOA 1SEVA 3OEWA 2Q2QA 5F1KA 3PGJA 4JGBA 4L74A 4A7PA 5BT9A 3PXXA 2UYYA 1XCBA 2X9VA 5IXSA 1W8DA 2EWMA 1ISMA 2YFQA 1M75A 3W1VA 1ADFA 1B15A 1ORRA 3PPIA 4A73A 1EBFA 3OJEA 2YQ5A 4EW6A 3COSA 3F5QA 3JD4A 4C7JA 4KWIA 4N7RA 2NQ8A 1HLDA 3KM0A 1HTBA 4L8VA 1DC3A 4TVBA 2HCTA 4Y8VA 3PYMA 5A9TA 3KHUA 1A5ZA 1E1KA 1U4SA 3LC1O 1IL0A 2W8ZA 3B1KA 5K6AC 3ZU3A 1I01A 1P77A 3DC2A 3VPXA 2AW5A 1X7GA 4OM8A 3UGKA 4K9DA 1WWKA 5DF1A 3ST7A 5L4SA 1EDOA 4BV8A 1E5LA 1VL0A 2IE0A 1ZCJA 4YRBA 5AYVA 4GX1A 2JCVA 1X1TA 2EERA 2YV3A 4NBRA 3H5RA 3ANMA 4R54A 2OL4A 2Y0DA 4PRLA 1A9ZA 1I36A 1GL3A 3H9EO 3VAZA 5T67A 4L76A 1ARZA 2CZCA 3CE6A 4IDDA 4CM8A 3ZHYA 4NG5A 3QWBA 4PGFA 4YA6A 3TPCA 3EW7A 4PG4A 1CWUA 5IG2A 2ZCVA 4RPGA 4E31A 4BNGA 1KOLA 1BXKA 3BTOA 2HO5A 3F3SA 2DT5A 2ET6A 2CVZA 4LVCA 3E6AA 2AG8A 4L73A 1LQTA 3GDGA 5F1OA 5CFZA 3R0IA 3O38A 1UXIA 3FNHA 1E6EA 2P2SA 1UZNA 1G6KA 3PHGA 2VTDA 2EKLA 3PRJA 1E7YA 5A5FA 3PWSA 2A94A 3AOGA 4Q39A 5A05A 3OMLA 4YRAA 1D3AA 3GNQA 4M86A 1EQUA 2BFAA 5JLAA 4JP3A 1Y8QA 5CPFA 1I30A 4A26A 4ALLA 2VZ9A 3ZWMA 2PFGA 1VM6A 1PZGA 3ASVA 2UV8A 3PLRA 1RM5A 3RUHA 3WGGA 5BNFA 4MVJP 4I5EA 2R00C 5IFLA 1C0KA 1F8GA 1GZ4A 1XWFA 5G0VA 1DIBA 2O2SA 3FNGA 4R1SA 4RV9A 1MXFA 4WK6A 3WYEA 2JHFA 4X54A 2ZQZA 4KDEA 1R6DA 3OBBA 1T2EA 5JC8A 4E2YA 2IZ1A 1K6IA 4URFA 2LDXA 3GF4A 1YGYA 3TQHA 1DBVO 3G49A 3INGA 1DFIA 4XIJA 5U1PA 1ZJZA 1EVJA 4GWKA 1KYQA 1VRWA 2Q2VA 1Y8QB 3ZWAA 5KWEA 3WGIA 4TRRA 1IHXA 4JCOA 1N8KA 1XLTA 5BSEA 4FOSA 1DAOA 2AMFA 1Y9AA 4ONEA 5B4VA 4CUJA 2LDBA 4RVGA 2Y1CA 4WE3A 3TZQA 4YCAA 3QIVA 2X7HA 1I33A 2GSDA 1GYRA 3BXXA 1DFGA 1KEUA 3P2OA 5TSDA 4RVHA 2GGSA 3VKVA 1PZEA 1GADO 4M55A 3PEFA 4DRYA 1ZW1A 4XYBA 3GRPA 4J90A 1MG0A 2Q1SA 1CERA 3TL2A 3H9UA 2VWQA 2OMEA 4RPHA 3E48A 3RJ5A 2GZ1A 1LLQA 2PD3A 4PLVA 2NVBA 3PQEA 4BNWA 1EE9A 4M89A 1I3MA 3E1KA 4FR5A 3PYXA 3WBBA 3NDIA 4CM1A 4J7UA 4U5QA 3S2EA 1HRDA 3ZHZA 2PGJA 2YDYA 4R1TA 3RKRA 4HFMA 4JIGA 1OI7A 3C1AA 2FP4A 3QVOA 5CPBA 3KSZO 2P91A 4Z6KA 2EP7A 3PVZA 2Y1DA 2UAGA 2QIOA 4IGFA 4CLOA 2QZZA 3BAZA 2X5KO 1L1FA 4YTEA 4GVXA 4J4BA 5A9RA 5IZCC 4YJDA 1D1TA 3LT1A 1T25A 4PLFA 3D5TA 3MJSA 3GNSA 4CQMD 2VRBA 4MJLA 4OL9A 1ZSNA 1SPXA 4PG6A 4TSKA 1PJLA 3DMYA 4H15A 4RORA 2NADA 2Q1TA 1R4NA 4XKJA 3K2EA 5DCYA 4WNCA 2GDZA 4PG5A 4K28A 2X9NA 5AXAA 4DQUA 1P1FA 1JAYA 2UUOA 3GA0A 1U3UA 2NU7A 2H1SA 3GZNA 1NVMB 2HK8A 2HRZA 5DBFA 2PK3A 5TS3A 4D43A 1VE9A 4GGOA 3WLEA 1YJ8A 2YUTA 3ZV5A 5JDIA 4E6PA 3ZCXA 1Y8RA 3E82A 1Z45A 2GZ3A 2PV7A 4E2XA 3V8BA 2PD6A 3KUXA 1X13A 1DJNA 3HDQA 4WOJA 4BKRA 4CLOB 4NPCA 4CM7A 3AI1A 4LRSB 2JCXA 4AJJA 2A9FA 4K1LA 3WNVA 4O59O 1LXCA 5DP2A 3WX0A 4UUNA 1VSVA 3WNQA 3GN2A 4LSWA 5L3ZA 1RYEA 2FSSA 5TGDA 3E9NA 1R4NB 2FR1A 1B7GO 5L7TA 2VNSA 3H2ZA 2V7PA 3ZWBA 1GEGA 5KJCA 2H6EA 3R3JA 3E5MA 1IHYA 1P45A 3V2GA 4GAEA 1DHRA 2HJSA 2I3AA 3ADPA 3GZNB 5HS6A 3WTCA 1JQBA 4W82A 4ZJUA 1P33A 2CF5A 2JD1A 2FPPA 3QE3A 1FMCA 3LK7A 2E37A 2I6TA 2WE7A 3K2BA 4CM6A 2GN4A 1NR7A 4A0SA 3ZWWA 2FR8A 4YAGA 1Y8RB 1SMKA 1YL7A 2BELA 3NAQA 1BVRA 1GQQA 1U2DA 2CMDA 2V6BA 3JQAA 5JSFA 3VVCA 3DOOA 5FI3A 5JMPA 4A10A 2VT3A 2VHXA 4R5HA 2EEZA 3VH2A 1PGNA 3OQ1A 3IJPA 2CF6A 4TWRA 1T2FA 4IM7A 3VTZA 3H9GA 5AXBA 2WJPA 5L4LA 4Y6RA 2ZATA 1B0AA 4YWJA 2BKAA 4NBUA 1K6XA 3QRWA 1BG6A 2P68A 2HJRA 2JD2A 3JQBA 5T8KA 3NUGA 5GZ1A 4WCFC 1NASA 4NK4A 3RUAA 2AG5A 3ROMA 1HYEA 4CUKA 1ZJYA 1NWCA 4OYRA 1O0SA 2VYND 2XPCA 3D4PA 4OKIA 3V1UA 3VDRA 4HBGA 2EGGA 1EK6A 2PGLA 3SJUA 2C5EA 5F3RA 3T7CA 4BGEA 1YH3A 4G5HA 4AJPA 1E7SA 4RVUA 2AEMA 1DLJA 3EHEA 3VTFA 3JQAB 4I9NA 2DC1A 1HZZA 3CUKA 1KC1A 4L4RA 3O26A 1ZK4A 3KETA 3QVSA 4R01A 4B4VA 3WYCA 1UJMA 2PNFA 4YYZA 1LTHR 3RBZA 3Q1LA 4RZHA 1Y7TA 3ONEA 1ZEJA 4XEHA 2X86A 2X0RA 4IXWA 4IBOA 2O48X 1KVSA 4WLUA 5F21A 2CDAA 1BMDA 4ZN6A 2D3TA 5CHEA 3U9LA 3PHIA 4E21A 4UUMA 3DXFA 3TOZA 1MP0A 2NLOA 3D1LA 2YY7A 4ITUA 4EDFA 3QVTA 5KJ6A 4LSMA 1EBUA 1XGKA 2HUNA 3KYDA 4XGIA 2DFDA 1KEWA 2B0JA 1KVRA 1N1EA 4FJ1A 5DBGA 2WDZA 3RC7A 5G0TA 2WD7A 1N92A 2RCYA 3M2TA 2Y68A 3WGZA 3KVOA 2BGLA 4TVOA 1N7GA 3AU9A 3ROQA 3FNEA 3U0BA 3LT0A 1MLDA 2J5KA 4OOFA 4XQ9A 3GVXA 3NKLA 3WSVA 4IDCA 3OA0A 1GY8A 5HA5A 3WIDA 3H3JA 3Q2IA 3LSYA 1ZIDA 3TZKA 4L9RA 3EGOA 2Q4EA 1P1JA 1PJBA 2B4RO 2R6JA 2BD0A 1DRVA 4RLHA 1QLHA 4XZ3A 4Z0HO 4NJOA 2OP1A 4YAEA 1CJCA 1PGQA 3MJ4A 4TKMA 5ER6A 3WMWA 4EI2A 3KYDB 3F6YA 1WDKA 3IKVA 4BNKA 1GUZA 3NTRA 4I9UA 3TZHA 2WWRA 2B35A 3GEGA 1RM0A 2QG4A 1FXSA 2P4QA 2VHZA 2WD7B 3DBHA 2GPTA 1C0LA 4LCJA 1FDTA 5JCXA 1PQPA 2VNAA 2Q1UA 2XF8A 3ZV4A 2NTJA 2JAPA 5KJ1A 2X5OA 4O63O 2YDXA 3X2FA 4UUPA 1O95A 1UDBA 2D5CA 4BO2A 2DQ4A 3O8QA 1ISHA 1FF9A 1LU9A 3AUTA 4BGIA 3IP3A 5K6AA 1GD1O 3PIDA 1AHIA 3TZCA 4EITA 3I9NA 4MIYA 2FZEA 1PSDA 1PGOA 3H6KA 4MOWA 3EMKA 5I9NA 4J2HA 2ZK7A 3ZNPA 3B70A 5IDXA 1MC4A 2Y93A 3OECA 2ZYGA 3Q0EA 4B3IA 3ANNA 1A9YA 1RJWA 3FCOA 4CV0A 4LGVA 3GMSA 1GTMA 4IIUA 2CNBA 3TRIA 1PS9A 1D4FA 3L9XA 3DBHB 3V1TC 4UVEA 4J9UE 5G0UA 5L9AA 1JKFA 3BYZA 4XB1A 3PHHA 3I9JA 2HSDA 2A35A 3ZW9A 4RDHA 4YT4A 1OC2A 3O8QB 1HXHA 4CLRA 3RVDA 4I9HA 1C0PA 3K8ZA 4YT2A 3OEYA 3JQ8A 5JCJA 3DHEA 5FI5A 1MV8A 3P2YA 5T57A 3SBOA 2C82A 2DUWA 4M87A 4PVCA 4XGKA 1OMOA 1CQIA 4Q3NA 2IZZA 2V65A 1E3SA 4KMSA 4FC6A 1UZLA 2OO5A 1P1HA 4EJMA 1PJQA 1ZMTA 1NFRA 2HLPA 2PGDA 2VWGA 1ZK1A 4UULA 5EESA 1H9BA 5BNIA 1P0CA 2O4CA 2C2XA 5COBA 4B4WA 1H6DA 4JX8A 3ZHXA 3KTDA 1OZAA 2IODA 2J3IA 3B20A 3W4KA 1DC4A 4IGEA 2R00A 3HJAA 2P5UA 3B6ZA 1O9BA 4BGUA 4CQLA 4EUEA 3JQDA 3U3XA 1QP8A 3EVTA 3NT4A 2X6TA 4ZQHA 4CLRB 4A27A 1KY4A 4E5MA 3EUWA 1XYGA
chains in the Genus database with same CATH superfamily
4E07A 1G8HA 3JRXA 1CUJA 1L8QA 1ITZA 1VKJA 3D02A 1E4OA 3QNWA 2KM1A 4R1LA 4EY4A 5FPTA 3ICEA 1T3SA 1G2OA 3UPUA 1W6RA 5DWDA 1OH5A 1BN7A 1EPUA 1TB4A 1XTJA 2KSQA 4G24A 3AC0A 4P38A 1DDOA 2PKEA 2DM6A 5F9HA 1YI8A 5CB8A 4CKCB 4GQIA 3H5NA 2J7PD 1G21A 3HZZA 4TYYA 2BMWA 1XNHA 3U44B 4QG3A 5E6SA 3ETDA 5HOEA 3MGAA 4KO3S 5F7XA 5JRDS 3HB1A 3AWDA 4AF6A 1YAJA 2JJ2A 3KZNA 5H8WA 2O05A 3L1IA 1BA3A 3B7PA 3HGQA 1AHHA 3LDAA 5SY9A 2YVKA 1C4OA 1KETA 1QHHB 1R0KA 2QMOA 3NI2A 4D0SA 1E9AA 2IEGA 4R7GA 3FYCA 3PXUA 3SHWA 3W7AA 1PNQA 2FX2A 3UJDA 2AWNA 3VR3D 2OBMA 1HBJA 3NRBA 4H31A 4CQLB 4HUQB 4PLYA 2HPHA 2HRRA 4B80A 1K7SN 1EQAA 4BP3A 4CTJA 2A92A 2Q50A 3LQ2A 3LDGA 1U0BB 1TZ2A 2ZEJA 2HU7A 3HN7A 2O5EA 2N3ZA 2D5LA 2AR0A 1Y63A 2PBLA 2CVPA 2H5LA 2V9ZA 4HYYA 4DCTA 3WMXA 2ZU0C 1A98A 4J0KA 3L82B 5H3CA 4AO6A 4W5TA 1E20A 3DT9A 2NO7A 5AVYA 1FL9A 2QAGC 3BTSA 3OPMA 3SYTA 2PS3A 1C7RA 4QOFA 1K63A 2VYQA 1JHYA 4U6SA 2B7BA 2O52A 3FB1A 5F5NA 2HW8A 4KHPB 5F35A 3VR4A 2OCLA 2PS0A 3AV0B 1Z68A 3NQ41 1IN6A 2QA5A 4MI6A 4IMJB 1OBFO 4Z9XA 3BRWD 5G3YA 4A0RA 2FRDA 1TF2A 3VTAA 1DI0A 5SYMA 1TAHA 4LCEA 2FK8A 3MWEB 3RU2A 2Z5GA 1MA0A 1S9HA 1OFIA 3IEUA 3EGDA 4HO1X 5LLDA 2JRLA 1BMFA 3ZXIA 2Y05A 3ZHCA 3PQDA 4KR3A 5JS1A 1FP2A 4MW6A 5JQGA 4WECA 1XMPA 2AR9A 1NG1A 1LJLA 1MMFB 3GJ7A 1NULA 3GFOA 3H5AA 2DULA 3MTBA 3R9KA 2XD4A 3T9FA 1DZIA 1M54A 2DCMA 3EF0A 3F5SA 4XRRA 2AFVA 1K3TA 3OP1A 3GLIE 1W6UA 1H2RS 2SKDA 3ADKA 3OZUA 2IEBA 5E9QA 4CIYA 2QM0A 2O3UA 3FD8A 3IESA 1N4AA 3LL4A 3L7DA 2VZEA 1YD7A 2OY0A 3B7WA 4HEA6 3L7AA 4FDAA 4D5GA 1ISIA 4HUJA 4W8GA 1V95A 1U8TA 4F3KA 4R81A 4GT1A 1RYMA 1L5RA 2Q3EA 2J9YB 3G2JA 1I0IA 3TLZA 1XMIA 4Z53A 1EVIA 4R16A 4D1YA 1RRFA 3BWXA 3FOAA 4QBHA 2JI4A 2FLKA 4OH7A 1TX4B 3THOA 4KV7A 2OAQ1 2ZUEA 5CA0A 4M0CA 1KHTA 2O20A 1JAXA 1OV6A 1QUFA 2FN8A 1LDEA 3P0FA 2ACVA 4FEGA 4KSYA 4DIBA 4LWOA 4XSHA 1WE2A 1VMAA 3GG9A 4M22A 3ESRA 3FYHA 4IJVA 3RASA 4YCMA 2JIZA 4EAQA 1H2BA 1TCBA 2Q3LA 5REQB 4L2IA 1M0EA 3NVAA 3RKUA 4MR8B 2PMFA 3U62A 3ZBPA 2VKTA 4IOLA 4I1RA 4KDRA 4DFDA 1H4TA 3LQ1A 2BTOA 2NYAA 2I8CA 3DBOB 1OB2A 2XYPA 2H9AA 1OFTA 3A1WA 4DLZA 3FYUA 5AOAA 2O2ZA 3R23A 2PKWA 4DM4A 3K31A 5KU7A 2W2NA 3QKIA 3C5HA 4ANFA 1UC9A 4CODB 4XWYA 1YKSA 4B85A 3SYLA 3FOWA 2EBHX 2FQQA 3CVOA 3SHQA 1UBNA 2HUPA 3E8XA 1I94B 2P5SA 4Y1RA 4OI1A 3EC7A 4B40A 1KP9A 2ZE6A 2DPYA 1A5BB 5FBKA 1H1LA 4U7WA 1LI5A 4NH0A 4Q3EA 1SNYA 2IYOA 3AIMA 4B4KA 1W49A 3TXAA 4E1AA 1Q3KA 4NHOA 4QUGA 2XA2A 1B1AA 3K0AB 2C7PA 4EY8A 1NVWQ 1UFKA 4G81A 5FOQA 1Q91A 3OKPA 2V5VA 2QSYA 4U2FA 5LC1A 1NF2A 3LPLA 4RGYA 4PBTA 1JE1A 2ZI6A 2JW5A 1PV4A 1OBOA 1T8UA 4HNTA 4N5NA 1W9HA 4DEYA 1G3UA 5JARA 2TECE 2VJNA 3K8YA 1AHPA 1P44A 4RFLA 3WJ7A 2XODA 4TX1A 2YWFA 1D4ZA 3H2IA 2RHMA 3DB2A 3IHWA 4ZAWA 1VYHA 2P9HA 2FZKA 4UU1A 2ZRJA 2PX5A 4EPTA 5EEGA 1C7IA 2EQBA 2UYQA 4BL5A 1IEQA 2BP7A 2FSHA 2Z3VA 5JWHA 3W5HA 4MKGA 2PRJA 4N4AA 1M7HA 2Q21A 3L05A 1N77A 4PPYA 2XJ9A 2QQGA 3JYPA 1FUUA 1XQ6A 4JLWA 1SG9A 3L1KA 4WK4B 2CLKB 1O6BA 4WCFA 5IAGA 2Q8NA 4DM7A 2NP7A 1JMKC 1VCMA 4X9XA 3VFDA 1ZUNA 4X61A 1RYHA 4RMJA 1NL3A 3L49A 1UM9B 5K03A 3U4CA 3GP5A 1CUEA 3K92A 3Q3JB 5AW9A 4F1JA 3FJYA 1RI2A 1SOUA 3QW2A 1HY3A 2ZPAA 2FDXA 3ZY6A 4W5RA 5K4HA 5DEOA 3HHPA 4YPFA 1XMOB 3ILYA 4D6PA 3CNQS 1OFUX 3M6XA 4KH1A 4NICA 4OQPA 2O1WA 2ZDGA 2AJTA 4IMPA 1RQ7A 4NPAA 5JS7A 1ZRSA 1NDQA 4GYYA 3GH3A 1TW3A 4QDTA 1FX0B 1XA3A 2MSKA 4IG4A 1IQ0A 1LPNA 4OL0A 4OV6B 4RHCA 5AKEA 5K4AA 3COPA 3ZWKA 4G1EB 4DCOA 3AVUA 1RKUA 1YMQA 2PGOA 4UTRA 3CUYA 2VLIA 3MAAC 4HH3C 3NAZA 1E3JA 3BIJA 3FCUB 3CT6A 3PC3A 1L7MA 2ODQA 3TW8B 5DBIA 4JY7A 1JJAA 1XHLA 4EJSB 2RGNA 4U8GA 2O06A 1CLUA 1NI4A 4ZRMA 2ZE8A 3AJDA 2GZHA 1DCFA 3U61B 1C14A 1JIKA 4JB0A 1GNTA 2Z04A 4F4JA 4D3FA 3KQHA 2G83A 2E48A 3PJFA 3AM3A 3EMDA 1XA0A 1PJ3A 1CHNA 1VLMA 2OHOA 3FKJA 4NZMA 1ENOA 4X1IB 3TR0A 2WYUA 3T1TA 4AN0A 3FUXA 4YMSA 3IJ5A 3WHIA 1JN0A 5H68A 3UV7A 2HHCA 4DUYB 1JR4A 1YVEI 4B3DA 1QU2A 4LKOA 4R7TA 1YUBA 1PWXA 2HL6A 3ELDA 1N7IA 4WKNA 4RESA 4YAKA 3IT2A 5HUHA 4X8MA 4G23A 4QLOA 4DAEA 1TJ4A 1NRXA 3HCEA 4Q47A 2GTIA 1RM3A 4CMJA 4MV6A 1N9GA 3DEZA 1DXHA 4KXFB 4KFRA 1KNQA 4HQFA 5SZIA 1CB0A 1CE8A 3UFBA 4P4LA 2JLVA 1IN5A 2PWPA 3WGKA 1JECA 1ONBA 1G8PA 3RIGA 5FTJA 3EMBA 4A2CA 2GEVA 1DELA 1ZK3A 3EPPA 2JASA 2JFZA 4XYGA 2BH9A 1EVYA 2Y76A 1LC0A 5IRCD 3W3AD 1YJBA 4WIAA 1Z73A 3ESAA 1JUDA 3GUUA 2RK6A 3GQBA 3OQBA 4LRUA 2VHEA 3EUAA 4RANA 3R24A 5DWVA 2R68A 1MG5A 5ICMA 2JKZA 3H1BA 4G8JA 4S2EA 4UOEA 1UMDA 2X9QA 1Z5ZA 2AUNA 4P3XA 3I09A 1OT3A 3K4HA 4RF4A 3MOSA 5C18A 4P08A 2WF9A 3KKEA 4WBXC 4B3BA 1GTL1 1OXMA 4HB3A 2G09A 1K68A 4M0UA 4IP0A 3HU1A 3PKZA 3N58A 3SPXA 2H1WA 2QZ4A 3F7OA 2O5CA 1NVAA 1WHTA 3A0RB 5WRFA 4MXDA 1HNWB 4BDTA 4KL8S 2PAFA 5EKUA 4PTZA 2WJJA 2I99A 3PE3A 4JN6B 1FTWA 1ONNA 1PLKA 1WNTA 1YL6A 2GRAA 3N2YA 4D9KA 4E2ZA 2BC9A 2OILA 1E1MA 2LD4A 1DBWA 1SUEA 3QU7A 1AA6A 1MBZA 4A5OA 3RSLA 3SY8A 4CZ2A 1T5OA 2CDCA 3NH9A 5AKXA 5CA1B 3DFFA 1JPNA 2Z8YA 2QVCA 3ZV6A 4GMFA 2CUNA 1OW3B 3INYA 5DRYA 3PRHA 3SBEA 2X0IA 4JUFA 3R76A 2RHRA 4A6XA 4RTSA 3PTZA 2XWQA 1N34B 3OJLA 1W2GA 4RTPA 2XW6A 2ZJ8A 3KALA 3M4XA 2Q62A 4DLVA 2GO7A 5IAOA 4TMFA 2OYSA 4LC9A 2A9QA 4W6ZA 4E5UA 4ZODA 3B89A 1MAWA 1E7RA 2WIKA 3GRYA 2NUAB 3SEAA 1EFUA 2C9CA 4B5LA 2FPIB 3EWSA 1HYQA 3QUAA 1VLVA 3MD9A 2P9ZA 5FHQA 3J81k 4C0JA 5AK0A 5DULA 4JAVC 3VDQA 4JBXA 3D3NA 1JFTA 1LPOA 3JVDA 4F46A 1CVIA 2VN8A 3B51X 3NORA 2JHCA 1WDLA 1GPAA 2YJGA 3D4BA 5DHFA 2QNIA 2Y0PA 3IKJA 3RS3A 4PZYA 5U9CA 2ZRFA 3B1YA 3K8QA 3PFFA 1NBMD 4TUYA 3UATA 1RW4A 2QRZA 3WK8A 2I4TA 2NWQA 2QLLA 3OQIB 4JI6B 5F76A 5A4FS 1WXGA 2I4NA 1A9PA 1FDSA 4WUVA 5HJEA 2ZE7A 1AB5A 1KH2A 4FDLA 5EXDA 3PGMA 1FU4A 2J32A 2YRFA 3A9UA 3MWDB 1WR8A 5CJ2A 5IULC 5KHOC 5F7JA 2ANCA 3HCNA 2AQHA 3LXXA 2WKPA 4AKTA 1SXPA 2AN9A 2QGNA 4KR0A 5HRCA 5THXA 2AFIB 4AULA 4QFDA 2GF0A 1LLUA 4NDNE 3CX6A 4IJQA 2IYVA 2EC5A 1BHQ1 4D9NA 1O5IA 3WLQA 3LLUA 5JXWA 3OZVA 1J0BA 1W2WB 5T4FA 4MDFA 5JBQA 1HR0B 3ZDAA 3RBVA 2IGBA 1E2IA 5TE9A 1RCTE 2Y0CA 1LSSA 2IQ5A 3LZCA 1Z7EA 2ABWA 2FSUA 3L79A 1MENA 4L0MA 5I9MA 3HYSA 4C4YA 1W2HA 4IV0A 4YCLA 5JV5A 1ES9A 4QTZA 1NUPA 3IDOA 1BA2A 1KBZA 4ZWNA 2OEPA 2B1QA 4QBFA 2TYSB 4DLLA 4RGVA 4C07A 4MDHA 5HSGA 1ADYA 1SUIA 1V47A 2E49A 1GFWA 3EC1A 3GGCA 3PXEA 2XZOA 3DLIA 1JG6A 4MKZA 4INAA 1RADA 1NDHA 1IUKA 1QVWA 2Q41A 3UICA 4ISCA 5D2CA 4KNWA 1DKOA 4CW7A 3R4VA 3I32A 1DC5A 4YUVA 2ID9A 3KIPA 3AJEA 3WQSB 4NSNA 4X62B 4YJHB 2RH4A 1ZP6A 3G5MA 1IAQA 3H87A 3I42A 4HLNA 1DTSA 2HJHA 3X1DA 2OAGA 4Q7JB 3KV3O 1JLLB 4H6WA 4LV6A 3MHPA 3IVMA 4GI2A 1TMYA 1VKOA 5AM5A 5DDIP 1T10A 2XXJA 1T26A 1RWMA 3OT5A 2HIAA 4BFXA 1CUYA 1I1HA 1SK9A 3MCVA 5ALLA 3EVGA 3JZDA 2ZTLA 4C6TB 3CXUA 1AKEA 4G1BA 1XTSA 3G1UA 1T43A 4D4KA 5MFZA 4N82A 4REMA 1LEHA 3B85A 1F0YA 1ESDA 3I1IA 3PDHA 3TQSA 1XNJA 1D0SA 2PCLA 1R37A 4NV3A 4OGLA 5KAMA 3E5HA 4DCMA 1ZGAA 4IXNA 3ZU4A 5JSQA 4TZ6A 3WK5A 3LOQA 5EP2A 3ZQ4A 3C1TA 4YCCA 3DOIA 1NBEA 1X87A 4TKUB 1E98A 3AF4A 1M74A 1USUA 3IPLA 1QPBA 1U2SA 1E2LA 4QBIA 4UTXA 2ZBUA 4W5HA 2DZDA 4RLSA 5KPJA 5KBYA 3H6GA 1KJQA 4EHLA 5G1OA 2B9EA 4CEIA 1BW9A 1IWPB 2QUZA 3CHYA 4ND6A 3DWEX 4ROSA 5EXSA 3A28A 5L7WA 2ZRLA 4HDCA 3ETEA 1WL8A 4WTOA 3N53A 4YI5A 4EHNA 4M6WB 4B87A 2ID4A 2FYTA 4AN4A 2CMFA 1QQ5A 2P2YA 3LCJA 3K1JA 4B6OA 4I50B 4QOIA 4PLZA 5D6NA 3REOA 4B9EA 1UK6A 1DPFA 1VHDA 2UUPA 1ZU5A 4GOND 1RJEA 1Y9DA 4POAA 3ZD9A 4AUMA 3DLBA 1CRQA 2W43A 4XYLA 1IBLB 4NCJA 3O4IA 1US8B 2GT1A 3UWPA 2GBCA 4XIFA 1E1NA 3QPVA 3E5RA 1TD9A 3IDAA 1DC8A 3EFEA 3QK7A 5A3QA 2CV1A 3DEAA 4JEHA 1XTBA 1YR9A 3KT6A 3MRXA 4O4HB 3L41A 4DV4B 1NVFA 4KLAA 1FC0A 4XQCA 1S8FA 3SIXA 1Z6XA 1W36B 4LECA 3COJA 1M8FA 3HVIA 5M3BA 1RHRA 3M1AA 1F2TB 1PAUA 4ND8A 4TKVA 2WICA 4I1UA 3H1TA 4AZ3B 1HYGA 5C7LO 1V9LA 1Z0IA 7AT1A 2VTBA 4UHEA 3AUFA 1N9KA 1Q21A 2BR3A 1PUXA 1T9GS 1TZJA 4AG3A 4M99A 2BZ0A 4II3A 1OWNA 1EM6A 2ODTX 5E7IA 5LMZA 2OGTA 3BN3A 1NX9A 4AUEA 1GQFA 2KLBA 3SSMA 5I4CA 4QWWA 3C3BA 4KBFA 3RVRA 4NEHB 1R7RA 1V45E 1TEHA 2CLSA 4FGSA 4O2LA 1FVFA 1ULSA 4QU9A 1Q0PA 3WYFA 2R751 3UBMA 1O3YA 3IEXA 1X2EA 1YHYA 4NU8X 1Z4KA 4WA8A 3NP7A 2VXBA 2HA3A 4A2QA 3HFRA 4IZHA 4D46A 4KQWA 1A2BA 1HDRA 2ZYVX 1OAOC 1J49A 4G0OA 5TQJA 4TTQA 3UA4A 4D3ZA 1CR6A 4P32A 2C3MA 3M3HA 2HK9A 5JYEA 2ZJ7A 2INGX 1I13A 2G1UA 4X6LA 3V7FA 3AVOA 5EKDA 1XU7A 1ZGZA 3L93A 3DKPA 5KJFA 3TSCA 1UZUA 1X80A 4MVJM 3TSZA 4D45A 2FPKA 2R1ZA 3AU8A 3EXAA 4OI4A 2D2EA 1OXUA 2N9UA 4TPKA 5AVQA 1WHSB 1Z0ZA 2IA5A 4L7QA 4QX6A 4YAIA 3KLPX 4BB0A 3O75A 5HK8A 3BBPA 2YMMA 1Z8FA 2GF9A 3A36A 3A9WA 3EIOA 3HEAA 4GU5A 2ORVA 3GP3A 4ZALA 4JI5B 4RY9A 3VRHA 4WCDA 4HNSA 1SU8A 1CZUA 4GE3A 4CF3A 3A06A 2H54A 4MI9A 3RSZA 1HEUA 3W5SA 2FN7A 3T61A 2QP4A 3EZLA 3NKVA 3Q10A 4MITA 5KAPA 1Z7WA 3ZCRA 1PK9A 2QENA 1C8LA 1N2GA 3K9HA 3BQNB 3OF3A 4WA7A 5EN4A 4EG3A 5C8YF 3ZWDA 2PWAA 1DG1G 5AKZA 2JI8A 4Y67A 4EB8A 1TK3A 1Q14A 3EGXB 2ZB7A 1LW7A 1UXGA 2QL6A 4C30A 3IUEA 5FKJA 4CM9A 2HJGA 1E5DA 2BTQB 3C7CB 1XTUA 3N86A 4KKXB 2AE2A 2N47A 1CNFA 1O4WA 1YZ3A 6YASA 3ZVMA 2FUEA 1FFAA 1R0CA 1XJ0A 2GO1A 1BWRA 3EHDA 2FE4A 4P4SB 4CMEA 1Q0TA 3O91A 4MVJD 1ORHA 5HG0A 1QJCA 3BFKA 3S55A 3NX4A 3H4TA 3KBBA 2PY6A 3VMFA 3WKAA 1WV0A 3B1ZA 1EFVB 3AYZB 3DSRA 2VK8A 1Q1BA 3DGFC 3MJFA 3ZVRA 3G2KA 1PJSA 4GI1A 4EF5A 2SCUA 2R9VA 3GYBA 3I8OA 4C76A 3L6RA 2ZIEA 4TSRA 2HJ9A 5TQ0A 2VHUA 2DJ5A 4IDPA 3RS5A 3P20A 1YZKA 3VR2D 5A2GA 3T3GA 1UWKA 5HZMA 3Q41A 4RZXA 3OX1A 2DSTA 3I9OA 2PLNA 2X4DA 3DQPA 4OBBA 5JBNA 2PUFA 4FKZA 2AF3C 1PT8A 1BGXT 5GIPE 3WL3A 4WKBA 4GPIB 4BO3A 1ID1A 3GA5A 3JQ7A 1MVNA 4FP9A 3G0DA 1QGAA 3WB2A 2WAAA 1GYQA 2HZBA 3T3EA 1P2FA 1R0WA 2XQVA 2NVUB 1P9OA 2LP4Y 5HUQA 1FUEA 3G1WA 4MLPA 4GM0A 1R0YA 1FU8A 3ABSB 3DDOA 4HP8A 1UC4B 2CC2A 4MVXA 4OFXA 4CUZA 5JCPA 1QIKA 3CPSA 4UMDA 1MW9X 2I1QA 4DA4A 1U9JA 2OZLA 3PPVA 2HREA 2B1IA 3EIHA 5EE3A 3DTTA 3O7MA 1NMZA 4X93A 1IOLA 1SKQA 1B26A 1IZ0A 2AXNA 2KW5A 1S01A 1LSOA 1VPVA 3PYLA 5CNJA 1GFZA 4JWTA 5G4LA 1DCTA 4B3GA 3RVNA 3ENNA 2PSSA 3PLAE 2CCJA 4XQ0A 5DFAA 5IMBA 4EBBA 1E8MA 2LBPA 1HL7A 1ZHFA 4B32A 4ZFNA 5TC4A 3R5HA 1EGVB 4V39A 4YRMA 2HDOA 2ZIZA 1PR4A 1YSCA 2D1FA 1E64A 1OE0A 2CNKA 3EBLA 3K0KA 3Q2OA 4KXQA 1Z62A 5F3DA 1ECJA 5FFFA 5BRAA 5L3VA 2ZB8A 2I5PO 1UAYA 3GPDG 3OCYA 4I1OA 2BPOA 5LMUB 4NNJA 2VDJA 3R1IA 3B1JA 4Q82A 5AI6A 2ODBA 1S3SA 4ZZ3A 5UKDA 4EK9A 3LWZA 2WTUA 2DG2A 3CLRD 5AIAA 4BMYA 5EC8A 5DNAA 3C8HA 4PF1A 4JLSA 1ZNQO 3DJFA 1XUOA 4K05A 3TTWA 2RE8A 5TPWB 4KFUA 3KFVA 3BSSA 3ASZA 2QMYA 5AK4A 1AD2A 1P6UA 4S0ZA 1ACJA 4PLGA 1MJGM 3DV0B 3KXDA 3PGVA 2CCKA 4OQZA 4C7XA 7ADHA 3EFOA 4H17A 4CU2A 4I5FA 2R11A 1TXGA 5KDOA 1EGHA 1YKFA 4IWXA 4WEOA 5FWYA 5I8WA 1DSSG 2WZBA 2C5AA 4FHEA 3VX3A 2D7DA 2HRBA 2VTEA 2O54A 3AUUA 3R5SA 3HKCB 4HS9A 5EYPA 4AJNA 4PYOA 2RH9B 3S7ZA 5K3CA 4AW9A 2B25A 1P7WA 3O82A 3HA5A 2V54A 3RFFA 1AZSC 1LVUA 1WEHA 4CWAA 1C7EA 1DTWB 5I5GA 2XKAA 3L46A 4KUGA 4V1CB 5ALVA 3D6UA 3MRTA 3OQ6A 4M9ZA 2IW1A 1IY0A 2BFEA 2PVSA 1XDBA 2PQ0A 2PSHA 4LZPA 4UXJA 4ZVNA 3U39A 2FWBA 3O9ZA 2QNBA 4EX6A 2BGJA 3TQTA 4LN1A 2NXCA 3FWKA 2GXQA 5C31A 1E3EA 1Z0JA 3DMRA 3F4KA 1R8JA 1IQRA 3WKCA 3HJBA 2UXBB 5E3JA 3PIIA 3E23A 1Y4SA 3EG5A 2LXNA 3ESXA 3EVNA 3N70A 4K03A 3WYBA 5CDSA 1BIFA 5DI3B 1EHYA 3PCRB 1ICEA 4P36A 2CXHA 3HACA 2JB9A 1A1SA 2ZI4A 3MTEA 1U3DA 2NZVG 2C77A 3G2PA 4RZQA 5DEIA 5B37A 3VV3A 4B45A 3CVYA 4FMCB 1QUEA 2W6CX 5HF6A 4EYGA 1UPCA 3GI1A 5BW4A 3QP9A 2PPLA 1JSLA 4Q7EA 1OFUA 5ESXA 3TJRA 4PPGA 1HDEA 1W85B 1X92A 3D4OA 2EX4A 4IKEA 1HEIA 4EUFA 2PX6A 5EWMA 1C2YA 4MMZB 1LSJA 1PS0A 1EXMA 4JVOA 2ILTA 1Y82A 3X1ZA 4TS1A 2HRDA 1GAQA 2WA2A 4TRNA 2VNKA 5ES3A 3UKOA 8AT1A 1G5HA 3I2YX 3LC0A 3JARB 2FKAA 2J67A 1CZHA 4LNAA 2GVDC 5EUMA 3X1JA 2NUBA 1ZONA 4HY3A 5HNKA 4IHJB 1GN9A 4GR5A 1B23P 4RGBA 1C8VB 3EZXA 3CWZA 1YJCA 1HYHA 2C95A 5BN5B 2CD9A 2G67A 2HCRA 3UJAA 3B3GA 4JLBA 4ZI5A 1Z25A 4UUQA 1SC4A 5EWJB 5FPYA 3WLTA 1HDYA 4HDSB 5SZKB 3WNDA 4QJ5A 1ESMA 3OD5A 5JS2A 3CKKA 3BL8A 5I9IA 3T0IA 1MRSA 1VSUA 4HH0A 2ZYHA 2I6SA 2ZULA 2A88A 4K1XA 2Y2VA 3BIWA 5G0WA 3AGQA 5FORA 2ZIWB 5K4GA 1CDZA 1ONPA 3PT5A 1CS4C 5H83A 3UT6A 2AV6A 1OAAA 1P3DA 1WD7A 2YIDA 1BC5A 3WP0A 4NH4A 3ZXSA 4E3WA 2Y1KA 1C80A 1NVXQ 3LFTA 4E5SA 3C3AA 2B21A 5GJBA 1E2PA 2Q6IA 4L85A 2E18A 1JG4A 5E0KB 1KF0A 4MCAA 2RG7A 4WADA 3TLBA 2IH5A 3VZRA 2POQX 3A58B 3GARA 1ORIA 3GJYA 3KP1A 2F1KA 4JLKA 1LKZA 4KEAA 3BICA 4PCUA 5FBLB 2QE7A 1J1UA 3GRRA 4TXJA 1V11B 1RLIA 1ZGCA 2PFSA 4BMZA 4AJHA 2FMFA 1J5PA 3EEQA 4KN8A 1WMAA 2JFUA 1C8BA 3HZOA 3PGXA 3TXYA 3GGOA 4RJTA 2W2QA 1LBQA 4R6WA 1R64A 5HDQA 3SN6A 4F3YA 1J4AA 1UFVA 4OQDA 1ORWA 2QKYA 1WPXA 2A9KA 2EJBA 1VC2A 3ANTA 4PZZA 2C3OA 2QLMA 4RSHA 1VJ0A 4N48A 4C6RA 1WSBA 4FUTA 4UUBA 1XXHA 3TI7A 4P5PA 2D1YA 4JT2A 3Q40A 1B3RA 1OROA 2GB4A 3BK1A 1R4MA 3BSWA 3GLTA 1XKXA 4U4AA 2WVHA 1EMDA 3JYOA 3OY7A 4CIDA 4R3NA 1F5NA 2XUJA 1CB7A 1GDHA 1NMEA 1QMPA 2GETA 2EGHA 5TXGA 1S2DA 3RTEA 5L95A 1R8SA 1GTZA 1KGDA 2A9JA 3HPRA 3LH5A 4QTYA 1FJGB 2Q5LA 4GE0A 3SX2A 4YMLA 1UMBA 4NEQA 4BLPA 1IHOA 2YOGA 4E5KA 5JXHA 2ZI3A 2G40A 1YTUA 4C7BA 5GZ6A 3UK1A 2BRUA 1T24A 2YVLA 5T4EA 1GN8A 2QZSA 1RLOA 5EA2A 5DNCA 5I9LA 1S7CA 2VSFA 4WXPA 721PA 1NW6A 4XDYA 3Q1KA 5BSRA 3U7EB 1N57A 4CDMA 2FWNA 4NK5A 2DPHA 4G4IA 4BNNA 3CVVA 1L6RA 1WKVA 2PUVA 1KXZA 4EYSA 3SEQA 2QDXA 2ZSHA 3EXG2 1GEEA 3O2SB 4TTRA 4YQYA 2CB9A 4PAQA 3VHXA 2ZUTA 1D2CA 4EA6A 2JLYA 1RIFA 1RPTA 2FY8A 1HNNA 3EXFB 4GRDA 2Z4RA 2YHSA 1CC1S 5HRUA 1L4UA 3DTVD 4RS4A 3VPBA 3VGPA 4YAFA 4XD2A 3KJQA 1YS1X 4AY6A 1D1SA 3F97A 2B4AA 3NTQA 3QX7A 3SSNA 4MYCA 2A5FA 2YY6A 4TWZA 1SQGA 2V3WA 4F5EA 5BURA 1YBAA 2XMZA 3TBKA 3W4IA 1W73A 3IBGA 4EUNA 2VP4A 4KWCA 1G4AE 4Z9YA 2PKQP 2WWVD 3IVAA 1XP5A 4RL6A 2QZJA 4BO8A 5MF6A 1EK0A 3H17A 4G0NA 4WNAB 2I0FA 5C4IA 4R31A 4CKBB 4IXMA 3LUBA 4KN9S 2R8OA 2CLOB 1TC2A 3Q72A 2FZVA 3MCAA 3RT1A 1A4XA 4QHSA 4YIKA 1WUHS 4ZANA 3WDLA 2DLDA 1P0PA 2BBSA 1HO3A 5MN4A 1H85A 3H13A 4TWAA 2QN9A 3T41A 1GQRA 1Z5VA 3ODGA 2W90A 4ND3A 4DHWA 4F3RA 1Z88A 3SR3A 1SBYA 1TJPB 1YQQA 6REQB 3QI7A 3NDJA 1XDGA 1QH8B 2HLDA 1Z75A 5GV7A 2G8NA 1RZVA 1T2UA 2XTZA 3RVBA 3EW9A 5JAHA 1H4VB 3R44A 3U6KA 5I7AA 3LKZA 4Z4FA 5FH9A 1HE3A 2CVQA 1YB2A 3IGFA 3G2HA 2A2ZA 1D2MA 3IS3A 3ZE9A 3CLVA 4RJJA 1P80A 4AVYA 4GGMX 1VSTA 3OG9A 3AEQB 3ZWCA 1MZPA 2NQ2C 4CMCA 1T1EA 3FHCB 3W4KA 1L5SA 5IJ9B 3K20A 3KAPA 2D2IA 3U9TA 4M36A 2WLSA 4MH0R 2R79A 4BQOA 4IJ6A 4YXWA 3ETNA 1D4AA 3IIEA 2ZTMA 1LI7A 2WBLC 1Y3BE 4XWAA 3FOFC 4GR4A 4G2TA 1DOAA 1G42A 4IDGA 2KS6A 5F9MA 3QJ5A 1U2GA 3T9EA 1QF9A 2JA1A 1KOFA 3NBZC 4B3HA 1GR0A 3KKOA 4QKQA 5EJ8A 1L3BA 4PZUA 1MB9A 3MTJA 4KO4S 4YRLA 5DHQA 3HQ4O 3UAGA 6Q21A 5IX8A 3PR2B 4FR2A 3USZA 4WXHA 4B71A 1WTAA 4BUZA 1YWGO 4QSHA 5KYUA 1XKLA 3LVQE 2CMHA 4LNHA 5C1IA 1C30B 4I4TB 4KZPA 1MNAA 2GBIA 3EGVA 3BOSA 4D9HA 1DBQA 5KNDD 1UZAA 1I6LA 4F91B 2A59A 3CNNA 1F6WA 3CISA 2PT5A 5FT9A 1UINA 1GPWB 5KNBD 1A0OA 3QUCA 4WH0A 3LI2A 3BF8A 4IGKA 4XM0A 2D3WA 5EMMA 2V6JA 4IDEA 1YVUA 3NV9A 3CPHA 4EYKA 1ZA2A 2Z2JA 2WJZB 1ZO8A 5CD9A 3QVKA 4TMXA 2Q0SA 4XWKA 5EE0A 2NZXA 1VDMA 3S99A 2YR0A 1KJZA 1EDDA 1NURA 4LV8B 2FOIA 4PNHA 3QOXA 1K5DA 2ZCJA 3TFWA 3URKA 5I3ZA 4MK4A 3DS8A 1RFLA 4EKGA 1VB3A 5E7JA 2DQZA 1YDHA 4IJWA 3VV2A 4RVSA 1ABBA 2FPLA 3EZYA 3E1SA 3MJCA 1QTIA 4TV9F 5IDYA 1CUGA 1LVHA 4JHXA 2ONJA 3WGOA 4EB6A 2FPSA 2VJYA 3ESQA 5CXSA 1FPQA 1H0KA 1K66A 1N5LA 4FKMA 4QUBA 1XT6A 1GYPA 3LVFO 2QQEA 2A8YA 2X8WA 4BO6A 1LCIA 1TFRA 4NC9A 2GZSA 1T8RA 3RVKA 1DKPA 4GI5A 4KXYA 2F43B 2JFHA 3Q5EA 5JSHA 9ABPA 4R1UA 1ND5A 3GPLA 1O89A 1CBUA 4U0KA 2O8NA 1FS6A 5ALWA 1U8XX 4R2HA 1EUQA 1AS2A 1JQJC 3HWRA 4IQ8A 2YN2A 2DWCA 1U7OA 3I2HA 4D80A 1VG1A 2IVFA 2VRNA 3P2EA 2B94A 3GRUA 3RSSA 4DXHA 3S1SA 2PMEA 3P9YA 4HPJB 1U31A 3PPYA 4FOLA 3AF0A 1FLVA 3BJEA 3BZWA 1ZWLA 5KQRA 2ZTVA 3A1TA 4FHDA 4RK1A 2E4VA 3LHFA 1AK9A 3C24A 4HFRA 1BSVA 3WMFA 3GHHA 1AC5A 1JDZA 1T9CA 2W48A 4TGLA 4OJTA 2YC2C 3GRAA 3UMRA 2QD5A 1ONOA 4RD3A 4UUAA 1T8PA 2XYRA 1HUQA 3QLVC 4H3SA 3KT0A 3Q6IA 4ZJPA 4JL5A 3WICA 1LLCA 1FTGA 1YZUA 1V39A 3JQFA 3O8BA 2P9EA 4AQDA 3OHSX 1ZD8A 4NL4H 3TUJC 421PA 1V5IA 1VP3A 3A6FA 3G7NA 3HK2A 2WPNA 2YJNA 3NNNA 3GVIA 3PFKA 4MSUA 3F9RA 1UUFA 4XYEA 3UGQA 3VR5H 2REQA 3HFGA 2H1IA 2EOAA 3VNSA 3ZV3A 1TM3E 3H6HA 5BT8A 4MV5A 3LUJA 1YDEA 4Q6BA 4CMIA 4E32A 1ULUA 2O9JA 4IH9A 4WXYB 4ZOLA 5A3JA 5MGBA 1QV7A 3E0QA 5JO9A 2GKOA 1RKVA 1N0UA 2PT9A 3L06A 1SCAA 3NUQA 5JVDB 2EBWA 3ZBTA 1M6YA 3FY4A 2P3OA 5HQ3A 1VCIA 2A5GA 1XC7A 2ZCUA 3A10A 1AH2A 3GX1A 1MRZA 3UK0A 4GG1A 1B42A 1AXGA 1USKA 5FI1B 4AJLA 5JLJA 4MRAA 2G77B 1I51A 1MOZA 1P2UA 2WAMA 3DMNA 3IUYA 3LW7A 3E4DA 4TVKA 3UGTA 2HADA 2ZYSA 4I55A 1C9EA 5JYDA 3NNDA 2B36A 1PYOA 4UXIA 3QHAA 3ZZMA 1IBKB 2PJRA 4M38A 3A1NA 3HWSA 3AB8A 1LK5A 1X0XA 1NQVA 3FMVA 3FUCA 2M1XA 5ALSA 5K8JB 3DL7A 4PYKA 3R7FA 2ZIVB 4DSUA 3U4DA 4A3SA 2AIRA 3PUKA 1PZHA 3F1LA 3Q87B 4QTTB 4R1MA 3MMNA 4ZYUA 5CCBA 1UIMA 1UXJA 5CGQB 2YYZA 1NP7A 2LKDA 3FWPA 3GPIA 2WU0A 4R8MA 4ENTA 4PO9A 6CHYA 1F1JA 1TQ4A 4MUJA 4OLJA 5I6DA 4U2EA 4YCBA 2Z5FA 4YP7A 4URXR 3T7RA 1A1VA 4GMDA 2W6QA 4HYTA 4YRGA 1E18A 3BXFA 4ND4A 4GD3Q 2J5BA 4PLWA 2OSVA 3PP8A 2DECA 3AFGA 3QQ5A 3HNPA 1JIJA 1FFGA 1ZZEA 2E21A 2Q8QA 3MUNA 3OOSA 4BLOA 4C7KA 1I3OA 1BOOA 2VQEB 4JZKA 1A5TA 3GEDA 2Z57A 1ZINA 2ZTHA 4PCVA 4BOYA 4Q4AA 1KWKA 3KYBA 3FZGA 1HOTA 1FW8A 1ZNXA 3A3NA 4KZKA 4PONA 3BMOB 4O4JA 5EPEA 3RREA 3GLFA 5CTAA 2VRCA 2CSUA 3WFJA 4ZARA 1CX9B 2D0IA 3G8YA 2GBLA 4DLTA 3G13A 4Q12A 1P5JA 2F64A 1VHWA 1ORTA 5D3MA 4LGCA 5BV2P 1ILWA 2XZLA 1Q84A 1L1RA 4PVDA 2F4NA 5CM9C 4I46A 2IWHA 2FSPA 3JVIA 1SQFA 1KFCB 1J00A 4RY8A 1WD5A 1A2QA 2TS1A 3UMMA 1SVKA 3S2ZA 2UZIR 4E13A 4RHXA 3JQGB 3MWLA 4UZFA 3GIDA 2NU8A 1YFZA 3JSXA 5T3UA 1T6ZA 3KTOA 1K92A 4D6XA 3K0EA 4OJKA 5GGYA 3G2OA 3H2SA 1IB0A 2FETA 3OEED 1RXEA 1U8FO 3VNUA 4HSEA 1W93A 5TVKA 4GP7A 2DLCX 3ET5A 3O1JC 1DO2A 4MWEA 1EX7A 4MGHA 1CU1A 1OI2A 1QANA 1X7XB 3IP6A 4FMDF 1ZH4A 4CJXA 4W7IA 5A6SB 2JS7A 1OYYA 2GJSA 3UC5A 2W83A 5KOIA 3IUJA 3AR4A 1TOAA 1TPYA 1CY1A 1ZJWA 2IYPA 1HOXA 1XN4A 4AP6A 1PDVA 3CC8A 3PJDA 3QEMA 1Y4AE 4XDHA 2BEVB 4WACA 1X9IA 4OQXA 5DHUA 4C88A 1DZ3A 1JIVA 2ATEA 3IHLA 2HAEA 3WRYA 1JA1A 4Z5XA 2VH1A 3I76A 1P73A 4PAGA 4ZQEA 2O5RA 1G9SA 2WYIA 4RL4A 3BERA 2PZ8A 4DBVO 3V4LA 5HKOA 4NYMR 5KCMA 2VQ3A 4KJZA 4NYMQ 2VSNA 9GPBA 1J21A 2MYTA 3LT4A 2GNAA 3QUTA 1XZ8A 2EDCA 2R86A 4NQZA 4PLCA 2C7VA 1F6BA 1G20E 1VLLA 1JNXX 4UD6A 3HVKA 2J9FA 4KGZA 4UU8A 1ATIA 2WJHA 1RWBA 4WKOA 2IIVA 5EJ5A 3I1FA 4XX0B 4R3WA 3K6RA 1CUCA 1UFOA 3HA7A 2YWJA 3RS4A 4A9AA 2XOKA 1SC3A 3ZY5A 4BZQA 4GKVA 4C4OA 4WOCA 3IKLA 2WUVA 4HG2A 2OORA 2PHZA 3F5DA 4I6JA 1UJNA 1L5GB 5LNK1 4D3YA 5FLKA 1TVKB 1NU6A 1Q5PA 2AEEA 2PIAA 4J49A 4AXXA 1WMDA 1ZOSA 2IYEA 2JGJA 2DX7A 4PQRA 3IE2A 1MVLA 3D64A 2X7JA 3HL4A 4JL8A 4X41A 5FBRB 4Z0PA 3EEOA 3MMSA 1ZXXA 2DPXA 3H11A 3SIWA 3SOPA 5B12A 2JEOA 4FFSA 4LJ6A 5KINB 3C3YA 1OSNA 4LJSA 4C7OB 2HKIA 5CBPB 2PE5A 3CX7A 3WLPA 1D1QA 2OTCA 2UVPB 4ETWA 4RIEA 2J59A 2VDNB 1NMSA 2N1BA 1HURA 2RHCA 4YAJA 3ZKAA 1H8EA 3W2EA 3IIIA 1X1AA 3IYLW 5KX5F 1L7OA 1C0IA 5IF3A 4M2LA 1PJTA 3VH3A 5KYXB 4YJ2A 4QHYA 2CVFA 4HDNB 4TMKA 1D9ZA 4NV0A 2FZLA 4C0HA 4TRJA 4YBZA 2NNLD 2P1ZA 5JFGA 1JG1A 1NT2A 1YUMA 4G84A 3ORHA 5KOJA 3OC0A 3NGXA 3IQWA 5DN9A 1GNQA 3DVAB 3FYSA 3ZEAA 1JKJB 4ZHQF 1NG9A 3I9KA 3UQZA 1GAXA 1UDRA 1G63A 3OESA 3FOZA 1P7ZA 2E9SA 1RAEA 4PSCA 3TR6A 1F17A 1U80A 4FJ2A 4Z0NA 3OHPA 1KMMA 1YDWA 3AI2A 4DS3A 4QTXA 1Z2EA 5AJXA 3B5IA 4ZOEA 1KEEB 1O5OA 2ZYIA 1Z17A 3ZUPA 4DPLA