5F1KC

Human cd38 in complex with nanobody mu1053
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
VQLQESGGGLVQAGGSLRLSCTGSGRTFRNYPMAWFRQAPGKEREFVAGITWVGASTLYADFAKGRFTISRDNAKNTVYLQMNSLKPEDTAVYSCAAGRGIVAGRIPAEYADWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 31
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1kC00
2VUOA 4ORGA 3FONA 2EDXA 4Y4HA 1NAMH 4KK6D 3LKSB 4ZFOA 1HH9B 3IXTB 4HCRA 4CN6A 3EYVB 4RNRB 1AIFB 1S7VA 1JIBA 2I24N 4HS8H 3IDXL 3PWUB 4YDJA 3VXSA 3H8NA 3DRQB 1EA9C 5CJBA 4PJ5A 3TT3L 4L3CA 5FYKE 4LLAA 2IPTL 3B8YA 1N7MH 3HE6B 3D85D 5C0GB 1K6QH 5IQ9A 2QEJA 1MFNA 4I2XE 3VXMD 3BH8A 2MQ3A 3BIAX 1X6LA 2AJSH 5FK9B 4JREC 1MVUA 5HVFB 2B2XH 5TE4L 4FQQB 1ADQL 3FQRA 4X7EC 3VRIB 4JR9L 5KOVC 5D4QA 4U1JB 1UB6B 3VXPA 5IHLB 3RZWA 4YHOL 1R3JB 5KZCB 3JXAA 1FQ9C 5DK3A 4M1DL 3VI4F 3BKCH 3VCLA 3OAZH 4OLWH 4OGXL 2XQBL 4UTBL 4LL9A 4OSUH 5DMKA 3D3VA 1DSFL 2VDPL 4XWOC 3PXJA 3KS0J 4RMUA 1A02N 2FRGP 4CMHC 1PDKA 4KKNA 4G8GA 1T89C 3SDAD 5KOMC 4LPCA 3WFBH 1C12B 1O5DT 3IKCA 4FQIH 4JFQB 3F7RA 1RZ8B 4C56B 5KS9B 3FB6B 1MH5A 4GT7A 2BNRD 1D5BA 2DMKA 4UV7L 5GS1C 4JJ5A 4GKZB 3S37L 5CEZH 4WGWB 2HKFH 4CNIA 5EC1B 2P24B 5CEYA 1IAOB 1N8ZB 5GSRA 1H15B 4OUOA 1M71B 4KDVA 2ZCHH 2XKNB 3BO8A 1IM3A 5CLTA 5FO8A 4J3OC 2PR4L 4WO4C 5CSGA 1BD2B 2PNDA 1J0HA 1GIGH 4URTB 2FO1A 1MCQA 5SWQA 1C16A 4Y4HC 4XP5L 5HPOA 3ARUA 4MNQE 4MDIB 4EDWL 1J1PH 2F5AL 4OZGB 1A4KB 2QJDA 1B4JL 4ODHH 2Z31A 1QLRB 2J4WL 2R0ZL 3ARZA 1T1XA 3EKCA 5I1KL 5E6ZA 5I6XC 1GRWA 2NLJB 3BPOC 1OAYH 4YAQB 4RMRA 5ELIA 3IU3A 4MHHI 5EFIA 3KR3H 3LS5L 4R4BA 2OL3L 4JHAH 4K71B 1F6AB 4NM4L 2PYEB 4NT6B 1V5JA 5L6YL 3HRZA 3DX9A 3K8MA 3X13A 5E8PA 3CDYA 3KNBB 5E9DB 1RZJC 2PTUA 5CZVL 1CR9L 3D0VB 3GO1H 4V1DB 3KS0H 2GJJA 3VD9A 2ZSVA 3MGAA 3GSXA 1ADQA 1IGYB 5FUCE 3KLHD 4MLSA 5I1JL 3PDOB 4HZLB 1IQWL 4PRPD 5AYUH 3GMLA 1B88A 4TUKL 2X4OB 3KYKH 3MFGB 1FVDB 5L2KB 2XZAL 3SGEH 2CDEB 1BFSA 3WL9A 2COQA 4LNRB 3BDYL 3PWPD 1ED3A 5C2BL 2ITCB 5C9KA 4KPHH 1ZTXL 2X05A 1IGFH 3C8HA 4JY4B 3KJ4C 3DNKA 3GNML 4KK8D 4S1QL 1JYNA 1MI5E 1KTKE 2AV1A 2A6KB 3TA3A 1A6UH 1A7QH 3FQWA 2GSGB 2VDML 4GFTB 3VWJD 1NGZB 3GMNB 4MXVE 1I8IA 1QFWH 4JKLA 4PJGA 1S7RB 1XAUA 2Z31C 1LO2H 3DBXB 4PBWD 5GGVL 5JHDB 1ZGLM 2HFTA 3NCEB 3KPNB 1TTUA 3RWCA 2J8UF 3O4LE 2Y1VA 3KYOB 1K8DB 3H9YA 4P4RA 4G8FA 4K94C 1G0YR 5HVHC 5IFHL 2JCCF 3QEGH 4D94A 1T80A 4XPHL 4W4OA 5DUBB 1T4KB 4JRYD 1NMBL 1X5FA 3EHBC 5FYJE 1HCVA 1LP9B 1NJ9B 2X40A 3O0RL 1T2QL 5DRXA 5BJTA 1Q9LB 2VLJD 2OR9H 1NBZB 4HLZH 1KFAL 1CYGA 3MRCA 3SKOB 4H8WC 3AFLA 2OM5A 3OV6A 5HHXH 3V0WL 4HBCL 4K3EL 2CRZA 1MHEB 2AK4B 3DSFH 4N5EC 1WUNT 3L7EA 5GS0D 5E8OA 1IEAA 5T3XE 3ARTA 4JN2A 5FYLD 4HJGA 4Q9BA 5FYKU 3RDTA 5ISZB 1MHHB 4X99A 2YMXH 2IADA 4RISH 5CJQL 1XF1A 5AUMA 5ID1B 3MJGX 2HFFB 5ESQA 4K8RD 4UTAL 1AY1H 5JQ6H 2YKLL 3MRMA 5GXBB 1FL3B 4MA3A 2UUDH 2VL4A 2VDNL 4OUUA 2DQDH 1AE6L 5HGAA 4NO3B 2Q8BL 2X42A 4AEIH 3CFIC 4EDXB 5K9QG 3O8XB 4L3ED 4O2CA 1EEZA 1DZBA 3BKJL 2PCPA 5EU6A 4XXDA 4GRWE 2VZTA 5F3BA 1QBMH 1M05B 2EIEA 4R97C 2WIIB 2GK2A 4ISVA 3TFKC 4NKIH 4RSVA 2Z9TA 4UDTA 3EO1B 1FCGA 4DWHA 2F9BT 3AC0A 4ALAL 5DWUH 1IGMH 1T22B 2JCCA 2QADB 3UZVB 3VXOA 5BV7B 1FVCA 4S10A 4UIMA 1I7UB 3ES6B 2YPKA 4F9LC 4XHJD 4U4BA 5HGDA 1ZVSB 2JJWA 4Q97A 5DF0A 5IHUH 4DUXA 3P77A 1BOYA 4W4OC 1B0RB 5CBEA 3QFJE 5D1XA 3X3FH 1LK2A 1TQBB 1NGWB 2H2SC 3IDUA 1OLZA 3SE9H 3ME0A 4RCAA 1DBML 3BQUB 2C3WA 3OXRA 4YXLH 5F88B 1DQDL 4YJZL 1GL4B 2YZ8A 4OCLC 1J88A 2DM7A 4WTZG 3U7YH 5GGRB 2ICEA 3CCHB 5D9SA 1INQB 4XRCA 1WFTA 4XNXH 4NQDE 3CNKA 3CSBA 3KPSA 5GIRA 1HILA 2RFXB 3SDDA 2BOBB 2AVGA 4U0QB 4MJIA 3MXVL 2C26A 5JXAH 5IEHB 3PG2A 5K9OB 4Z78A 1OGAE 1EJOL 1M7IB 1ZS8A 3C60D 1LEGA 3WNKA 4G8EA 5D7JA 5DMGC 3KPMB 4JO4L 1A14H 1JUFB 1IL1A 4NDMB 5CJXC 1GYAA 3EYUH 1U8HA 1I9IH 2I07B 2YXMA 5L9DL 5GGVY 3CFKA 4O02L 3FB5A 4PJBE 1QO3A 1JGDB 4ZXBB 3QIBC 1MAML 4HG4K 5JUEL 4HWNA 1RJYB 1CGXA 2JELH 3VD5A 3U6RA 3EO0B 5JOFA 3UC0L 4BH7A 2HG5A 3CFCL 4WJ5A 3QULB 4G6MH 1KCSL 3NCJL 4Q9RL 3L7FA 4WEMB 4K9EC 3UJJL 1YUHB 15C8L 2MQCA 4DN3L 4O5LH 1K4DB 2XQYG 5FYKL 2BVOA 4HWEH 3I9GH 4HXBL 3JV6A 5DJCA 1FGVL 1QLFA 3PGCA 4DQOL 4RAUA 3WN5B 3MXWL 3V6FA 3VFTB 1JRHL 2H32H 4M93B 1OSZB 4HC1L 5D1XC 4JHWH 3MRNB 1RIVH 1J10A 1UXSB 3PIQB 4WU7A 4JG1L 4XAKD 2XZCL 1PY4A 3OGOE 2P5WE 1A5FL 5CGTA 5KJRL 3RWFB 1KIQA 3QUXD 3LEXA 2E6QA 2WUBH 4DGYL 4OZIA 2VLKB 2V2WB 5IB5A 3L3OA 3QDJD 5EOCJ 4N9OB 5D7IE 2HLFD 3GGWB 3QRFM 2GT9B 4P4KD 2IFFL 3HI5H 4L4TE 5DMJB 5ICZA 2BVPA 2JE8A 1KJ2H 3NAAH 1DL7H 4PJ7E 4XBGB 3IJHA 5EG6C 3F6IA 2FEDD 3BN3B 2XY1A 3WFCL 1NC4D 3BJ91 5HGHB 3RL2B 1EZVX 1AJ7L 4NHUA 1FIGL 3I6LE 3W39B 4C4KT 3CMGA 1G7HB 2VDOL 2P5EB 5C07D 4YFLI 3NPSB 4ZD3L 1G7MB 2AEIT 4LP5A 1WC7A 4J7RA 3DXAD 2P8LB 3TA3D 4X5LA 2VMFA 1MJJB 1RZKC 3EZJB 4DK3A 3G5VA 5EC2A 3L5IA 4G5ZH 4P57A 1KT2B 1MQKL 2LE9A 4OKVA 4XGZB 3DI2B 2BOCB 1CGYA 3PABB 3G6AA 1R0AH 5FDWB 3GIZH 3OB0K 5SV4A 5F7EH 5DVKA 1NC2D 3PL6A 4O2EA 3RGVD 4NM8L 1CLOH 4JO2H 5DQ9B 2C1PA 5FFLA 1B6DA 4ZOBA 1G7PB 1R3LB 3MLRL 1MIEH 3MREA 4PRAA 5JMRA 5C1MB 2YEZB 1F13A 4DTGL 5E1AA 4UV4L 2VZUA 2KZWA 1IBGH 3JWNC 4GO6B 4DVBB 3GUTB 2EO9A 2BNUB 1ZEAH 3C5JA 4TTGA 1FNGB 4Y5VC 5IVXF 4HC1A 4WUUA 5EOCH 1D5MB 1I7TB 3HG1A 1EO8H 3JTSB 2ARJA 3THMH 3VXRB 3P0YL 4L1DA 3MLPA 3B5HA 2VWEE 4NWUH 4N90E 4RGND 1IAIH 5I8OH 4ZPTA 1DEEB 4WVRA 3O9WD 3RZCA 3RVUD 3RDTD 5HSFA 4L8SA 3QUKB 4AH2A 4ELMB 4JPKL 2VXTL 2GCYA 2GITB 1CXHA 2BNQB 4QRUB 5KG9A 2IH3B 2DQIL 1Y6NR 2OQJA 3ARFA 1D6VL 3DX8B 1HHHB 4WI5A 4I3GA 4S2SB 4XC3L 1T0MA 1J8HA 1DUYB 5EU6D 1N3NA 1U0QA 1L0XA 5DI8B 2D0HA 1FO0B 4X4ME 3TO4A 5BRZE 4MJ5B 3LQAC 3A6CL 3AU1A 2EE2A 4IJ3B 2CDFA 3KAAA 3V6BR 4D8PA 4B53A 3QUML 4MNQA 5IOPA 5JTWA 1J11A 4PJ9B 3QDGA 4MJ2A 3DMMC 3WCYA 3BP5A 3FJTA 3BX7C 3M8OH 3PL6C 5DO2C 4Q74A 4C56E 1A1OA 4JLRA 5CZKA 5ABDE 2YBRA 2CJUL 2ENYA 3UTTE 1A7OH 1ZHKB 4X6FB 5ESVB 5IVXA 2VNCA 5F8RC 1VFOA 1Q9KA 1RIUL 2F54B 4Y16B 4MXVF 1NDMA 5KW9H 3F7VA 1Q1JL 5D7SH 4RX4D 1CE6B 4UDUB 3GK8L 2XV6B 3CXHK 2Y4SA 4R2GD 2AJYL 1BVZA 1BD2E 1PGRB 5IK3A 2OMNA 5JW5A 5IMLB 1AXTL 4K7PH 1SEBA 5DHVH 4NIKB 4OZGE 5F9OH 5T3XL 1KN2L 3C09C 3SDDD 4MD0B 3IXAB 2PN5A 4KDWA 1VEPA 5DHXB 4L8SC 4M03A 1U58B 4GW1B 1VFAA 2Q3AA 3CLFL 3X12B 3K7UA 3RP1A 2QKIB 2F5BH 4OLZH 1A64A 4XWGL 3V2AR 4U3HA 1V7NL 5D7JD 4LF3B 3V5KA 3SDYL 4JFPB 1PZUB 1JV5B 2ED7A 1FH5H 3SGEI 1A0QL 4LU5L 2PYEE 4Q2ZB 1T6VN 4XZUB 4OCYH 4GKOA 2DM3A 3DSNA 1JPFA 4U6VH 3GSUB 5B21A 5E9DE 2R2EA 3MA9L 5I73B 4JY6B 4V1DE 3IRPX 5F6HJ 5D7LA 4NC0B 3RNKB 3VFVA 3EOAA 4JDTH 4Y5XB 1E0OB 1GZPA 3NZ8B 1KCUL 3NCYS 4NZRL 2YD6A 1JHLL 3HAEA 1XF2A 5IV2B 3VFRA 4C54A 1OY3B 1QFWI 3MOBH 5KVDL 3RWEA 3QCUL 5MHSD 1U8JB 4UB0H 1N0XH 3SJVB 2YUXA 5D5MB 5EUOB 5GJSL 1FFOB 4GRWF 4LFHG 4GRLB 5EO9B 4ONHA 3LKQB 3ZZ1A 5B38G 1TMCB 1JPGB 3AXLA 3KWWA 1Y18A 3CK0H 1D9KD 3E0GA 4FQLL 5BS0A 4TTDD 5LQBL 5L0QB 4DUWA 4A2LA 5DYOA 4HWUA 3QEUB 4UIKH 4M5ZH 3SGKA 5GRYA 2FIKB 3BRGC 1HHGB 3TJHC 3L5XH 1H3GA 5EZJA 1JPTL 1YNTA 2WNGA 3MX0A 2FHFA 3OXSB 1QBLH 2CKBH 4Y19B 1L7TL 5EZLB 5EU7E 1ITBB 4PRHD 4QRRD 3BP7B 1U93A 5JHLH 5DZOA 3SEPA 5MP6L 4MHHG 1FBIL 2Z93B 3QO0A 4M3JA 4PIRF 5FGRA 2ORBL 3WBDA 4XPFH 2AI0L 5T5NG 5IVOA 3B9KA 4OIAA 2FGWL 3Q6FB 1YN7B 1TZGH 2ADGB 2BSSB 4NKDB 1LP9E 5F9JB 2CK0L 1S5HB 4DKDC 3QI9D 4ZAKA 4ZFZA 5C7XH 2YK1L 3MRBA 2YSSB 5C0AA 3B9DA 3QIUB 3P4LA 2AK4E 1LK3H 3OKLA 5JOPE 3BAEH 5DD3L 5MI0B 2D03L 5ISZE 2NY6D 5EO1A 2EDDA 4MB5A 1TVBB 2R0LL 3SGDI 2WINA 5B22A 3N1GC 1I4FB 1UA6L 5HHPA 1FJ1A 2EXWC 3N1FC 2E6JA 2E7MA 1EGJH 1S5IH 2NY3C 1CN4A 2UZXB 4PJBF 5F1IB 3BD5A 3O6FA 4U3XA 1QLEH 4UILL 5FCUH 3ARBA 4JJHA 3T65B 4PB0H 4HWZB 4F8QA 1NKOA 1HYSD 4ZQKB 5FYKD 3V5HA 3S96A 4QWWD 4NO5B 2J5LB 3L3JA 4LIQH 4N8CL 4APQA 4M7LL 2PO6A 5AZEL 3QFJA 1HE7A 2OI9B 3K4AA 4B41A 3C6SB 1FL6A 3FOLA 1OP5K 2BDNH 3KLAA 1D6EA 3MR9A 3U1SL 2NY4C 1OTSD 2F8OA 4F7CB 4JM2F 3RZCD 2BZDA 3RAJL 1WQVT 1Q0YH 1I3VA 4BSJA 5BVJA 1MHCB 4KVNL 3IKKA 4MAYC 1BIHA 3WHXB 3PHSA 2VXQL 4XCCL 3B9KC 2W9LA 5ICXB 5F71A 4U31A 5EIQA 1BEYL 1EAJA 4TNWF 1NANI 2ZG1A 3C5ZA 2CXGA 2X7LA 2Z4QA 3ARFD 4JKMA 1KB9K 4ZUWB 2RQ8A 3E8UH 5DLMH 1OAKL 4ZAKC 1T7ZA 5D7IF 2A0LC 3DRTB 4J1UB 2P8PB 4I5BA 3D0LA 2VKXA 3O41A 1X5KA 1UVQA 2D4DA 1F3JB 2GJZB 3H3KA 1JGUH 2C5DC 4LSSL 4H20L 3TO4D 1GGUA 3WUWB 3MRDB 2HJLB 4QHMA 5E5MB 3PP4L 1G6RB 2EICA 4G7YH 1KLFA 4GG8A 3U79A 1S78C 5E5UB 1PSKH 4WW2B 4MNQD 3I50L 5H37G 1O7VA 1MCRA 3GRWL 5J12C 5HHOA 4OFDA 4FRWA 2E9IA 1WCBA 1PW3A 1JGVH 4KY1L 1TPXC 3TBTA 4NO0B 2MMXA 3QUZA 4ODUB 4CKVX 2HWZH 3MRLA 4H88L 2VIRB 4UT9H 3LKOA 4YK4C 3ZL4L 1U8OB 4APQC 3GB7A 5E2UH 3VXNB 2WK2A 4WV1A 1JZ5A 3WUWG 1M7DA 1DE4B 4PP1D 1XF5B 3ZKXB 2XA8H 5FKPA 2V6HA 3OPZL 1RJZA 5GZOC 1RK0B 1SBSL 1MSPA 2WQ8A 1KELH 1AD0A 1MRDL 2Q86A 3RUGB 3UTZA 1OAZH 5F44A 4L29B 5J13C 4X5XA 3U0TB 4JAMA 1S7UB 2EYTA 2EYSB 3O2DH 4QRQA 4HPYH 4CMMB 5LXGH 5D7IA 4CU7A 1YNKH 2FSEB 1ZLSL 3MA7A 4UBDC 4NHCH 3D2UA 3O6MH 1KTDA 4HUUB 1DBAL 2XZQL 3A67H 2WWMD 3EJJX 4P9HL 5AYQA 1DBJH 2JTDA 1XF4A 1CGUA 1UB5B 3M45A 3QB7C 4OLXL 4K23L 1MCLA 3CFDB 2R2BB 4L4VB 4M7KL 1YNLH 5LAXA 5CINL 2N7BA 3L3GB 4NQCB 5C0EA 3TM6A 4DAGL 2VLKE 4GW5A 2ZUWA 3MRPA 4OZFG 1MI5D 1UZ8A 4E5XA 4HWBL 2BHUA 25C8L 3P30L 4TUJB 4XH2A 2R56L 4HJ0C 2C4FU 4JQVA 1EHAA 4PYGA 4CAGA 2EO1A 1XZ0A 5T1MA 2A9NH 4YHML 2MCPH 1QOKA 3I75A 3Q1SH 2NXYB 2D7NA 4HPOL 1FNFA 1Y6MR 4J3XA 3BP6A 3K2UH 2YZ1A 1RZIA 1AQKH 3AS2A 3QUZC 1BQLH 3D87B 3MUHL 3O4LD 4U1KA 1VFBA 2P5EE 1NAMA 4PRIA 1ZLVK 1I1YA 1UYWH 3V4PL 2H2PD 5GGTL 4EIGB 1F00I 4WV1C 3NPZB 5FF6A 4XCYB 1DLFH 1PKQA 1MLCB 1JZ6A 5JR1H 4RRPA 4IRSA 1EAPA 2VH5L 4N0RA 4PG9A 1OAQL 4JRXA 4KH2A 4YUEL 3WXVH 4N0YH 4HIXH 3MZGB 1HH9A 3IXTA 3L5JA 4RNRA 4U1LA 1EXUA 5T3XD 35C8L 4MD4A 3DRQA 1X9QA 3GHEH 3VXQA 4H1LH 3TH3T 3HZMB 5LJYH 2B5IC 3TIEB 4OZGF 3HE6A 1CBVL 5C0GA 5FUOH 5ERWA 1TJIL 3W0WB 1H0DA 1EJ6A 5FK9A 1N59B 3L9RB 4N0CD 4LCUB 4U1GC 2DBLH 4PY8J 3IDNA 2ESVA 3NFPA 3PE9A 3VRIA 4KZEL 3K2MC 1HZHL 4QEGA 4QRSB 3GI8L 1QNZL 1REIA 2YN3A 4OJFH 2DJSA 1R3JA 3KGRA 4ELME 5T1LB 4X4MA 4JQVC 4WTXA 1FN4B 3GSWA 2BNQE 4X6EA 2WP3T 4A2MA 4JQIH 1INEL 3O6FD 3PHOB 4L8CB 4XP9H 1N2RB 3TO2B 5IB3A 3ARBD 3KJ6L 3MOAL 1C12A 1CZ8H 5A16B 1KEMH 3SN6N 4JFQA 4PGEB 4HUXB 2JIXD 1S3KH 4C56A 5KS9A 5F1NA 2AGJH 3VWKD 1C5DB 2PO6D 3QFJD 3TVMC 3TN0A 5KAQG 5INCA 2VITB 4I77L 5EC1A 1T1WB 4FXGB 1H15A 4NWTL 1M71A 4IRSC 1LHZA 2V2XA 1PX4A 1QA9B 1X5LA 1HWGB 4HKZB 1QSEA 4M1GH 5GGTA 4FP8L 2ED9A 4O4YH 5CIPB 3WHE0 2ITDA 4NQDD 4NJAL 5EZOL 1JPSL 2NNAA 3WS6C 3VW3H 2C3VB 4OZGA 2FO4B 1A4KA 3QP3A 2G60L 4FA8A 4XNUL 4LPTA 1CGSH 4JQXC 1QPPA 2JB6B 3QIWC 4D0CB 1QLRA 4IM8A 2XNAB 4YC2B 2HMID 5IW1A 2EEBA 4GKSB 1OGAD 2HLAB 3C5ZD 2F54E 4KTEL 2R9HD 2EEDA 2NLJA 3LEYH 4G9FB 5MERB 4YAQA 4QOKB 3BPNB 3UJTH 3U4BL 2BJMH 3TP4A 2PYEA 4NT6A 1MHPL 5CILL 5BXFB 3MBED 2A6JB 2CMRH 5E2VH 2Q87A 5E9DA 3RX7A 3T0WA 3D0VA 1HOCB 2APFA 3QHFH 3FFCB 4OKDA 1A7PL 1LP9F 1RUKL 4OLVL 1JZ2A 1J87A 3WD5L 2NZIA 4HKBB 5TE6H 3FB8B 5BW7C 5I1CH 3VG0H 3ZHDA 1BPVA 2X4OA 1S8DB 5L2KA 2FECL 4E41B 2CDEA 1CQYA 2LFGA 4LARL 4I0PB 3DUHA 4Z7OE 5K59E 3QNXA 2E5EA 1MCWW 2NX5E 2ITCA 3MV9A 5E56A 5M94B 4M43H 1E27B 4H26B 3TN0C 3OAZK 4ZFGL 4JM2D 2E7LA 4JY4A 4X6CA 1M6OA 3C8KB 2OTUB 1OTTC 2KUTA 4LAQH 2P5WD 2FHCA 2VLME 3ALWA 4TULL 1RAMA 3ARGB 3SQOH 2YD8A 2HFGH 1OL0A 4U1HB 3UJIH 5BV7L 3S5LA 1MJ7L 5IQ7H 4HMDA 2GSGA 5GRVL 1S9KC 1NGZA 3GMNA 3SJVE 1S7RA 2J8OA 1I9JH 1A6WL 2HJFB 6FABH 3ZTJH 4H0HB 5JZ7D 5JHDA 2A9ML 3GSNB 1D5XB 3T1FA 4YGVB 3KPNA 5GHWL 2IAMB 4L4TD 3IU4H 5IF0B 4EN3A 4ETYA 4ERSL 4HJJH 3HKFA 3KYOA 1WBXB 4IDJH 2AEQH 4LDEB 2LTQC 3MLTB 1I8MB 4A6YB 3HZVB 1XGPB 5F6HI 1KPVB 3P11L 4L1HA 1QFHA 1T4KA 5DUBA 4P3CH 1LP9A 2AP2A 5D6DA 2HH0H 1OCWL 5E8EB 4HUNB 1Q9LA 2VR5A 3QEQE 1NBZA 4Y19E 3VXTA 3X11A 5DHYA 3SKOA 2EKSB 2FH6A 4J3TA 4QRTB 4Y89A 1E4XI 3TBWB 3MV8B 1B0WA 4XMPH 5I15H 4GS7B 1AHWB 2VUYA 4QKXB 5ISZA 4GBXB 1MHHA 4WEBH 3VDAA 4RGMB 1OQXA 5ID1A 1DQTA 4JB9L 4P99A 1TZHB 3UO1L 4UUJB 4UNVA 3E6FB 1UGNA 1J0KA 3H0TB 3F58L 1OARH 1J12A 3VGAB 1NFDB 4PRID 1JNNL 1U3HC 1ZWIA 3KDMA 4NO3A 1YMHB 2ZWLT 2E7LC 1FFNB 4EDXA 1S9YA 3JWOH 7FABH 3CVIL 1YEDA 4ODTH 4FQCH 2GY5A 1XGTA 3ULVH 1KCRL 5I1IH 1QHOA 3VH8A 3BPCB 4XX1E 2D7MA 1K9TA 5TDPB 1NBVL 1D7FA 2WIIA 3JVGA 3B2VH 5I76A 4YR6B 1R3HB 3I6GB 5D70L 4E42B 3QNZA 4NC2B 4N90D 5FB8A 3G6JB 4KUCF 4OF7A 5E5RB 1BOGB 3T0BA 1CDBA 3NA4A 5HD8C 4EN3C 4RBPK 5BQ7A 1OD7A 4PP2B 1JHTB 3ES6A 2Y5TA 1U8IB 5CKGA 1ZVSA 3TBVB 5C6TL 1B3JA 3HE6D 4HUWB 2A77L 1B0RA 1GH7A 4HFUH 5DK0A 5BMFL 3VMOA 2APVA 2D3VA 4IOFD 1NEZB 1NGWA 2BVQB 4KKAD 5D6DC 1U95A 1T5WA 1N6QH 4LP4A 2VZVA 1Q0XH 5F88A 2X4PB 3U2SB 1GOGA 5GGRA 3CCHA 4L9LB 3BD4A 4POZC 3F7YB 1Q94B 2VZSA 5KZCD 1OVZA 2W9EL 5D1QA 5D2NB 2HTLD 2RFXA 5BRZD 2IEPA 4HDIA 4UQ2A 2B1HH 3OTTA 1JF1A 1T1ZB 5BVPH 3OX8B 1XGUB 5D93B 3FZUC 5LBSH 1RVFL 1FPTH 5T3ZE 3WKNA 5ILTL 5GISH 3ARPA 1NEZG 1CXLA 4G6JH 3PGFH 1JUFA 2CIKB 4C56D 4OM1H 1AGBA 2DWEB 2Y07L 4LGRB 4M7JL 3MLVH 3OZ9H 3AMLA 5TF0A 3ZYIA 1GPOH 2NMSA 4TSCH 3V7MA 2BVUA 4FTVA 4O2FA 2X1OA 5DD0L 3RI5F 2F19L 4LDLB 2XYCA 4WHYH 2ICES 4LSUH 4BK4A 1VPOH 4EXPX 4ZXBA 4JDZA 4V2CB 5DJAB 1BD2D 2XPGB 1IGCL 3RWHA 1KXQE 2ZCLL 3MFFB 3BUYB 2H32A 3EO0A 5JW4M 2ED8A 3WFEH 5FM5O 2UUDK 1G9NH 4Z0BL 1BWWA 3BESR 3L6FB 2IGFL 4KJQC 4L3AA 2AJZA 4KHXL 1YUHA 5HYJE 5DD1H 5KSAA 1RJLA 4NYLA 3ULUE 1FZJA 1K4DA 3KPRA 5IGXL 2MKLC 4XVSH 4ZPVB 3CJJA 4ODSH 1HDMB 5J89A 3WN5A 3VFTA 2DKMA 2XG4A 1INDL 1NLBH 3NIGE 4TPRH 1UXSA 2ZUQB 2PYED 4TQEH 4GUPB 4KMTL 4OLUH 2B39A 1KYOJ 2WBJB 2R29H 5I0ZA 4PJIB 1DEDA 3KHQA 4X5WB 5KTEH 4JFDB 4S1SH 4KROC 1OAXL 3RWFA 5E9DD 2BXYA 3RUGE 4DCQB 5C0BA 4G80B 4AIOA 4DGIL 3OSKA 2ADIB 2AK1H 4V1DD 1EH9A 5D1QC 5DVLA 3PGDA 2VLKA 4QT5B 3VFOB 2B8OT 4KK9C 4TSBH 1BZ9B 1KJMB 1YN6A 2O5ZL 4NNYB 3AM8A 4WRLA 4CBPA 3TCXA 5LCVH 3GGWA 4HK3N 3QAZB 5ITBH 5L2KD 2NY0C 5B4MC 2K7QA 1CG9B 1IQDA 5FCSH 3ZKQD 2DIJA 2V7HB 4FFZL 3UPCA 4XBGA 5T1KB 4F33B 2AQ2A 4L4VE 4MAUH 2Y6SC 1F58H 3OHXB 2GIYA 1P4LB 1QVOB 4ELMF 4EI5C 1SEQL 3D85B 1BAFL 1FO0L 3VXMB 1R5WB 1G7HA 4NQCE 5CGYD 2W0FA 4GXVH 4AQOA 2P5EA 1QRKA 1MFEL 1WFOA 4YDLC 4IS6B 5TFSH 4Z7UB 3LMJL 2B4CH 5IVNA 2P8LA 1C1EL 3BDXA 3RVXC 5CWSB 1XMWA 1KT2A 1MFAH 3SDCD 5KSAC 2EDRA 1K2DB 4KVCL 2DDQL 4ZUSA 4XGZA 2EE3A 4F80A 4OBRA 2WIMA 3PABA 3MLXH 5FDWA 1S9XB 2A38A 3WE6B 5D7KE 3V9FA 1R3LA 3DGGB 3U7AA 5F70A 3OG4B 2YEZA 1T2XA 5C2UB 3R06B 3WLBA 4OLYH 4DVBA 3GUTA 1O7SA 2NY5H 5F3HB 3ABZA 4YWGL 2VKWA 4YIQB 3B9VA 1I7TA 3JTSA 1JCKA 3VXRA 1MWAH 4F2MB 2B7DT 1JFQL 4UT7L 3SE4C 2AK4D 2HRLA 2WLYA 1F3DH 5JOPD 4XCFL 3RWDB 3HMXH 4UOW0 3RNQA 3AM8C 1DEEA 3C5SB 3MYJB 5ISZD 4D3CL 3ECBB 3ZTNH 5C0DB 1UCTA 4LSVL 2BNQA 1I3UA 5I8EB 1BJ1J 3P4MB 4QRUA 3FO9B 1LO5A 5DC4B 3N85H 3GMRB 2IH3A 4IIQA 3RWIA 3W0WE 1X5ZA 5GS2D 2BRQA 3INUL 1SYVB 4FN0A 2GKIA 4JN1L 4NCC2 2BY3A 5TF1H 1FCCA 3DX8A 2OX5A 1HHHA 1BM3H 3O8XD 4OFVA 3HN3A 1EO5A 4DW2L 2X1XR 4N1CA 1DUYA 4ENEC 3WDJA 5JO5B 2ZCKL 1ZGLP 4U3CA 4C4KO 3QCTH 4LASH 5DI8A 1FO0A 1MFBH 3EDDA 3U0WL 4Z7OF 4HGWB 1IM9B 5FGSA 4M6AA 4FABH 3RL1B 5J4MA 4WI4A 3KPPB 3QXAA 3DPBA 3QUYB 4WW1B 2QADD 1JGEA 4JCMA 3MPCA 3C08H 4PJ9A 1JMZA 4LLUA 2YWZA 3GBML 1NSNH 1FNEB 3ARWA 4NZDA 1ZT4B 3EFDL 1VGEH 2H8PB 3CFEB 5JXEC 4HIJB 3TCLA 4G6FB 2ICCA 1ZHKA 3VRJA 2XXCB 2C4XA 4LCYA 1PZ5B 1SJHB 2F54A 3BWUC 5L88H 5D2LB 4M1CC 1QG3A 1KACB 4LCWE 1CE6A 3TV3L 4U1SB 4WCYH 1YJDL 2VR9A 4R6UA 1AC6A 1CIDA 1KIUA 3BQUD 4K3HA 1CFQA 1T7XA 4POYA 4OAWB 4DKEH 5T5NF 4B7LA 4JFZL 4F7MB 3RKDD 3SGJA 4MCZB 4PJDB 1WZ1L 4QNPE 5DRWA 1J5OH 1KN4L 4K2UH 3FQNB 1BJ1H 1IC4L 3K8KA 5GGQH 3IXAA 3UROR 2GSIB 4NZTH 2Y72A 3VWJB 3AY4A 2D7PA 4GW1A 4JZJA 1WZLA 1CD8A 5DRNB 2AAVA 3IFOB 2X1QA 2QKIA 3MLZL 4KDTA 5E8DL 5C71A 2XZZA 3O6LL 4J4PA 3CVHB 3REWB 2CLRB 4G9FE 4IIQC 4QOKE 4WNQB 3JBG7 4JFPA 1JV5A 3RPIB 5LVEA 2AEPL 2BERA 1G7IB 4L5FH 1F3RB 4Q2ZA 1IGJB 2D7TH 5AAWA 4X9FA 5J3HD 4N0UA 1NCCL 5DZLA 4ZUTA 3FQTB 3DETC 3GSUA 1FNSH 1A6TB 1OT1A 2IG2H 3LHPH 2DI7A 1BQHB 4KUCD 4ZXBD 2VLJB 3CVHH 3F8UB 2R69H 3RNKA 2J7LA 1YC8A 3HZYB 4OCRH 1SY6H 4Y5XA 2PTTB 2DOCA 3O3EA 1LDPL 4G43A 1DQML 3NZ8A 1DQQB 5CCKL 4LPUA 2PW2A 3PWNA 3P0GB 5IV2A 2NCMA 3KYNA 5TQ2H 4ODXB 3UTSE 1JI2A 4R4FL 4E41E 3T8XB 1U8JA 4P2OB 2Y5EA 5D5MA 5EUOA 1FFOA 3SCMA 5DUPL 4GRLA 4MMZC 4PFEA 2DQGH 3FO2B 4NRYA 4P3DB 2CKBA 1AQDA 4HXAL 5I1EH 3BE1H 1AKJB 4AENB 3G08B 4WDIB 1C5BL 1BQHG 1LD9B 3H7BB 1KIPA 3DUUB 2YD7A 1HH6B 5FYLH 2FX9H 3QEUA 3LN5B 4FQ1H 1HHGA 8FABA 4LLQB 5JIHA 3N1PC 4YFDB 3WFDL 4GJTB 4QXGL 3SOBL 3OXSA 3MMEA 4K8RH 5DEFB 4KRPB 2ID5A 2VLKD 4Y19A 5IM7B 3S88H 1MNUL 3DV6B 4MNGB 4P23B 3AY4C 1CK0H 5T5FL 4AM0B 3BP7A 4KK5C 5E94B 4JZJC 2EE9A 3PF2A 2VABB 2MHAA 4J4PC 5T3ZL 3OQ3B 1ZANL 2CDGA 3U30C 2FX8H 2XT1B 2GFBB 4HSQA 3ROLA 3Q2CA 1GXEA 1ODAA 1FSKC 3Q6FA 4XVUD 1MJUL 1YN7A 3STLB 2CUMA 5E2WL 3GJFH 3HMWL 2YPVL 1FDLL 2ATKA 2EDWA 3MGTB 4LEXH 3FN0L 5F9JA 2Y06L 4C83B 3TT1L 1AGEB 1MIMH 1JWUA 2P5ED 1I1AB 3L3DB 4P46B 5JMOC 1EGJA 1G6RL 1QSVA 1T04B 3UPRA 4PY7B 1KG0A 1CDIA 4L8DA 5IVZB 1JZ4A 2HT4C 3MV8E 1QR1B 3AAZB 5IBLC 5EN2B 4YXHL 1KCVH 3KPOB 2Q8AH 3MCKA 2KQMA 3QDMA 3ULUL 3F7QA 5SWZB 4RGOL 4XPTH 3BHBA 3VFWB 1QSFA 5F89B 1NGPH 5L7XH 2X70A 4QHKJ 5DVOA 2ZG2A 4TNVF 4FQHB 5CSZA 5I0DA 5IROA 3SCMC 3OF6A 2WANA 4OD1L 3C60B 1KBGH 4KI5C 1NFDE 3ZMRA 5ADOL 3LN4A 4X7SH 3T65A 3S36H 4WW2F 4HF5L 1A6AB 2DL9A 5I18H 1KSRA 3GJEA 1N5AB 2GAZB 5GRUH 5TQ0L 4PJHA 2DAVA 3ULUF 4Z0XB 2F53B 3C6SA 4FOMA 3FQXB 4F7EB 2NZ9C 2F8VA 3VXRD 3CDGB 4PV9B 3IFPB 3JWDH 4JFFB 2A1WL 3ZHKA 2HN7B 2N56A 1I9RL 1DN2A 3LRHA 3G6JE 3QYCA 3W9EB 3NIGF 1G7QA 1VA9A 5HPMA 2YWYA 1HIMH 2ENSA 1DFBL 3HNTH 3LPFA 3FO1A 3QQ9D 3UDWA 3QG7H 5BZWB 1XCQA 4MA1B 3HC0B 4QXUL 1P7QB 1MHCA 3QZWB 4N0FA 4JY5L 2BNQD 4Q0XL 5ICXA 2NY1C 3RUGF 2Z8RA 1AP2B 3O11B 2F58L 3O2WL 2NW2A 4PLJD 1H3TA 4UNTA 5B39G 4FXKA 4LLVB 4FFVC 3IS0X 4ZUWA 4MZ2A 3SKNA 3MYZA 5C0ND 3LEVL 3NFSL 3DRTA 4J1UA 2P8PA 4GLRI 3SPVA 4W68A 1LWRA 4J3VA 4I3RL 1E28A 4UINH 1F3JA 1BIIB 2GJZA 3LS4H 3PQYB 2DLGA 4LVOC 4OTXH 3ZDXE 3AS0A 1RI8A 4FHBD 5D2NE 3QUXB 2HJLA 3LY6A 4HQQL 3QZWG 4CVXB 4OIIL 1JI1A 1LMKA 4WFFE 1PJ9A 1X5YA 3IDXH 4R4NC 2NYYC 3QWQB 4MA8L 3TT3H 4PJ9D 4I9WE 4OCSL 3TYGL 5IROC 3MNWB 2IPTH 1AD9B 2VLLB 4JFEB 1XIWB 4O58L 4NO0A 3A0OA 4NGHL 3V5DA 2F54D 4QRPB 4Y16D 4ODUA 4I13B 2VOTA 3HPJA 5TE4H 1ADQH 1U8OA 4JR9H 1CS6A 3O2DA 5IKCA 5DJDA 3LQZA 1I1FB 1DE4A 3NGBB 4YHOH 3QQ3B 2AXFB 4TOYL 4Y2DA 5AZ2L 3PUCA 4M1DH 1J1XL 1II4E 3DXAB 1QEWB 2IQAB 4OT1L 4PRDB 1RK0A 2Y36L 1Z9SA 4OGXH 2XQBH 3LRSA 4UTBH 2VZOA 4L29A 1T0NA 1DSFH 2VDPH 3UDWC 3U0TA 3STBA 2AV7B 3O4OB 1E6OL 4LKXB 4Y4FB 3HUJE 3T0VA 3TNNB 4CMMA 4OZHE 2Q6WB 3FN9A 1G9ML 3BWAA 4ODWB 3RGVB 5A3ID 2YUZA 1CFBA 4UV7H 4LFHD 3S37H 5CLWA 2NXZC 4PJIE 4QHLB 5GS3A 1WJ3A 2NX5D 3P4OB 4JFDE 2PR4H 1P4IL 3HFMH 1NH6A 5K9JL 1U8LA 4CVZB 4XP5H 1A8JH 4J8RB 4EDWH 2F5AH 5F7KC 4LEOB 3UBXI 2X4NB 3EOTL 2AXHA 1B4JH 2VLMD 1TVDA 4NN6B 3AREA 4TUJA 1DDHB 2J4WH 3MROA 1R6VA 3ZSSA 4ZTOL 5K9KB 2R0ZH 1TVHB 3ETBF 2DBJA 4OGAD 4G6AD 3V4VL 1VFMA 5I1KH 4KRMB 4HK0B 3SJVD 2XI9A 2P44B 3ZDYE 2H6PB 4GRLD 3MACL 5FA4B 3LS5H 2OL3H 4YH6A 3JTTB 4NM4H 1W0VB 5DS8B 5L6YH 1MCBA 1YYLL 4ZUUB 5EORL 2ERJB 4Z7UE 2DD8L 4XCYA 4DFIA 5CZVH 4Y88A 3WEXB 1CR9H 1MLCA 3BEWB 3BIKA 5C3LD 3AB0B 4Y2DC 2BFVL 1OT2A 1VADA 5HDQL 1ONQB 5I1JH 4RMVA 4Y19D 1ZT7A 1IQWH 3MRRA 5ALBL 4D0BB 5A43C 1BBDL 4WGVB 4XI5D 4TUKH 2XXMB 2NY2B 3B83A 1CXIA 4P5TB 5GRXG 2XZAH 1A2YB 5DQJA 1N6UA 3QDHA 3BDYH 5C2BH 1AXSB 2EXYD 3OGCB 3NIFE 1CGVA 1ZTXH 4QNPF 3TIEA 1BREA 2DTSA 5I1HL 2R8SL 3JZ7A 3RJQB 2VISA 3TZVC 2D7OA 3MODL 3GNMH 4HAGA 4DEPC 4S1QH 1NPUA 4LCUA 4IRJB 4ZOAA 1CDHA 3SO3C 3QIUD 1PQZA 4WHCA 5IJVA 2VDMH 4QRSA 3MUJA 4X6BA 43CAB 1YMMA 5HYQB 3AREC 5TH2B 3SY0B 3KPLB 3MV11 5GGVH 1IEBB 5JPMA 5A40E 5FUZL 1HHKA 5C09B 3V0VB 2NXYC 2OTPA 3TIDB 2X89D 1Q8MA 2DB8A 5I1LA 1VKXB 3H9SA 1MCWM 5IFHH 4UAOB 5C8JA 3P3YA 4U1IB 4XPHH 1XGRB 2HT3D 5CD3B 5A16A 1YA5A 4PJEB 1NMBH 1U2HA 4PGEA 4HUXA 3O0RH 1T2QH 3R8QA 32C2B 2R4RL 3CSPA 1EV2E 1T1YA 5HI5D 5IB4B 4WWKB 1DQJB 1NDGB 1C5DA 4BZYA 1KFAH 2CO7B 2H3NB 4LLWB 1F6LL 4FXGA 4HBCH 3V0WH 3TH4T 4KTYA 5F96L 2N1KA 3STZB 4K3EH 3ZKND 5FAAA 4HKZA 5SV3A 2A6IA 1OLLA 3GSNL 3PV6B 4YHIA 3OKDA 1MPAL 1QKZL 2DQJL 5CIPA 3IJSB 2G75A 5CJQH 4YE4L 4H1LG 5DMYA 1Z9LA 2OTWA 4U1NA 3RTQB 2JB6A 4D0CA 1FL5A 2YKLH 4YLQT 2XNAA 1ND0B 4A6YL 5DC9B 3HB3C 2VDNH 4GKSA 3EJYD 5DJ8B 2HLAA 2Q8BH 5D2LE 5FO7B 5T3ZD 3CXHJ 5MERA 5GZNC 4QOKA 3OKKA 3ILQC 4WUKL 3BKJH 2A6DA 1HK6A 4MCYB 4N1HB 4BSVA 5C0JB 5I71C 1U6AL 1JN6B 4M61A 4PJDE 3ZE2E 2FJFB 5DFVD 1FYTB 2FEEL 2GEEA 3U9UB 1Q38A 2A6JA 2VC2L 4O9HL 3FRPA 3MLYL 1HOCA 2IH1B 2D0FA 4ALAH 5IR1B 3QEHB 1DP0A 3FFCA 1MCJA 3I3EA 3CC5B 3S34L 4XNQB 3FB8A 3MO1B 5DK2B 4LOUD 1JK8B 2YA1A 3RVTD 5J11B 3UPAA 1R5IB 4HH8A 4BZ2L 3FB7A 5HYJD 2WP3O 3ULUD 3HE7B 4NO0D 3BEVA 4I0PA 4XP6L 3DGCR 4RFOL 2AJUL 3X14A 4NKMB 3CIQA 4NQUA 2XWTA 4MXQC 4HHAA 4LPXA 1WFUA 4ZNEA 1DBMH 5ETUB 1E27A 4H26A 4JCLA 1DQDH 4BZ1L 4RFEB 3QPQD 3C8KA 5KVMC 2OTUA 4MDJB 2K3TA 4PJCB 4J23A 1NFDF 4GRMB 1KPRB 1LO0L 3DI3B 3ARVA 5T1DL 4JVUA 3MXVH 4U1HA 5EOTB 2OJEB 2G2RB 1EJOH 1VFUA 2HTKD 4GAFB 9CGTA 3D39B 4JO4H 3IF1A 4X7CC 3HI1B 4PJAA 1D5XA 3LDBC 5TGBB 4YGVA 1V3KA 2IAMA 3LOWA 1AR1D 4YNYA 4XHQA 1HSBA 3G6JF 2YS4A 1JJUA 5L9DH 3QFDA 3MLTA 4L4VD 4O02H 4A6YA 3HZVA 1XGPA 1KPVA 2YPLE 1NMCB 4JG0L 1YY9C 3OG6B 2VL5A 1MAMH 2O5XL 4BQCA 1CVRA 5I1GL 5JUEH 1YQVL 1PLGL 4I2XB 4NQCD 3UC0H 3CFCH 3LS4L 4K3GA 5IMMB 1KCSH 3NCJH 4Q9RH 4BQBA 3UJJH 15C8H 3BD3A 2CIIA 3TBWA 4DN3H 5IHUL 5FYKH 4XCNA 4HXBH 2CRMA 1ACZA 3FOMA 4GBXA 3QNYA 1BQSA 1BZ7A 1FGVH 5I74C 5C08A 4DQOH 5D1ZB 3MXWH 5IFJB 1JRHH 2HT2D 3SDXA 2UWEB 3ZDXF 1CFSA 4HC1H 4EOWL 5IIEB 1JL8A 4B5EA 4I0PC 5E2TL 4OCXL 3E6FA 4JG1H 4RDQG 1TCMA 5D7KD 2XZCH 3NH7L 1VACB 2V5MA 1WEJL 2IANB 4G9DB 5KJRH 2K7PA 4JVPA 3U46B 1FFNA 3BXNB 3T4AB 1KOAA 4EVNB 3UEZA 3T09A 4QCIB 1Z5LB 1Q9WB 1ETZA 1P1ZB 3FRUA 4DGYH 3RHWK 2BSTB 2H1PL 4ZSOB 2VXUL 1J05A 4XTRD 1HINL 3BPCA 2I60L 5F7FA 4FQXB 2MPAL 3BZ4A 5TDPA 3L1OL 4I48B 5SWZE 5C70A 1R3HA 3DX6B 1EHLL 2IFFH 3GSRB 4BUHA 5DQDL 2YD2A 2Z0BA 2O93L 1SHMA 4G6KL 5I1DB 5DA4A 4WFEE 3EOBB 2HKHL 2UYLB 3WFCH 3D18B 2XA3A 2FYYB 4LVNB 4NRXB 4LKCB 4P2RB 3T0EB 1AJ7H 4LCCC 1FIGH 3O3DA 1AI1L 3TBVA 4HUWA 5AD0B 2VDOH 2JELL 1NBYB 1RUQL 4QTHB 3W0WD 4MQSB 4XC1L 2F53E 3KPQB 1NEZA 1WSST 4ZD3H 1Z9MA 4R96A 1XGYL 1Y0LB 4LHUB 3SQBA 4JFFE 3HUJF 5B8CC 2DJUA 2X4PA 2A73A 3U2SA 4O5LL 1MQKH 5FGBC 5EBGA 5F1OB 3RVWC 4ZODA 2XOTA 5EBLB 5T1LD 2IPKA 4PJIF 1DN0A 1OW0C 1A1NB 1QYGL 5D2NA 3JWOC 4GS7C 2UVEA 2XTJC 4YHYC 2RBLA 3QA3B 2J12B 1K85A 4DZ8B 3LB6C 1T1ZA 4NM8H 1MELA 1XGUA 2X4RB 4LBEA 1MCOL 3ULVC 1TJHL 2DI8A 5ALCL 4CL7A 3MLRH 3QHZL 4Y1AE 2R0KL 2YD1A 1R5VA 5J1AA 4UV4H 3UMTA 1TXKA 2CIKA 4LHUG 4NQSB 2DWEA 4HW6A 3T2OA 3B6SA 4XP4L 1H3XA 1BFTA 3PQYE 4LCWD 3ZDYF 3P0YH 2M1KA 4NO2B 5DJAA 3HC4H 3RPKA 5H94B 3BUYA 2JJVA 3K3QA 1MI5B 5KN5A 2JLLA 4JPKH 4R3SA 2VXTH 2PKDA 4Y4KB 4FNLL 3L6FA 1NGQL 1WIPA 2W1NA 3DLQR 4Z7UF 5TDOA 4JFEE 5JLZB 2DQIH 2YRZA 4QRPE 1P5VA 4PRBB 1C5CL 1D6VH 5EBMA 1T3FA 4OLEA 3G5XB 4G9FD 1ZHBB 1TNNA 3HHRB 4QOKD 4YZFE 5SWSA 1N4XL 3QUMB 4PTTB 4XC3H 5DUML 2C3XA 1B0GB 1URLA 3OJ2C 3HAEH 4GUPA 4F7PB 4N8VB 1TITA 3VE0B 3WS3A 2WBJA 1KV3A 3HLAA 5C0CB 5CZXC 1U8PB 3A6CH 4DCQA 1JWSB 4G80A 4POUB 4F15B 2ADIA 1HKLL 1FZOB 5AWNL 4F37F 3PJSB 4P2QA 3D25B 1KJMA 3OAYH 5LGJA 2J6EL 3N06B 4KTDL 5J06A 5JA8B 5D93C 2CJUH 4OD3L 3IDIB 2AJVL 3UTSD 1TQCC 4E41D 1RIUH 1J0YA 4WTWA 1E4JA 2V7HA 1Q1JH 1WZMA 3GIVB 5T1KA 4F33A 3QWOB 3GK8H 2OJZL 4N8VG 4QXTB 1P4LA 2BSRB 3P73A 5ESAA 3D85A 2AJYH 4XNYL 5BOPA 1JHKL 3VXMA 4PJXB 1AXTH 2Q7NA 2PXYB 4LVHC 4PTUA 2X5PA 1YEHL 3IGAB 4Q6IB 5T3XH 4I18B 1KN2H 5FECB 4Z7UA 3ARGD 3CLFH 5DDHA 5F9WC 3C2SA 4XWGH 4AIZB 5EDXA 1SM3L 1KCKA 1V7NH 1K2DA 4KUZL 3S4SB 3NCYP 3SDYH 1S7QB 3WDIA 3KXFB 1SYSA 1MREL 1D5ZA 1A0QH 4LU5H 4DZBA 1S9XA 3C9NB 2IAMD 2APWA 3OJMB 3WE6A 1P2CB 4MJ6B 1MWAA 3SDAA 2ADJA 1AC0A 3OAUL 4M6NL 4GRWH 1FLTX 1EEYB 3MA9H 2HYMA 3EO9L 3VWKB 5F1SA 2WBJC 4NUJB 1F4XL 5F9AC 4Z7VA 4EJ1C 5F3HA 5E6ID 3IAPA 5A2IH 1CTOA 3UBXB 5JDSB 1WAAA 1M1SA 4YIQA 1KCUH 4NZRH 1PBYA 3ILPA 3WIHL 5D2LF 1JHLH 2FATL 4AIXA 2I25N 3MV8D 1T5XB 3RWDA 4XT1C 5KVDH 2P8MB 3QCUH 1CGWA 4HFWB 1JGLL 4KK6C 5GJSH 5IB1A 3C5SA 1AGFB 2EIBA 3MYJA 4GBXD 4ONFL 1HQ4B 3FFDA 5C0DA 3QAZC 3D9AL 4PJDF 1MRFL 2B4CC 4X8JB 1O0VA 1WVZA 3VMPA 1FC1A 3FO9A 4JEGB 4FQLH 1UJ3A 5LQBH 2J6EA 3MV01 2EYRA 3WNNA 5F6IB 3UBXG 3MRIA 1Q9OB 2I9TB 3WKML 3L5WB 4M8QB 1JPTH 3MJ8B 1LNUA 4G7VL 3BGMB 5JO5A 1BLNB 1GGBL 2YRPA 2IFGA 3VA6A 3EW3B 1L7TH 5GS0L 5IMKB 4YDVB 3VFMB 1Z0MA 5J6HB 2BP3A 1IC1A 3BT2L 5KVEL 1H3PL 3FTGB 5MP6H 5MEQB 3DVNA 1HHIB 1FBIH 1UH2A 1IM9A 2DLEA 3JV5A 5C09E 3QXVA 2G9HB 3RL1A 2ORBH 3OJDB 2AI0H 1EHXA 3TYFA 3KPPA 3VXUE 3QUYA 3CLEL 2NY5C 2FGWH 4PRPA 3I3BA 1NUGA 1AGCB 3WJJA 1U8MA 4PJEE 1ZT4A 3SDAC 3W11D 2J1KA 3CFEA 2CK0H 3Q3GA 1UZ6E 3CX5J 43C9B 1I7RB 1PZ5A 4R90L 5AG8A 1SJHA 2YK1H 3DV4B 4FMFA 4Z77B 3G6DL 2P42B 5B3JF 4IEFB 4MXWL 1H3UA 2PYFB 1WTLA 2YA2A 3EDFA 1RUML 1S9VB 5DD3H 2D03H 1NUNB 4Z5RB 3O81A 1XEDA 2BSED 1KYOK 4PJDA 3GMOB 5HHQA 2R0LH 2NY7L 3FQNA 1UA6H 1U9KA 2EDFA 3TPUB 3VWJA 4PRNB 4U7MA 4NN5B 5DRNA 5FGCB 4UILH 4WFFD 1I85A 1CICB 1X6NA 1IGTB 4HS6A 3RIAK 4XPAL 3CVHA 1GHFL 4KJWD 4I9WD 1UJ3C 4WNQA 3MRFB 1GZQB 1SY6A 5J6GA 1DLHA 3RPIA 1J1OL 2VLRB 4QHUA 3WNMA 4N8CH 1G7IA 4M7LH 4MD5A 2ZUUA 5AZEH 4PJ7B 1IGJA 2APXA 3WFZA 4RIRB 2J88L 1FYTE 4NZJA 1SQ2N 4OF5A 4XXCA 1NQBA 4JRYA 3FQTA 4NSKB 4PJFA 1YEKL 5D96B 5DJ0B 4ZMAT 4B50A 3LSOA 2KZ1B 2VLJA 3U1SH 4HUMB 3DVGB 1TIUA 4GXUN 4NQXB 2VZ1A 5C6WH 1JTPA 4ORZC 3D5OF 3RAJH 5HYSB 5ANMB 1DBKL 5EU3B 4KVNH 1IZKA 4PJ8B 3KLHC 2YXFA 4JKPL 2VXQH 4XCCH 2BXZA 5IHZB 3D69B 4I4WB 1CXEA 4NPYB 1BEYH 1GGTA 2X44D 2M26A 3T8XA 3BP4B 3WJJC 1QFOA 4NUGL 2P49B 1S7SB 1X3DA 3M1BA 1MOEA 5I16A 4M48L 1MFDL 1DVFD 1OAKH 3MCG1 2D9CA 3S35H 4JFYB 3L95B 1MRCL 1E4XL 3G08A 4PB9L 3WNOA 2V5SA 1LD9A 4LSSH 2EDNA 4H20H 2DQCL 4JFDD 2OSLB 4KK8C 5HYSG 3MRQB 1HQRB 3V6OE 1EK3A 4LLQA 3PP4H 3BGFC 3DTXA 5IG7B 4EUPB 1G84A 5DEFA 4LVEA 3ZE1E 3I50H 5IM7A 1UWEL 2ZKHL 3GRWH 4MNGA 3VWJC 3DOSA 2GTWB 5ACZB 4AM0A 3D39E 4JFXB 1CT8A 1IGIL 4JREB 4KY1H 2XTLA 2GFBA 2JF1A 2GK0B 1GAFL 5T1KD 4H88H 4Z8FL 3ZL4H 1LO3L 2D7QA 1T83C 4GQ9L 3IDYC 1T03L 5HYEA 3DARA 5I8CA 4C83A 1YC7A 4XXCC 1AGEA 3BW9A 1SJVA 2H9GB 1I1AA 3BZFA 1KF9B 2DI9A 3L3DA 4EUPG 1T04A 1KB5B 3PWJB 4PY7A 3OPZH 4FG6D 1SBSH 4CMHB 1KLUB 1MRDH 2QQNL 5EB9A 1GC1L 4P48A 5IVZA 2R39A 3HCVB 2QSTA 1L0QA 1QR1A 4PREB 4GKNB 3RJDA 3CFJB 5EN2A 2QLVB 3F65A 3KPOA 4YO0B 4UT6L 2YN5A 5GS0C 1CDYA 2Y7QA 4F3FA 5BRZB 4U0RC 5GS1B 4XP1H 2NTSP 2UWEE 2EH8L 3VFWA 1ZLSH 3T0AA 4X4XB 4FQHA 2I9LB 1DBAH 2XZQH 3ZHLA 4P9HH 3RVVD 1XR8B 4K8RC 2FLBT 3C60A 4OLXH 4WO4B 4K23H 2IANE 4M7KH 1FRGL 3MTRA 3FONB 4ORGB 4Y4HB 1HNFA 3GM8A 5CINH 1A6AA 3BJLA 4ZFOB 3UTTB 2GAZA 1NCTA 4JHBA 5CUSL 2Q3ZA 2B20A 3Q5TA 4DAGH 4ZSOE 4NQTA 2VTFA 4YBQD 1MLBB 4YDJB 3VXSB 4PJ5B 3RX5A 1F4YL 4XCEA 4HWBH 1UWXH 25C8H 1TZIB 3P30H 4Y8AA 5I6XB 4XMLL 5JW3L 1VGKB 3IFPA 4JFFA 5F8QC 5I75C 2R56H 3BPOB 4YZFF 3MNZA 3BH8B 5DEGB 1BVKB 4YHMH 1XH3A 5ECJE 4HPOH 4DKAA 3HC0A 1JWMB 1P7QA 3FQRB 4P2RE 3T0EE 1X44A 4NC1C 3WSQL 2NPLX 3VXPB 4Y2OA 3O11A 4XHJC 3RBSA 3V8CA 3V4PH 1EVTC 5GGTH 3W82A 1G9EA 2EC9T 3TESA 1V3JA 2WUCL 3D3VB 1KULA 4XNZC 4R0LA 2VH5H 1FFQA 5HYIA 4JDVB 4G8GB 4Z6AT 1OAQH 1RZFL 1K4CB 3QUXA 4YUEH 1IM9D 1YY8A 3GJFK 1MH5B 1H8OA 2W9DL 3NCMA 2O61B 4CVXA 5GQBA 4OV5B 4GAGL 4QYOA 4JJ5B 3QUYD 35C8H 1MUJB 1DBJL 4CNIB 3QDJA 3KJ4B 4P2YA 4XNMA 1R24B 4OFPA 4M62L 4AMKH 4LRNL 3MNWA 4P4KA 4ZYKB 5FO8B 1W72B 1AD9A 2VLLA 3C60C 3JWDC 5FV1L 1JZ3A 1CBVH 1TJIH 4G6FD 3RIFK 4H5SB 5CBAB 3X3GL 4CN1A 4P5MB 3BKML 2CQVA 2AJ3B 1NC4A 2Q76B 4NRZA 1ORSB 7CGTA 2DKSA 2EDTA 4KZEH 3I6KA 2Z31B 1HZHH 3MLSL 1G7JA 1NCNA 3GI8H 1BBJA 4RQQA 1I1FA 1QNZH 1KC5L 5C07A 1T1XB 3PNWB 3G9VA 3V95A 3QQ3A 1B6UA 4XVJL 4R8WL 4KAQL 3DXAA 2IQAA 3MCLL 1CD0A 4PRDA 2CUHA 2ICWB 5EFIB 3FAXA 5HVHB 3G04B 3LIZL 5DJ2A 2I5YL 1FAKT 1INEH 2FWOA 1CU4L 5F72S 3HRZB 3DX9B 3SDCB 2AV7A 1PG7L 1OWRM 4S1DD 5EWIL 3MOAH 2DWDA 1PY9A 3FKUS 4LKXA 4U2YA 4Y4FA 3TNNA 4P49A 4I8DA 2Q6WA 1NC2A 3RGVA 1RQ5A 4NN7C 3GSXB 1UM4L 4I77H 5C9JB 1F11A 3GKWL 3I2CL 3UTQB 4FS0A 2C3HA 4NWTH 2IPUG 4R0LC 5C0CE 2X4TB 1T66D 1A7RH 5HI3D 2WLZA 4HIXL 2AJXL 4FP8H 4DJMA 4CVZA 3WL9B 2OL3A 2OP4L 3QUXC 3CDFA 4GAJL 4NJAH 5EZOH 1JPSH 1C7SA 4NJ9L 4LEOA 1I7ZB 2G60H 3U48A 4XNUH 4HUVA 1DDHA 4GMSL 1YPZE 2CD0A 3FCTA 1F5WA 5K9KA 3O9WA 1OM3L 2KKQA 4P2OD 2HLFC 4HK0A 4KHTL 4KTEH 4P4KC 2BC4A 1JP5A 1KJ3L 3UAJD 1CFVL 5FA4A 3U4BH 5E99L 3NIDE 1IC7L 3FQWB 3O3BB 2FEDC 3JTTA 2IPUK 3CFBA 1AKJD 4PJXE 1SJEB 1MHPH 1I8IB 3B2UD 5CILH 5DS8A 1ZLUH 4PJGB 5A2JH 3BVNA 1RUAL 12E8L 4QY8A 2YPLD 2YA0A 3WEXA 3ZLQC 3BEWA 1DUZB 4PJEF 1FNHA 5CMAA 3RWCB 1A7PH 1RUKH 4OLVH 2DQTL 4P4RB 3TA3C 3WD5H 4KRPD 5DEZA 1UZ6F 1OB1B 4D0BA 1SMOA 4P23D 2ZSWA 4MQ7B 5GS2H 2J8UA 1IAIM 1NFIA 3KXFE 1KXTB 2R4SL 1H8SA 1I8KB 2VO5A 3O4OC 3ULSB 3BN9D 1A2YA 4TVPE 4LARH 3DO7B 1AXSA 5I9QC 3RGVC 4MA7L 3OGCA 4JFHE 1A3RL 2H26B 4Z7WB 3A6OA 4JPVL 4ZFGH 3QSKB 4OFYD 4KKBD 3CPLB 3S97C 3L5HA 4HJGB 2FIRT 4X99B 4P46D 1I1AD 1YDPA 2G5BB 4RX4A 2IADB 1EIBA 3ESUF 4IRJA 4TULH 4DN4H 2GUOA 5ESQB 5BV7H 1FORL 1MJ7H 3MRMB 4UU9B 4E0RA 43CAA 1RULL 4MA3B 4OUUB 2VAAA 1A6WH 4NN6C 1C08B 5HGAB 4RGNC 1NCWL 3O9WC 1IEBA 2A9MH 4RMWA 5SWZD 5M95B 1EEZB 3RVUC 5EO0B 3RDTC 4NNXA 3N1QC 5GHWH 2PCPB 3V0VA 4XXDB 4ERSH 2DICA 3N9GL 5F3BB 3QIBB 4LSQL 4WFED 1RUPL 5JW4Q 1J18A 4U1IA 3M17A 1XGRA 5SX5K 4HS3A 4ISVB 5HDLA 5CD3A 3P11H 1WWBX 4UDTB 1YYML 2CGRL 1OCWH 32C2A 4M9OA 5I17A 1NDGA 1I3GH 4JANA 2DYPB 4OI8A 2W0PA 2F53D 5F7WC 1D3CA 1TDQA 1FVCB 1MCFA 5HGDB 1RJCA 4JFFD 2Z92A 3MBXL 2QQQA 2EDKA 3I84A 5CD5D 3WO4C 4X80L 3AVEA 1FP5A 1LK2B 3OKOB 3E2HC 4CW1B 3IJSA 5F7UA 4LLMA 1CVSC 4PJCF 4HBQA 4JB9H 1P7QD 2OK0L 3ZO0A 2XN9B 3UO1H 3OXRB 1FIEA 1ND0A 4X0KA 3F58H 5D9SB 4XRCB 5DJ8A 5HHNB 4PV8B 5DGRA 1QBBA 3B5GA 4MJ4A 3ZE1F 4DGVL 5FO7A 1F42A 4R7NA 4Y1AD 2R23B 3CVIH 3GHBL 2YC1A 3IRZA 2HFGL 4MJIB 1D9KA 5FHAL 1C7TA 4U6XA 1U3YA 2HRPL 1NCAL 1KCRH 1BGXL 1JN6A 1ZHLB 4R2GC 3U0PB 4Z76B 3PQYD 4MS8D 1FYTA 1NBVH 4G8EB 4HZAA 3EYQD 3U9UA 5D70H 1IL1B 4U1MB 5FXCH 4RDQF 2IBZX 5IWLA 2IH1A 5IR1A 1U8HB 5DSCA 3SDDC 3O3AB 5FGCE 2Q7YA 1HN1A 3GSQA 4V2BA 4PRHA 4QRRA 1QACA 3CC5A 1CFNB 3FB5B 1I8LA 1CLZL 5C6TH 5CJ8A 4JZOB 3QH3B 5EU4B 3TGXA 2VLRE 1R5IA 2A77H 4JFED 2EZ0D 4UAOC 5I1AA 5D7JC 1XIWD 1YQ2A 4Q6YA 5BMFH 2E9JA 4BH7B 2HG5B 5HHVL 4W6XB 1CL7I 3EGSA 5FYJU 4QRPD 1ZA6A 1DQLL 5ADPL 5ETUA 1FGNL 2UWEF 1YEJL 1U91B 4KKCD 3QI9A 2VAJA 4R26H 2BVOB 2E8ZA 3JV6B 5ANME 4PJCA 2W9EH 4JPWL 1QLFB 4X9BA 3PGCB 1CE1L 5F97E 1JNHA 1YECL 2H45A 5H35A 1TNMA 1WIOA 1CDCA 2IJ0C 5EOTA 2E6PA 4PBXA 3SKMA 4KFZC 1RVFH 3C6LD 3LPGA 5ILTH 5CP3H 2XWJA 5DD6B 4Y4FD 4Y5VB 7FABL 2NQCA 2FZ3B 3HI1A 1EBPA 3LEXB 4ZOCA 5TGBA 4U7KA 1EO7A 4M7JH 4OZIB 4ZDHA 3VDCA 4DUVA 2NTFB 3S3PA 1SMAA 1D9KC 5DD0H 4TTDC 2F19H 1X4ZA 3H42L 5HI4D 5DA0B 1IGCH 3ARQA 4I2XA 4MB4A 4OFKA 4OQ1A 3ROOA 5ICZB 2D2OA 2BVPB 2ZCLH 1R3IL 3C87A 1KGCE 2CO6B 4Z0BH 5IWLC 5IMMA 2IGFH 4G42B 4HULB 4OQTL 4KHXH 4N1EA 5IP4A 1LE5B 5IGXH 1I8LC 4J3WA 2BY2A 2GJ6E 1ZT1B 2FCBA 1X4YA 3VI3E 1WC7B 5IFJA 2UWEA 3MRGB 1P53A 2VDQL 1INDH 1B2WL 4HMEA 5EC2B 5J9PB 1J9CT 1HHJA 2LAGB 4KMTH 3FT2A 1TJGL 1VACA 3ZE0E 5F7NC 4MVBD 4OKVB 3REVA 2LVCA 2RR3A 3QI9C 1OAXH 3BXNA 1S7TB 1QTYT 3G6AB 3T4AA 4EVNA 3E3QC 1NCBL 4QCIA 4DGIH 1Q9WA 2AKRA 3DMMB 3CZFA 4PS4L 1P1ZA 4HH9A 1U36A 2IMNA 1QFPA 3B9AA 5D8JL 3PL6B 4O2EB 3HI6L 2C1PB 2XIDA 1LO4L 2O5ZH 3GZKA 5C0RL 3MGOA 2SEBB 4L3EE 5E1AB 2NY6C 2NY2D 4BFIB 2FLRT 4XBEL 3IJYA 4P5TD 4K3DL 4R7DA 3Q0HA 5HVWA 3OZ9L 5I1DA 4FFZH 1KEGL 3DIFB 4WUUB 5JDJA 2BRRL 2W91A 3LH2L 4FZ8L 3P0VL 2FYYA 4LPYA 4LKCA 5KVGL 1SEQH 4KMLB 1BAFH 1FO0H 4MQXD 3O45A 3FN3A 3Q6GL 3C09B 5AD0A 1HYSC 4X98B 5FYJL 4ETQB 4M8VA 3WMSA 1ZA3B 4QTHA 1MFEH 2WM0A 3VXSE 4L8SB 4QWWC 5KANI 4PJ5E 4AH2B 5HGBB 1VEOA 1Y0LA 4IRJD 3LMJH 1C1EH 5KG9B 1BMGA 3QCVL 3RY5A 5GSVA 4KJPD 4K7FB 3H2WA 4DVRL 1KNOA 1S9WB 2FDBP 3P4NA 2OQJB 1G7LA 4KVCH 2DDQH 1OTSC 5EBLA 3RZCC 1A1NA 2FBJH 5C09D 1T0MB 4OIBA 4AL8L 3QA3A 1N3NB 4LLDA 4AT6A 4FZEL 2X4RA 4BFBD 3BPLC 5C0IB 4LK4A 5HHMB 3D3VE 3ARFC 4LSDA 3HNSL 2R0WL 4S0SD 4D8PB 4WWKD 4YWGH 5HDOA 3IT8D 4G8GE 4EKXA 5B38B 4Q7DA 2NX5B 4XVTL 1LGVA 5IOPB 2IWGA 3BP5B 4KKLD 1JFQH 4UT7H 1A1OB 4JLRB 4XCFH 2YBRB 4NO2A 1I1RA 3RWJB 3TO4C 1IRAY 1JYXA 3O6KL 2FR4B 2J2ZA 5JOEA 5H94A 4PJXF 1YEIL 4D3CH 3ILQD 2DLHA 1MI5A 3B43A 2FBOJ 1RZ7L 4TVPL 3OWEA 3EDJA 4LSVH 1RK1A 4LSPL 1BF8A 5GJTL 3GBNL 3RTQD 5IK3B 3ZT6A 5JLZA 1WZKA 1IKFH 2HJKB 1V8HA 3MRHB 1SEBB 3INUH 4JN1H 3IETA 2IF7A 3W9DA 2X4SA 1ZHBA 3QUMA 2MCG1 4PTTA 4DW2H 4X6DB 3O4LA 2ZCKH 2FL5B 4U6YA 4XB7A 3LQMA 3VE0A 3ZYJA 3U0WH 4BH8B 2VYRE 1FYTD 4EZMA 4PP1C 1A9EB 3V5KB 4KWUA 3O2VL 1L0YA 1U8PA 3VGBA 1A47A 5E00A 3TBSB 3QEQB 4AYFA 1NLDL 1FZKB 3S35X 2V7NB 1XF3A 3GBMH 4M6ML 5IW6B 4XMKL 5EUKA 3EFDH 4IMLB 5FUCC 1JF5A 1T0PB 1BWMA 3K80A 5D7LB 3IDIA 1P7KB 2ZUVA 4LSRL 3HE7D 5GGSY 1H8NA 4D0DB 3JUYA 1J0IA 3GIVA 3HR5B 3TV3H 5LWYL 3K81A 1YJDH 3QWOA 4ONGL 1RSFA 2WWMC 4LCIL 4YHPB 2JJSA 2BSRA 4YBLC 4U6HA 5T33L 3S98A 4MNHA 4ZS6D 3RWEB 3V0AC 1ZK9A 4PJXA 4JFZH 5F7LB 1RHHB 4M7ZC 1WZ1H 2BHZA 1KN4H 4ONHB 1IC4H 1TTGA 3ALXA 2MFNA 3AXLB 1YEGL 3KWWB 3KVQA 4PR5B 2QHRL 5BS0B 2EH7L 2R15A 3ZKMD 3MLZH 3U7WL 4Y5YA 5E8DH 3O6LH 4AIZA 3WNPA 1X7QA 2BX5A 3S4SA 4NFDA 3D39D 1A1MA 3KXFA 2VXSL 2AEPH 3C9NA 1LEKB 3T2NL 1P2CA 4PJGE 4MJ6A 2CR6A 4OGZA 1NCCH 2NY4B 4HV8B 4WEUD 4JFOA 3HS0B 4CRPA 4TN9A 1EEYA 2JIXA 3QO0B 4GW4A 5GRWA 2H2PC 2I26N 3VWKA 4NUJA 1A6VL 1TETL 2EIZB 4MAYB 4MZ3A 3SGKC 5DGQA 1UCBL 3MLWH 2V17L 3B9KB 5JDSA 3OKYA 3VG9C 4M4PA 1LDPH 1DQMH 3CAFA 5CCKH 2ZJSH 4FFWD 3F7PC 3GMQA 3BRFA 1LILA 3NFNB 4OCWL 3IDGA 2ZNXA 2P8MA 4R4FH 5E7BA 4TSAL 4IRZH 4ZAKB 5I2IB 4ZFZB 4NQDA 1YEFL 3MRBB 1TFHA 3HZKB 5DUPH 1HQ4A 2EECA 5C0AB 5D1ZD 4Z7WE 3OKLB 4DOHB 4HXAH 4X8JA 5AAMA 1EDQA 4OZ4B 2WBKA 1OGAA 4P5KA 1C5BH 3OKNA 4KRNA 4H0GA 4YHLL 5EO1B 2AABL 2IAND 4XAWL 3MJ9L 2WINB 3T1WA 4CDGC 3MOQA 4NKOB 5HHPB 3VFSA 3V79C 2ZOLA 1Q9OA 3OAYK 1UXWA 2I9TA 4N0CC 3L5WA 3WFDH 5J12B 4QXGH 3SOBH 5DTFB 3BGMA 2V5RA 2VQTA 3MBEA 1MNUH 4YDVA 1TPXB 3PHQB 2ZUSA 4PJ7F 1V3MA 5H37H 5T5FH 3G5YA 4FQXD 1DTUA 4PJBA 3VGFA 1ES0B 1JMXA 4QGTA 4W81A 5MEQA 1HHIA 3S96B 4Y5YC 5T3ZH 1ZANH 2QQKL 4YK4B 2G9HA 3OJDA 3L3JB 4L4JA 4APQB 1FL6B 1MJUH 3O6FC 4M5YL 5E2WH 4TYUA 1WT5A 5EPMB 1AGCA 2YPVH 1FDLH 3HMWH 3LKPB 4P2RD 4MX7A 3T0ED 4OB5L 3K4DA 3ARBC 5HYJB 4PGCB 3FN0H 2Y06H 2RCSL 3MR9B 3TT1H 5J0BA 43C9A 4PGDB 3DV4A 5J13B 1G6RH 4Z77A 3L3KA 3VWKC 5BVJB 4LHUD 2PO6C 2ZUXA 4JM2A 2PYFA 4U7SA 1S9VA 1TLKA 2WWKO 4YXHH 3MUY1 3DVIA 2MNUA 5HJ3B 3ARDD 4CADA 2P5WA 4Z5RA 2X7LB 1B4RA 2Z4QB 2OZ4L 3ULUH 3GMOA 3VMNA 3DECA 4RGOH 3GI9L 2XN9E 5K33A 4PRNA 4OZFB 1NCUA 2OCFD 2K1MA 4OD1H 3O41B 4GSDL 1CICA 5ADOH 4AY0A 2NR6D 1NAKL 1NEUA 1UEMA 2HMIC 3KPSE 4WI9A 4HF5H 3EYOB 1Z3GL 3C5ZC 1I3RB 1OAUL 4P3WA 2R9HC 4L4TA 4MJIE 1KB5L 3TWCL 5TQ0H 1IC5L 1ZLVH 4JZNB 5F6IC 4GG8B 3B8SA 4PJ7A 2AXGA 2IMMA 1C8PA 5HHOB 1ZLWK 2A1WH 1WCBB 3VI3F 5A2KH 1I9RH 3MBEC 3CXDL 4OM0L 1IARB 3MJ9A 4G3YL 4NQXA 1DFBH 3E1F1 2ZG3A 3QUZB 5GRJL 4HGMA 4JO3L 3ZE0F 4QXUH 5E4EB 4Y4KD 5ACLA 4PJ8A 1UH4A 4JY5H 1L9NA 5IHZA 4Q0XH 3D69A 4WV1B 3DURB 1WICA 4NPYA 1M7DB 1U92B 4YHZL 1WT5C 3BP4A 2F58H 1MIML 2M8XA 3O2WH 3GMPB 5DJ6B 4ZFOL 1VENA 4HCRL 5L2JB 1RJZB 2FJHB 4XPBL 2Q86B 3LEVH 4OCNC 4JFYA 3NFSH 3GRWA 1G0DA 5DRZA 3PDDA 4GXUM 4I3RH 1FLRL 5CHNB 4JM2C 4JO1L 4WHDA 4OI7A 2OSLA 3MRQA 5C0CD 4OD2B 1HQRA 5FYJD 4YFEA 4HQQH 2P45B 1CLCA 2ARJQ 4OIIH 5IG7A 2B5IB 3NBNA 1NL0L 3JV4B 1XF4B 4NBZB 1FVEA 3QQ4B 4MA8H 2VDLL 1OTUD 1BFVL 4OCSH 5JIIA 1RZJL 2GTWA 3TYGH 1FAIH 1IAII 1FG2B 3LKSA 3DVFA 4JFXA 4KI1A 3VFPB 1IMHC 4U1GB 3EYVA 1AIFA 4O58H 5DT1L 5JZ7C 5C0EB 4OZIE 4NGHH 3PWUA 4M02A 5EOQL 3MRPB 1MCSA 2E8YA 4P0DA 4RMQA 2YUVA 4XH2B 4DK6A 2W65B 2OXHA 5T1MB 3W2DL 1EUUA 2JJTA 2PXYD 2H9GA 3I75B 4TOYH 5AZ2H 4I0KA 1J1XH 1DANU 4LSTL 1KB5A 3PWJA 4OT1H 4FQQA 2Y36H 1MCIA 1KLUA 4U1JA 1UB6A 4XPGL 2V9RA 3WLWD 3HCVA 4IOSD 4PREA 4GKNA 3CFJA 2ADFL 1NAMB 1W72L 3E3QE 4YO0A 5E1HB 3LKNB 1E6OH 2GTZB 1QP1A 2XICA 3CGTA 5I19L 3QWRD 4TNWK 5BRZA 5FF6B 3JUZA 3TVMB 4ZTPL 3SE8L 1G9MH 3AGVA 3OB8A 3KXFD 3FT4B 1A4JB 1U3JA 2UZIL 4X4XA 3H9ZA 4IRSB 4HWBA 4TVPD 1P4BL 4WO4A 1T7WA 4JGJA 2R2HB 1F2XK 2X1PA 4JRXB 1MJ8L 2D0GA 3FHQA 4JFHD 4WI3A 1K8IB 1RZ8A 1P4IH 3FB6A 3UTTA 4P9ML 1I9EA 5INDB 5K9JH 4X7TB 4GKZA 4K94L 4U1LB 1EXUB 1BVLB 3CX5K 1QD0A 2E3VA 3NZHL 3QIWB 1MLBA 2P24A 4MD4B 1IAOA 1N8ZA 4LCWB 1GGIL 3VXQB 1V7ML 2DLFL 3BH9B 2XKNA 3EOTH 1UT9A 1TZIA 1BD2A 1VGKA 4EBQH 1QFUL 3CMOL 4ZTOH 3MJ7B 2E9BA 4UI2A 5ERWB 1OPGL 3V4VH 5DEGA 1BVKA 4RRPG 2ATPB 4MDIA 1CFTB 1H0DB 4H8WL 4WUUE 2VWEC 4Q58C 3HG1E 3MACH 2CK2A 5BOZG 5FO9B 1F97A 1JWMA 3IDNB 2ESVB 3NFPB 1N5YL 1F4AA 3NABL 5FEBA 4AQ1B 1QHPA 1YYLH 5EORH 3HE6C 3R8BB 2PTVA 3EJZD 5HDBE 3GSWB 2V5YA 2DD8H 3FO0L 4X6EB 5CIPH 4IOFC 1F6AA 2JJTC 4KKAC 2BFVH 1GCFA 5HDQH 4P9HC 2YR3A 4JDVA 1E4WL 5IB3B 1ZE3C 2DLIA 5ALBH 4BK5A 4PD4J 4E9LA 2VRAA 4HIHB 2DQEL 1BBDH 3KNBA 5IHBA 1K4CA 3H9HB 3CSYB 4V1DA 1J8HE 1E6JL 4Y0GA 5F1NB 4HAFA 3ZT7A 2O61A 2LV4A 2HTLC 4OV5A 1IGYA 4WFHE 5TE7L 3PDOA 3TN0B 1MUJA 5INCB 4HZLA 4HKXB 2WZPD 4HKJB 1R24A 2V2XB 5I1HH 2R8SH 4ZYKA 1IKNA 1BF2A 5HHME 4CVWA 1FVDA 3UTSB 1W72A 1QSEB 3HFML 3MODH 4PPTA 4FQ2L 1MFCL 4LNRA 5EH1A 3WXWL 1CDUA 4H5SA 5CBAA 2LVEA 2ITDB 2NNAB 4P5MA 4F9PA 2FNBA 2AJ3A 3QDGE 2Q76A 4R9HA 3V52L 1ORSA 3M07A 3T2PA 5IW1B 4RMSA 5IVXE 1YEEL 5E08L 3PNWA 2AS5M 1HXMB 4PJGF 4NOFA 5EULV 2A6KA 4ODVL 4FXLA 2P4AB 3O3UN 1H3VA 2XKUA 2ICWA 5EBWB 5FUZH 3ZDZE 3G04A 2LTQB 1TTFA 2KBGA 2AQ3A 5CFHA 4PLOB 4PLKD 5LG1A 2V9QA 5IFAL 3SDCA 4KZDL 1CICD 4AEHL 5E03A 2YD5A 3DBXA 1A6ZB 4I3SL 5KANG 3WIIL 1N0LA 3T4YB 4H25B 2BVYA 1UWXK 4X6DE 2R4RH 2VLRD 1K8DA 3R1GL 8CGTA 2QBWA 4ZS7L 4K71C 3WHE1 2BK8A 5C9JA 2FX7L 4FFYL 3UTQA 5F96H 2X4TA 1NJ9A 1LVEA 3I6LD 4EXKA 5F9DC 4Z7WF 2XKSA 5E6IB 1BJ8A 3GSNH 1A3LL 1MPAH 4M00A 1QKZH 2DQJH 5KVFL 3QNXB 4YE4H 1RZGB 4HX1B 2BHYA 4HD9A 4JGUA 1I7ZA 3MV9B 4PJ8D 1MHEA 2AK4A 5JW4R 1U3HB 4A6YH 5D7LE 4X6CB 1CD1B 1M6OB 5H2BB 3U9PL 4RBPH 1IKNC 2EDHA 2O26U 4XBPB 2OLDA 2V2TB 4YHKL 2HFFA 4K9EL 4NZUL 4J3UA 4WUKH 5HYFA 4GH7B 3O3BA 3S5LB 4LQ1A 3DJ9A 1FL3A 4F9PC 1U6AH 1SJEA 2XWBB 2VDRL 5F7MC 3NA9L 3QRGL 1B90A 4NBYB 4X4ZA 3FT3B 3EYFB 2VC2H 3O8XA 1T7YA 5CGYC 4O9HH 1IFHL 3MLYH 1DUZA 3T1FB 4EN3B 2E7BA 5BS0E 3NCBB 4F9LA 1M05A 1OB1A 2QSCL 3S34H 3CU7A 1KGCD 1KCLA 4WTZA 3EO1A 4MQ7A 3SDCC 2B1AL 4ODBD 5EU7C 4AEEA 2OS7A 3U4EB 4BZ2H 1I8KA 3ULSA 1T22A 4XP6H 4RFOH 4LPWA 2AJUH 3S5LG 1EVUA 3VXTB 3X11B 3DO7A 5DHYB 2GJ6D 2BVEA 1IT9L 1I7UA 4OF6A 1XR9B 2H26A 4Z7WA 4BZ1H 5DD5L 3CPLA 4RWYL 4RA3A 4WHTB 1MCDA 4HLZG 4N9GB 1UWGL 5CKAA 3A6BL 2G5BA 4XWOD 4Y8DC 1BX2B 1LO0H 3VGGA 1UJTA 3BQUA 5T1DH 5L8LB 1HNGA 3UP1A 1UACL 4UU9A 3WDHA 1INQA 1DBBL 2L0DA 5CJXA 3TH2T 1C08A 1GOFA 1ZWIB 3KDMB 5C0AE 5E7FA 3H3PL 1S9YB 2BOBA 5LKNA 5EO0A 4DOHE 1RZKL 1YEDB 5DURD 5IEHA 5K9OA 3ISWA 1XGTB 3W5MA 3DO3A 1M7IA 3QIBA 5FIEA 3VH8B 4WO4D 1WWAX 2VN4A 4CU6A 4Y4HD 3KPMA 3EBAA 4K7PX 2BY1A 5I76B 4JG0H 3SGDH 2O5XH 4NDMA 3QNZB 4GMTL 5I1GH 1YQVH 1PLGH 3UTTD 5FB8B 2I07A 3PDGA 3O8XC 4PUBH 2DYPA 3VXSD 5JIKA 1W8OA 4PJ5D 4AG4L 5BQ7B 1CWVA 1JGDA 2Y5TB 4X9HA 1RJYA 3JVGC 3QPXL 3K0WA 5DK0B 2AXJA 3OKOA 4QXWA 3QULA 1ZLUK 4CW1A 3T3PE 5C6PB 1U95B 3VH8G 1T5WB 2FHBA 2QADC 4EOWH 2P7TB 4JM4L 2XN9A 3TEUA 5E2TH 5BV7C 4OCXH 4KROB 3NH7H 5D71L 3S3SA 1ZVHA 1WEJH 5HHNA 1DVFB 4PV8A 4U6TA 3HUJB 5D1QB 1OSZA 2R23A 4OZHB 3MRNA 4HDIB 2YUWA 1P84J 1TQBC 4UQ2B 5FOJA 3D3VD 2N4IA 3PIQA 1JF1B 3HR6A 5E0QA 2H1PH 5JW4N 2VXUH 3V8OA 1TCRB 1ZHLA 1HINH 1NANH 3BQUC 4G8GD 4M6OL 4Z76A 3U0PA 2I60H 4OZIF 2NY0B 2MPAH 4UOJA 3L1OH 4MWFB 3RKDC 5J56B 1EHLH 4U1MA 5DQDH 3E6HB 1XCTB 1AGBB 1GGCL 2IALB 4G6KH 4EI5B 3O3AA 5IW3A 2V2WA 4FTVB 4O2FB 2HKHH 3ARYA 2Q1EA 2JB5L 3H7LA 1D5IL 1CFNA 3LQAL 2GT9A 3F6LA 1AI1H 4YDLB 4JDZB 4X8XA 4JZOA 1F3DJ 1WF5A 1PAMA 2MWCA 3QH3A 5EU4A 5EU5B 3RWHB 1RUQH 2FJGB 2H32B 3LRGA 4XC1H 5KSVB 5GRVK 3L3HB 5CP7B 1UM6L 1XGYH 5HGHA 2EDLA 5HHOE 3RL2A 5J3HC 2AJZB 4CU8A 1J0JA 2Z31D 3W39A 4X83A 5KSAB 1CQKA 1RJLB 4NYLB 1U91A 1FZJB 3KPRB 3OBAA 5CP3A 2QQLL 4ZXBC 4P59L 2AQ1A 1G7MA 3ORJA 1QYGH 1BQUA 1RFDL 4Z7QE 3JSSA 1MJJA 1T6WA 4IDLA 1NMAL 2X1WL 1MCOH 1TJHH 3EHBD 5ALCH 1ZGLB 3ZT5A 2XFXB 2BOCA 3QHZH 5HGGS 5BO1L 5LGKA 2R0KH 1KJ2B 5DD6A 4Y5VA 1U2CA 2FZ3A 3G5ZB 5C0BB 2X6MA 3MJ6A 1OGTB 3WN5C 5DQ9A 2ZUYA 4XP4H 1G1CA 3PGDB 4M93C 4N5ED 4BFEA 1G7PA 2NTFA 1YN6B 3LZFL 2OR7A 5L8JB 2HVJB 2XQYK 5FHBH 2PW1B 2JJUA 2DM2A 1RIHL 1OP9A 1N6VA 2BNUA 1IQDB 4CGTA 1FNGA 4QHNB 3TF7C 1D5MA 5CAYB 4ZUVB 2UVFA 1JF6A 4FNLH 1FNAA 1NGQH 2DMBA 4G42A 3J7HA 5HDBF 4NP4H 4U33A 5FM8A 4WY7L 1LE5A 1CF8L 1ZHNB 2W0FB 3QUKA 4ELMA