5F1OB

Human cd38 in complex with nanobody mu551
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
DVQLQESGGGLVQAGHSLRLSCVGSGSRFDNYAMGWFRQAPGKEREFVAAISWSSGTTRYLDTVKGRFTISRDNAKSTVYLQMNSLKPEDTAVYYCAARYQPRYYDSGDMDGYEYDNWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 39
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1oB00
4EVNB 5HDBE 1WIOA 4J12A 4JRXE 1OQXA 3STZA 3SBWA 4GAJH 1IGYA 5BOPA 3QXTA 1OP3H 5FV2A 5ILTL 5BVJA 1DFBL 1FNSH 4HH8A 4XNYH 3WO4B 4PJIB 3DMMA 1KTKE 2XQBL 3OAUH 1JIBA 1A47A 4AH2A 2PO6C 4YXKH 5CEYB 3QQ4A 4HKBA 1KJMA 1IEHA 2WBJB 3A6CL 5KS9A 3MBEA 2AJUL 4M7JL 2DTMH 4H8WL 3C09B 5GGUA 1LVEA 2GT9A 2F5BH 2YMXL 4PY8I 5IHLB 5HVHC 1NAKH 2O5ZL 4N1CA 1A6AA 1DCLA 2R4SH 2CGRL 4IMLB 1RZGB 4K71B 5TE7L 3G5YB 3O45A 3VXUE 5BXFA 5IFHL 3DXAB 5F7EH 5SWSD 4U1MA 1K3ZA 2NY7H 3E6FA 4YR6A 1TZGL 3MRCB 4IRSD 4GKZA 3RBGA 2GJJA 4JREB 2QSCL 2FEDC 2IF7A 1Q9WA 1JPGA 5C0BE 3AS3A 4Y16C 2B1HH 5C70A 4NQCA 4G6ML 3VXNA 1T1XA 2QJDA 3P9WB 3ZT5A 3TBVA 4FFZL 5GGVL 4XBGB 4HEPG 2EE6A 2YPLE 4X9BA 5F96H 1A02N 4X6CF 4AEEA 1MFEL 2NW2B 2I24N 3V5HA 4J6RH 5TDNB 1VFBA 1RZKL 4NRYB 4LCYB 3LQZB 3ZKSD 4ZUUA 2VUYA 1A0QL 3BPNC 2H2PD 3O0RL 5EC2B 5J12B 3BPCB 4S1SL 1FN4B 2DD8L 3FO9A 4TNWF 4OZ4B 3QNXA 3DX8A 3TF7C 1OT1A 4KRPC 3OF6D 5GS0H 5J0BA 2FEEI 2LFGA 3BE1L 5AG9A 3BYTA 4EIGB 2GCYA 4IOIA 4ZSOB 5I16A 4NOBA 4PS4H 2ZOKA 4PLJD 3MOBL 5DMIL 4APQA 4KY1H 1MFDL 3BPLB 1G9MC 3W39A 4N0RA 1YPZB 1WGOA 3UYPA 2Y06H 4R90H 3S6CA 5J1AB 5A2IH 4HJ0C 15C8H 1SY6L 5CIPA 3GMOA 3MJ6A 4IIQC 3H3KA 1D5IH 3QUXA 1DFBH 2PTTA 5SWSB 2BXYA 1JTOA 2G9HB 4O51A 12E8L 3QNZA 4HBQA 2XQBH 2EDDA 4IRSB 1JGDB 1GOGA 1UYWL 4YQXL 1ZTXL 3B2UD 3FT3A 1ZOXA 2OXGA 2VZUA 3A6CH 3C60C 3MRIA 2AJUH 5J6GA 1T7WA 3RVTD 2VDQL 5FM5M 2R0LL 4Z5RB 1AIFA 4S1QL 2CGRH 1D5BB 5D7IB 2VWEE 3F7YB 1EGJL 3BQUC 1BD2B 1PAMA 4JM2C 1CCZA 1SJEA 4TTDD 2G2RB 1BX2B 1U8OB 1TZGH 1KGCD 3VH8B 2QSTA 4ZUTA 3CXHJ 1RIUL 1PSKL 4WFEE 3K2MC 2QSCH 3PIQB 3SDXB 3T09A 5JOPD 2JJWA 4JZJB 5D1XD 4NQVA 1CGYA 3OB0H 3HHRB 5D96B 2O5XL 4J7RA 3WNNA 3B4NA 4M00A 3C6LD 5HI5D 5GGVH 1MFEH 2N7AA 4E41D 5I71B 1B0GA 3OKYA 5DJCA 3GMLA 4BH7B 3GRWL 4PRIE 1JF6A 4X5XB 1NLDH 1O0VA 32C2B 1RZKH 3KXFA 3MRKB 4M6NH 4N0CD 4JDTL 4POUB 1A0QH 2ORBL 2D31B 4PP1C 1JRHI 3DMMD 4GG8B 3O0RH 1F2QA 3MX0A 5B21A 2XZQL 4S1SH 3D0VB 4JDZB 1AXSB 2EDBA 4KMQA 1WAAE 4LPCA 4MJID 4PJCB 1D5ZB 4Y1AA 4HD9A 5HHVL 1TZIB 3I75A 4UOW0 1RJYA 1MPAL 1IMHC 5JQ6L 1NMBH 4YBQC 3WBDA 2FIRT 4UV4L 2XWTA 2I25N 4PB0L 3MOBH 1YMHA 4H5SA 3VMPA 2VQ1A 2UWEB 2X1PA 3MTRA 5FXCH 1GGIL 1SY6H 5AAWA 3QZWG 2JJUA 4YIQB 2CLRA 2LVCA 4WWID 1R3IH 2HFTA 4PJGE 2W65B 4JFXA 1BWWA 1GZPA 1ZT4A 3PWPA 12E8H 2VDPL 4RNRB 4LLDA 4G3YL 2OL3A 1ZTXH 4NQCD 3U4BL 5JDSA 4G6JH 5DVLA 5CD5C 3GSRA 1FP5A 5D1XB 3M45A 3MRQA 3ULSB 2R15A 5DQDL 5BO1L 2VDQH 2R0LH 5KVGL 1ZGLB 3WO4C 1NAMA 3S88H 1N6QH 2VN7A 4PJ9B 1KV3A 1X5YA 1HWGB 3RUGA 2KKQA 2YD2A 4L1DA 1A8JH 4XAWL 4AIZB 1N8ZB 5BQ7B 4E41B 2WBJC 2H2SC 3ME0A 1EGJH 5ENWA 3BSZL 2YZ8A 4S10A 4Z77B 5JIIA 4J2XA 3C09C 4WW1B 1T7VA 3VWJA 4E5XA 3T65B 4IJ3B 2P1YA 2ENSA 3LIZL 1YDPA 1PSKH 3OKOB 4LEOB 3L1OH 5K9JH 4K71C 4AH2B 1ZS8B 1WT5C 5CZVL 1R5IA 4KAQH 5J6HB 4MJIB 4LKXB 2O5XH 1FIGH 5HI4D 4GS7B 3VXMB 5EZJB 3PWLA 1XEDA 2LAGB 1SM3H 5E2UH 2IQ9L 3QWOB 5KVEL 3PF2A 3IFLL 4YFDB 3UZQA 1BJ1J 3B9KA 5TH2B 3GRWH 1NH6A 2HG5A 4YDIL 5BXFB 4NKMB 1B9ZA 3QUXD 4GSDL 2YHGA 4U1MB 3L5HA 2F54E 4C58B 1A7RH 3VFNA 3REVA 5E8EB 4D94A 4GKZB 4C55A 5C07A 5HY9B 1AHWA 4LBEA 1CXFA 2B4CC 2B2XL 4Y0GA 1ORSA 2PR4H 1M7IB 1MPAH 4H8WC 4NQCB 4DVBA 3Q2CA 1T1XB 2GJZB 5JQ6H 2ICEA 3JWNC 3KVQA 4BQCA 5EBGA 2H8PA 4UV4H 1WVZA 5J12C 2R4RL 1YC8A 4PJDB 5A2LH 3BP6A 4M6MH 1T0PB 4HDIB 3NMEA 1TTGA 4HK0A 1W0WB 4KJQD 1MF2H 4AEIL 4L29A 4POYA 3MV7A 1K5NA 1MH5B 4ZNEE 1D5MB 3VXQB 4RDQG 1F3DJ 5D5MB 1HDMB 3NZHH 3OJMB 5T1KB 2BRRL 1D6VH 3IJSB 1H9VA 2VDPH 4WIQA 4IMKA 3BPLC 5F9DC 3DX8B 1MIMH 3FL7A 1JPST 3U4BH 1CDCA 3QDAA 3M1BA 3TBTB 3KJ6H 3NCFB 3UZEA 1B2WL 1ADQL 4X6FA 3D2UD 3RPIB 5LGJB 4ZFGL 5KVGH 2GTZB 1KPVA 1IKFL 5E1HB 2BP3A 4OZIA 4GQ9L 4CU8A 4IRSC 4U7KA 3KPNB 4O58L 3DGGB 5M95B 3W39B 4CMMA 1RZJL 1XF3A 4IRZL 3SE4A 5L6YH 2Y36H 1LEKA 5CIPB 3KPRA 5HGBA 1A1NA 4HS6B 4MXVF 5EUOF 1PX3A 1XF2B 2PTTB 3MRDB 4NOFA 1XR9A 1YECL 1BFVL 5CJXA 3LIZH 1PQZA 4O51B 5ALCL 3Q3GB 1QACA 1N4XL 5E08H 3QWRA 1G7IA 4FFWC 3FT3B 3X13A 2AI0L 2DMBA 3NH7H 2XYCA 4RSVA 4PJ5E 2PYFA 5FA3A 4MD5B 1G7HB 2JB6B 2NLJB 3B3IA 3GMRB 4G7YL 4LSRL 1YMMB 3ZDYF 3FRPG 4OLYL 2IQ9H 2WLZA 5KVEH 2VLJB 3WIHA 3MCG1 4JZJC 2RQ8A 1HN1A 4OZGF 4XPHL 4AY0A 1NFKA 4ZAKA 4OAWB 3PL6B 5DD1L 1CVSC 5D96C 5F7MC 1SJEB 3VXTA 3B5HA 2BK8A 4ZTOH 5EZLA 3PWPD 1FYTD 2ZSWB 1M4KA 3QEGH 3LEXB 4RFOL 3L3DB 4PBXA 2VAJA 1J5OL 5I71C 4NQSA 3JVGA 1DZBA 5GGQL 4Q9QL 4KV5F 3QA3B 4PLJC 1V3KA 1H5BA 2JKXA 2R2CA 5TDPA 1INEL 1JTTA 5HYJE 1GHFL 2B2XH 2HYMA 2I07A 1DN0B 1FZKA 3R8BB 4N5EC 3HB3D 4P2CG 1EJ6A 2H9GA 4Z0BL 1MVUB 4TSCL 3D2UB 3L3KA 2OXHA 2WINA 1B0GB 5C86A 4N0YH 5HPOA 2V5TA 3ARFA 4Z7UE 3VWJD 1MAMH 4AEIH 3B2UC 4U6YA 4NNXB 1TJHL 5KANG 3HS0B 3RY4A 2Y9RT 1FNHA 4JRYE 3RVTC 2RCSL 1PG7X 3MCKA 5D1QD 3F8UB 5E2TL 4MSWB 4LNRA 2IAMB 3M17A 5CD3A 2GK0A 3DROB 4DN4L 4CL7A 1G7QB 3MV01 5DVMA 4AG4H 3JUYA 1WIUA 4GRLA 4HGWA 4ZFGH 1IKFH 3B9KD 2Z35A 2WLYA 3HUJA 1FO0A 4O58H 2VQ1B 4MDIA 2I5YL 4NO3B 5AG8A 1UQSB 2J3SA 5D1XC 3PNWA 4LSUL 4QTHA 3QXDA 5IVXF 5DD6B 5I8OH 4YHKH 1HHGA 3RL2A 2VUOA 1NCAH 4F2MB 2Z31A 3EDKA 4L3AA 1V5JA 4G42B 1YECH 3CFKB 5DK2A 1BFVH 5KZCB 1EO7A 3X14B 4PJ9C 2Z92B 1ZT4B 5IM7B 2BJML 3PWPB 1FYTB 1RHFA 4G5ZL 2DYPA 3T3MF 4FFVC 1N4XH 3RWFA 4JM4H 2P47B 2YPKA 3EOYG 4ETYA 3P40A 4DUXA 4IJ3C 4K3DL 4X83A 3LB6D 3UYRH 1ES0A 3ZMRA 1VACA 3MRQB 4N0CC 2Q20A 1AY1H 4U3XA 1EHLL 4PG9A 4PUBL 1FNAA 1TFHA 4LSRH 3KLAB 4OLYH 3R8QA 2OJZL 4XPHH 1UG9A 1FAIL 5DD1H 4LLUB 4YXHL 4GS7C 4H88H 4E5XB 5I19H 2QQLH 3IDIA 1ZKAA 5DFVD 4P2RE 4YHNA 1CQYA 1NCTA 3UTTA 3X17A 2HJLB 4OZHA 3TV3L 4RFOH 3VFSB 1J5OH 2G75B 3BZ4A 3NIGF 3PWUB 2XTJE 2R1YB 5D1QB 1P4IL 5FK9A 2IH1B 5DJAA 1MHCA 1JPFA 1SBSL 3QDJE 4RAVB 4W6WB 4WI2A 1HINH 2AJSH 4M62L 3FAXA 4WW2A 4I5BA 3O9WC 5BS0A 1CT8A 3UTZB 1P53A 3O8XD 5EBWB 4Z0BH 4KJYA 2K7PA 4NZRL 5BCAA 5IIEA 2DOCA 4UT7L 5EZIL 4F7TA 4Z78A 1KT2A 4NDMA 5FOBA 1RZ8A 4PRPB 3QJFB 3KPRD 3IRPX 3HZKB 4TUOB 4P9HL 3CNKA 1VB9A 3CH1A 3G5XB 3EYVB 4OD1H 3QWRD 3P4MA 3BISA 2BSSA 2HTLD 2KZ1B 4G8IA 4OM1L 3RGHA 4NRZA 1S7SA 4DEPB 4N8VB 1NFIB 1IKNA 2VQUA 1BVLA 3ALPA 4ALAL 4XGZB 1QTYT 4OZFG 2PYEE 1HSBA 3CXHK 1NQBA 3MROA 3E8UH 2EDXA 1I85A 3T4AA 4IDJL 1AFVH 3U82B 2P8LB 1N59A 4Y5YA 1CDHA 3O4LA 4NT6A 4YHPA 5ETUA 3QDGE 3TVMA 2R0KL 1AQKL 4M7LL 4R4FH 5MP6L 2FYYA 4LSUH 5TQ2L 3RNQA 2DWEB 4MNQD 2OTPA 2YD9A 3QUKB 1IZKA 1YA5A 5HI4C 5IFAH 2VLRD 2MPAL 1GIGL 2M26A 1V7NH 2PTVA 2AV7B 4G5ZH 4JN1L 1Q9LA 1LP9F 3U36A 5EU6E 1NC4D 3MRBA 3M1BB 3G04B 2DMCA 2R9HD 1DQJB 3KYNA 4M61B 3TT1H 2GIYA 2DMKA 1M71A 4XP4H 3FHQA 4XB8A 3MXVL 1EHLH 1HILA 1A4JA 2VXQH 3MNZB 4PUBH 4RZCA 3MYJA 2F8XC 3SJVA 1A7NL 3S4SA 3MODL 3O8XB 4LHUD 5TE4L 3PJSB 4WY7H 2BDNH 4NWTL 3MRGB 1A1MA 3HZVA 2WV3A 4QT5B 1DL7L 5HGBB 4D8PB 1A1NB 3MRPB 1PG7H 1U8LB 4UAOB 2QTEA 4OT1L 4PTUB 3TV3H 5K33A 1PQZB 4U1JA 5KSAA 3DRQA 3VFWB 3LKPA 1R0AH 1MUJA 1FL6A 2FX8L 3TP4A 3E6HB 3PL6C 4R26L 2JLLA 1P4IH 3HAEA 3X13B 4N0UA 5I74B 3B5TA 3JWOH 4KJQC 4GRLD 3LCYA 5F6HI 5HI3D 5FHAH 3STLB 1ONQA 5I9QB 1I8KB 1FL3A 4PBVC 5JIPA 3B3IB 4FQCL 3B8YA 3L3IB 4FZEL 1MLCA 2FJFB 3GBML 3GSQB 3D18A 2RJMA 4EDXB 3ULVD 1RZJC 2Z31D 4F7MA 5KN5A 4Q9CA 3DRTB 4KDWA 4PB9L 1FGNL 4TVSa 3LH2L 4RIRB 4MNQB 4F15C 4M3KB 5I1CH 4MXQC 2JIXD 2NX5A 2VLRB 3VD4A 2AERT 3LEYH 1M1SA 4ALAH 1MQKL 5C09E 2BY1A 4NC0B 2J6EA 3HCVA 1NC4B 2QBWA 2AJVH 4Q2ZA 2DBLH 4IDJH 2H9GB 1S9VB 3FQRA 2M1KA 4NRXA 3L95A 1NPUA 1IAIM 5J57B 5F3BA 3UTSD 4CU6A 4HJJL 2IAMC 3MLSL 1AGEB 1AQKH 4M7LH 3DO3A 4LHUB 5DEGB 3EFDL 3A6BH 2NXZB 5TQ2H 2NR6D 3UTTD 1TVBB 3SY0A 1JI2A 3ARED 4HIJB 1ED3A 5F7HA 3D69A 4BQ6A 1WTGT 4RRPG 3ARPA 3DTXB 1FCGA 2FECL 1IC5L 1UWEL 1QP1A 4XCEA 3MCKB 1KOAA 1T04A 1T1ZA 4JN1H 3QWQB 4E42B 2DS4A 1RJZA 2H32A 5L7XH 2C3VA 1NCDL 1UFUA 3M17B 1A3QA 4XB7A 1K2DA 4NIKB 4KJWD 4DVRL 4X4MA 2DIAA 3MXVH 4GRLB 1S7RA 3C2SA 1S78D 3MLXH 4X6BA 4BK4A 1CIDA 3F12B 1YQVH 4G8FB 2V17H 1J11A 1OW0A 4MD0A 1FNFA 3HUJB 1FO0B 3IETA 2V5MA 3MODH 5TE4H 3O81A 1MRCL 4PJHE 3IDGB 4NWTH 1TTUA 3QDHA 1BZQK 1KB5L 1LEGA 1UKSA 3UO1L 4RMRA 1I75A 1HH6B 1BAFH 2Z31B 3EZ8A 1MCWM 1BQSA 5DK2B 4R7NA 3NACL 4OT1H 1FZMB 3HB3C 5EU3B 1EMTH 5HHOB 2EDOA 5IMMA 3TNMA 2GFBB 3OJVC 2WQ8A 1FNGB 2FX8H 4JFHD 2FR4B 3I2CH 4OCRL 4UQ2A 5F7YC 3VFGL 3O2WL 2JIXB 5BRZD 1AGBA 4WFFD 1BQUA 2IPKA 1K4DA 4LOUD 3ZZ1A 3O11A 1S7UA 5D6CA 4FQCH 1K3IA 3BAEL 2YWYA 5AWNL 3LQMA 3V4PH 5D1QC 3WUZA 1LE9B 1MIEL 3GB7A 4ZO8A 1T20A 3I85A 5IW1B 3UTSB 2E7CA 4QRSB 1CE1H 4YHNB 3LH2H 3O3AB 1U95B 3AREB 2HLAA 3BP4B 2MHAB 2IG2L 4K55A 1YN7A 3I02A 3A67L 3VFUA 3U2SB 2DQUH 4OBRA 3EBAA 1JZ4A 2MKLC 4R96A 1MQKH 3JBG7 3KNBB 4HUXA 1MHCB 1KENH 1KB5B 3QXAA 4XP1L 1Y0LA 3B9EA 5ID1B 4UTBH 3NFPA 4I5BB 4P49A 4ZFFB 4HLZH 3PHQB 3VGGA 3LHPL 5GGTL 4DEPC 2E27L 5K9QG 2C5DC 1U93B 4F58L 1KEML 3DYOA 3KPOA 5E2JA 1HH9B 4PRDB 4NDMB 4MD4A 3ARYA 5FOBB 3JV6B 2WWMC 1A64A 3UBXB 3BESR 3RJQB 3DYPA 4LPTA 4L4TE 1TJGL 3LB6C 4GRMB 5KSAD 4JFYB 1UZ6F 4LLQA 3QQ3B 1TENA 2G60L 1IC5H 2AXGA 2QSQA 2XQYG 3KPLA 1CDGA 4NQDA 3TCLB 2BOBA 3L3JB 1WIPA 4JM2F 5IEHB 4G7VH 3UDWA 5F71A 1F4YH 1NCDH 5CUSL 4BKLB 4Y5XB 3VXUA 1HSBB 1J8HA 4AMKL 3PP3K 5FUCE 5BRZB 3MROB 5EUOE 4MJ6A 3T4AB 5DFVC 1EHAA 5FUZL 4J3TA 3D39A 1MJ7L 1QZ1A 5IT2L 2DL9A 1U3JA 4KK9D 4YHPB 1OB1B 3PUCA 2YD4A 4N1EA 3PWVB 4G9DA 2HH0L 1DLHB 3G5VA 4WI5A 5FKPA 5B38G 5D2NB 3RNQB 1QA9B 4P9HC 3VFOA 5GISL 3UO1H 4M9OA 5LKNA 4I3SL 1U8JA 1Z3GH 2P5WE 3ZDYE 3BUYA 3TO2B 3UC0L 3O8XC 1FYHB 4LPYA 4RBPH 1PZ5A 2BNUA 2W9EL 3S5LA 4D2NA 4XNXL 4I4WA 1NFDA 3AAZA 3O2WH 5F88B 1I8IB 3I6KB 4LL9A 4P46D 4NKOA 2VRAA 3UJJL 1M71B 1N2RB 2DN7A 3KPMA 1NGPH 4UAOC 4HKZA 4WHTA 4A2MA 5CJXC 4RZCB 3MYJB 1V3LA 1E6JL 3BAEH 2YPVH 2CKBA 1QFWI 3S4SB 4KV5E 3NCYP 1MIEH 2HTLC 3RWGB 5I74C 3QULA 1DQDL 4JEGB 4JCLA 3GSNA 3QBTB 5I9QC 1QEWA 3QYCA 3V5KA 1RY7B 2JF1A 5LJYH 4GAFB 1W8NA 4EJ1C 4KQ4L 3LKPB 4NPYA 2Z91A 1OOAA 2FGZA 4JJ5B 5ADOH 3BN9D 4U6XA 1OAXL 1TQBB 4G8GB 4L8SB 4MYWB 4N0UB 5DRZA 2BNRA 4X6DA 5EOCJ 1BP3B 3IJYA 3WN5B 3GZKA 4QKXB 1ONQB 2CIKB 1RZ7L 3OKMA 1IAIL 4KMLB 5D9SB 1VGEL 4JLRA 1GXEA 4PJXA 1FG2A 3LHPH 2OBGA 4D9RD 4HZLA 4F58H 1Q8MA 5GQBA 1AO7E 3MNWA 3VW3H 4E0RB 2R9HC 5SWZA 4QYOB 1TJGH 2HJKA 5CINH 3PQYE 4WEBL 5AZ2L 1MCQA 2G60H 1UB6B 3SGJC 5C0RH 4MMZC 1OGTA 4GLRI 4K23H 2HT2D 3VGHA 1HSAB 4JDVB 1A7PL 1A9EA 2NXZC 4NUGL 1JK8B 4V1DE 3SDDA 4TUKL 1OAKL 4AMKH 4P46B 2BX5A 5GXBB 3GM8A 2OTWA 3WFZA 3FO2B 5IV2A 5FCUL 5HYIA 2VNCA 1MJ7H 1IGFL 3T3ME 5F3BB 3FOMB 2QLVB 2HH0H 5FDWB 3UJIL 1KBGH 4BA8A 3SO3B 1CFNA 5GISH 5DMJB 4GRLC 4XCCH 3ETBF 5HI3C 2P46B 4L1HA 4ZDHB 5CP3H 4MQTB 5MEOA 1PBYA 2Y7QB 1T1ZB 1ZT7B 3ZDXF 3R0NA 1LHZA 1QHPA 3ULVC 3CFBA 1Q0YL 1S9KC 5D7KD 4PLKC 1KYOJ 1RJCA 3FQUB 5IB3B 3V5DB 3MJ9A 3C6SA 2JJSC 1C5BL 1C7TA 4QRPA 1J05B 1KIQB 1AKJD 3IETB 3T1WA 3EFFB 3NIGE 3PDOB 4HUUB 1DLFL 1S5HA 4FQLH 1CK0L 2X09A 3VA2C 5ISZE 3TBYA 2UZIL 5HHQB 5K9OA 4XPGH 3GUTA 4HIIB 5I1EH 1E4XL 3V6FA 3ES6B 1LNUA 1QRNE 1R3KB 4WEUD 4NQDD 4OLVL 3LPGA 4U0QB 5C0AE 3ARVA 4XCYB 1T4KA 1UKQA 4K3JL 1OF2A 2EH7L 3ZDZE 3LPFA 4YBLB 1FNEA 4P5MB 1UJ3A 4OLUH 4XAKE 4L9DA 1BGXL 2NR6C 1RZ7H 1IAIH 3AREC 4PJEA 3BT2L 3O11B 1S7UB 1IM9A 5EOQL 3D39D 5D6CB 3DURA 1YPZF 5IMOB 3U9PL 4D0CA 3D1MC 2R8SL 4MAYD 3GB7B 4GW1A 1EEZB 3QCTH 1MCPL 1ZWIB 4WEBH 5AZ2H 2ICWB 4Y7MA 1S78C 3VD5A 2LVEA 4RGND 4U7SA 1FC2D 2ZUWA 4JFPA 1CGXA 5JHDE 2I60L 1YN7B 4LHQB 2D0HA 3I02B 4LLVA 2DQFA 1H3GA 4KK8D 4YWGH 4HUXB 2C3GA 2DBJA 1ZHLB 3QXAB 5GGSB 3QG7L 3LRSA 4C56D 5E70A 5BW7C 4GT7A 5IKCA 5D7IF 2DJUA 1Z2KA 2Z8RA 4DK6A 4MLIA 4QLRA 2D7PA 4QRRE 5FM8A 1MWAA 5IFJA 1IGFH 2CR3A 1TXKA 4CGTA 2V2XA 1REIA 4MHHG 1AKJB 4KZEL 1LO5A 4HUNB 1GGBL 4Y5XC 1KJ2H 3T04D 2CIIB 1KELL 4G9FE 5DRNB 4OLWL 3NFNB 4OF8A 4NNPL 1TETH 4X7FC 3SDXF 5K9KA 4LOUC 5C92A 5INDA 4PV9A 3BX7C 1A1OB 3VXRA 4NQDB 3RTQA 3WSQH 1JFQH 3KAAA 3WHE0 5D2NC 4OSUL 4GKNA 2ARJQ 4PRBB 3HC4H 3ZKQD 1FV1B 4LLYA 1LMKA 2DDQH 1N3NB 5DRWA 3M07A 2X4RA 4HH9A 1E28B 5CKAA 3ULUH 3AM8A 4G9DB 1DLFH 2GW5A 3TBSA 2NY5H 5SWZD 3QFJA 5AYQA 4MAYB 2ZSVA 4KUZL 1MCEA 1IEAB 2XWJA 1JYWA 3RGVA 1J87A 3ARGA 1UXSA 2X4NB 4PJCF 2AP2A 4PJ7A 1ZLVH 3BO8A 3VDCA 4OLVH 3DECA 1JGVL 2BHUA 2EO9A 3BDBA 3MLYH 1NBYA 2BNUB 3VFRB 4ELKA 1M7DA 4K3JH 3AAZB 4M9PA 1EEUA 2XY1A 1R6VA 5TPWL 3O6LH 1BGXH 3GM0A 3FAWA 1TLKA 4WHTB 1ND0B 3BT2H 2ED7A 3EGSA 3MLRH 5EOQH 2UWEF 5JORB 4C56B 2M2DA 1YEGL 3P0YL 5D7LD 3U9PH 2VIRA 4XCFH 1MCOH 1TQBC 1MCLA 4G6KL 4L8SC 4LSVL 3WN5C 1MFAL 3TEUA 1NEZG 4K9EL 4LRIC 1MCPH 2ESVA 4HC1L 3FOLA 5FGSA 3WDIA 5E9DB 5L2KA 5DFTA 3VMNA 5J9PA 3ALWA 3KDMA 3GSOB 3QO0B 4XPAH 2E7LC 1YEDA 2Z91B 4NPYB 1BOGA 2I60H 3RVWD 4U6XB 2X05A 2EYTB 3HC0B 4KK9C 1JWUA 4RA3A 4CMHB 5E24E 2WZPD 3WFEL 1R5VB 5IHZA 5IP4A 3QG7H 2X4PA 5F72S 2XFXA 4LASH 3U4EA 4K7PY 4NKIL 4WU5B 2A9NL 4JLRB 4QRPD 3O3EA 4HKXB 5KVFH 5E00A 1I8MA 4ODTH 1LD9A 1JMXA 1PLGL 3WUWB 4M5YL 2VSCA 5E94A 2VSDA 2JK5B 1XCQB 3MRMB 3MNWB 1CL7H 3AMLA 2MWCA 4P46C 4NN6B 4X0KB 2R23B 1A6TB 1H3PL 4QHUB 2X40A 4OD3L 4HUWA 3MGTA 4LPXA 4U3CA 1KULA 1OGTB 5F1IA 5CBEA 2HVJB 3S35L 2WM0A 3MA7A 3SCMD 3SO3C 2NW3B 3TH2T 4P2OA 4OSUH 4QXTA 1IM9D 4MA3A 5DMKA 1A7BA 4KVNL 3MOAH 4QXWA 3JV4A 1EO8L 2C4XA 5IV2B 5IMKA 5KG9A 4YK4B 4I2XE 5GSVB 3C2AL 2FL5B 5D7LB 3L5WA 3BN9C 3OR7A 1HKLL 2ITDA 2CLZA 3GJFK 1CFNB 2WBKA 4XH2A 3X11A 4HX1B 4W81A 4OGAD 3VRLF 1EXUA 4K8RL 1WV7T 4KROD 1JZ6A 4XVJL 1BQHB 5DT1L 4P23B 5DD0H 3HMXL 1BVKB 3JSSA 3KLDA 5D72L 5IEKB 2VE6A 2IEPA 5MEQA 1T21A 5DJ8A 1HYSC 4Z7NF 4PJDF 1I3GL 5HGDA 3GJEB 3F6IA 1VFAB 1C1EL 1EHXA 3IFPB 1AXTL 3G08B 3G6DL 1KPUB 1PDKA 1G7MA 4RISL 2NY2B 1RULL 5EPMA 1YEGH 3P0YH 4QRPB 3DV6B 4UINH 3UJTL 4NZUL 1RAMA 3OWEA 1NGWB 1YYML 2H26A 4YBLC 4G6KH 5JIHA 5TDOB 4GAYB 3OKDA 1X5GA 5CMAB 5DEFA 2IANB 1MFAH 5GGRA 4KKBC 4ODWA 2N1KA 3P11L 4NZJA 2EC9T 1CLZL 4J4PA 4IM8A 2V6HA 5KOMC 1HNFA 2XN9A 3VXRD 3RTQD 2LV4A 2M8XA 3RWIB 5HYSA 5EU7C 1T5XA 4QXGH 2IWGA 3ZYZA 4QEGA 1FNEB 1S7VA 4Y2DA 3SE9L 3WFEH 4QOKA 3SCMB 3TLRA 1QLEL 5B3NA 3H9HB 4G43A 3J7HA 3IS1X 1YY8B 1PLGH 4CNIB 4M8QA 2FHBA 2QHRL 2R39A 3FN0L 4M5YH 3GSVB 3QFJD 4YUEL 2W38A 4GW1B 3OHXB 3ARGD 1CDBA 1OWWA 4UIKH 3L3HB 2VITB 4WFHE 1A22B 3P4OB 1HHHA 5GS2H 1W72A 1H3PH 5EA0H 4S11A 4MAUL 1XF4A 4OD3H 3SE3A 1UM6L 3C8KA 1QLFA 3B5GA 3WXWL 1KJVA 3U7AA 4N90D 2HT3D 3CSYA 4LLVB 5JXEC 2CH8A 4O9HL 2YUXA 1ORQB 3GMPA 5JXAH 4OV5B 4EBQH 5IKCB 3KYAA 1RUPL 1GC1L 1Z0NA 4X6CA 2UUDK 2GKIA 3BHBA 1LK2A 5FO9B 3UX9B 2NXYD 4FZ8L 1IGTB 3EZJB 1FVDA 4XVUD 4HCRA 1HKLH 1T66D 2X4UB 1S8DA 5C8JA 2YSSA 1AR1D 3BW9B 3ZHDA 1S9WB 3MRHA 3CFCL 5A40E 3T0EE 3AU1A 4K8RH 1DDHB 3JTTA 5F3HA 4LLWA 5DT1H 3W82A 3QEQD 1K4CA 5D72H 5DLMH 5GRUH 4DZBB 1A4KB 4Z7QE 4W6XB 4MAYC 1XGTB 3FO1B 4GKNB 4GO6B 2JE8A 4HUVA 1PJ9A 1YEIL 1CF8L 1WICA 1TVHA 1ZGLP 1C1EH 3G6DH 1CXHA 2CK0L 2D3VA 3KJ4B 1RULH 3OXSB 1I7UA 3DX9A 5LGKA 4NZUH 4ZQKA 1A14L 1IBGL 2VLKA 5EU5B 3BGMB 1F8TL 2H6PB 4MQ7A 4R4ND 1BPVA 1NMAL 4KK8C 3P11H 1TCRA 4AIXA 3BRFA 2E9JA 1UXSB 3KLHC 4YHIB 4OF3A 5HD8D 4AENA 1DE4B 2V2WA 3WNKA 4P2OD 4EI5A 5DA0B 4BELD 4DGIH 1MEXH 4ZFOA 3QDGA 3SE9H 3B2VH 4P57A 3IF1A 4X4ZA 3DX6B 5DUPL 3K8MA 3KPQA 1MCSA 4NFBA 2ZP0T 5T1MA 1NDGB 3H9YA 2OL3L 1NUGA 2QHRH 2VIRB 1OSPL 3FN0H 1E4KC 4YUEH 4NBYB 5D4QA 1CIUA 4CMHC 2IADA 3BZEB 1SEBB 3W81A 2NXYB 5ESAB 3NA4A 4XWOD 1TQCB 2E7HA 5T3XE 4PYGA 1ZANL 3QJHA 4Z0XB 1OD9A 4MAUH 3MV8D 4FTVE 2GUOB 5F8QC 5C0GB 4XVTL 5H94B 1YEDB 3WXWH 1YN6B 4LSPH 5TGBB 5E8NA 3TNNA 3QEQB 3LDBB 3U48A 4O9HH 1MCWW 4NN6C 3NOIA 5IVZA 2XFXB 3RUGF 4M4RA 2KL6A 3U4EB 3QPXH 3T0BA 1RUPH 4ZS6D 1GC1H 5IW6A 1I8MB 5KVMC 3VCLA 1I1FB 1LD9B 3BGAA 5E94B 1E27B 1I1YA 4FZ8H 4LVOB 3D9AL 1EDQA 3P73A 3TO4D 3UZVB 3ZDXE 4JO1L 4G80A 3MGOB 3QHFL 4MNGB 4J4PD 3X3GH 2J4WL 4K9EC 4ZTPL 1I7ZB 3HE7B 5IR1A 1R3LA 4WCYL 3TPKA 3MO1B 3WEXB 5BZDB 1U8IB 1YJDL 4YK4C 4O2FA 3DJ9A 3L7FB 3OGCB 4Y2DD 3P9LA 2FH6A 4QOKD 1QPPA 4P9ML 1QG3A 1CG9B 1D5XB 4KQ3L 2CK2A 3BD4A 1KIRA 2FEEL 5J7CC 1QSFA 3IKKA 4HS8H 1JHLH 3ZTJH 3RWJB 4GW4A 1XIWD 4P23C 4DKAA 4XNUL 3ULUE 3WIIL 4X8JA 1U8KA 1IBGH 3C5SA 5DYOB 3P30L 4R4BB 3BH9A 1NMAH 4XH2B 4QHLB 4XI5D 2YKLL 4GFTB 1MSPA 2HT4D 2V9TA 4P3DB 4BSVB 1JJUA 4OUUA 1MCNA 2NY2C 2AKRA 4HIEB 4ZUVA 3CLFL 3MV8B 3OKLA 2XTLA 2FX7L 4WU7B 4PIRF 5D6DA 3KWWA 3QDMA 2F8VA 4F8QA 1JGLH 4YDJB 1WBYA 3FTGA 1KPRA 1YNTA 1MQ8A 2BSTA 1QHOA 5EPMB 2VZ1A 3EYUL 1YEFH 2OL3H 5DQJB 1FG9C 3IVKB 4ODSH 5D2LA 1DUYB 1BLNA 3W5MA 4ONHB 5GGRB 3TO4B 4ODWB 1KFAH 3SCMC 3ZE2F 5C0CB 1D9KB 1NAMH 1HZHL 2BVEA 1TIUA 4K2UH 5D7IE 4K7PX 1ZVHA 3SKNA 4LF3A 4GMSL 4GH7B 1MJ8L 5FF6A 2WUCH 4XP9L 1M05A 5I1IL 1S7VB 3SQOH 2I9TB 5F7FA 1ZHBA 2VISB 3N85H 4F7EA 3CVHA 3SDXE 2YRZA 1A5FL 4DCQA 2PW2A 4OGAC 4WGWB 4I0KA 1D7FA 4U4BA 3VXSA 3BP5B 4UUJA 4AT6A 2E6JA 4ORGA 2OR8A 1XIWB 2D2OA 3D9AH 1MJJB 1RJLB 2A2QT 4PJFE 1A7OL 3QHFH 3WHXA 1A2YA 4ZTPH 3VDBA 4Z7VB 1Z5LB 3HNTL 2B5IB 4O5LL 4ENEC 4WCYH 5I73B 3WIHL 1YJDH 4EI5D 3IXAB 1EJOH 1JRHL 5EDXA 2F8OA 4P9MH 5E2WL 1H3UA 2A6KB 1OTSD 3OAZK 2DLEA 2NTFB 4LVHB 4HMDA 4JAMA 1MFBL 3RWDB 2VL4A 4PJCE 1NCWL 3D5OF 2UY7A 3TIDA 4XNUH 3WIIH 1LK2B 5ICZB 1I7RA 1S7WA 1QNZH 5T3ZD 4NHUA 3P30H 2J8UB 4K7PL 1EX0A 3X3FL 5C8JB 2VR4A 2YKLH 4PTTA 4ODVH 3MRHB 1NGYA 1B4JL 2VLLA 3IDNA 3KJ4C 4NP4L 3JTTB 1CFSB 3HI5H 3RL1A 1ZLUH 4J3XA 2DLHA 2P7TB 1F90H 1NGQL 1OGAA 3VDAA 1J7VR 3QIBD 2YUVA 2OLDA 3TWCL 7FABL 4M02A 4OKVA 5IROC 2F53A 5T3ZL 1DQTA 3W0WB 3DVGA 4RFEB 4A6YA 3ESVF 4UTAL 1TVHB 3L7EB 4MB4A 2W0PA 1GC1C 1BFSA 1EAPB 5FB8A 3FQNB 4QCIA 4WTZG 4ZQKB 2A77L 3RA7L 2W91A 4JHZA 5CJOL 5JMOC 2DB8A 2FO1A 2MQ3A 2BY0A 4OFYA 1EPFA 3MR9B 2F74A 1HZHH 5C0DB 1JNHA 4YPGA 3FB6B 3UBXG 2I9LA 2N7BA 4LLMA 4YO0A 4ELMA 4GMSH 2G5BA 4HHAB 1MJ8H 2XRAH 3F58L 4GXUM 4J1UA 3D3VA 2NXYC 4I3RH 5I1IH 3BWAB 1TQCC 3C5JB 3AXLA 4GMTH 4XVUC 1T66C 1VEOA 1QQDB 2ID5A 5SX5K 5CEZL 3HUJF 3WFCH 1AR1C 2ATKA 1A5FH 1NKOA 1OP5K 1MHEB 5F7KC 4C83B 1CDYA 4EIZC 3MRFA 5KS9E 3ULVF 2P24A 1J0IA 4J8RA 4TVPD 4BFIA 1C16A 3BKMH 3LDBC 4OZGA 5F89A 1A7OH 1NL0H 2CXGA 4JANA 4Y4KA 3GIZH 2DQEL 4O5LH 3BZFB 3AUVA 3WIHH 4EDWL 5JPMA 2H45A 3QCVL 1WBXB 4LVOC 3RQ3A 5IBLD 3H7BB 5E1AA 3QDMD 2VYRE 2OMBA 5E2WH 5E8NB 3TNNB 3QIBB 5T1LD 1T83C 3HE7C 4WFGD 4R4NC 4JHBA 5F9OH 4JG1H 1MFBH 3VRLE 4LGSB 3V0VB 1NCWH 4GXVL 3WE6A 5FO8A 2Y25A 3VCLB 1X5LA 2XZZA 4NQCE 4PRAA 2VZVA 4HS3A 5EN2A 3P73B 1Z6JT 3EJZD 2OTUA 2PNDA 4G80B 3X12B 2EEAA 1FFPA 2O61B 2OP4H 4K7PH 3X3FH 4B7IA 1JGEA 1URLA 3V6OC 5DC4B 4Z7NE 2IH3A 2XG5A 3T0VA 5IR1B 3D87B 3MFGB 1B4JH 1XGUB 5DZOA 4FQHA 3CX5K 3FB5A 3G6JA 3QRGH 5IJKC 4NP4H 4WI7A 2GTWA 2ADFL 3CDFA 2X4QA 3EO9L 1RK1B 3D6GA 5FYLL 4LQFL 1C12B 3FQWA 4PJAB 3MRJA 3MQIA 4WVRA 1NUFA 5CHNB 2J5LB 2Q86A 2DI7A 4H26B 5E03A 4ZFZB 4CN6A 4LP4A 1KIRB 4YHYB 2J8OA 1UA6L 4HFUH 4XWOC 3VXSD 2H1PH 5SV4A 3LN4A 2FIKB 1DQQA 2BHZA 1Y6MR 4P5TA 1MFNA 1MJUL 1G7PA 3U0TB 4DGYL 3RVVD 2PETA 2XACC 2A77H 1I7TA 3C5SB 4L3CA 1DBKL 2CRIA 4JHAH 5CJOH 5HHXH 3FFDA 1ZK9A 5IVXA 4I0PD 4V1DA 4FQQA 1YJDC 4OQTL 25C8L 5AD0B 3MUGB 4YDKL 1UWXH 4ZS6C 3BPOB 4NKQB 1P9MC 2GQHA 2GJ6D 3PWNB 3GJFA 1X4XA 3TO4C 5D93B 2YK1L 3IU4L 5TF1L 4ZOEA 4OLXH 2A6IB 5IWLC 3TYGL 1D9KC 1T0MA 5CEZH 5T1LB 4DOHE 1KEGL 1KCUH 1YNTB 1P2CB 5ANMA 4HKJB 5DHVA 1JWMA 1JP5A 5JO5A 2LQRA 3QUZA 3RVUD 4P5KB 4RQQB 5D2LB 1MY5A 2NY1D 3C9NA 5HJ3A 4QRQB 1PKQB 4L4JA 2EDEA 2YBRA 5A2JH 4U1IA 1OGAD 4L4VD 4EDWH 1UH2A 5CJQH 1XIWC 3QCVH 1ACYH 5IB4B 5E8PB 5C7XL 2F53D 5EBLA 4NUJA 5JZ7C 2QR0B 3NZ8B 1S7QA 3LS5L 1ZHBB 2FATL 2YEZB 3T3PF 4F7EB 4Q97A 1TDQA 2DKUA 4XI5C 1UENA 2JJVA 5I73C 2ZOLA 3AS1A 5BJTA 3PGDA 5C9KA 2ARJA 3ABZA 4GXVH 5DFWH 3VXSB 2YD5A 2FWOB 5CEXB 4AT6B 1WFNA 2GSIA 4ORGB 5FYKD 5CSGA 4JGUA 4Z95L 1GGYA 1JZ3A 4GAGL 1T89A 5I15H 1J18A 3V6BR 5I76A 4LVHC 1U8QB 1OWRM 4ETQB 4NSKA 5EBMA 3C5ZA 3CX2A 2ZCLL 1JZ5A 4I0PB 4QY8A 1MREL 2ADFH 3EO9H 3KXFE 3U7WL 1CTOA 4FFYL 5FYLH 4L3EA 1S7XA 2V7HB 4KXZI 1U9KA 4KHXH 2GJ6B 3Q1SL 5JW3L 5C71A 2APBA 1IGIL 5CFHA 1AQDA 4JAMB 3QZWB 3RAJL 3ILPA 4CU7A 4QHNB 4Y1AE 3FKUS 5C0FB 1GGCL 1I1RA 4ZOAA 3U30B 1MJUH 2HKHH 1WFOA 2W60A 4DGYH 1Q38A 1UACH 5D7SH 2J6EL 1LE5B 4Y4KD 5INCB 2IQAA 5BVPL 2NY1B 4QGTA 2JB5L 4RMVA 3CZFA 1ZLWK 2O26U 3ROLA 4CN4A 2HMIC 2VLLB 3MREA 4OTXL 1GSMA 5I1HH 2XXCB 5HGHB 5HYEA 1IM3A 1VESA 1ZA6A 3MJ7B 4YDKH 4QRRA 1HCVA 4L4VB 2AK4A 3KYMB 3MRLB 1LP9A 2EKJA 3FQTA 1OQOA 1IQWL 3GSXA 2YK1H 1WZ1L 3IU4H 1OPGH 5JUEL 5TF1H 5IHBA 3PWPE 3OR6A 4UB0L 4J23A 2F15A 3RNKA 1P6FA 1I4FA 2ZUUA 3H2WA 4YAQB 2X70A 4PGZA 5BMFH 3V4UL 5KTEH 3WS3B 4D0BA 1FAKT 4IDLA 1CGTA 2ADGA 5JOFB 4Q6IB 3RPKA 3CC5A 1OTSC 1QO3A 2XA3A 3RUGE 2F74B 2FB4L 5T5NG 2GYSA 3RWCA 3JTSA 4MCYA 3O3DB 2I9LB 4LLMB 3GKWL 1KIPB 4ELMB 3S96A 5E7BA 4ONGH 4RA0C 5C7XH 1DEEB 1MI5A 2FBJL 5IQ9A 5TFSL 1VKXA 1A6ZA 4DGVL 2X6MA 3SPVA 1OT2A 2X4SA 3CDGB 3F5WA 4I48B 4K07A 3GMNB 3HG1A 4OLEA 3T2NL 3W9EA 3QPQD 4JFFD 3IAQA 4NO0A 4I1NB 1NCBL 3OG6B 3HAEH 1U8MA 5EO1B 4BFIB 3QFDA 3O41B 3QIBC 4LNVA 1NANI 4E9LA 1BFOA 4Y4KB 4U1SB 4OZFA 1RZIB 1JN6A 2CJUL 1KG0B 2ZCLH 3EYOB 4WO4B 3A6OA 5IB1A 4OCYL 4FFYH 1ZHNA 4UDTB 4XPFH 1G7LB 3WLBB 1EFXA 2DQDL 1KCKA 4L8CA 5KSVB 3QT2A 3KPSD 3NPSB 5C07E 3OZ9H 4LAJH 2ILLA 3QUZD 5FYJU 1BIIA 1KN2L 1GGCH 5FO8B 2PO6A 3KPPA 5C08A 4FQIL 1FJ1B 4X7SH 5SWQB 1LO4L 3S8WA 4ONOA 2J5LC 2J6EH 1BEYL 3BH8B 4RX4A 2MCPH 1MAKA 5BVPH 4YHYC 2JB5H 2IH3B 4HWZA 2IPUG 4ACPA 2BSRA 3G6JB 2V5YA 1DVFD 3P77B 1EV2E 4OCWH 5KSUB 4GG6B 3FQWB 3HPJB 3MRJB 1P6AB 1CBVH 3R06A 4M1DL 2C4FU 3ZE2E 3RWHB 4UB0H 3INUL 5F1OB 1CE6A 2WIIB 3T0XA 4KPHL 1EH9A 1DQQB 1CTNA 3T8XB 3BPOC 5DWUH 1LEIB 5AYUL 2H32H 4JFFB 2CDFA 2E9WA 5C0BD 4Y16A 5D93C 1HWHB 4M5ZL 5IBLC 1AP2A 4FS0A 2HN7A 4N9GA 3LS4L 1UB5B 4OZIE 1IGJA 2FB4H 4MVBD 1BHGA 3WFHA 5ERWB 4MNHA 4FQQB 4TOYL 4L3ED 1T2QL 1YY9D 1KCVL 3FO0L 2X9WA 2HFFA 2AEPL 1K8IA 3KPRE 1XCTB 4JRXB 2H41A 2FBJH 4PLOB 3EJZC 3KYOA 1FVEB 1YEHL 3IDXH 1T0MB 3IB4A 3KR3L 3T2NH 4DW2L 3H0TA 5E4IA 2OSLA 2UV3A 2OR7A 1WTLA 4Y19D 3KPSB 5ANMB 5KOVC 5DHVB 4DJMA 3LV3B 4HPOH 4HMEA 3QUZB 3QEUB 1KLGA 5FKAB 3GMQA 1QSEA 4HULB 3A0OA 3ARUA 2V5SA 2YBRB 2HFEB 4U1IB 3VGBA 2AK4D 2P8MB 4FMFA 1C7SA 1I8LC 2VL5A 4KVCL 4OCYH 5EIVA 3WKMH 5L8JB 1RHHB 1DVFB 3AGVA 3HNSL 4HAGA 1FE8L 2DQDH 5EBLB 4NUJB 3RVVC 4DZ8B 4IIQA 2NCMA 5HDOA 1BQHG 2XG4A 3LZFH 4WTXA 3R1GL 1KUMA 3OBAA 4I0PC 3K0WA 5BJTB 4XP5H 2Y72A 5BZWA 5LGHH 2DIBA 2IFGA 3LKSA 3DO7B 3NIFF 3ORJA 4FQIH 1TPXB 1EEYB 2DKMA 3TPUA 2MSPA 1X5ZA 3CLEL 3LQAL 5KBNC 3U6RB 1ZSDB 3FT4A 1BEYH 2LABA 5C0BB 1FORL 5I76B 1G0XA 5FECB 5E8DL 3EO1B 1IRAY 3GIVB 1T0NA 1U8HB 3WNPA 3SDAA 3CFIC 3CVIL 3U30C 4X6DF 2XKUA 2Z93B 4KDTC 3BQUA 3RVUC 1R3HA 4ODHH 4JM2A 3N06B 1ZHKB 2NY1C 4M1DH 2GEEA 2R0WH 4WNQA 1IAKA 1WWWX 1HKFA 1RUAL 3L6FA 4NC1E 4NO0D 2X9YA 4MWFB 3INUH 2FNBA 3ILPB 3FZUD 4WFED 4KPHH 1AJ7L 4DAGL 4XTRD 4Y19B 5IESH 3NIDF 3T4YB 1QBML 1CICB 4HWEL 4JRWA 2VXVH 3K1DA 3FB7A 5DHYA 4Z76A 2IQAB 5TQ0L 1XGRA 3LS4H 3NABH 4XZUB 3HUJE 5DJZA 4PR5A 5FIEA 1K8DB 2QSVA 4PRNA 1KCVH 3FO0H 4BSJA 1EFXD 5CILL 2AEPH 2CKNA 5F70A 5C9JA 4Q6IC 5CEZE 2JELH 5EC1B 3KR3H 1BZ9A 5EU4A 3RNKB 3TBWA 4ZYKA 5EO0B 2HTKC 4HQQL 4X99B 1CL7I 4MX7A 2H3NA 2X70B 4FABH 3BMWA 3DNKA 2X1QA 1LK3L 4NGHL 4RX4D 3WD5H 3ZYOA 5E56A 4U1NB 5BV7L 1C5CH 1J12A 2L7JA 5MENA 1AXIB 1SJHA 1KXVC 4Q9BA 2LU7A 4C54A 5EULV 2OR9L 5CJBA 2E7BA 3JTSB 5LWYH 4EXKA 4OKDA 4KVCH 3U46A 2DQGL 5GZNC 1G6RA 5IMLB 3HNSH 2E5EA 2OK0L 1PYWA 1UVQA 5ID0B 3GSNH 3UTTE 3MLTB 4JJHA 4OZHE 2BXZA 3IFOB 4Y4KC 4X98A 3CU7A 3R1GH 5JR1L 3LKOA 4P4RA 4PREA 4WO4C 5GIRB 4YDVA 3EDEA 3EW3B 1YNKL 1U8MB 1VPOL 4BFGA 2D03L 1FORH 3QUYD 3NPSC 2QHLA 2KBGA 4OZFB 1QKZH 2FD6L 4YEEA 4PJIA 5E6ID 3VE0B 5JDJA 4JY4B 5CEYA 1X5JA 2WBJA 2VDOL 1ZHNB 4PRIB 1OVZA 3RIAF 2F5AH 4PJEF 4HV8B 3IJHB 3K7UA 4N0FB 4GKSB 5B38A 3B6SB 5J3HD 4UU9A 1RUAH 4KRPD 2YA0A 3LN5B 4GUPB 1DN2A 4FN0A 1A7QL 2WP3O 4MQXD 2DLFL 1RZGA 3MXWH 4JFHE 3G5YA 1QBMH 1CGVA 3SGKC 1KCSL 2EIBA 3DXAA 3QSKB 1KC5L 4GQPH 5FGBC 2C3HA 3DX7A 3T08A 3U7YL 3CFEB 3MRCA 2DI9A 4HWZB 1J1OH 2BSRB 3H42L 2AXJA 3O4LE 5ACLA 1G9NH 4PP2B 3VGDA 5CWSB 1MWAL 3RJDA 4D0DB 3QPQC 4HJ0D 5CILH 1A3RL 3BEWB 2F54D 4H1LB 4XBGA 4QNPE 5F1SA 4KKCC 2FHFA 2NW2A 2V7NB 4HQQH 4PJGB 5TDNA 2QKIB 1LK3H 3OB8A 4NGHH 4NRYA 4LCYA 3LQZA 4LQ1A 5BV7H 1QFWL 4LPUA 4ZPTB 5CZKA 1FLRH 3SJVE 2AVGA 4MMXC 4RAUB 5EC2A 1TTFA 2BY2A 2EH8H 3MJ9H 4LLAA 3SDAD 1SEQL 3QUYB 1RURL 4KK6D 4MNHB 4OZ4A 4GXUN 1JUFB 3QUZC 4PG2C 3W2DL 1UM5L 5IB5B 5E6IB 1NDMB 2WBWB 3ZHLA 4N1HB 2OK0H 4EKXA 3CK0H 3CFJB 4LKCA 2YN5A 4ZSOA 5H35B 3LEVH 2AXHA 4ZUSB 5FYJD 3I3DA 3OKEB 3SOBL 3GI8L 4NNYB 1S5IL 4N0UE 5I18H 1YPZA 1DVFC 1T6WA 1IEBB 1YNKH 3HRZB 2EDYA 2J8HA 3MLUL 2BCKB 1JWSB 4X9GA 4YLQT 5SWSA 4YE4H 8FABB 1CZ8L 1F4WH 1H15B 3OKNB 2G9HA 3C87A 4U1KB 3I6GB 1NBZB 4IRSA 1JGDA 5D71L 1TPXC 5DJ2B 5I1AA 3HI6L 3TH3T 1FGVL 4PP1D 4FXKB 4Z7WB 2F54B 4Z5RA 3V6ZB 5DMYA 4OCNC 1EUTA 2NX5E 5IHUH 4MVBC 4Y4FB 1D5BA 2DLFH 2R1WB 3F7YA 1B0RB 1YY9C 1BD2A 3TPUB 4GAJL 1KC5H 4YBQD 2G2RA 1U8OA 3EDJA 3U7YH 3ARWA 1FNLA 3OAUL 4LRNH 3ZE0F 1MWAH 3PIQA 3SDAB 3SDXA 4CW1B 4YXKL 1CICC 4JZJA 5HHPB 4JPVL 3OF6A 1S9YB 3PP4L 1SY6A 5H2BB 3JZ7A 1AD9B 5ADPL 2F5BL 3S97C 4WNQB 1CFBA 1NAKL 3LPWA 3QXWA 3T0DA 2R4SL 3GBNH 4BH7A 4TNVF 5CD5D 5DRXB 4X5XA 4PGEB 32C2A 1DBAH 5I1GL 3MRKA 3LQAC 4J3SA 3P4NB 1QFWH 2W0LA 2NY7L 1GH7A 3ZKMD 2W07A 3AB0B 2D31A 1XGRB 1WK0A 4GG8A 5EFIB 4PR5B 1RURH 3WMSA 4LVNB 3D0VA 4JDZA 1AXSA 3DIFA 4PJCA 4BSWB 1D5ZA 4D9RE 2FGWH 1UM5H 4U0RB 1TZIA 5CSZB 1F11B 1EGJA 3PGFH 5C9JB 1ZAGA 1WZKA 1ZA3B 3D85B 2BERA 5F96L 1EERB 4JRYD 2CR6A 1WQVT 5GS0D 1HHKA 4ZYKB 3SOBH 2VR9A 2UWEA 1T3FB 2Y07L 3DXAD 5AZEH 4J6RL 4RWYH 5LAXB 4WGVB 2VWEC 1GOFA 4YIQA 5FEBA 1OCWH 3U9UB 1CZ8H 1CXKA 2W65A 4PJ5B 4RNRA 3IU3B 1YYLH 4R2GB 3FZUC 3BN3B 5D71H 3GRWA 3U46B 4XVSH 4D9LL 4XTRC 4U3HA 5D1XA 1PYWB 3HI6H 1FGVH 1N0XH 3ULSA 4OGXL 1U2HA 1ZGLA 4PREB 4PJ9A 4Q58C 4KY1L 4YDVB 3RWEB 3L9RB 4AIZA 1N8ZA 5BQ7A 4E41A 2Y06L 4R90L 4Z77A 4BQBA 4WW1A 15C8L 3T65A 2ICES 5HYJB 4Y4HD 5D7KE 1D5IL 5J1TC 5J1SC 2BOCB 1T2JA 1U91B 2X4OB 3MFFB 4JO4H 4JG0H 4Q0XH 2ADIB 3H3BC 4MZ3A 4LEOA 3OKOA 3MRNB 1U3ZA 1ZS8A 3MGAA 4JPVH 4U1GB 5J6HA 4MJIA 4HG4K 5C0IB 4LKXA 3PP4H 4Z7UB 1HQRB 1KXQE 3VXMA 4DKEH 4P2RD 5EZJA 5ADPH 2Z4QB 3DBXB 4M6OH 2R56H 5B38B 1JZ8A 1WWAX 4UU9B 4ODUB 3QWOA 4XX1G 4NQDE 3VI3E 1AI1L 5IF0A 4HEME 4JRYB 5TH2A 2CRZA 1GL4B 4NKMA 1I3RA 4JVWA 5I1GH 1J8HE 4LCIH 3QDJD 5ESQB 2X7LB 3DX7B 5DC9B 3WJJC 1HHIB 3EO0B 4X7DC 3O9WA 2EDFA 5E8EA 3AS0A 3D39E 1LDPL 1Z9OA 1IE5A 1U8NB 2YRPA 5HY9A 5DS8B 3OX8A 4UV7H 1KN4L 1FFNA 3HI1A 5I17B 1M7IA 1YEEH 3V0AC 4XRCB 1FQ9C 2GJZA 3DSFL 4LARL 5DDHA 4HWBL 1CGWA 3QUYC 3SDYL 1JYNA 4PJDA 3BIKB 4RGNE 3CPLB 4HDIA 1NFDE 4FFWD 1BD2D 4DTGL 1I1AD 5E6IC 1PKOA 1W0WA 4UDUB 2Y07H 1NLDL 2J8UF 1V8HA 3ARRA 4M6NL 1MH5A 3P0VL 1D5MA 3VXQA 1BJ1H 3UAJC 5DJYB 5D5MA 1HDMA 1AH1A 3DUSB 5D8JH 5T1KA 1H0DA 2R2HB 5GS1C 4Y4HB 3IJSA 2DLIA 2PTUA 2COQA 5J3HC 2MFNA 1DUZB 1Y6KR 5E5MB 4XMKL 4MQXC 2BC4A 4D9LH 3TBTA 1HXYA 4IHOB 2XZAH 1FIEA 3L3OB 1NMBL 2RAMA 1JL8A 4LKCB 1VADB 2JCCB 3HPLB 4OGXH 3RPIA 5LGJA 1F3RB 2GTZA 4P2RB 4UT6H 3IGAB 4JFOB 4LCWA 4Z7OF 1SBBA 3KPNA 4F57L 5C2UB 3DGGA 3MLZH 5C3LD 1DSFL 2BNRE 1GRWA 1BM3L 4X6DE 2YUZA 2R1XB 2XTJB 4K3GA 4N5ED 2XOTA 2Z8VC 4HS6A 1XF2A 1R3IL 4Z8FH 3MRDA 4PJXE 3QDJB 5IB2B 2NY3D 3MV9D 1IILE 3MYZA 4X6EB 4Y4FC 1QVOA 5D1ZD 4K94L 1FFOA 3Q3GA 5A1AA 3CGTA 4YEFA 4G6JL 4HT1H 1HOCB 5I1AB 5SWZE 4JHWH 2D7NA 2VC2L 4XPTL 4MD5A 1G7HA 3HR5B 3BMVA 2JB6A 2NLJA 3GMRA 1W72H 2VZOA 3S88L 1YMMA 1N6QL 4OB5H 1AI1H 1Z9SA 2KDGA 3SDAC 2VLJA 1ZMYA 4KK6C 2HP4A 4LU5L 3C08H 4WV1B 4OAWA 3PL6A 1I1AB 1GOHA 4LAQL 1WJ3A 5HVFB 4FQ2H 1ADQA 2PYEB 2ZSWA 3SE8L 2C3WA 3F6LA 3LEXA 4Z9KB 3L3DA 3HLAB 4S1DC 1LDPH 3RDTD 4EN3D 3L1OL 5K9JL 3QA3A 5MERB 1KN4H 2VKXA 4KAQL 1P7QA 4EUPH 3UPRB 1FIGL 3AB0C 2BMKB 2HVKB 1DN0A 3DSFH 5KAQG 2FJGB 3IDJB 4LARH 4FOMA 4HWBH 4PJ9D 3SDYH 1SM3L 4LVNC 1MVUA 5E2UL 2X89D 2GSGA 3D2UA 4FFVD 4BQ8A 1P5UA 4DTGH 4YHLH 4U0RC 4RMUA 4NNXA 5EU6B 3P0VH 2WAHA 3HS0A 4M6AA 1LO0H 2EZ0C 2ZUYA 1OARL 3HE6B 1A7RL 4QRPE 3AC0A 1XGYL 4PJAF 2Q6WB 2JTDA 3DIFB 2NY3B 4MSWA 3MV9B 2VZ3A 4XMKH 1X5XA 5D1ZB 3BVNB 3EHBD 2ZNWA 2IAMA 3P9MB 3VXMD 2PR4L 2ZUVA 4ISVB 3ALXA 1J0KA 4GRWF 2VR5A 3DROA 3O3BB 1G7QA 1CD9B 3BXNA 4PGDB 2W92A 2A0LD 4KGJA 1QBAA 1OLLA 1Q9OA 3O6KH 1NJ9B 4NKDA 4PPTA 3RZCB 1XZ0B 1HHKB 4M6ML 4R2GC 4F57H 4NO3A 1UQSA 1N0LA 1DSFH 1MF2L 1VFMA 1IZJA 1BM3H 2XICA 5J56B 1BQLL 1INQB 3FN3A 2O5YL 5DD6A 3BZDA 4PJEE 3O9WD 5E5UB 4F2MA 2EDNA 1Z9LA 3NZHL 2OJEB 3CFKA 4G42A 4ERSH 1WZLA 3X14A 1D6VL 4WUUA 2C7UB 2Z92A 1UKTA 5IM7A 1FYTA 3WLWC 2EC9U 4K94H 1MIML 4EOWL 4YDLB 1AGDA 3RDTB 3HZMB 3RIFK 4EN3B 5I0ZA 2X1WL 2P5ED 3KJ6L 1NBQA 1U92B 4DK3A 5JIKA 4TPRH 2VC2H 4PY8J 3V7AG 4X4XB 4XPTH 3ZKMC 1QFHA 2CDEB 3MUZ1 1IARB 3KLAA 3TGXA 2Q8AL 1RI8A 4YX2L 3EOAB 5D2LF 2X4TB 3U0WL 3RY6C 4LU5H 4U1GC 4L8DB 5DD5L 4OCXL 1N64L 5L6YL 2Y36L 4LLUA 3PV6B 5I8EB 2C26A 1RUQL 4LAQH 4PV8A 5T1KD 2QQKL 5C09B 3H7LA 4M1GH 2HJLA 3SE8H 1FPTL 4U2ZA 1FBIH 3VFSA 2G75A 2VERN 1ZLVK 3PWUA 5E08L 5GS0C 2R1YA 1F13A 5D1QA 1P7KB 3D0LB 2IH1A 2JJTA 3NH7L 4WWKB 4RAVA 3VI4E 3CMOL 1I9RH 1VA9A 4LCWD 3RRQA 3UTZA 4URTB 1ZT1B 2DQJH 5EBWA 3VXRE 5IF0B 1FSKB 1HIMH 5B3JF 4PRPA 3QJFA 1VCAA 1T22B 3HZKA 1I3RB 4TUOA 3NCEB 2RFXA 1JI1A 4GRWH 4ZTOL 1OARH 3G5XA 3EYVA 4JZNB 3QEGL 3O9WB 5KW9H 2PW1B 4R97B 2HAZA 1XGYH 1CYGA 4NM8H 1KTDB 3OX8B 3QFJE 5A2FA 2EEDA 3QEHB 1FVCB 4N8VA 1FFNB 1NFIA 3HI1B 1N7ML 4XGZA 4TVPH 4ZOBA 5HYFA 4PJHB 5DVNA 3MNVB 43CAB 5DDHB 4PJ7E 1YMMD 2P5EB 4JQVC 4Y4HC 1NEZB 4BH8B 2VLJD 4GBXB 1FFQA 2P8LA 4ONFL 3PL6D 4N0YL 1RIVL 2WQRA 1RU9L 3W9DA 5C0JB 4N90E 1MAML 2D7QA 3Q6GL 1BQLH 1QD0A 3G6AB 5I1KH 2O5YH 2DWEA 3QUKA 4KGLA 2DLTA 4A6YL 1F6LL 5C2BL 3V2AR 1H0DB 4NCC2 3DSNA 3OSKA 4BQ9A 2AV7A 1K9TA 2QQQA 2FO4B 4EOWH 1P7QD 1NSNL 4S0SD 1H3TA 4U1HB 2GAZB 2BC4B 3G04A 2XTJC 1DQJA 4M61A 2ESVE 1HXYB 2C1OB 5FGCE 1PGRB 5L2KE 4AG4L 5LQBL 3MNZA 2I26N 4MXQD 4WENB 2Q8AH 4LCWB 4YX2H 3U0WH 3ZE0E 3O8XA 3PJSA 4IOFC 2E8YA 5DD5H 3MRGA 1RZKC 4OCXH 1N64H 3ZLQC 4QT5A 2OI9B 5I8OL 1RUQH 4YHKL 4D8PA 2DQTL 1NCAL 2QQKH 3MRPA 1U8LA 3CVHH 1FPTH 4PTUA 4ELMF 3VFWA 1FH5H 1QVOB 3N1FC 1ZV5A 1FFOB 2IAMD 4WV1C 3G5ZA 3E6HA 4JM4L 4M1CD 1I1AC 2I27N 1L4IA 3STLA 3UYRL 1L6ZA 2V9RA 3CMOH 1AY1L 1I8KA 2AEIT 4L4TB 3L3IA 3UP1A 2FJFA 2VLME 3F7VA 3GSQA 4EDXA 3GI9H 3VFVB 5L0QB 3C8HA 4X80H 4KKLD 1OLZA 4H88L 3DRTA 2DAVA 3V6OE 5I19L 2QQLL 3H9SA 5KZCD 4WUUD 4RIRA 4MNQA 2O93L 5LBSL 4A2LA 1WCBB 3LSOB 4S2SB 3L5XH 4KUCD 2VLRA 5ICXB 1Z9MA 4K7FB 3RY5A 5ITFB 2BVQB 5HGAB 1N7MH 1P7QB 3DVFA 1CVRA 1HINL 1NC4A 4NWUL 3HE6C 2AJSL 4RDQF 3PQYD 4TQEH 3SDCD 1S9VA 1IC7H 1R3JA 2GSGB 1HQ4A 4F15B 2NY3C 4ONFH 1P4LB 3SGJA 1CI5A 3PG2A 4L9LB 1RIVH 1JPTH 2EYRB 5D1ZC 1RU9H 1AGEA 5DEGA 3Q6GH 4LHUA 1CD1B 3OJDA 4X5WB 4D3CH 4WI3A 1TVBA 4HIJA 5I2IB 4MA1B 4YHZH 3G6JF 4A6YH 5DVKA 5C2BH 4JO3H 4XPBL 3DTXA 4OD1L 3DHJA 2YXMA 3RZCC 4GG6F 1D6EB 4MXWL 3RU8H 4LIQE 4E42A 1NSNH 1XR8B 4MJ5A 2DF3A 2WWKO 3ROOB 5DUML 2KQNA 4XNMB 3BXNB 2XN9E 3E8UL 5LQBH 1DBML 3F12A 5L2JA 4G8FA 3NA9H 1Q9OB 4NKDB 1AFVL 4PRPD 1C5DB 1IAOB 4YDLC 1X7QA 3RDTC 3BIAX 4EN3C 3E2HB 3IDGA 5ACZB 3WL9B 4R4FL 4QOKE 3PWJA 3L5IA 1HH6A 2DQTH 4AM0B 5IFAL 2VOTA 5EORH 2VXTH 2PKDA 3RIAK 1FZMA 4WUUB 2P8PB 5EU3A 5HDBF 1V7NL 2JJSA 5HHOA 3S34L 1GPOL 3MUY1 2GFBA 4YZFF 1FNGA 2FR4A 2WWMD 1AGDB 4PBWD 4XBEH 2JIXA 2FLBT 1EUUA 3TT1L 2DM3A 1AO7B 1U8PB 4XP4L 43C9B 4OF6A 1Q0XH 2VXQL 3BIBX 1QRND 3VU2A 4FRWA 1VSCA 3PQYB 3FFCD 3SDCB 4OFKA 4XBPB 3TT3H 3IAPA 1LE9A 5DSCA 2AQ1A 4WY7L 2BDNL 4HW6A 4WWKC 1U36A 5IW1A 1MCBA 2PXYA 3UTSA 1IC1A 4QRSA 1VENA 3EHBC 4XAKD 4PV8B 4N9OB 4I13B 4TSBH 1PG7L 1U3HA 3O3AA 4RMTA 3TYFB 1U95A 3AREA 4PRHD 4I0CC 2A0LC 1QSVA 4X6CE 5LBSH 3BP4A 1TCMA 2MHAA 1MVFA 5IOPB 1PEZA 5JLZB 1R0AL 1FSKC 4ZXBD 5H37H 5ALBH 3U2SA 3RX7A 4WHYG 2J8UE 4AZ8A 2QEJA 3KNBA 4AJ0A 3JWOL 3BJ91 3NCCB 1KB5A 3VFPA 5FHAL 4WTZA 3UYOD 4NWUH 4ESKA 5ID1A 3MLPA 2F19H 4ZFFA 4R97C 1QR1A 4M3JA 3PHQA 5L9DL 3F65A 5GJSH 4U6HB 3Q5YA 1U93A 5JHDD 1HH9A 2AABH 4PRDA 3VGFA 4WJ5B 3JV6A 3DHMA 3SKOB 3KHOA 3LMJH 3UBXA 4F8TA 4QO1A 4P4KD 2RFXB 4W70A 4P2QA 5MHSD 3WFBH 4GRMA 4IOSD 4GBXC 4JFYA 2P44B 2A74A 4XPBH 3QQ3A 3L3GB 5BW7A 4XNQB 5HYQA 4Z7OE 5I1CL 1UXWB 4MXWH 3SGEH 3TCLA 1LO2H 2VLKE 3L3JA 3LEYL 5KSBA 4NN5B 5IEHA 4EI6B 3RHWK 4EQ3A 1BJMA 2ICWI 4BKLA 4Y5XA 2KQMA 5DUMH 2AJVL 4G9FD 5BRZA 3O6FB 1J0ZA 1DBMH 3VXPA 1NLBH 2DBLL 4DWHA 2YC1A 5CLWA 2X1OA 3J8F7 3TA3B 1QRNB 1AE6L 4S1RH 5F1NB 1OB1A 3QUML 3PWVA 3W9DB 3GJFH 4ORZC 1DLHA 4RCAA 3FFCB 3H9SD 5D2NA 3A6BL 1QA9A 4TUJB 3SKJH 1WC7B 5IJVB 1JCKA 1XAUA 4OGYL 4ZO9A 4OFDA 1KIUA 2XY2A 1JNNH 3PABB 4JCMA 1XH3A 4M48H 3MJ8B 3TO2A 1JF1B 3KGRA 1UEYA 4PRHB 5GGTA 1PD6A 1GPOH 3S34H 4NQED 1W0VB 1I3UA 5F88A 5L7XL 2LE9A 3DOSA 4ZXBB 1I8IA 3I6KA 1QFPA 2OI9C 3H3PH 3JWDH 1N2RA 2CRYA 4HF5H 4PGBB 3RI5F 4XXCA 3MLXL 5GSRB 1YQVL 2V17L 2HRLA 1WUNT 3ZKNC 3SKUD 2NXZD 2WK2A 4H1LG 3RWGA 5F1KC 1JNLL 5JHDB 5IGXL 2XNAB 2XZCL 3TN0A 3QG6B 4F7CB 1BAFL 2A73A 4P4KB 1MNUH 2IBZX 1EMTL 4I77H 4IS6B 4JJ5A 5L0QC 3G5ZB 3I2CL 4POZD 4O2EA 4G8GA 4L8SA 5F7NC 4P48A 3WN5A 4TNVK 3SGDH 3K8KA 4LRIA 2CIKA 2OCFD 5FUOH 1F00I 5D9SA 2XV6B 3VXOB 1OHQA 4G9FB 1X4ZA 5L9DH 1SYSB 3T2QA 5IG7B 1IT9L 2VB5A 2E7LA 3F7VB 2BY3A 1F2XK 3V4PL 1NGZA 4NJ9H 2AQ3A 2DI8A 1QSFE 4PLKD 4Y5VA 4GRWE 4E0RA 4HUKB 4QRUB 1CE1L 3H9SB 4QYOA 4P3CL 1JV5B 5DA4A 3BWUC 5HHOD 3WNMA 4QRTB 1UB6A 2XPGB 1QPXA 3OAYK 1J88A 3DVNA 4L9LC 3NPZB 1TJIL 5A16B 2Q87A 1HSAA 4TVPE 2CDGB 4JDVA 2DQUL 4NQEB 1Q1JH 3EUUA 1KENL 1JK8A 4MA1C 3E0GA 5JPNB 2PUQT 3N1PC 4P46A 4UTBL 3CUPB 5GJTL 3NCJL 4HJGB 2UUDH 1R3JB 3BKJH 1HQ4B 3FO2A 5HPMB 4HXBH 4D9QD 3K4ZA 1F42A 1AE6H 1S7TB 1FZOB 2PXYD 3FCTB 4I9WE 3QUMH 3FOMA 3H6JA 5FDWA 3K8LA 1BECA 1H8OA 3PDDA 3QDME 4M1CC 1U3HD 3OJDB 4OFPA 5EO9A 5DTFB 4LCCB 4OGYH 4WFGE 4LDOB 1YUHB 4K3EH 3O2DL 4ZDHA 2EIDA 4YNYB 1QYGL 5I8CB 5D2LE 2Y7QA 1P1ZA 5DR5H 4H25B 1ZT7A 1ITBB 3E2HC 3T77B 4MDJB 4G7VL 4MJ5B 4PY7A 2J88H 1F4YL 3U4AA 4WTWA 4KKLC 2EDLA 3QO1B 1XMWA 3FQUA 5IB3A 4JFED 3V5DA 3ZHKA 5L2JB 1RD6A 1T5WA 4R8WL 5IQ7L 3EYFB 1J05A 1KIQA 4KTYA 2K7QA 3EFFA 3PDOA 1CS6A 1X7QB 4HUUA 1S9XB 4P2QD 1JNLH 2XXMB 3FT2B 5IGXH 2Q3AA 5EOTB 3PWJB 5HHQA 4AEHL 2XZCH 4HIIA 3T0AA 2ZJSL 3PHOB 1Z3GL 3V9FA 3ES6A 1OAUL 3VXSE 1CXIA 1R3KA 4F37F 4HGKC 3NAAH 4G6AC 3SDCC 1UM4L 2MQCA 1WEJH 4XCYA 4CRPA 5CP7B 5DURD 4J3WA 1N26A 4KRLB 2CUIA 2EXWC 3QI9D 4LGPB 5SX4H 5B3JE 3CXDL 1CFQB 2Q76B 4P5MA 4X9FA 1NGPL 4DUVA 4OCLC 1PY4A 3AY4C 1QLRB 4TULL 3THML 2YPVL 4O4YL 2F9BT 2OQJB 2Q7YB 1U0QA 5IMOA 3UROR 1F97A 1IT9H 1G9ML 5DSCB 2JJTC 3Q6FB 1INDH 1IGMH 1EEZA 2PXYB 1DEDA 3BD3A 2NPLX 5E4EB 1U3HB 4P3CH 1ZWIA 4HMCA 2IC2A 5FA4B 2ICWA 1JGUH 4JFZL 1TJIH 4CVWA 5ADOL 4Q9RL 4RMSA 4X7TB 4I2XB 4KTEH 4Z7WF 5ITBL 1ZHLA 3LN9A 2P49B 3VFPB 1CFVH 5GGSA 3FHAA 5GJTH 3NCJH 2AJYL 1QR1B 1OGAE 1FCCA 4JFEB 2P45B 4NN5C 1AKJA 2F53E 3VW3L 3TN0D 5JXEA 3RVXD 4H20L 4G6FB 2ATPB 2CIIA 4P2QB 5DRNA 3O6FC 3NFNA 3T0WA 5B4MD 5CINL 3ECBA 2A74B 3O2DH 4JPIB 3TA3C 2HFGH 1QYGH 5HYQB 1A1OA 1PVHA 1E4WH 4Y8DC 5C0RL 4G8GD 5KSBB 4K23L 4M43H 2MMXA 1DBBL 4R0LB 5DURB 3JWOC 4XCNB 3QI9B 3HRPA 4PRBA 1ZLSL 4AK1A 1O7SA 4MXVE 5E8OB 1J0YA 5CBAA 3VXPB 1FV1A 2EE3A 3ZSSA 4C4KO 4R8WH 2YC1B 4ELME 5IK3A 5IQ7H 3CD4A 5IVNA 1Q72L 1N3NA 1KLUB 2FCBA 3D3VE 1E28A 4XC1H 1NCCL 4ZXBC 3BDXA 3C8DA 1AC0A 1KBGL 1E6OL 4MAYA 1DANU 1IEAA 4AEHH 4XCCL 3WXVH 2ZJSH 1F4HA 5B39B 4KH2A 2X4NA 5IBTL 4YXLL 4QHMB 5I0DA 1OAUH 5EH1A 2NNAB 1MHPL 1XH3B 1L7TL 1UM4H 1R24B 3CMGA 4Z6AT 3VFRA 1N5AB 4OZGE 1S3KH 4JY6B 3CXDH 5F6HJ 1IC4H 2VZTA 5C1MB 4P4KC 5HVGB 1ND0A 3SKJL 4KXZH 3GK8H 4UOW1 5JORA 4TULH 1I1CA 1IGCH 5CSBA 3THMH 4O4YH 4U6VH 4C56A 4QWWD 3WS6C 4ZD3L 1G9MH 3VRJB 4JFQA 4FQLL 3QIUA 3E3QE 1LO3H 4JO2H 3LKNB 3OXRB 4XPGL 3S3JA 3TN0B 5I1EL 2A73B 5E9DA 4W4OC 4JPKL 4ODXA 2IBBA 3GSOA 3OGOE 1CFTB 1NUNB 3QO0A 4JFZH 2N4IA 3HZYB 4Q9RH 1E4KA 3GMMB 3U0PB 2AJXH 2EYTA 3HC0A 2SEBB 1QOKA 4O2EB 1R5VA 5ITBH 4OLUL 5DUBB 4KHTH 2BNQA 4H0IA 1FDLL 1MRDL 1L7IH 3G6JE 5DQ9B 4LEXL 4WU5A 1F6AB 4HKXA 2AJYH 1P84J 35C8L 3AMKA 3WIFB 1AR2A 3WUWA 3T0EB 1MHHB 2JK5A 5F7DB 1XCQA 3GSWB 3MRMA 1NGZB 1IFHL 1HYSD 4Y5VB 4H20H 3QCTL 5I1LB 4PJIF 4X0KA 4QTIL 2R23A 1A6TA 1NBVH 4QHUA 5T3XL 3OKKA 3GDBA 3QCUH 3NBNA 2PCPB 3DVNB 2FJHB 1GCFA 3VGEA 5FYJH 4IRJB 5D7JB 4EUPG 2W9DH 1DBBH 2HVJA 3IXTB 4KKBD 1Y6NR 3OAZH 4YWGL 2NW3A 2GI7A 5IVXE 5F9AC 4LCCC 1ZLSH 4HC1A 1NEUA 1MCKA 3ARDC 4P59L 4HWUA 5DD3L 1Q72H 5E2VL 3BJLA 3LVEA 5GSVA 4YZFE 1NCCH 1GAFL 2FL5A 5D7LA 4CJ1A 4V2BA 4JY5L 1E6OH 1KJ2L 3QISA 4OJFH 4POZC 5EO9B 2KH2B 2PF6A 4HX1A 3NN8A 5ANME 3KPSE 3UCRA 1TETL 2UYLB 5IBTH 4YXLH 5DMGD 4HK3J 4PJ8B 1NANH 1MHPH 2AXFB 1BQHA 1L7TH 4P23A 3ULUD 1P1ZB 2IALA 1BVKA 5I1DB 1KTRL 5IEKA 2B4CL 4F3FA 4FQ1H 3WSQL 1JFQL 4PY7B 3K4DA 3UTPD 2EICA 4I18B 3MRRB 3OV6A 2OZ4L 4O2CB 2Y5TB 4HPYH 3GJEA 3HC4L 1VFAA 3KS0H 2ZG2A 3QAZB 3IFPA 4G8EB 1WBZA 1WWBX 3G08A 1KPUA 1PG7W 1SMOA 4Y88A 1T5WB 2DDQL 4NO2A 3DV6A 5GRVL 4ZD3H 4FTVB 4OI9A 4YGVA 5JXED 3ULUL 1UWGH 2BVUA 1NGWA 1G6RH 5TDOA 4GAYA 2HKFH 2NY5L 2WUBL 5CMAA 1K6QH 2IANA 4JFDD 5EUKB 3F7RA 3CFDB 4UOJA 4WDIB 4JPKH 1UZ8B 2ARWA 3QHZH 3I84A 4P0DA 2A6JB 4FXGB 3RWIA 3MLYL 3OG4B 2LU3A 4HXAH 4NQXB 3LKRA 2PXYC 2JCCF 3K74B 4GW5B 5SX5H 5LXGL 1KJ2B 5E4EC 1FDLH 4GOSA 3SCMA 1U3HC 3O6LL 4NJAH 1MRDH 5GRJH 1DQMH 2CD0A 3H9HA 1OP5H 2XWBB 4LEXH 3NFSH 3MLRL 1YY8A 35C8H 5DHXB 2DKSA 4L3EE 4CNIA 3NTCL 3B9DA 4XCFL 1XFPA 5ESVB 1MCOL 3GSVA 3HMXA 5B8CB 1IFHH 2AJ3A 3OHXA 2D7TH 4MJ2A 3TC9A 2EKSB 3L3HA 5L8KB 2VITA 1V3JA 3P4OA 4QTIH 5T3XH 4F7PB 4Y19E 2Y4SA 5LVEA 4L8BA 4XPAL 1B4RA 2E3VA 5T5FH 3DV4B 2N56A 3ESUF 2EO1A 3KYKL 3TZVD 1ORQA 3FQXB 1VDGA 1T1WB 4LCUB 4OV5A 3KLHD 2J7LA 4LASL 2AJZB 4XWGL 3F7QA 4HWNA 3BKCL 4P59H 2HJFB 2A9ML 5T1DH 3WJLC 5KVFL 2V2TB 4ODTL 5DD3H 2HA1A 5FO9A 2AK4E 5E2VH 4R0LC 3QIUD 1LP9E 3BEVA 1GAFH 2R2BB 1IGTA 1NC2D 1MAJA 3QI9C 1WCQA 4OIIL 1CL7L 1HHJB 2X4UA 4JY5H 3SN6N 5E9DD 5ILTH 4JFDB 1HEZB 3BW9A 3UEZA 1YQ2A 3EKCA 1S9WA 3V4VL 3ECBB 1LDSA 1DDHA 3FB8B 1WFUA 2B4CH 4DZBA 1A4KA 1RMFL 1C08A 2BNQD 3K3QA 4M7JH 4H8WH 1XF5B 1XGTA 2AV1A 3FO1A 2APTA 2OZ4H 2YMXH 5F9JB 3VRIB 3MOAL 5CBAB 4H0GA 4KI5D 2O5ZH 5IK3B 3OXSA 5HHNB 5TE7H 1FZJA 2BVPB 1MI5E 4RMWA 5EU5A 3BGMA 2WUBH 5IFHH 5F93C 2H6PA 3T1FB 2D4FA 5IROA 1VERA 1WFTA 3HG1E 4XXCC 3TFKD 1J86A 1SYVB 2FDBP 5F97E 4YHIA 4HFWB 1DE4A 4F9LC 3PGCB 5DD0L 1DBJL 1IL1B 5L8LB 3MZTA 3BKYL 4BFEA 4P2YA 4G6MH 5F9WB 1QRKA 2DM4A 1Y18A 2VDML 3HTLX 5LXGH 3TN0C 4PJFB 4X4YA 3RVXC 4U1LB 3DX6A 4FFZH 3TZVB 2CO6B 3UTOA 2FZ3B 5B4MC 1MY7A 1RIHL 4HIHB 1NDGA 2K3TA 4UINL 4JQXC 3NTCH 3W11C 3QQNA 4JFQB 4HGMA 3BZEA 1SEBA 4OBSA 3QIUB 5ESAA 1KB9J 1T1YB 3IDMA 3KHQA 5F7UA 1NC2B 1T7YA 2IPTL 2BVYA 4F9PC 4P23D 2A6DA 2D4DA 4ODXB 4Z0XA 2DD8H 2GUOA 5C08E 5C0GA 3T0EC 5FM4A 5H94A 3MBED 1YN6A 2VDKL 3GGWB 3IYLW 2VXUL 3BE1H 4QXGL 5TGBA 2NTSP 4X9IA 3QEQA 1JHTB 4Y5VC 3KYKH 4JN2B 2BNQB 5GS2D 4CVXB 4XWGH 5ELIA 2NY2D 4X5LA 4J3VA 3VJ6A 2CXKA 4CBPA 3BKCH 5DMIH 2A9MH 4DFHA 3DLQR 2GITB 1MFDH 1I1FA 3ARXA 4IRJC 5D7JC 3BI9X 1E27A 2IAND 1CLCA 5C6TL 3MGOA 4MNGA 3UXFA 4OIIH 2ZUQB 4UIKL 2VAAB 1I7ZA 1T83A 2AEQL 3HE7A 5FHBL 3V4VH 1IQDB 3MO1A 5EA0L 5DJ6B 3WEXA 1X5HA 3OKKB 5BZDA 4N8CL 1JE6A 1U8IA 3BP7B 4QXUL 3LRHA 1UYWH 4YQXH 1G0YR 1FRGL 1TZHB 3L7FA 3OGCA 4QWWC 1RMFH 3IKCB 1CG9A 1D5XA 5JXAL 2FX9L 3HN3A 4YFEA 5DZNA 2W0FB 4EBQL 4K8RD 3V6OA 4PJ8C 3C6LB 4S1QH 3RWJA 2NYYC 5ECJE 5IJKA 3SEPA 3GO1L 3MUHL 3MBXL 4ZO7A 3STZB 1OAQL 2KUTA 5I6XB 4JPWL 4I18C 5DYOA 1IGYB 4R4BA 3ISWA 1ZLWH 4QHLA 5BVJB 3NN8B 3QAZC 4P3DA 4BSVA 2V9QA 4HIXL 1RIUH 3DMMB 4HIEA 3ZE1F 4CDHA 2AS5M 2IALB 3MV8A 3QQ4B 1DBJH 4HKBB 4PJHF 5DLML 1KJMB 5GRUL 4F3FB 1RUML 3BKYH 5K93A 5KS9B 3MBEB 4WU7A 5GGUB 1QSEE 2GT9B 2VDMH 3LRGA 4JE4B 2PN5A 1RK0A 4YDJA 5FOJA 4ENED 4APQD 1WBZB 3S37X 2B8OT 4JREC 1RIHH 1A6AB 4NO2B 2L4OA 4JR9L 2ICCA 5DQJA 3IVKA 4YGVB 4OCSL 1P9MA 1DUYA 3O45B 1BZ7A 2WW8A 2Q8BL 4ONHA 4JDTH 5D5MF 4Z7WE 3TO4A 2IFFL 3E6FB 4YR6B 2ORBH 5C0CA 2IPTH 5IWLA 2CMRL 1D9KA 4M7LT 2XZQH 1UGNA 1Q9WB 5B8CC 5HHVH 2VDKH 5JHLL 2VXUH 1JPGB 3LKRB 3I9GL 4DGIL 1MEXL 3VXNB 3HA0A 2I9TA 3B2VL 1WISA 2VISA 4L5FL 4LDEB 3TBVB 1CLOL 3S36X 5C6PB 1UZ6E 3GSUA 4PB0H 5DMGC 3V5HB 3BP5A 2QADD 1XIWA 3ULUC 1MJJA 1GGIH 1VFBB 1RJLA 5C6TH 2AJ3B 2DWDA 2NY5C 4ZUUB 1VHPA 4Z7VA 2AEQH 1Z5LA 5FHBH 1L9NA 2IMMA 2J2ZA 5HHME 3BFOA 5H37G 5FYJE 3FO9B 4N8CH 4QXUH 3QNXB 3IXAA 4L8BB 4G3YH 2YXFA 2C3XA 1FRGH 4LSPL 3MC0A 2A6KA 1RV6X 2GCYB 2FX9H 3S37L 2NTFA 4IOIB 5DK3A 5DQDH 5I16B 3RX8A 5BO1H 1JTPA 3RWDA 2B0SL 4WHDA 1OAYL 2ZOKB 3QPXL 4APQB 4KC3B 3GO1H 4LFHG 4OFVA 4DN3L 4XAWH 2VABA 3KXFD 3MBXH 5ICZA 3BEVB 1OAQH 3BSZH <