5F1OB

Human cd38 in complex with nanobody mu551
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
128
structure length
128
Chain Sequence
DVQLQESGGGLVQAGHSLRLSCVGSGSRFDNYAMGWFRQAPGKEREFVAAISWSSGTTRYLDTVKGRFTISRDNAKSTVYLQMNSLKPEDTAVYYCAARYQPRYYDSGDMDGYEYDNWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 39
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1oB00
4JQXC 1Q8MA 4NN5B 3RZCC 1JP5A 4JPKL 1N59B 2WAHA 3WSQL 3BHBA 1ZT4B 5EU3A 5AZ2L 2JK5B 5DEGA 3QULB 1OLLA 5F7HA 2A2QT 3VDBA 4UV7H 2CMRH 4I3RL 5DF0A 3G04A 5HGHA 3P0YL 2DQDL 4LSUL 2NY4B 3O45A 4F7PB 5D6DA 4LCYA 2Q8BL 5IBLD 3ZE1F 1R24B 1UB6A 4FQHB 4WFED 3IDXH 1VGKB 4M03A 4Z76A 4YDLC 3D2UA 1YQ2A 3ARQA 4HJ0C 5GJSL 1OCWH 2GJ6B 3C60B 5HHNA 4KK6D 5I1DB 1EV2E 4AT6B 3RVVC 4YO0A 1XIWD 4U7MA 1TVHB 5ACLA 4XVUD 1REIA 1CD1A 4XC3L 5HDOA 2BFVH 2NW2A 4Z7VF 4HHAB 4LLWB 1FQ9C 4BUHA 1WCBA 2A6KA 2YRLA 5D2LF 3MBEC 2VZ1A 5KTEL 3CH8A 2RFXA 4H8WC 3DHJA 4LLQB 4NUGH 1T03L 3HZMB 4M3KB 5I1EH 3MFGB 4R4FL 1PDKA 3L6FA 5B8CB 2FJHA 4D0BB 4N0UE 5J12B 3I85A 5DC4B 4GFTB 2YUXA 1N64L 2B1AL 4L4JA 1OAKL 5C0EA 2OZ4A 3WIIH 4OQTL 1AP2B 1FE8H 2W0LA 1IGYB 3WS3B 2AK4E 4TPRH 1YNLL 4KRPD 4TQEH 1MCOH 4H1LG 4QNPE 1ZSDA 1S7UA 4E0RA 4F15C 3BEVB 1T7VA 5FKAA 4LLYA 5JUEL 3U6RA 1NCAL 5ADOH 1QBLH 4FFWD 3X14A 1MHEB 4P2QB 1MJUH 4MHHG 5CCKL 2HJFB 4UT7L 3VFRB 3TH2T 5TE7H 3L95A 4PGEB 4Y5VB 3EHBD 2XWBA 3LN5B 1YEFH 4RGNC 4FXLA 1A7NL 1U8QB 3C08H 1DBBH 2VKWA 2DQFB 4P4KB 5H94A 1M71A 2L0DA 1ZHNB 3RBGA 3TYGL 4XXCC 2W0FA 5CBAB 1SEBB 3MLTB 3QUMB 4ZSOB 2WLYA 4K3HA 5CJQH 3T0EC 2FX9L 3TVMC 1INQB 1JHTA 1FVCB 3KYOA 3MRIB 2ORBL 2Z31D 5F88B 4JPIB 3TZVB 3QIBC 4TN9A 4M5ZH 4K2UH 3CFEA 4L4TB 4M7ZC 2DD8H 35C8L 3KGRA 1F8TL 1CFVH 4NHCL 3OKDA 3QRGL 5DTFB 4JFXB 2WUBL 4R9HA 1EFXA 4O4YL 3CZJA 5IHBA 4CUCA 1NKRA 3Q6FA 4ONHB 1CXEA 2VDKL 1FZJB 2DKSA 5F3BA 1A9EB 5EBWB 3WKML 1OF2A 2G9HA 2V9QA 1K8DB 4Z7WB 1KB5H 4XPTH 2NTFB 4HS8L 5EFIA 3ET9F 4I9WD 4J12A 2YPLB 3ARDB 5EBGA 5ILTL 1T83C 2NY0B 3SE8L 4ZYKA 3LAFA 3KYAA 3ALXA 1WEJL 1MELA 3GSVB 5TE6H 1QEWB 5IW1A 4G8GA 1QA9A 3QZWA 4J4PA 4X99B 5EZLB 4MNHB 1UGNA 5M7QA 3BKJL 3IFPB 3BJLA 1UWGL 2XY2A 5A16B 1UZ8A 1LO5A 5E8NB 5F7EH 4M7KL 4GRWB 4D0DB 4RGNE 4X7TB 5DHVB 3ZL4L 3JXAA 1Y18A 1VA9A 2R2HB 3VFUA 4PJDB 1NCCH 3GZKA 1CGXA 5JW4R 1S78C 1MAKA 4U6YB 5LCVH 2Z0BA 4G7VH 3F7QA 3QUXC 4LCUA 1SJEB 5T1KB 3P73B 5DQ9A 3QXDA 1YJDC 4OM0H 2P47B 4ZNEA 5HYJE 3FO2B 2UWEF 2MCPH 5KS9A 4ZO6A 5GGRA 3D3VD 5J9PB 5JPNB 1Q72L 1JWSA 2VN4A 4E42B 1F3JB 3IDGA 1ZWIB 1KUMA 5KSBB 4IM8A 1BZ9B 1DSFH 5DUPL 2ESVA 3HMWL 5DK0B 3S34H 5FM8A 1Q0XH 3JUYA 3QA3A 3QEQA 1MRDL 1OTTD 2EKJA 5ANME 3TA3D 1G7QA 2XKSA 1U58A 4WHYH 1XF3A 3DV4B 3G6JE 3QZWG 2FECL 4BH7B 5CJXC 3VFTA 5TDNA 3TWCH 2DQIL 1LE9B 3LV3A 4K8RC 4JVPA 2A0LC 2VAAA 3BGAA 2HT4C 5GRYA 3B5GA 1J0HA 3TO4B 5HBBA 5E70A 1JGDB 1I8LA 3MODL 2UZXB 1U93A 3PXJA 5SWZB 43C9A 2ENSA 3PGDB 4NJ9L 4DZBA 4Y4KB 4CL7A 1G7IB 1IAMA 3AREA 3KYKH 4JRYE 3MRKA 4RFOH 5IB1A 4YBQD 5BZWB 3S88L 1HHIA 3ULUH 4XCYB 5IJKC 5K9OB 1E6JL 4DUXA 2IPUG 4I4WB 1CG9B 2R9HC 1RZ7L 5GRUH 4V1DA 4PB0H 4JLRA 3E8UL 1CBVH 3WMSA 4ENED 1KPVB 2CDEB 3IXTA 4NBZB 3VFVB 5BVJA 5HGAB 1CQYA 3GBML 4HH9A 4TSAH 2EE2A 4XVTL 4NQEE 3Q0HA 3MMEA 1BD2A 1QVOA 5EU5A 1A1NA 5C0DA 4H8WL 3MYZA 1I8IA 1PQZA 2ZCHL 3L3IB 1X4XA 4BQ6A 4LEOA 1T7WA 4P9ML 1J0KA 5C70A 3AFLA 1RUPL 1HHGB 3V79C 1LO2L 1IC1A 2X1OA 1WISA 2ATKA 2K9UA 3FB5A 3MV9B 4PRDA 1KN4H 2BCKA 1Q9KA 5ALBH 3CD4A 5SWSA 1K6QH 3S36L 4RA3A 3FZUD 4HK3J 5GGVY 1JPGA 4MAYC 3DX8A 1KXQE 5JO5B 3ARBB 1OP3H 1MCHA 5ISZD 3WKNA 5L8JB 3OG6B 1E6OL 5EORH 1PEWA 1UKTA 3GI8L 3UTPD 4U1JB 4UAOB 3F7VB 4YR6A 2EYRA 4FQQB 5HYSB 2BVOA 1ORSB 1BEYL 1BBJB 3MJ7B 1MLCA 3VG0H 4JZNB 1QO3A 3KPSD 4KVCH 4APQA 5HDQL 1H3GA 3QEHB 1L9NA 1PG7L 1SQ2N 4W4OA 5I8EB 2XT1B 3D5OF 2OL3A 2XWTB 2ICWB 4HKJB 4HUKB 1PX4A 2CLZA 1X4YA 4HWNA 4KHXH 3EW3B 5FUZL 5ICZB 4YXLH 3UBXA 3DUSB 2N7BA 3WN5C 2MOVA 3CXHJ 5BMFH 1JFQH 2I9LA 2VLKA 1RUMH 4ZTOL 4Z0XB 3FONB 5KJRL 3QUYB 1T3FB 4J3WA 1ZVYA 1IBGH 1KJ2L 3FB7A 3WLBA 4M43L 4BSWA 1MCEA 3MA9H 1QRNE 5C0AA 1RULL 1BX2A 3P40A 4K3JL 2ZNWA 3KPLA 3NH7L 5HYQA 4YEEA 1JNHB 4R0LB 1WZLA 2H26B 4DFIA 4GW5A 2WINB 4J6RL 3S96A 4BQBA 1JWMB 1RZJC 1YEHH 5DMIL 1UQSB 5ELIA 5F1IB 1KC5L 1YEIH 1U95A 1T2QH 3CFDA 1FORH 4U7KA 1AQKL 3JV4B 2HTLD 2DS4A 1CE6B 2AXJA 2H3NA 2X1PA 1RZKL 1GZPA 4Q6IB 1UKQA 3W9DA 3S6CA 1W8OA 2AEQL 1CK0H 3ILQD 4MGXA 3FOMA 5F7WC 5GGRY 1HDMA 4R7DA 3BP5B 3H8NA 3O6ML 3RWIB 1I9RL 3IGAA 2AJXH 3UTSE 1JZ5A 4G6JH 1I3VA 4OBRA 4C4KT 2J4WH 2OJEB 3WV0A 1C12B 1FGNL 4XHQA 3KXFA 1H5BB 4AJ0A 1OGAD 3RU8H 4LDOB 5FO7B 3UPAA 3BPNB 4K7PY 4EDWH 3GB7A 4NKOB 4ZXBC 3OKOB 2JCCF 1HYSC 2FEEI 2FBJL 5IBUB 5GGUB 1HQRA 3JZ7A 3MLVH 4PG9A 4WW2F 3AXLA 4Z7QE 4GLRI 1E4JA 4P46D 4PS4H 4HGMA 2GTZB 4H25B 3RGVB 1MEXL 1AC0A 4TVPH 4XB8A 1NFDB 4AIZA 5DFVD 3LKSB 2B4CH 2BNQE 3Q3GB 5CMAB 4DQOL 4JKKA 5IP4A 2R29H 1HHJA 4Q9CA 1J1XH 4EN3A 1TLKA 2OTWB 3HC0B 3IU4H 5ID0A 3DIFB 2EDYA 3UPRA 1FL6B 4EI6A 1F2XK 2YZ8A 3HG1B 5IFAH 4MXQD 4XAWL 4XHJD 3PWJB 4RMSA 4GRLD 1B88A 4X6BA 5KVDL 3DXAB 3T0VA 1RK0A 3L3GB 3WLWC 4PJ7E 4F2MA 5E9DD 4S1QL 3GIVA 4L3AA 4MD4A 5JHDB 3FT2B 1M7XA 2VERN 4JHZA 4LCWB 4PJ5B 4K94H 4XVSH 1IZKA 4I0KA 1A6ZB 1JPFB 1XIWA 3FQTB 4FMFA 1PKOA 5BZDA 4JFEE 2CRZA 4YGVA 3C8HA 4DGYL 2QV2A 2QADB 4NQCB 4GRMA 2EDXA 5IG7B 2IANE 4HUUA 3HZVA 3FKUS 3SGDI 3S98A 1L0XA 1AGDB 2A6JA 1K3ZA 5JZ7D 1CFTB 2L4OA 2HFFA 3DRQA 3K81A 3P9MA 3B3IB 4RA0C 4P5MA 1DJSA 3D6GA 2GCYA 2NY6B 2QTEA 4MA8H 2VXTL 4Z77B 4OCLC 2YN3A 1FH5L 1KEMH 4X8XA 2FWOA 2A6IA 4IMKA 4PJFB 2XZAL 3T77A 3ARGB 5FHAL 5MHSD 4PRNA 2IADB 1MIEL 2X4PA 3RP1A 1C16B 1MFCL 1P7QD 4BKLA 2WNGA 1G7HB 1KB5A 3A6BL 3N9GL 3TT3H 3AC0A 4G3YH 4AZ8A 4TSCH 4I18C 5D7IE 5CILL 2V5TA 4Z18A 2MHAA 4Z0BH 5JW4N 2GYSA 4S2SA 5EZJA 1MVFA 3KPOA 4P3DB 4IOSD 2E9BA 5DMKB 1NCBL 3H9HB 4Z78B 3RAJL 2ARJA 3QDJE 4D9QE 1U8MA 1DN0A 1GPOL 1XF4A 1NGYB 4WFGE 2WBJB 3T04D 1W0WB 2Z4QB 3MLRH 5D1QC 2BVPB 2ADIA 5F7MC 5GRVL 4Q9QH 5I73C 1P4LA 2VLLB 2C4FT 4MA3B 4S1DD 2NYYC 4XPFL 3U1SH 4Q9RH 4LPVA 4G6AD 4UMGA 2E8YA 3KNBB 4UTBH 4M48H 2DI7A 1UKSA 2ZG1A 2P1YA 5DLMH 1Z5LA 4CU8A 2D03H 4JDTL 4M7LL 1YN6A 1JGEA 5L9DH 3O2VH 1E4WL 1IKNA 3QIUB 1QFOA 3PHSA 1JI1A 1ZLSH 3TN0C 5I76A 1DE4A 3KDMA 1IQDA 4E41D 3EOBA 4ODSH 1WBYB 3RBSA 5KSAB 3VXRB 1EHLL 4MXWL 3A67H 2BSRB 3Q5YA 4JO2L 2MKWA 4LVEA 3EYOB 3VA6A 2KZ1B 1U8OB 4HXBH 1RAMA 4LLDB 3RDTC 1A2YB 5DC9B 2DM3A 3OHXA 1KJMB 4PV9B 3MNVB 4K3DH 4Z7OF 5I1AB 4Z7UB 4L3ED 4XP9H 3UC0L 1QFWM 4I0PC 5GRXG 2B5IC 1EIBA 2NLJA 3F12B 4AEIL 1YMME 1GGTA 1ZA6B 5HHMD 1K4DA 4QEGA 1PLGH 4W68A 2IQAB 5CHNB 4JY4B 1XAUA 4PJ9C 4WUUD 5ESQB 4WHTB 1QOKA 4I48A 3CGTA 4FZEL 4LSRH 3BGMB 2HN7B 2HT3D 4P3CL 4PRPB 2ZCLH 2EH7H 5DJXA 1PG7X 1RZJL 5BJTA 2VO5A 3JWOL 4L4VE 1AKJD 4JPKH 4RAUB 1JV5A 2Q3AA 3FB8A 1A4KA 1S7RA 1VFAA 2A83B 2OQJA 3OJ2C 3WSQH 4UU9B 4K71B 5AZ2H 2ZUWA 4Y8AA 3SDDB 5MEQB 4PBWD 4I3RH 3EDKA 4ONGL 4XNZC 1N8ZA 3X11A 3P0YH 2DQDH 1DUZA 4GSDL 4LSUH 1JYVA 4YHNB 2XKNA 4IMLA 2Q8BH 4FXKB 4GW4A 4X5XB 3S4SG 3O8XB 4LHJB 3PGCB 1KLFA 1FG2A 2BX5A 3MRJB 4ZAKD 2D7MA 2JB6B 4NFDA 1WBZB 4HXAL 4WFHE 3O9WD 1DEEB 5GJSH 4LKXB 1F4YL 4L9LA 4WDIB 5L0QB 1T7XA 1MFAL 3BMVA 2DI9A 5AZEL 4X6CA 4WNQA 2P43B 5EOCL 4XC3H 2YRPA 3TA3A 4CVUA 4TULL 3W0WD 1QKZL 3K7UA 4FFVD 5KTEH 4OF3A 1V7NL 2HT2D 4K9EC 5DQJB 1KBGL 3BGFB 3I6KA 3VWJB 1T03H 4PP2B 5IQ9B 3PP3H 3JVGC 1RIUL 1VACB 2CIKA 4UT6L 4R4FH 2DYPB 5MENB 5E94A 5EUOB 5F1NA 1MLBA 5IEKA 1N64H 2B1AH 3MRNB 1OAKH 5GSVA 1BFOA 4M61A 4XH2B 2FD6L 4OGAC 3MGOA 4OQTH 2GAZB 4OD3L 1MFEL 5D7LB 1WT5A 1YNLH 5IR1A 2CUHA 1FCCA 1K8IA 5GRZA 2CRMA 1EHNA 2G5BA 3QFJE 1H3WM 2C7UB 3C5JA 3UTOA 2OI9B 2CKBL 5JUEH 1NCAH 5B39A 3OG4B 3X12B 4GG6E 5I1KL 4C56B 4FZ8L 4EQ2A 4JFOB 4WENB 5T3ZL 5CCKH 1I7ZB 3MUJA 4UT7H 2IAMB 2R1XA 4HDIA 4LSDA 1RSFA 3ARXA 2DQTL 1S8DA 3IAPA 1FSKB 1KCLA 3ES6A 1OAZL 4N5UA 4Y5YC 1A7NH 2R2EB 4PB9L 1UB5B 4PTUB 3GSWA 5F6HI 3IJYA 3TYGH 5HVGB 5A40E 4ZO8A 3QCUL 2IH3A 4TTDC 1C5CL 5ESAB 5BXFB 2EDRA 3PV6B 2ORBH 4MQXD 4MVBC 4L29A 1MFDL 3GJFB 4OFKA 4ZODA 1GOGA 4N1HB 3U9UB 4RISL 5J1AB 3ARFD 4QHNA 1S5HA 3D85B 35C8H 1F8TH 4NHCH 4O9HL 3QRGH 3N0PB 5J1SC 1T5WA 4FQXB 2WUBH 1FNFA 3QDGA 1YQVL 5ISZA 4O4YH 4RRPG 4PJ8D 4YUEL 1D5IL 2VDKH 5CEXA 2XPGB 1M4KA 4UIMB 1P6FA 2PR4L 4NNYB 3WKMH 4UBDC 3WJLC 3TO2A 3GBLA 4HS8H 5ICXA 3VXUE 2H8PA 3O4LB 2AK4D 4IRSB 3CFJB 3OJDB 4JKWA 3PL6B 4MCZA 1CTNA 2YXFA 3KPSA 4KVNL 5ILTH 3RZCD 3SE8H 3VE0A 4XP6L 1WEJH 3FT4B 2R15A 3VXNB 1FN4A 1XGRA 3GMMA 4XAKE 4XBGB 4EUPG 2E7HA 4PIRF 1DDHA 3D0VA 4HQQL 3ZDYF 3D1MC 1I1FA 3IYLW 1WAAA 3F6LA 5DVKA 1HKLL 1RK1B 3CDFA 2PO6A 3BKJH 3HI6L 4CMHB 1AIFA 1UWGH 3DVFA 5I2IA 4M7KH 1PKQE 5I66A 3LQZA 4P23C 5ENWA 3D69A 3V6OA 2V17L 5F9OL 3T2NL 1OP9A 1FIGL 4P2RA 3ZL4H 8FABA 4PJXB 5SV3A 5EZIL 4IRJB 5J6HB 3UDWC 4DK6A 3OGCA 1G7MB 4PJGA 5CSGA 3VGFA 2IG2L 2VLRA 3DROA 4HJ0D 2Q87A 4PRIB 3PABA 4ODWA 2EIBA 3JV6A 3L7FB 2W91A 4DVBB 4YDKL 4QHLA 3IXAA 3SGJC 4H20L 5DRZA 4DGVL 1RZFL 2ERJB 1N26A 3RQ3A 1Q72H 1T0MB 4ZFOA 3MBED 1NLDH 2BY0A 4KQ3L 5HI4C 3VRLE 3ZHDA 5BV7L 3CNKA 5E6IC 4XMLL 5DUPH 1IMHC 2PKDA 3HMWH 1Q1JL 4WTZG 4EIGB 4YFLI 1RZ8A 3H9SE 3FN3A 4D0CA 2PTVA 4UNVA 4PJIE 3PHOB 1MRDH 1TFHA 4FQJL 2P46B 1RZGA 4ISVA 4QLRA 5CGTA 5DDHA 1VCAA 3MJ9L 2AS5M 1LP9E 1R5IA 1W0VA 3CDYA 3W39B 3C5ZD 1SJHB 1OGAA 2XQYK 4GMSL 3RVXD 1CXIA 1H3TA 2DQIH 4OKVA 1C5DB 1P9MC 3VD7A 1Q0YL 4NJAL 1U8HB 2XIDA 4RCAA 2FX8L 5H35A 4JFPA 2FZ3A 3MODH 2Y5EA 5E24E 2QJDA 4P46A 3T2PA 4LPCA 3HE7D 2GSIB 4NJ9H 1WFTA 5IVXF 4KK8D 1T2JA 1YPZA 2Z91A 3S88H 5HTSA 3EO0A 1NCWL 3LH2L 2W38A 1E6JH 3EZ8A 4N0FA 2E6JA 4NKMB 4RGND 3STBA 5JW5B 1RZ7H 4LMQE 4MHHI 3W82A 1RUKL 1I3RB 2V2WA 1AI1L 3E8UH 4LOUC 5CIPH 1A6AB 1MI5E 4MS8C 1DCLA 1OP5K 5B3NA 1CXFA 4LCCB 3CSYA 3GBMH 1IAII 4JREC 4XVTH 3TVMD 4PJAE 5C71A 3NPSC 4POZD 1R5WB 3AB0B 4GRLA 4H8WH 5HYJD 2VQ1B 3DX7A 1INDL 5E9DA 2ZCHH 4S0TD 2VXSH 4ZS6C 1FRGL 1WFNA 3O3AB 3QIBD 1MAML 1KGCE 4P9MH 1RUPH 2VLJE 1LO2H 4JY5L 4B41A 5L8KB 1JZ7A 3VDCA 2KZWA 1ZV5A 5IW6B 4QRPD 3EYSL 4ODUB 3SGEH 3S36H 2F5AL 3C8KB 3WDIA 2EDNA 1IGTA 1TTFA 1RHFA 5IHZB 3QUZC 4PJEF 3MLPA 1QFHA 3T8XA 3JV0A 1NBZA 5HXMA 3HZKA 5TH2A 2WQRA 5F1KC 4EI5A 4JQIL 3EJYC 4XCEB 1E0OB 1GC1C 3LRSA 2CQVA 4EDXA 1GHFL 3FN9A 4OZIB 1FC2D 4LARL 1E6OH 3UTZB 1JZ6A 2NZ9C 2YC1B 1D6EA 2H32B 3GI8H 4MCYA 4P5TB 4OGZA 1H9VA 1F58L 3LZFL 1BEYH 3AS1A 4IIQB 3FFCB 2DM4A 1E28A 2FATL 5JOEA 4JRYD 5MEPA 5E8OB 2FEDC 2EE3A 4J8RA 4JPWL 3QO1B 5HDQH 3WHE1 4NO2B 3UAJC 1PG7H 3TV3L 5ECJE 4A6YL 3ZHLA 2IBZX 3U82B 4OLXL 5AAWA 4R2GB 2GITA 3V52L 4F8TA 3T1FB 2RR3A 2VDPL 5FUZH 1CU4L 5FK9A 4WW1B 4HW6A 2GTWA 1CLZL 5L6YL 4NQED 5GGQL 3KAAA 3B8YA 3O41A 3G5ZA 3RHWK 5DJ2B 3TEUA 4ZTOH 5KJRH 4RZCB 1JVKA 4RSVA 1U2HA 1KJ2H 4M43H 1FNGB 2RHEA 2ADGB 1WV7T 1RULH 4K3JH 1JRHI 1U41A 3NH7H 1G9NC 5I75C 1A3LL 4PV8B 3BPOB 1JF1A 3I75A 2O61A 4UDTB 5KN5B 4J6RH 1EAPB 4ZQKB 2NPLX 5DMIH 1KC5H 4PJCA 2VXQL 4MNQA 3BH9B 1AQKH 2ZUQB 2GUOA 5MEOA 3ELAT 5GS1B 4XBPA 1D5XB 2AJ3B 1S7XB 5KSUB 3D39B 5FGBA 4E41A 4W81A 1CXKA 1RZKH 5GGSB 3KPRE 1MCJA 4ZUTA 4YAQA 3QDME 3IF1B 3DV6A 2AEQH 1MCQA 4K7FB 5CFHA 3O6MH 4FG6C 1I9RH 1EXUA 4K8RD 4MJ4A 3OAYH 3WJJA 2A0LD 1KEGL 4YZFE 2EDOA 4JFFA 2WQ8A 1FGNH 2P24B 1S7QB 3SDCB 2MPAL 3MRBB 5SWQA 1BIIB 4LRNL 3RIFK 4X98A 4XWGL 2EYSA 2OXHA 3HI1B 3QQ4A 4KGJA 4WUUA 4Y4FA 1KB9J 2LQRA 2FBJH 4ELMF 4WU7A 2WBWB 2YPVL 2WV3A 4U33A 4QOKE 3SDXE 3BN3B 1MCWW 5CP3H 1GOHA 4EBQL 3HNSL 1KACB 1U3HB 1MEXH 4M93C 4MJID 2X9WA 3PG2A 4P9HC 3CVHB 4YHIB 3CPLB 3HE6C 4OQTA 4LSQL 4IHOA 2YWZA 4DQOH 4ZUUA 4QY8B 1YN7B 5B8CC 4JANB 1C08B 5AAMA 2Z35A 1OAQL 2X4SB 5D1ZC 2CLRA 3C6LC 3QO0B 3OR7B 3NIGF 4QHMB 3QWOA 4PJEE 4XAWH 3KPMB 4LNRA 1DEDA 5KVDH 4KRNA 4X4XB 3Q6GL 4DEPB 2V2TA 4S1QH 1EEYB 4ZAKA 2QQQA 1H3VA 1LNUA 1NEZA 2DWDB 2C3VA 1ZEAL 3O9WA 4YPGA 1CGUA 1A1MB 3K8KA 4MAYD 1ED3A 2VXUL 2BXZA 5DRWA 1JJUA 5B38A 3TCLA 1T1ZB 4FP8L 3W9EA 3EYVA 4NPYA 1ZHBB 4NO3A 3SQOL 3UTSD 2O5YL 4R96B 3T3PE 1G84A 3V8OA 4DGYH 4QXGL 2BOCB 5TDPA 4CU7A 3W0WA 2HTKC 1MJ7L 4KDTA 1SEQL 1J86A 1IVLA 3HKFA 3PWLB 3C8DA 1IEAB 1Q9LA 3CC5A 4QRUA 3QG6B 3QIWC 2BVYA 3K4DA 1R6VA 5IEHA 3RTQB 3HB3D 4GRWF 1NDGB 3BVNB 2VXTH 2Z8VC 4PJBB 3ZHKA 2GJ6E 2X4RA 1FH5H 4FQPA 1MJJB 3H0TB 4PJDF 1CVRA 3FB6A 3NN8B 5CP7A 1VFOA 2XZAH 3QCVL 2M2DA 1KLUA 1M7DA 4MDJB 5FHAH 1OHQA 2VN7A 5C0BD 3P77B 1E4XI 4S1SL 1MIEH 2ITCA 1ZLUH 4BQCA 1T6VN 2O5ZL 1KIPB 1MFCH 3P0GB 1PX3A 2BNQD 2W65B 3H7LA 3A6BH 1S7TB 3N9GH 5CGYC 4QWWD 2R2CA 5CILH 5I1LB 1FYHB 3BO8A 3DVNA 4AEEA 5IQ7L 4X7EC 1S9VB 4GKSA 2E6PA 1L7TL 2FLRT 5J13B 3ZYJA 4HK0B 1YEDB 5E5UB 1NCBH 2WMPA 4OSUL 3IRZA 4B50A 3RAJH 5H2BA 1HEZB 1UXSB 3VXTA 1GPOH 3DSFL 1OAYL 5KVEL 1H8OA 3J8F7 5E8EA 1NSNL 4H1LB 2YD4A 4XPFH 3VGAB 4K3EL 1BVZA 5E8PA 1RIHL 4JDTH 4M7LH 1HI6B 4JFED 1E4WH 5GZOC 3OBAA 4F37F 3ARFA 2IAND 2HKFL 1MRFL 3ME0A 2P49B 4LVNC 2DWEA 3ZKMC 1EHLH 4MXWH 3IDUA 3EFFA 3V6BR 4PJ8A 4JO2H 3VFOA 2VIRB 4N0UA 1CD1B 4ZSOE 4OJFL 4EVNB 4ZXBD 5EO9A 5E1AB 1HYSD 3VG9B 3EJZC 3ILPB 1UM4L 3KLAA 1MCPL 1OB1A 1A14L 2AK4A 3UC0H 3KR3L 4JFYA 2J8UB 2Q86A 4AEIH 4JQXA 5L7XL 4L4TE 2FJHB 4XNQA 1XGYL 2JIXB 1NC2B 3QNZA 3L5JA 5HDBF 1HH9A 2PW1B 1AY1L 3RY6C 1XCTA 2J8HA 1MQKL 1RY7B 4FZEH 3T4AA 1FNLA 4P3CH 5T1MA 3CSBA 5TF0A 1RZJH 1CDBA 1FAIL 5E00B 5C3TA 3NFNB 3JWOH 1NMBL 1QQDB 5EUKB 1ZVHA 1ZHLA 5HY9A 1KLGA 4E0RB 4OFIA 2AK1L 4Z7WE 3BI9X 4G8FB 4D9QD 3WUWG 4LLYB 4WFGD 3WLWD 2CXGA 2YPLE 3RRQA 2MWCA 4PLJD 3WFZA 4ONGH 3CCHB 4XI5D 1TENA 2KDGA 3LEXB 4GSDH 2Z92A 4D9RE 5D6CB 1AO7B 3L95B 5I30L 4X9HA 4P49A 2N7AA 3MRFB 1RD6A 3MA7A 1QSZA 3GSQB 5FB8B 5IOPA 3ZKXC 4Y1AB 5T3ZD 4JVUA 4HXAH 2W0FB 4D8PB 5BS0B 5IK3B 2MMXA 4U1IB 1A6VL 4GRWE 1F4YH 3O2DL 1DLHA 1MFAH 1T1XA 3GMNB 4IJ3B 4KKAC 5AZEH 3ECBA 3D18A 2VNCA 5EOCH 3BE1L 3OKKA 3LPWA 3CFEB 2G2RA 2FL5B 3CXDL 4TULH 3BD4A 1QKZH 4WWKA 3TBSB 3C5ZA 4ONOA 1V7NH 1KBGH 3MX0A 3E6FA 1QSFB 2EXYC 1RIUH 2PETA 4UT6H 1V3KA 3Q6FB 4OCRL 3MXWL 5IIEA 4QRQA 3VI4F 4DGIL 4MMZC 1SYVB 5I16A 2FD6H 5KSBE 1LE5B 1HH6B 5SX4I 3HE7A 3CSGA 4LEXL 4OD3H 3MUZ1 1MFEH 1DVFC 3DURB 4Z95L 1S7VB 2WWKO 1OD7A 2NTSP 1DANT 1IC7L 2W9EL 1J7VR 2AV1A 5D7JD 4WFFE 2DMBA 3MC0A 5EOQL 4HMEA 1JK8B 2CKBH 3GIZL 1T20A 5T1LD 12E8L 1NC4B 4G8GB 4Y2DC 2BY3A 3QZWB 5I1KH 1Z0MA 3EOAA 4YXHL 1DUYA 3P4OB 4FZ8H 3TBVA 5L2KD 5T3ZH 4O2FA 5GHWL 4NRYB 1LO5B 3JTTB 2DM7A 2DQTH 3TVMA 3I6LD 3HRZB 1OAZH 1A7RL 5SWZE 5HYJA 1X5ZA 4PB9H 1NANH 1Y18B 3SCMD 4HKBB 4HSQA 3QIBA 5K9JL 4WFHD 3QUML 3VGBA 2YA2A 4GO6B 3CU7A 1JIBA 3QCUH 3RUGB 3B6SB 3TN0D 5FF6B 5AG8A 4MD0A 1C5CH 4F3FB 3BAEL 2EKSB 4YC2B 2V5SA 2WIIA 4HWEL 4CVWA 1TMCB 1TZIB 3BP6B 1MFDH 4WUKL 1KJ2A 1FV1B 1NGWA 1BZQK 4PR5A 4RISH 2UVFA 1JGLL 4ZUWA 5GGRB 1I8MB 5ANMA 3HZYA 3EO1A 4NQVB 1JWSB 2Y23A 5JORB 1G6RL 4O9HH 4P4RA 3ZDXE 4M8VA 1B4RA 4HK3N 3G6JA 3NGBC 1RIVL 2E3VA 4NM4L 3LB6C 1YQVH 4G5ZL 3RX5A 3BQUD 4YUEH 1RVFL 4Y89A 1D5IH 3FQWB 5E4EC 1CFNB 3U36B 4ZO7A 1NFDF 2YD3A 5I1HL 2PR4H 4MLIA 3QA3B 1IQWL 4PJ9D 1TJHL 3QNYA 1GXEA 3F62A 4DKEL 1BVKB 3MV9E 4MXVE 3BIKB 5E7BA 4M4RA 5FUOL 1RJZB 4NO5A 5AWNL 4JRYA 3PNWA 4KVNH 3MOBL 5TDNB 1NFIA 2QQNL 2G5RA 2EYTA 4Q9BA 5EC1B 4JGJA 2IMNA 2BMKB 4XP6H 1V7ML 4ZOCA 4NQDD 5JIHA 2BK8A 5FDYA 4U1GB 4BUGA 4YBHA 1QPPA 4HQQH 1H8SA 5J89A 1QSVA 1XGQA 3REWA 43C9B 3BDYL 3U0PB 1UJ3B 4PP1C 1EO8L 1HKLH 1XH3B 4HMCA 3AUVA 3AREB 3HI6H 4YDJA 4KROB 2C26A 1AHWC 1TPXB 1CGVA 3NIFE 4NQEA 5DMGC 1KELL 5IB5B 3BZDA 2V17H 5F9OH 3T2NH 3U79A 1FIGH 1UFUA 4X9IA 1EMTL 4JLRB 5E8DL 1MPAL 5DEFA 3V5KB 3IXTB 5L88L 3T0DA 2IG2H 3VD4A 1IEBA 5BVJB 1AGFA 4HH9B 1GVIA 3MGTA 4C54A 5C0DB 5JIIA 4NN7B 3U4BL 4YDKH 1K9TA 3HI5L 4NSKA 4P3WA 1WFOA 4H20H 4DGVH 1RZFH 1FZOB 2IWGA 3QI9B 1JYNA 3BZFA 3MO1A 2IGFL 3D0LA 4TSBL 5JDSA 4KQ3H 3VI4E 4JVWA 3ARUA 5BV7H 3FB5B 4XMLH 2OBGA 4X6EA 2BCKB 5CJXA 1Q1JH 5SWSB 4RWYL 2Y07L 2A74A 1GSMA 2VITA 1GZQA 2HJLB 2OCFD 4FQJH 4OB5L 3MJ9H 4MLSA 1EH9A 3VXUD 4HPOL 3DX8B 4OF7A 4OGAD 3QYCA 4JFHD 1FJ1B 4HT1L 1WZ1L 1NBQA 3NIDF 1P7KA 4GMSH 3U7YL 4UQ3A 1C7TA 4CDGC 1KNOA 1Q0YH 4NJAH 4YGAB 1VENA 3BT2L 4GQPH 2FX8H 2NXZB 5C0GB 3GMOA 3ORJA 1NKOA 3IVKB 3T3MF 1B2WL 1BBDL 5ID1A 1AGBA 4G6KL 2BHYA 4OZHF 1EEQA 1QO3B 4APQB 5JIPA 3S5LA 1XR9A 3CUPA 3G08A 1K4CA 4U1KA 1HQ4B 1NCWH 3LH2H 5E2TL 5FYJL 1I3GL 3QQNA 4Q97A 1OWRM 5FYLE 3ZMRA 1M05A 3DHMA 2AP2A 3B83A 4UB0L 4DTGL 1RUKH 4MX7A 1ACZA 3MRRB 1AI1H 1TZHA 1WWBX 1QRNA 4DN4L 3O11A 2RBLA 3SO5A 4G6ML 2X42A 4J3VA 1U8JA 2D0GA 4P99A 3MROA 1I7UB 2VLKB 3GMRA 1B6UA 4MVBD 1INDH 1LQSR 1Z6JT 1G7PB 1FRGH 3DRTB 4BSWB 1MAMH 5E08L 1U42A 1X5JA 2V5YA 1NLBL 2VQTA 4MAYA 4JY5H 3QWQB 4Z7VB 2NNAA 5HYQB 5IFHL 3BZEA 2QKIA 2QSCL 5D96B 3EYSH 2R1YB 3L3HB 2Q6WB 5EU6B 1D5MB 2F5AH 3UTSA 1F6AA 4GQ9L 4NO0D 3HG1E 1NBYA 4UBDD 1AD9A 4W4OC 2H3NB 3O3DB 3DXAE 3GUTB 4JQIH 1SM3L 2OR7A 2Z8RA 3FOMB 5FV1L 1T1YB 1GHFH 1HDMB 1XF5B 5JHDE 4LARH 3SBWA 3IGAB 1KENL 4OT1L 2EIZB 4HX1B 4LCWE 2YSSA 4PJ5E 4X5WB 1FVEA 4AEFA 1LGVA 2A73A 3GSXB 4PY7B 1F58H 3LZFH 3W5NA 5IVZB 4LLMB 3KXFB 2GJZB 2FATH 3GSNB 1F2QA 1MHCA 3ARRA 4JPWH 3PDOB 3GB7B 3P30L 3VFNB 5C6WH 3QSKB 4BZYA 4B0MM 4NQCE 3H9ZA 4TNWK 3TV3H 2BNQA 3PWUA 4A6YH 4HLJA 4P23D 1N6VA 4GBXD 3F8UB 4OLXH 4BJLA 3AXLB 2Q8AL 2D7QA 2E7BA 1QSED 3V52H 1SY6L 1PFCA 2Q3ZA 2VDPH 3GMLA 1CU4H 3E6HB 1KPRA 4D94A 3WHE0 2BOBA 2P8LA 4ODXB 2UY6A 3VXMB 1CLZH 1OQOA 4G6FB 5DYOA 5L6YH 1DBKL 5GGQH 4HUXA 3OL2A 3QQ3A 2XFXB 2VE6B 4PJ7A 1CDCA 1Q9WA 5E5MB 4KV5F 4PJFE 2J12B 3RWEB 1HHJB 3S97C 5KSVA 2VLJD 3FT3A 5DVLA 5INDA 5DMYA 3UPRB 4OUOA 5HI4D 1VB9A 1A3LH 5BQ7A 5E6ID 3W81A 4UI2A 4X6BB 4ZFZB 4JFEA 4UQ2B 1NCUA 5EUOF 1JGVL 2AJUL 2KQNA 5TGBA 4JG0L 2VXQH 3VW3L 4UTAL 2J5LC 4L8SB 1OPGL 3DMMB 2IANA 3MYJA 2ZUUA 1LDSA 1JMZA 1YC7A 3ARPA 4WY7L 3BUYB 4UUJB 2XRAL 2YD8A 3V6FA 4QCIB 1XIWB 2IH1A 1DQQA 3G6AB 4FRWA 5DJ6B 1Y0LB 5JW4Q 4XNMA 1AE6L 1KEGH 2BNUA 5FYLL 4JZJA 4TUKL 4OIBA 2HLAA 3O8XC 5IV2A 5D2NC 1NDMB 1TETL 2ZZUT 2MPAH 5F7KC 1T22A 4DUVA 4LRNH 3TESA 3P9MB 4XWGH 4P5MB 3VCLA 4EN3C 3ARYA 5KOVC 4U6HB 3W11C 1ZT1A 5D7IA 2BP3A 5IBLC 3VXRE 2YPVH 5DT1L 5FXCH 3SY0B 1TQCC 1SYSA 1S7WA 5FGSA 3QHTC 2CDGA 4EBQH 1MWAL 2DMKA 1PZ5B 3UZVB 3HNSH 2P45B 4PRNB 1Z9SA 2Q7YA 4K55A 4IRZL 4UOW1 3QDJA 4X0KA 5DS8A 4LSQH 1KB5B 3CMGA 4G9DA 4Z7UE 4ETQB 2RCSL 2YKLL 3OJMB 2YOCA 4WJ5A 2MHAB 3LKRA 4ZPTA 5FAAA 4QRSB 3OAUL 2WWMC 4XVUC 1OAQH 4OZGB 1OAXL 4S2SB 4NIKB 4NWUL 2UWEB 3NVQA 3BP7A 4Y4HB 4HIXL 5DJ0B 2CKBA 4WU5A 2ZUSA 1R5VB 3BIAX 2VL5A 2SEBB 1CFQA 3Q6GH 4PRPE 5C0NC 5JXAL 4J3OC 3CLFL 1ES0B 2VKXA 4JHWL 4XCNB 1PG7W 4P2YA 1ZEAH 4OF5A 3TJEL 1J12A 3QUZD 2HVJA 2XTLA 4ZOEA 2VXUH 1X5KA 3QDMD 3LQAL 1BHGA 4R3SA 1XR8A 3TBYA 3EDJA 3X13A 1W0YT 5ERWA 4FP8H 4M4PA 1Z5LB 2Z31B 3MNWA 4KH2A 4TTGA 3DGGA 2OP4L 4IMKC 3SQOH 2ZG2A 1XCQA 2GSGB 2O5YH 4UDUA 3FQNB 2NZ9D 3VH8A 3GO1L 1U8LA 1JF5A 3A6CL 3REVB 1JPST 3BFOA 4KRPC 4QXGH 4UNUA 4LPWA 1DE4B 1E27A 4HIJB 5I8KL 2CDFB 1N5AB 4EZMA 1KCVL 1MJ7H 1SEQH 2VZOA 4U1LA 1CDIA 4Y2OA 3S4SB 3LS4L 3KS0J 1YMMA 1NPUA 2X05A 4GXUM 4FXGA 2P7TA 4HIHA 3ULVF 3UAJD 4JFDB 2I9TA 1G7JB 4WV1A 3VXSE 1TVDA 2X4NA 3EHBC 1M6OA 4I18A 4PD4J 2R8SL 3V4VL 3QCVH 1VSCA 5AD0A 2YD5A 4ZFFB 3HS0B 4S1SH 2ITDA 3BH8B 4RDQF 1H3PH 1P84K 2O5ZH 4U3XA 5D7JA 3PWNB 2JE8A 2RIKA 3P0VL 1J05A 1UG9A 4JDVB 3OV6A 5T1LA 5C9JA 2Q7NA 3R06A 5IQ7H 2C1OA 1MHHB 3IDIB 3ALWA 4HWZA 3GI9L 3RVUC 1KIRB 1L7TH 2BVQA 2JB5L 1JN6A 1EBPA 5FGCE 1S7SA 5ETUB 3G5YA 4OSUH 5DWUL 3GGWA 1XGPB 1FNAA 3DSFH 1OAYH 2OL3L 3SCMA 5IMKA 5D7LE 1BP3B 2WBKA 5IB2B 5KVEH 4U0QB 4H88L 1CL7I 4N5ED 1J8HB 1K5NA 5HHOD 3VH8G 5C1MB 1NSNH 1DUZB 4H5SB 1I7TA 4JY6A 1AR1C 2XKNB 4IMLB 2ZOLB 5DD6A 2HKHL 1ZK9A 2DLFL 4K3EH 3TNNA 2W92A 5C09D 1RIHH 3FOLB 2XA8L 1HHHB 1FG2B 2ZKHL 4FG6D 3MRHA 2YN5A 1BVLB 2NY4D 5JOFA 3D3VB 3LN4A 2IJ0C 4JHBA 4NQSB 1U3JA 4CW1B 3LD8B 3QJFA 2HKFH 1MRFH 5IMOA 3M17B 4L9LB 3Q2CA 3MLYL 3X3GL 4Z5RA 4X6CB 3BQUA 3BPCB 4QHKI 3E3QE 4WNQB 5FHBL 3TF7C 3OXRB 1T89A 2Y06L 3WFHB 4NKDB 3PJSA 2EEAA 3MNZB 4OJFH 1Q9OA 4YIQA 5MI0B 2GJ6D 2X5PA 1UM4H 1MCPH 1SMAA 1PGRB 2OSLB 5HSFA 5FOBA 3IDYB 3CX5J 3HPLA 3KR3H 1IL1A 5ICYB 2R69L 5L7XH 2QSQA 2CIKB 1IRAY 2VOTA 5F89B 5E94B 4AYFA 5F1NB 4LPXA 1XGYH 4KXZI 3ULUC 2QR0A 3MJ9A 5DJDB 5CSZB 1DQLL 1GAFL 1AY1H 5GSVB 4GG6A 1MQKH 3FHQA 1YEKL 3MGOB 1OW0A 1HSAB 4NYLA 1UA6L 4X4YA 1FAIH 1NMBH 4FTVB 1ZT7B 2DQCL 1A6TB 5HYIA 5DUBB 1RJLB 3ZE0F 1X7QA 5CD3A 2AK1H 3C5JB 1S9WA 4U49A 5AUMB 4NNPL 2NX5D 3O4LE 4KJYA 2ZUYA 2AXGB 4UILL 2BY1A 2V7HA 3DTXA 4ZDHA 5I30H 2BJML 4EUPB 1OTTC 3O6FB 5ALCL 5EBMB 3HN3A 3TA3C 3MRMB 1RFDL 3FL7A 3NZ8A 4G42A 1HZHL 4MQ7A 3S3SA 5T3XE 5DGQA 1A6VH 5CLWA 1IM9B 1CDYA 2HTKD 3O2DH 5F7DA 1J10A 4KGLA 4KRLB 4PJXE 1HINL 1TJIL 3QIWD 2FIKB 1QD0A 3BE1H 5EO0A 3EYFB 4XPHL 3CXDH 4YBQC 1S5HB 3HNTL 3RL1A 1ONQB 3V6ZB 4PRIE 1G9EA 3I6GB 4YE4L 1B3JA 3VXUA 3VFPA 4XXDB 2JCCB 1LEKA 1H15A 3TZVD 5ISZB 4L4TD 3OWEA 1KYOJ 4UINL 4OCRH 3N1PC 5CEXB 3MXWH 1EVUA 4DGIH 4X7SL 4OTXL 3PUCA 3DX9B 5DRNB 5CGYD 1FFQA 5ICXB 4R7NA 4LEXH 3FAWA 1F3RB 1ND0A 2ADJA 3J7HA 3TPUB 2OR9L 1PKQA 4Z95H 4YHML 5LKNA 5GJTL 3SPVB 1YYLL 1IC7H 2W9EH 3V0AC 3STZA 5EOQH 1DDHB 5MP6L 4Y5YA 3IKCA 4MSWB 4HGWB 1B6DA 2VMFA 3GIZH 2YPLD 12E8H 2J3SA 3UJIL 2VSDA 4BM7A 5A2KH 4YXHH 1KN2L 3BMWA 3O6LL 5C07D 1CD8A 3HNVL 5GHWH 2CO6B 3QDHA 4A6YA 4ZUVA 3OKNA 3I3EA 4L8DA 3GMPA 4DK3A 2XNAA 2PXYA 3FZUC 3FRUA 3LKQA 4OGYL 2BNRB 1A7RH 2FEEL 3VFMA 2DL2A 1ACYL 3IT8D 4YDIL 5E56A 5ESVB 4Z6AT 5GZOD 4B53A 2EDBA 3T0XA 1MUJB 2FO4B 1U8NB 3MTRA 3QUMH 4QKXB 5K9JH 3BRFA 3OGCB 3R8QA 4BFEA 3E2HB 1X3DA 1P2CB 1BOGB 1KG0A 3MFFA 4PRAA 2NY7L 3CDGB 3VFGL 4MA1B 1UH3A 3OX8A 3BAEH 2VUOA 4YBLC 4PGBA 1D5ZB 3MZGB 2DDQL 5DJZB 4HWEH 1WITA 5D70L 5DMJB 4AH2A 3M45A 4OIAA 3H9SA 4WUKH 4U7SA 4PJIA 1B9ZA 1JGLH 3VD3A 2BSTA 4WO4A 4NO0A 1LP9A 3EJZD 1G6RH 1TTUA 2AXFA 1GCFA 4XMPL 5IM7B 5C0CB 5DQDL 5E6ZA 1RIVH 4NM4H 4G5ZH 4HFUL 1RVFH 2AV7A 1CICB 4D0CB 5I1HH 2PO6C 2VYRE 1IQWH 4A2MA 1TJHH 1YMHA 1KJ3L 4DKEH 1W0VB 5K93A 4OCXL 5AWNH 5EU7E 5FUOH 1LMKA 4X8JA 1OGAB 5EU4B 3V6OC 5F7UA 4O2EA 1MCBA 3MOBH 2ZUQC 3L3JB 2QQNH 4OKVB 4W4NA 3G5VB 1V7MH 1MCIA 2X7LA 4QXWA 4CBPA 4RQQA 4P23A 4GBXA 3C6SB 2FZ3B 5FM5M 5J6GA 1MI5A 1QSEA 1NGPL 1QFWI 3BDYH 3UDWA 1EO8H 4F9PC 2AAVA 1N3NA 5FKPB 4OZIE 1HYRC 4YHPB 3BPLC 2V5MA 3ULSB 5T3XL 1DZBA 1KELH 1UJTA 4PJAA 4N0FB 3TIDA 3STLA 3F58L 3FFDA 5DHVH 3FFCE 2FSEA 4Y4KD 4NQXA 4RMTA 1EMTH 2V2WB 5E8DH 1MPAH 3BP4B 1MRCL 4CVZA 5L88H 2GKIA 2VLJA 5FYJD 5D93C 3WL9A 4NDMA 2YWYA 5J0BA 2WP3O 3U4EA 3IETB 5BCAA 1U3HC 3B9DA 4IDJL 3U4BH 3HI5H 4F33A 2AQ2A 3RHWF 4HUMB 8CGTA 4WCYL 3PP3K 4UT9L 3K1KC 2X9XA 2IGFH 3GSRA 3IDJA 1T66C 4TSBH 3VFSB 1A4JA 3FQXA 3SKOA 4BK5A 5INCB 4PGCA 2EXYD 1I1AA 2HVKA 1L4IA 4P46C 1FO0B 4RWYH 4OV6F 1F02I 1JF6A 4HS6A 4OI9A 2Y07H 3DECA 5J11C 1IGTB 2PCPA 4G8EA 2YS4A 4RIRA 4OB5H 1EX0A 3T8XB 3U0TA 1CD0A 3GHBL 3SKNA 5GSRB 4HPOH 5EDXA 5JA8B 5L2JB 1CF8L 1CDJA 4ORGB 4PRBA 5TH2B 4HT1H 1WZ1H 1BQHA 2R1WA 4OD2B 3U7YH 1DVFD 4OGXL 3LRSB 3QEUA 2UYLA 4DOHB 3DBXA 1P53A 1XMWA 1D6EB 3SDAC 3B9KA 5B22A 3BT2H 1SVCP 1NGZB 3V5HB 1CCZA 3HUJB 1B2WH 1BBDH 1JUFB 4Y2DD 2P8MA 5TJWK 4G6KH 4G9FB 1G0DA 4AEHL 2ZOKA 3MREB 2YEZB 1VKXB 4RAVA 1F42A 1SMOA 5E2TH 5FYJH 1I3GH 3RIFF 1P7QB 2GQHA 3IFOA 1QLFA 2IFFL 2N56A 2Y25A 4NNXA 4FQ1L 4OUUB 4UB0H 4DTGH 2DM2A 2XI9A 2GITB 5F6HJ 1JWUB 4F7CB 5IMLB 2JJWA 2FR4B 3GRWL 1EFXD 4DN4H 1XZ0B 5D1XA 3L9RA 4G6MH 1CLCA 3ROOA 5CEYB 4GH7B 1M1SA 4RFEA 1WUNT 2CLVA 1IC5L 1F97A 3G5ZB 5D7KE 3BRDA 4KK5C 5JLZA 1EEZA 1HXYB 2J6EL 5DZLA 4EI5C 3PHQB 1BGXL 5K59E 5E08H 4NN6C 1TCRA 1NLBH 2EH8L 4GUPA 2UVEA 3KPRA 1YNKL 3QDMA 3LMJL 3ARTA 2GJJA 3C9NB 5IFHH 5DJYB 3VXPA 4Y5XB 3CFBB 1O5DT 2QSCH 4C83B 1BQHG 1UYWL 4EQ3A 2RJMA 2X4QB 4GQ9H 1F6LL 2GUOB 4KJWC 4H0IA 5MERA 3DUUB 1I7RA 1CVSC 4E41B 3NTCL 4WI5A 5I9QB 4MJ6A 1PEZA 4LGPB 5GIRA 3TBTA 1SM3H 2FB4L 3BISA 1INEL 1DBML 4NKIL 4HH8A 5EN2A 1RZIB 1KENH 3RWHA 2VDQL 3GSOB 4OT1H 3IDNA 4QOKA 1MCSA 3SDXA 5J56B 4YK4B 4L3EB 4C58B 4ETYA 4PGDB 5TQ2L 2NY1B 2HP4A 3V7AG 4PP1D 3PIQB 4GW1A 2X4UA 3P30H 3HLAA 2EYSB 5DMGD 5FYLD 3I2CL 2NY3B 4S1DC 3T0WA 4YLQT 3VRIA 1QR1B 4G6AC 1D5BB 3L3KB 2X4OB 4G8IA 5F9DC 2Q8AH 2IPKA 2DQEL 1SY6H 3AAZA 4Y16C 3CIQA 4KUCF 2ESVD 3I3BA 1AKJB 4M9PA 5F3HA 1I85C 1A1OA 1DBKH 1HILB 3QEQD 4PJBE 5I6XB 3VXQB 2ID5A 5E2JA 3G9VA 5DO2C 5DRXA 2LE9A 3MJ6A 3IFLL 5FIEA 3RGVD 5C8JB 1YA5A 1N59A 2XG5A 1PYWB 2KL6A 3NCYS 3WJJC 1ZT4A 2JKXA 2CR3A 3RKDC 3H3KA 3QULA 4OV5B 3QWOB 1A3QA 4LNRB 5GS2D 5CD5C 3O3EB 1G7LB 2OX5A 1OT2A 4N1CA 1JGVH 2AJUH 2P5EE 4JG0H 4M8QB 1X6NA 4ZAKB 3VW3H 4F7PA 4UTAH 1FZKA 4J3UA 1OPGH 3U0WL 4YPGB 1R24A 4XPBL 3DXAD 4WY7H 4Y4FC 3TCLB 2XRAH 2W0KA 2DQJL 5LWYL 3ABZA 3B43A 1VGKA 5DGRA 3W9EB 3RI5K 2CGRL 5JHDD 2APWA 3WXWL 1HXMB 3CJJA 1AE6H 4LCWD 4PJ5D 2GJ6A 3C60A 3CK0L 1OSZA 5FYLH 3O2DA 5I1DA 4TUKH 4AT6A 4ZFOL 4ZD3L 3SE9L 5ADPL 1IM3B 1TVHA 1KXTB 1KULA 1TETH 3AS2A 5TDOB 2BDNL 4LQFL 2QADD 3VDAA 3CMOL 5CWSB 5CZVL 4OFVA 5I8OL 4LLQA 3HZMA 3QXAB 2X4RB 5DT1H 3HCVB 5C92A 4U0RC 5CP7B 5B8CA 4D0BA 3RUGF 1MWAH 1KLUB 3CVHL 2NY6D 3CFCL 3NOIA 5IB3B 3WUZA 4IRZH 1ZHKB 2DLGA 4OM1L 2Y6SD 3SJVB 1IGYA 2RCSH 3WS3A 2YKLH 5GS2H 3ARGD 5LVEA 5KS9F 3DVNB 2J8UE 1XEDA 2DI8A 3OAUH 1KTLB 3SEPA 4DAGL 5I8CB 1ZLWK 1OAXH 4NWUH 4N8VB 4JM2C 1KT2B 4UOW0 2IBGA 5CJ8A 3RNKA 1V8HA 4HIXH 5H2BB 5AEAA 1MHEA 2H2PC 4FFVC 5HVFB 3LPFA 4KDTC 5JXAH 2HJFA 3VFRA 3PWVB 3CLFH 4FS0A 3C2AL 5IT2L 3F65A 4PGEA 4Y5VA 4JHWH 3EBAA 3LN5A 3TJEH 3LVEA 1Z9MA 4QT5B 5J8OA 1I1CA 4KI5C 1UZ6F 3LQAH 4X6FA 1U8QA 3WUWB 3U30B 3RVWC 2LU7A 4P4KA 1ZHNA 5CBAA 1SEBA 3QUMA 4TUJB 2OP4H 4ZSOA 4BA8A 5KANG 2J7LA 3GO1H 4RBPH 4EOWL 3A6CH 1T04B 4NHUA 1AO7E 1INQA 1CI5A 3WO3B 5I8KH 3MRIA 3SN6N 1KCVH 5F88A 2YK1L 3LS4H 1A7OL 3TZVA 4Y1AE 3ZSSA 4PJ8B 4L4TA 3VFOB 5DUML 1DP0A 5BS0E 1EUTA 5DTFA 4JFXA 5IVXB 1G6RA 3A6OA 3VXRD 4FOMA 1FVDB 2R8SH 3V4VH 4CAGA 2BZDA 1ZS8B 5D5ME 4C4KO 4ONHA 3NMEA 1FZJA 2UV3A 1B90A 2KUTA 4MQTB 1TQBC 5DA0B 5EBWA 3RZCB 3WFBL 4XNQB 3QWRD 3U83A 4Z7WA 5HVWA 3QNZB 2NTFA 1ZVSA 3MRPB 4L1DA 3P0VH 2DLTA 4M6ML 1MFBL 2YPLA 3ARDA 4KMTL 1QSFE 1HK6A 3VRJB 4X7FC 4OZFH 1R3KB 3B2UC 3VWKC 3GI9H 2QSTA 3SDYL 4YEFA 3GSVA 1ZHLB 4NGHL 4EXKA 3ARFC 1QEWA 1KLGB 2JB5H 4F7EB 3NFPB 2EDQA 5DWUH 4X99A 3DVGB 3TIEB 3S9DB 4WIQA 5EZLA 3AGVA 4MNHA 4M02A 2OL3H 5D4QA 1JZ8A 1CN4A 3IFPA 3VMOA 5E8NA 3SQBA 1EPFA 4H88H 4WI9A 4YDLB 2AXHA 5EPMB 4D0DA 1JTOA 1WZMA 3T0AA 4X7TA 2WM0A 5DHVA 4KI5E 2HKHH 3OAYK 2DLFH 3I50L 1MY7A 1NUDA 4XP4L 4G8GE 2R2HA 5CIPB 3KPPA 2XA8H 5HI3C 4DFHA 1A6PA 2ZKHH 1KIQB 2I27N 2X89D 2GEEA 1CFSB 5JPMA 4U6YA 3OXSB 3LHPL 1RQ5A 3MBEB 1SJEA 1K3IA 2DN7A 4HZLB 3O8XD 1IAIL 5HPMB 5KG9B 1T1XB 3MLYH 3TBWB 5CBEB 3FO2A 3X3GH 4BSVB 2YD2A 1DQDL 5FHBH 5CAYB 3ECBB 2Y06H 5I74C 1R3LB 5J9PA 1T1WB 3OKKB 3WNMA 1LO0L 5JPNA 2I60L 1VDGA 2WANA 1U8PB 3I3DA 3RUGE 4E42A 1ZWIA 4EN3D 1T21B 3B9AA 3VXSD 3W11D 3RY6A 5KSBA 1BZ9A 5DK0A 2R0LL 4G43B 3M1BB 3L7EB 2R69H 2EEDA 4GKOA 4M6OL 2A77L 4QRQB 3DYOA 4F15B 4LLVB 1YYML 3GHEL 1DQLH 1GAFH 3EFDL 3DV4A 2O93L 5I16B 2WZPD 4BH7A 3BZ4B 1YEKH 5I71C 3W5MA 1LE9A 1UA6H 4RFNC 1IAKB 2DYPD 5FEBA 2VDLL 4LIQE 5LGJB 1WSST 2WWMD 1RJYB 2VAJA 2AEIT 3G9AB 2DQCH 3WYRA 1FFNB 1JGDA 4P5KB 2ICWI 4RGNB 5SWZA 2DKUA 4NNPH 2N4IA 3PGDA 3KJ4B 4Y4KA 2BXYA 5D7LD 4BH8B 5C0ND 3GMQB 5BZWA 1SBBA 4XCYA 3KS0H 4KKNA 4UILH 5K9OA 2VUYA 2KBGA 2FJFB 2CR6A 3RWGB 4I4WA 4R8WL 2BJMH 1CG9A 2E7MA 3T0EB 4Y8DC 3MR9B 3TVMB 5ALCH 4CJ1A 1HKFA 2VISA 4PYHA 4WWKC 2CDEA 3ZE2F 3C5ZC 3VFVA 1RFDH 1UWEL 2IAMD 3CXHK 2XTJC 3RVXC 3ZDZF 1HZHH 5HGAA 2EE9A 4L8CB 3OGOE 1I1YA 4U1HB 3IRPX 4K23L 4MD0B 4HUWB 1Q94A 2EO9A 4YPJA 3L3IA 2WIIB 4YHKL 5B3JF 1HINH 4QRPB 4LLUA 1TJIH 4QRRE 3HE7C 3OB0H 4KK8C 4XPHH 1HHGA 3GSUB 3HNTH 4YE4H 4QXTA 4U6TA 4P4RB 3MV9A 1MCWM 1JRHL 1ZLUK 3U7WL 3WXVL 2A6DB 3QDAA 1DVFA 4ELMB 1MNUL 1FCGA 1ORQB 4UINH 1MHPL 4S11A 1J11A 2Y7QB 1BM3L 4X7SH 4OTXH 1HNFA 3TT1L 3F7PC 1J0YA 2JJTA 5A1AA 4GS7B 1YDPB 4POZC 4Y2DA 1F4HA 4JO1L 1MCCA 5DEZA 2D0FA 2QL1A 2OR9H 3RVUD 2BSSB 2EYTB 3SKMA 4U1JA 3F7VA 1IAOB 4YHMH 1QLEL 4FQQA 5GJTH 3NAAL 1ORSA 1YYLH 2K1MA 3UTQA 1R3HA 1BBJA 2OXGA 3C5SB 3H9YA 3SHSA 5FA3A 4HBCL 3O4LD 4OQ1A 1VFBB 4IRSD 5MP6H 4BFBD 5GRVK 3PL6D 4DZ8B 5T5NF 2DQGL 4XMKL 1NAMB 1VFUA 5TE4L 3KYMA 1YEJL 3BWAB 3UJIH 5HVHC 3JWDC 1DBJL 1KN2H 3O6LH 3QEHA 3TCXA 3HNVH 4YDJB 5I8EA 3MPCA 3SKJL 1A6UL 4PYGA 1AR1D 43CAB 1NANI 2PTTB 3BWUC 3QUXB 4OGYH 1ACYH 4X80L 1MFNA 1SY6A 4YDIH 3DUSA 4CVXB 1L6XA 4GLRH 1BLNB 2COQA 2XTJE 1PJ9A 1U3YA 1BIHA 3EDFA 2NY7H 1AGFB 5IMMA 3QXWA 3VFGH 1JNJA 4NWTL 4Z0XA 2DL9A 1RZKC 3OJVC 4KMLB 3QAZC 1T3FA 3QUYA 4X9GA 2DDQH 4JO3L 4CN4A 4N68A 4IRJD 5D70H 1N7ML 4HWBL 3ZE1E 2D9QB 3DLQR 5EC2B 1F4AA 3KYNB 3KPNA 1JNHA 2ZNXA 1ODAA 3JUZA 5DURD 4XMPH 4AQOA 2WINA 1JWMA 4NCC1 5DQDH 1UQSA 5F1IA 1LO4L 5HHXL 3HAEB 1EVTC 4HFUH 1G6VK 4LIQL 1A21A 4P2OC 2VWEE 2ICEB 4UNTA 1UACL 1ETZB 3ULUD 1B0RB 4Q6IA 4Z7VE 1KJ3H 4JO4L 4OCXH 5D2LE 2VTFA 3AU1A 3BP5A 3RWIA 5EU6E 4OZGF 3TP4A 3DX6B 1AHWA 2OJEA 4KHTL 1C12A 4I13B 1NUNB 4X7CC 1P1ZB 4KI1A 4LVHC 4U1NB 5JIKA 3IJSB 2E7CA 5DA4A 2JLLA 4KKLC 4BELD 1NGPH 3LRHA 1EBAA 4NKOA 5F70A 1LO3L 3OKOA 4MJIB 1XR9B 1MVUB 5T3XH 3LKOB 1JZ2A 5GGUA 5EIIB 5F1OB 1M05B 3F58H 3IS1X 3QUKB 5BO1L 1A3RL 2GTZA 4H25A 3BUTA 1MWAA 5D7SL 3RGVA 1MRCH 1AR2A 4JN1L 4ODHL 1E4XL 2ZSWA 3LKSA 4ZFGL 1VEMA 3RWJB 3Q3GA 1X44A 5CMAA 3AY4A 2ARWA 5FCSH 5HYEA 1ZAGA 3SE3C 2OTWA 4CMMB 1BAFL 4IDJH 1IZJA 1IEHA 3DIFA 1FL6A 3N1GC 4WCYH 3VXME 3HG1A 4UT9H 4QTHB 1SJXA 2ZUTA 3PWJA 1AJ7L 3PF2A 3DXAA 5F7NC 3L3GA 4KJPC 2EDEA 4WI8A 4FA8A 3BZEB 1N0XL 3BKYL 1FYTB 5JHDA 1ZTXL 5FYKU 2VABB 2CD0A 3FT2A 1HHKB 1I4FB 4LCWA 4PJ5A 3EDEA 2IALA 1A6ZA 2VC2L 3IJHA 4NUJB 3GHBH 1AD9B 3FQTA 3MRLB 3WE6A 4XCFL 1BQLL 1CF8H 1W8NA 5F8QC 1W72B 4OGXH 5I0DA 3FTGB 1KJVB 3OF6D 5DFWH 5IG7A 2NY5L 1U0QA 1QFPA 1AGDA 1CFTA 4LF3B 3SO3C 2NCMA 3O3UN 3B3IA 2P5WE 1TVBB 2I24N 5EIVA 3ULUF 3R0MA 1CE1L 4QHUB 5C0BB 4AEHH 3RKPA 1F5WA 4P5TD 4W6WB 3WN5B 4Z77A 1EA9C 1ZA3B 2BNQB 3FFCD 2IFFH 4PJFA 4FQ1H 3ARGA 2IADA 3QDGD 5DSCB 3GRWH 3ESUF 4LKCB 5IESL 2P8LB 1G7HA 4S0SD 4HUXB 3RL2A 4X6CF 1IC5H 2HG5B 3T4YB 1Q9WB 4OZFA 2F8VA 2J6EH 3C09B 1BGXH 4P3DA 5DMKA 2EH8H 1QP1A 3H9HA 3SBWC 3FT3B 4Z78A 1BJMA 2I5YL 5INDB 3HB3C 2G60L 1YNKH 3RWCB 4YWGL 3LMJH 1PBYA 4AENB 3GK8L 1NGYA 2WBJA 2XXCB 2Z4QA 4PG2C 1UYWH 2Z93B 5DI8B 5BRZE 1RURL 3IDMB 4MA3A 2VLLA 2YMXL 4OZGE 2PO6D 2UWEE 3L3DB 2NY2C 4N90E 1ITCA 3NTCH 4YHYB 3QHZL 2GT9A 4R97C 4QWWC 2VZUA 1ZOXA 3V6FB 2CRIA 2FB4H 3JWDL 3QIUA 1YEEL 1NCNA 1INEH 4P2RD 1DBMH 4NKIH 2H32H 5FCUL 1J5OL 2H9GB 4ZXBB 4TVPD 3OB8A 2VDQH 1WBYA 2FHCA 5FECB 3VXRA 2VLRD 5IHLB 5J3HC 5J7CC 2BSRA 3LDBC 3GSNL 4PRHB 2CUMA 5TQ2H 2FIRT 3EYOA 1U8OA 4MD5B 4XWOC 2VZ3A 4LLDA 3JWOC 2DAVA 1UM6L 3GM0A 2CK2A 3QWRA 4PV9A 3VCLB 3MNVA 3I2CH 4Z7UA 1ZT1B 2P42B 3O81A 5D7IB 3X3FL 1HE7A 3F12A 3QHFL 3K4ZA 5IFJB 5F21B 1ZA6A 4OZFG 3EZJB 2DQEH 1C7SA 2CDGB 5DZNA 2IQAA 5CHNA 4JY4A 4JFDE 5MI0C 5HGDB 1AD0B 5FO8B 5ESQA 2R39A 4PUBL 3BGMA 5DJCB 4E5XB 4PRPA 3IFLH 3ROLB 4OCWL 4ZPTB 5DHXB 1U3HD 4RAUA 4LRIA 3UBXG 1WWCA 2A83A 4HFWB 5EOTB 4UU9A 1T66D 5DD3L 4JZJC 3SDDA 3MBXL 5MEQA 1LILA 5DD1L 2W59A 5A3IC 1OTSD 1GGUA 1JBJA 2X89A 4YHNA 1RUAL 2GIYA 3CFIC 1K2DB 3U0WH 4FXKA 4O58L 2PYEE 2HVJB 4XPBH 4JM4L 1A6WL 3O8XA 5D2NA 3PGCA 1O7SA 1HIML 2VDOL 2DQJH 5LWYH 1XF2B 1QBBA 5ERWB 2CGRH 1L6ZA 1WBZA 2D4DA 3WXWH 3DGGB 4QO1A 5C08B 1J8HE 4KC3B 3VH8B 1U8LB 5EO1B 3VXSA 3QH3B 1NCDL 3SDAD 4JR9L 3CK0H 2XA3A 4WDIA 4ORZC 4DKFL 3WEXB 4ZD3H 3SE9H 5ADPH 4U1LB 1WAAF 5IUSA 1AQDB 2BDNH 5JXEC 3GNML 3QFDB 4HIHB 4PLJC 3D3VE 4LQFH 2XN9E 4XI5C 3CMOH 3JTSA 4RAHA 4OCMC 5CZVH 1F90L 5I8OH 4EIZC 5DQJA 3B2VL 3QCTL 5IQ9A 4I18B 1QHOA 2ATPB 2GI7A 4HEME 1VACA 1WIOA 4N8PA 2DYPA 4Q6YA 4PJGF 4NT6A 1ROWA 3CVHH 5EIQA 5T1DL 3L5IA 2ITDB 3MRNA 3CFCH 4XH2A 4YHOL 2FH6A 5F96L 2BY2A 4Z7NF 4OM1H 4OLYL 5IJVB 1B4JL 1VERA 2X4TB 5D7LA 5T1LB 4KK5D 2W9LA 5L2KB 4EI5D 4S10A 4WW2C 2AI0L 4I5BB 1FIEA 5D1QB 2V2XB 3VGGA 4DAGH 2C7UA 3HRPA 5I73B 2AKRA 4N9GB 1I75A 1FFOA 3FO1B 1OGTB 5C7XL 1JN6B 3GEWB 3G5YB 1JPTL 3X12A 1C1EL 2R4SL 5J4MA 5KW9L 4JFOA 2P5ED 2EDLA 1I7ZA 3FQRB 3DO7B 2IAMA 2G75B 4FTVE 3MLZL 3C2AH 5IT2H 1K5NB 3TN0B 4KJWD 3GDBA 2MFNA 4I0CC 3QNXB 2R2EA 4JN2B 1UB5A 4WV1C 5DD6B 3DOSA 1KTDB 1MJ8L 1XGTB 1A5FL 4BSJA 1X5XA 1VFMA 4J2XA 4F7MB 5BVPL 5T5NG 4ODVL 3W2DL 2H6PB 3MRHB 5C86A 4BZ2L 4EOWH 5JOFB 3OKLB 3RDTB 5ESAA 5BXFA 2DF3A 4OF6A 1Y6MR 3PV6A 4YNYB 5IMOB 1J0IA 2F53E 4NM8L 5D7JC 2EDJA 3DVIA 2YK1H 4Z9KB 2OTPA 3GJFA 1A7OH 4I0PB 3U9UA 2B5IB 5J1AA 2PYFB 5DUMH 3OKMB 4TNVK 4OZHB 1CR9L 4PJ9B 3ESVF 2HFEB 3FHAA 2HAZA 3WO4C 5FOBB 4L1HA 3HPLB 4Y16D 2XPGA 2IBBA 4UIMA 3SCMC 4NNYA 1LK2B 4MNQD 3WFBH 3KVQA 4NQDB 1CT8B 3V4UL 3HR5B 2ILLA 3QXVA 4JQVC 4GKNB 3O4LA 4IRSA 3CFJA 3PL6A 4M6MH 2HLFC 5DO2D 1MFBH 2JCCE 3S36X 2W60A 4KMTH 1CGSL 5EA0L 1Z0NA 4P59L 3FT4A 4EJ1C 4XNZB 3VXNA 3SDYH 2JIXD 4XBGA 5IBTL 2A1WL 4NGHH 3RKDD 1YY8A 5CD3B 4JFFD 1KCUL 4DKDC 2FGWL 5CD5D 1RK1A 3INUL 1LEIB 1F11A 2B7DT 3BQUC 1T89C 2ZJSL 4H1LH 4MZ3A 4OZ4B 3UTTB 4MZ2A 4KQ4L 4LSSL 2APFA 3LOWA 2YD1A 3MOAL 4Y4FD 5DJAB 3I50H 4PJXA 4HJJL 1N2RA 1OT1A 4XP4H 5BV7C 4IRJA 5J6HA 3U46B 2C1PB 1G7MA 3PWPB 4OCYL 3PV7A 4CJ0A 2EDDA 3LHPH 4PRIA 5JHLL 4HKZB 4ZOBA 3L7FA 4J1UB 3HUJF 1BJ1J 4ALAL 2DLEA 2BNRE 2DBLL 1IAIH 3KHQA 1OVZA 4TUOA 4JJHA 4DW2L 4MJ5B 1UEYA 1DQDH 3MOQA 2F54B 3MRGB 1EJ6A 1OW0C 1WF5A 3O3BB 5K9KB 1LO0H 1T0MA 2I60H 3LN9A 4OF8A 3S37L 3RL1B 4OKDA 4KFZC 3UCRA 2P4AB 4QRTB 2A9NL 2P44B 4MWFA 4IOIB 2R0LH 2DKMA 5K9QG 1F4XL 2RQ8A 1FL5B 4M6OH 1JNLL 4XX1G 4U1SA 2A77H 5JMRA 3H7BA 2H1PL 2J2ZA 3W39A 1YYMH 3GHEH 3EFDH 5C0CE 5ITFB 1QSFD 4U2ZA 2NXYB 4D9LL 4LNVA 1C5DA 4HJGB 2VDLH 2ADJB 4PREA 1U8HA 4XPAL 4L3CB 5GPRA 4JM2D 1X5HA 1YY9C 3L5HA 1XT5A 3LS5L 4IS6B 1HCVA 4RGMC 2H2PD 4Y5YB 3IKCB 2V7NB 4WHYG 1OGAE 4PJCF 1U91B 4LVOC 1T5XB 4CADB 1OOAA 3MUY1 3QJHA 9CGTA 4NKMA 3G6DL 4R8WH 4KI5D 5JW5A 3P3YA 4TYUA 4A6YB 3OKNB 3GMPB 1BMGA 3MQIA 1NC4D 5F9AC 1I3RA 4AM0B 1CLOL 3RVWD 2WUCL 5HGBB 1OL0A 4LCIL 5T33L 3GRWA 1D9KC 1UWEH 2FJGB 4L9DA 1FFPB 1YUHB 4OCNC 3V5DB 2A9ML 3MFFB 1R5WA 4K23H 3LCYA 3KWWB 3HFML 4KK9D 3NBNA 2VQ1A 1T4KB 4XC1L 4YHKH 5KANI 2J6EA 3O3AA 4XNYL 5DK2B 3MA9L 4JJ5B 2LU3A 2CPCA 1JRHH 1HWHB 2XZZA 3U7WH 3RIAK 3WXVH 4ODUA 3WD5L 3C8KA 5ACZB 5KZCB 1S9YB 1LWRA 2GFBB 4X4ME 3VD5A 1MNUH 4HEPG 4OCSL 1MHPH 3OF6A 1BM3H 1NUFA 2E5EA 3MLSL 4JRXB 3S35L 2X9YA 2DJUA 4WTWA 3TT1H 1GGBL 2FX9H 4XCEA 2PXYC 3FRPA 3EOYG 4JO1H 2DQHL 4OZIA 4Z7OE 3WFEL 3B2UD 2YC1A 1FZMB 3DGCR 2H32A 3VWKD 3N1QC 4P5TA 5E7FA 4HKXB 1QLEH 4R4BB 3NAAH 3JWNC 4U05A 4IIQA 3FFCA 4P23B 4OFDA 4HBCH 1IILE 2NZIA 2DQGH 4XMKH 5TE4H 3VFWB 5CSBA 5E8OA 1YEJH 3QO1A 1DBJH 1QSEB 4NO2A 2JF1A 2CH8A 1G1YA 4P57B 1KB9K 3SKJH 1A6UH 1X9QA 4WO4C 1JHKL 3HUJE 3WHXA 3T1FA 2XWJB 4X80H 4G9FE 5B39G 5HI3D 4B5EA 4KROD 4KY1L 1VESA 5MHSE 4GXUN 1FBIL 3L3OB 4N0CC 1MH5A 5C0JA 3NCYP 2PW2B 4JAMB 4LHUD 4XCCL 1BZ7A 2B0SL 5DJ2A 2M8XA 4NDMB 4NWTH 3V0VB 3RWFA 1GH7A 4F57L 5E6IB 4RZCA 3LKNB 4JO3H 4LASL 4QHKJ 4Z8FL 4QRRD 1N7MH 3PQYB 1D6VL 4HWBH 3T65A 1KIUA 2ADGA 2B8OT 4LLAA 2I07A 3ZKQD 1OD9A 1WJ3A 5I6XC 4PV8A 4OAWB 3DO3A 5KN5A 1EAPA 1A4JB 3FQXB 4ZQKA 4GBXC 4HS3B 3KG5A 1LO4H 5HHXH 3UMTA 2C3HA 3BH9A 4LIQH 1YEGL 2DICA 4MDIA 5GS1A 1D5XA 2AJ3A 1S7XA 3QI9D 5KSUA 1UACH 4X6DA 1KTRL 2PCPB 5GGSA 4QTIL 3IF1A 1LEGB 1SVZA 4LSVL 3U0TB 4K7FA 4JO4H 4LBEB 4F7TA 4CN6A 4PRBB 3B9EA 1BQHB 2Q1EA 2R1WB 4F9PA 2EC8A 4GMTL 3F5WB 4KHTH 3ZT6A 4DCQB 3RPIB 4PJHB 2P24A 1S7QA 3BESR 3SDCA 1FPTL 1IFHL 5C6TL 1BIIA 4LDLB 1XGUB 5FDWB 2P8MB 3DSNA 1LO3H 3OR6B 5EG6C 4PY8I 2IMMA 4NZUL 3HI1A 5LAXB 2UY7A 1HSBB 2ZOKB 3E1F1 1LD9B 3MJ8B 2QBWA 3MUGB 2WW8A 4JREB 3V95A 5IF0B 1H0DA 3NPSB 1QLFB 4L3EE 2RB8A 1MCNA 5BO1H 4WWKD 1RUQL 1A3RH 4Y7MA 1U3HA 5D7SH 2XTJD 1ZE3C 1I1AC 3CVHA 3GFUA 4JN1H 1IGJA 4ODHH 4YHIA 3QEGL 3CPLA 2XY1A 1E4XH 4ZFGH 4NFBA 4JDZB 3BXNB 5HJ3B 4ZUSB 1YN7A 1VADA 2XZQL 4JANA 2IQ9L 1BAFH 1C08A 4HUVB 1IGCL 2X4SA 2VR4A 3QO0A 3OR7A 3JBG7 4QHMA 5DXWA 5E2WL 5F6IC 3QUZB 3KPMA 1AJ7H 2VLME 2D7NA 3B9KC 3QDMB 4U6XB 4X4XA 5B21A 1R0AL 3VXPB 1EEYA 2GK0B 1AXTL 1N0XH 2MQ3A 3BKYH 1CYGA 1FO0L 1ZTXH 2FYYB 5JNYB 2DWDA 1NJ9B 1A1MA 4RMRA 5KAQG 3SDAA 3TLRA 1ZGLB 1CL7L 4HIIB 1T1ZA 2VC2H 3UROR 1Z2KA 4MJ6B 4XCFH 1BQLH 4ERSL 1ZHBA 2FX7L 5EU6D 3OSKA 3FO9B 4R96A 2X09A 2BOCA 2JJVA 3MRDB 4ESKA 2D31B 5EN2B 1JNNL 4W6YB 2HMID 1QFUL 5D1XC 2NY5H 5C0IA 3U30C 4BFIB 3DARA 1IEAA 1YECL 1UENA 4YQXL 3QG6A 5A2FA 3RNQB 1P5VA 3RWDA 3S3JA 4MNGB 3N50A 1ZLWH 3RTQA 1CE1H 1JPSL 1SHMA 1NDGA 2X4UB 2X1XR 3BVNA 4OLUL 3MLUL 3BKCL 4PJBA 3N1FC 3P4MB 5TF1L 2C3XA 1MJJA 3H0TA 4IEFB 3NN8A 1NMCC 4KAQL 3VRIB 4MDJA 4U1MB 4NBXB 1DLFL 3ZDYE 1NL0L 4ELKA 1KIPA 5IESH 2W65A 2YZ1A 4U2YA 5EULV 4QF1B 4NRXB 5GRWA 5I1LA 5I75B 2YXMA 3ZO0A 3D25A 3IAQA 3GJEA 4LL9A 2P5EA 2F74B 2JELL 3PP4L 4AMKL 4LPTA 4YHZL 3VXMD 3IFNL 4G6FD 4HK0A 2LVCA 1PSKL 5HHOB 1YEDA 2VDNL 2I5YH 1TNNA 2G60H 3SJVE 1CS6A 4YWGH 1HEZA 1UXSA 3GK8H 4N0YL 1T7YA 3F7YB 5C09B 3WFCL 4P2OD 3WCYA 1RURH 1QUNA 4H1LA 1JTPA 2YMXH 4XRCA 1FZKB 4HV8B 3DPBA 3BRGC 2CIIA 3DUHA 2AJZB 3QHZH 1HI6A 4HGKC 1VGEL 4P2CG 1DFBL 2DBJA 3JWDH 4XNUL 1YEEH 2VL4A 5DJ8B 4HULB 3DMMD 3M8OL 4YX2L 3BDXA 5FCUH 1J5OH 5F7FA 1FP5A 1OSZB 4LHQB 2YBRB 3C87A 4NQTA 2LTQC 2P5WD 3GSNH 4KKLD 2VIRA 2XXMB 5F93C 3EJJX 4Y16A 5JR1L 3LQMA 4EVNA 3S35X 5HHPB 2W1NA 4NN5C 4JG1L 4M93B 5E1AA 4OLWL 1UM6H 5GGSY 1I85A 3ILPA 4N5EC 5IVNA 1DQJA 1ZLVH 1A7QL 1EERB 2ZPKL 3HE6B 3BW9A 3X3FH 3BEWB 2J8UA 4BYHA 3QHFH 5GS0C 4G7YL 4QYOA 2HRPL 4JEGB 3D9AL 2JIXA 1FDLL 1NC2A 5F9JA 5F8RC 5D8JL 2NY4C 5IVXE 5D1ZB 3C6LB 2PW1A 5D71L 4R4ND 2AJVL 1JI2A 1RI8A 4PUBH 3GKZA 3HMXL 4RGOL 1B0GB 2NX5B 5E00A 3NFNA 4OCWH 1QQDA 2HWZL 5EUKA 2EXWC 4JZOB 5SX4H 4FQCL 2UZYB 1EJOL 1UXWB 4H26B 1B0WA 3NABL 4G8FA 4R6UA 3RJQB 3G6JF 5DD3H 3MRCB 1QNZL 5ABDE 3C60C 3MV7E 4I2XB 4KUZL 4KJPD 3RNKB 3MBXH 3BJ91 4HG4J 5CZXD 3CCHA 5DD1H 5BRZD 2WP3T 4X9BA 5FYJU 3LEXA 2DLHA 2K7QA 1AO7A 1RUAH 5D6CA 4ZS7L 3R4DA 4Y4HD 4N90D 2E9WA 3HPJB 3MRFA 4O58H 1II4E 4JM4H 1A6WH 3GSQA 5FB8A 4LP5A 3KJ4C 3IAGC 4X6FB 4F37K 4Y1AA 1HIMH 2VDOH 2Y5TA 3CZFB 4MB5A 4D2NA 1IC4L 3QIWB 3H3BC 4GAYA 3P4NA 4D8PA 5BS0A 1FL3B 5IK3A 4NOFA 2P8PB 1QRND 2DIBA 5J12C 4U1IA 1NCDH 4JR9H 4NHUB 4V2BA 3GMNA 5D5MA 4DKFH 3KHOA 1HOCB 2R2BB 2X70A 5E95B 3BSZL 4AIXA 1QLRB 3VXOB 2FL5A 3GNMH 4DWHA 1JYXA 1G6RB 3TBSA 1F90H 1FFRA 3P9LB 3B2VH 1QSFA 2Y1VA 3QCTH 1KCKA 2F8OA 2BC4A 4JFDD 4Y19B 5T1DH 3B9VA 3MCKA 2FBOJ 4JM2A 4Y5VC 4YHOH 1SYVA 5F96H 3K2UL 1LE5A 1E4KC 4FQLL 1ZVSB 4OLYH 1B4JH 1HH6A 5FA4B 3MLXL 4KJQD 3WIFB 5A43C 2B2XL 4TRPL 5FUCC 1P4BL 2YD6A 3DURA 2AI0H 1S7VA 3MGAA 4P4KC 5C07B 2ZSVB 2VSCA 1U8IA 5I1IL 5GZNC 5C7XH 1JK8A 3L5WB 1JPTH 1NC4A 4GS7C 1C1EH 4FHBD 2R4SH 3P4OA 2EDFA 5KW9H 3UJTL 1GGIL 3G5XB 3TZVC 3MV8B 3UEZA 2LAAA 3MLZH 4NRYA 1QFWL 3JTTA 4GKZA 2PYED 1PZUB 2NY2D 3HRZA 2C4XA 3EOTL 3O2WL 4HIEB 2E7LA 4O5LL 4LVNB 2X44D 1UVQB 4F9LA 5CINL 1MJ8H 32C2A 4RMUA 1I9JL 1QG3A 2D7PA 1A5FH 4HKBA 3N85L 5EBLA 3KPPB 1J8HD 3RUGA 5BVPH 1AXSB 3B6SA 4ODVH 3W2DH 5FF6A 4BZ2H 4M1GL 5JPMB 1NEZG 5M95B 2VRAA 1KTKE 4F3FA 3T0EE 2EKSA 1TZIA 2R56L 4NM8H 3BP6A 3DI3B 5J3HD 4PGZA 1FV1A 3BHBB 5B38G 4HWBA 5EU3B 1UT9A 4XP1L 5DEGB 3ARDC 4XWOD 2NY0C 1I8MA 2XN9D 4NQVA 4BQ8A 5JORA 1F45A 3G04B 5HGHB 3DETD 1NLDL 1CR9H 3O45B 5EZOL 5KBNC 4LCYB 4QRPE 25C8L 3QISA 2B39A 3L5XL 1UB6B 3FQWA 1CFNA 3U36A 3VWKA 4P2QE 5J57B 3CH1A 4B7LA 2C3GA 4Z76B 3V4UH 1AGEA 5E2VL 3D2UB 1BVKA 3BIKA 1BFSA 2HH0L 1RJZA 1UCTA 1MAJA 5HHNB 1CGSH 5EC1A 5F9WB 5EA0H 4ELME 1A9BA 3NFSL 4YO0B 5BW7C 2BMKA 4P59H 5FUCE 1N6QL 3NCEB 5IBTH 2M26A 2A1WH 2NW2B 3NCBB 5E4IA 5AYQA 4KZEL 1WCBB 2A6KB 1F00I 5IWLC 3CDCA 1KCUH 2FGWH 1QPXA 3DWTA 3U0PA 1UJ3A 1XH3A 3ZKXB 3INUH 3UZQA 5A3ID 2RFXB 4FTVD 3UBXI 1ULVA 2ZJSH 2ICES 3L6FB 4Q2ZA 5IB5A 4KQ4H 1Y6KR 1JL8A 4LHUA 4LSSH 2QQLL 3M07A 3MOAH 5C0EB 2VISB 3KJ6L 4HJJH 3NIGE 4QRRA 3V5KA 4OCYH 2NQCA 5JHLH 1CDHA 2E27L 1I1YB 4Z7QF 3O6FD 2F53D 4WI4A 4ALAH 1U92A 1ZSDB 1S7UB 2DBLH 3QDJD 1Q94B 4DW2H 2VXSL 5FKAB 5GS0L 3U6RB 4LLUB 1FZOA 3BIBX 5JXED 3X14B 3QI9A 4EKXA 4QGTA 3S37H 1IM9D 4B7IA 3TO4C 1X6LA 5D9SA 4QXTB 3O6KL 1S5IL 1TIUA 2XWBB 1CDUA 1UEMA 2A9NH 2EICA 3T09A 4KZDL 4KTYA 1NAKL 4Y4KC 1DVFB 2ZP0T 2HJLA 3IS0X 1F4XH 1GIGL 5H94B 1JNLH 1M71B 4URTB 2H1PH 4J23A 3QR2A 4PJ7F 1FJ1A 3AROA 2I25N 4D9LH 1JHTB 4Y2DB 2VDML 3KYOB 1MCRA 3K8MA 1MIML 2EIDA 4PJDE 4XPAH 3SKMB 5C0GA 1T0NA 4OLZL 4LHUG 3UTQB 3LS5H 1R3HB 3IVKA 5FA3B 5CKAA 3OKDB 3MUHL 1BFTA 3KYMB 1NGXA 2EDWA 1EFXB 1YMMD 1HQ4A 1UCBL 5F3BB 4EUPH 3G6DH 1I8KA 4XZUA 3FQUA 1CXHA 4RBPK 1OF2B 2G9HB 3MRRA 1CLOH 2WUCH 4MA7L 4LCIH 5T33H 5EFIB 4K07A 2F5BL 4MJIE 2GY5A 4L4VD 2AERT 4WWID 4ZYKB 5E2UL 1FHGA 2A9MH 1IT9L 2BNRD 1JTTA 5IMMB 1I7UA 1C5BL 3HFMH 3NGBB 3ARBC 4L8BA 1G7PA 4JHAL 2JJTC 4XC1H 5IW1B 3DRTA 2R23A 3HC3L 1KV3A 1QA9B 4XNYH 3NACL 1OAUL 5E4EB 5C3LD 5D7IF 5SV4A 4Z7VA 3KPNB 4UAOC 1UZ8B 2VZTA 3NCFB 4YJZL 5HPOA 5D2LA 2R1YA 5CJOL 3L3HA 2Q6WA 5EU6A 3WD5H 1D5MA <