5F1ZA

Structure of tyk2 with inhibitor 16: 3-azanyl-5-[(2~{s})-3-methylbutan-2-yl]-7-[1-methyl-5-(2-oxidanylpropan-2-yl)pyrazol-3-yl]-1~{h}-pyrazolo[4,3-c]pyridin-4-one
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
292
structure length
281
Chain Sequence
ASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKSGWKQEIDILRTLYHEHIIKYKGCCEDKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design and Synthesis of 3-Amino-1,5-dihydro-4H-pyrazolopyridin-4-one Derivatives as Tyrosine Kinase 2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Non-receptor tyrosine-protein kinase TYK2
total genus 93
structure length 281
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5f1zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5f1zA01
3PIXA 3TNPC 3KA0A 1YXTA 3KRRA 2UZEA 2J7TA 5E1SA 4S34A 4EH7A 3GCVA 5IZFA 4F6UA 5K4IA 4IAIA 4ACMA 3L8PA 5IH6A 1R78A 2FVDA 3R8LA 4XG9A 4HVSA 5A4TA 5TT7A 3SVVA 5AEPA 4YJTA 4JDHA 2JIIA 2XIZA 4ZIMA 2JKOA 5JMSA 1WBTA 4ERWA 4FNXA 4G16A 4BL1A 4UMRA 5CU2A 1LEWA 3NNWA 3Q4ZA 3F2NA 3FYJX 2JDVA 2O3PA 4XJ0A 5I9UA 4PMSA 1EH4A 2UZDA 4EK5A 1BKXA 1YHVA 2ETMA 3EH9A 3SRVB 1J7LA 4ZXTA 4XV3A 2QI8A 3FLYA 2YM8A 2WOTA 3ODZX 3R04A 4WNOA 3LQ3A 3OUNB 1NVSA 1UNGA 5AR3A 4IVBA 2X2LA 4I4EA 3K5VA 3VW6A 1MRYA 5H8EA 1XJDA 2ITNA 4LUDA 2BRMA 5HG5A 4ANQA 3JR1A 3BBWA 3D2IA 2RKUA 2ITPA 3FPMA 3ITZA 3D9VA 2WTVA 4MBLA 3MI9A 3LCKA 5IUIA 2CKQA 4DHFA 3L9MA 4NKSA 3EFLA 4D4RA 1Q3WA 3AGMA 4L9IA 5DR2A 2PZIA 4QD6A 5BMMA 2VZ6A 4JJRA 4KIKB 4D1XA 3ETAA 4U0IA 5KE0A 4O0WA 5EM6A 3V51A 5KMNA 2DYLA 4J8NA 4EOKA 4NKAA 4EOOA 5KMJA 4Z9LA 5M51A 3P0MA 1JWHA 3E63A 4JBVA 4M13A 4PTEA 1WVWA 1FGKA 3IGGA 3RBWA 1WMKA 4I41A 5E91A 2PE0A 2PMOX 4F9WA 5HVKA 4EYMA 3TUDA 3DBEA 3NRMA 1SNXA 3OXTA 5A6NA 3I79A 5HOAA 4TY1A 2WTDA 3HDNA 5F20A 5BX0A 3ORMA 5I9YA 4USEA 4FA2A 3GU4A 5AV0A 5CT0A 1PXMA 3WYYA 4F9CA 4XG7A 2IWIA 5AUZA 4ERKA 3DK6A 2P2HA 4BDGA 5HLPA 5D12A 4CT1A 5JFSA 3QTWA 1E9HA 4KIOA 3WZEA 3AT4A 5EI8A 5ANEA 5E8SA 4A4OA 4UV0A 4DGOA 4Z7GA 5HNIX 2IW8A 2R0IA 4AE6A 2R4BA 3CC6A 5CU6A 2CLQA 2HWPA 4DG0E 2I1MA 4XHKB 3DAEA 3FUPA 3AC5A 5CQWA 4O7RA 2ITWA 2YN8A 2ZMDA 2OXDA 3F2AA 3NPCA 3FMHA 2X6EA 4ZSGA 2HIWA 4AA0A 5ICPA 2X9FA 4TKSA 4QTCA 3ZYAA 4ZLOA 4QYFA 5CSVA 4O1PA 2XYUA 4MYGA 4C4FA 5BMSA 4U6RA 3CY3A 2QOBA 1V1KA 5K4JA 3P9JA 5KZ0A 4IB3A 4JL9A 3GENA 4X2FA 4XG3A 5BPYA 5I5ZA 4PPCA 5HCZA 5EKNA 4BIEA 4PDPA 2PTKA 3EZRA 3FZOA 4HJOA 3G33A 3ZSGA 3CTHA 4HVIA 4B4LA 5CVGA 3QKKA 4B9DA 2G15A 5IQIA 4IBMA 2OXXA 4B0GA 1OIQA 2QC6A 2XNMA 3NUNA 3Q2MA 3QUDA 4CZUA 4FEVA 3FY0A 2VTTA 3QBNA 4YZMA 5H3QA 3VNTA 3BHHA 3I7CA 2EXMA 4BDJA 4CLJA 3FMDA 3LVPA 2UZLA 5LMKC 1XH6A 2X8EA 3EFWA 1YWNA 5AM7A 4G31A 3COHA 2Y0AA 5IQHA 5J7HA 3DTWA 2W05A 2WMTA 3DPKA 5B2MA 3A7HA 5EQPA 4EK4A 3FSKA 1OPKA 4O38A 4KBAA 2X7GA 3OFMA 2VD5A 4EUTA 3LJ0A 4F6SA 4AT5A 3HMNA 3KQ7A 4WKQA 4M12A 3RAHA 3G6GA 2YDIA 5E8XA 2CGXA 4OTPA 3NAXA 3P23A 4QTAA 4IACA 5FGKA 2YLEA 3KXZA 5AR7A 4CLIA 5F9EA 3G9LX 5K5XA 5CYIA 3CPBA 3UO5A 4AN9A 1XHAA 4RIYB 1V0BA 3FJQE 1ZYDA 3QXOA 4J8MA 4F08A 4RIXB 3F3WA 2BR1A 4QP8A 1OL2A 3E88A 3F69A 3K54A 4PNKA 2GS6A 5HLNA 2GDOA 2XRUA 1X8BA 5DRDA 3R02A 3R63A 3HEGA 4RG0A 3UOKA 2RG5A 4EC8A 2UZUE 2GFSA 4QTBA 2JKQA 2W1CA 2W17A 1IRKA 2W96B 4C3PA 4D5KA 3MWUA 4PDYA 4EH9A 3NUXA 2QOFA 1IASA 5JZNA 5I9WA 4FZFB 1U5QA 5J7BA 1B39A 3AC1A 3Q5ZA 2UZWE 2ZDUA 3R8UA 3TNHA 4ALWA 5A46A 3FLSA 1Q62A 3W1FA 4K6ZA 4RJ7A 1K3AA 4U97A 1V0OA 3LM0A 4CV9A 4D4VA 4DBXA 4H58A 5AR8A 4JBPA 4I94A 4QP2A 4E4MA 3R6XA 4YHTA 3FWQA 2VWZA 3QCSA 2WEIA 4U3YA 3W16A 3N4VA 3BWFA 2BAKA 5BYYA 2VTIA 3F3TA 2OIDA 3F9NA 2XK3A 4EOQA 4BCPA 2YHVA 4DCEA 4QP4A 1QPJA 2VWYA 1IA8A 1SYKA 2CJMA 2W1DA 5DFPA 4RX5A 2PU8A 4Q9ZA 4ORKA 2BILB 4YJRA 2B55A 3BHVA 2XIXA 3TEIA 3U6IA 1WVXA 3W18A 3DBFA 4S33A 1U54A 3FI2A 4IW0A 3QXPA 2WU7A 4MAOA 2GPHA 4EKLA 4CYIA 5CXZA 2VGPA 3BQCA 3NAYA 3MIAA 5CAQA 5IEXA 4DTAA 3O8UA 4H1MA 5HU3A 3PVUA 2CN8A 4LMUA 4QOXA 4ACCA 5KKRC 5EOLA 5HLWA 1KSWA 1WZYA 3ANRA 2QOQA 4JX3A 4OBOA 4ARKA 3BKBA 2BROA 3CS9A 4D55A 4OTQA 5ETIA 3ZDIA 1FVRA 5HX8A 3LMGA 2YIWA 3ZO3A 4L3JA 4GV1A 3UQGA 5CS6A 3EN5A 4EJNA 1DAYA 2XBAA 3BEGA 2YCFA 5LVOA 4ASEA 3CXWA 1OM1A 4KUJA 5AMNA 3PA4A 2OWBA 2W06A 3GU5A 3MIYA 4M8TA 2XJ1A 1QCFA 2BTSA 4BIDA 3QRIA 3QL8A 4DCAA 2EWAA 2HZNA 3H9RA 3LIJA 3MVJA 4KABA 5DLSA 3I81A 4ZJJA 3RMFA 3THBA 3VO3A 4EH5A 3IW8A 1PMUA 5HU9A 4E1ZA 5DT4A 3PY3A 4Y46A 5ANDA 5CEIA 4W9WA 2RSVA 3EJ1A 4OT5A 4I5PA 3BWJA 4I6FA 4ITIA 2ZV9A 4DEDA 4FIEA 2JAVA 3U4UA 4XBUA 4G6NA 2G2HA 2HOGA 4E4LA 5IA2A 4WRGA 1H00A 1OBGA 3ZFMA 4L00A 3PRIA 3NYXA 2WQEA 4BY9E 2RF9A 3BEAA 5CALA 4BDCA 5DWRA 4QTDA 3K3IA 1U46A 1WVYA 4IVCA 2RGPA 2WIPA 3OXZA 3PJ1A 3QCYA 2Q83A 2YWVA 3P7AA 3EKNA 3I60A 4ZLYA 5BQ0A 2OIQA 1GJOA 2VTOA 2W1HA 3U8WA 4CCBA 3DDPA 5CXHA 3PJ3A 4EOPA 1UU3A 3LXNA 3DCVA 5HIDA 4FKJA 3I5ZA 2WQBA 3W55A 4DFZE 4YR8A 4BCOA 4FC0A 4BTKA 4O7VA 5FP5A 3LCDA 4BDHA 3KEXA 3EFJA 2XK9A 4FK3A 4FTUA 5F95A 4DFYA 5CU0A 3C4WA 4PF4A 4U80A 3RJCA 3WOWA 1KOBA 3RPOA 2ZJWA 1UVRA 3HYHA 4IM2A 4L67A 1Q24A 4ANBA 4B8LA 1G8SA 5ANJA 2R3LA 3BPRA 4BCKA 4CFXA 4EQUA 3OTUA 4WO5A 5CI7A 1W83A 2ITUA 2C3JA 2YM7A 3W10A 4NJ3A 2WPAA 4Z16A 4IZ7A 1H24A 4EK6A 3VS0A 4ZMEA 4D9TA 3BLQA 2EB3A 3ORXA 4G34A 2I6LA 3FBVA 3TNIA 3PXRA 3QC9A 4R3RA 4M97A 4GFGA 3EQHA 5A3XA 5FD2A 1O6KA 2Y6MA 3MVHA 4FZ7A 3OOMA 3TV6A 1DI8A 3O17A 3JYAA 5AR2A 4CNHA 1O9UA 4B7TA 3T9IA 3LOKA 3EOCA 3QQLA 4ONAA 2ITOA 4BCJA 2H8HA 4A7CA 1ZARA 4L8MA 4F9AA 2V7OA 2C69A 4FTTA 5LVPA 3OZ6A 4K18A 5IF1A 3O8PA 2BRNA 3LZBA 4O22A 4ZTHA 3BHUA 2A0CX 3EYGA 2YJRA 2WD1A 3U55A 2V62A 2ZM1A 3FC2A 2YAKA 4UEUA 4S31A 5FTOA 1FMOE 2ERKA 3MTLA 4HW7A 3AMYA 2X1NA 2Z7QA 3D83A 1SVGA 4FV8A 2PVHA 4YPDA 4ZJVA 3WZJA 2E9PA 3U6HA 5C4LA 3JS2A 2X0GA 4BC6A 5FXRA 3RZFA 4QMQA 4FICA 5CF5A 2WTIA 5AUWA 3RPVA 3C4FA 5LQFA 5ITAA 5JKGA 3NCZA 4WD5A 3FMNA 4FV1A 4XP3A 4PMPA 2GU8A 4Y8DA 3LFBA 4EONA 5KX8A 5CVHA 2WB8A 5DGZA 3QZIA 1M2QA 2J0MB 4HYHA 4JLCA 4RA5A 3VBQA 4U3ZA 4TYJA 4RVTA 2AYPA 4FSUA 4F65A 3EWHA 4HYSA 5GZ9A 4BHNA 4QP6A 2BZKB 3DK3A 4IVDA 4BVUA 2XNGA 2BZJA 3Q4UA 2OFVA 3DQXA 3F7WA 4R1VA 4UXQA 5CNNA 2QOLA 3RWQA 4EQMA 4CFVA 4BDBA 3GBZA 3HV3A 3F6XA 2YCQA 4WUNA 2XBJA 2GCDA 4UZDA 3OBGA 3OWPA 2XA4A 2JAMA 2G2FA 4DEGA 4FUYA 5BVEA 4RX9A 2H34A 4W4YA 2GNFA 3TTJA 4ACGA 3ZU7A 3FZ1A 4FEWA 2VTHA 3HP5A 2UVXA 5AM6A 1RW8A 4CZTA 2PY3A 3II5A 3MFTA 4W9XA 4C57A 5IDNA 3T3VA 4ANSA 3RAWA 4RT7A 2X6DA 1HOWA 4BTFA 3D7TA 3VS4A 3MA3A 4AG8A 2R2PA 4O0SA 5GHVA 2ITZA 4YO6A 5F94A 5CLPA 4C34A 4O81A 1UNHA 2CMWA 3R7EA 4FL1A 3P08A 4FV9A 4PL4A 1UWHA 4GH2A 3RPSA 4DH7A 2OFUA 3T9TA 4DFXE 5I0BA 2XKCA 4JDIA 5A54A 2QU6A 3CJFA 4O21A 3FQSA 1KE7A 3O0GA 5DT0A 1YXVA 4UMUA 2C3LA 3IW7A 3F7ZA 1PY5A 2RFNA 3DY7A 2QR8A 3P86A 4L7FA 4O96A 1NY3A 4CKIA 4QMMA 2A4LA 2QR7A 5CZIA 3R8ZA 3HLLA 2R3OA 4DITA 5L2WA 4W4WA 5JH6A 4IANA 4DFUA 3EQRA 2XJ0A 3E8CA 5FBNC 1A48A 5GINE 3AG9A 2ITXA 5CWZA 3FDNA 3E8NA 4HOKA 3ZMMA 3V8WA 5CAPA 4IQ6A 4G9CA 1H1QA 4GMYA 3G2FA 4O0TA 4D5HA 3HA6A 3PTGA 3SHEA 4IAFA 4XG2A 2HAKA 4O7TA 2HXQA 4FT3A 5LCJA 3PG3A 2Q0BA 3FHRA 3MTFA 3A60A 4HCUA 2XS0A 5AV3A 3TT0A 3COMA 3R28A 2XKEA 4I5CA 1SNUA 2BDFA 4J52A 5LCKA 4F1TA 4AOJA 4RFYA 2XKDA 3BRBA 3OP5A 2ACXA 5H9BA 5JQ5A 4RWLA 2VTQA 5K3YA 2HZIA 3OY1A 2VV9A 4GVAA 2RFEA 2W1ZA 2QOOA 2ZM4A 3FE3A 3FZPA 1Q8TA 3R1NA 1CKIA 4H3QA 5FXSA 3V04A 2BIYA 4OT6A 3OOGA 1OIYA 3NIEA 5AX9A 4FKSA 1OZ1A 3D4QA 3PJCA 4M84A 4P5QA 4NTSA 4K9YA 5EI6A 3PY0A 3R7GA 4YLKA 3PXYA 5HI2A 4QQCA 1BX6A 3H4JA 2YCRA 3F5UA 2OIBA 2IZUA 2R7BA 2B1PA 1L3RE 4JG6A 3FI3A 4OTIA 5H8GA 4ALUA 3ZSHA 4NJDA 4A9TA 4CCUA 4F7LA 2QQ7A 1DI9A 1H1WA 4E6AA 2W0JA 2XZSA 2WEVA 3HRFA 4GW8A 3TJDA 4BKJA 1H25A 3R2YA 3ZZWA 5HTBA 2FO0A 2IVUA 3ALOA 2PVMA 4TRLA 1GY3A 2BMCA 4YBJA 3E64A 2LGCA 3LHJA 4NWMA 2WGJA 3Q4CA 4BDAA 2G1TA 3R1SA 5BUJA 4LI5A 4NTTA 1PXKA 2XNBA 4MXXA 3VS6A 3ZZEA 3EQGA 4BRXA 2Q0NA 3G51A 2BIKB 4ZTQA 5IU2A 3CY2A 1F3MC 1PHKA 5G1XA 4GU6A 2F49A 3CD3A 3ZONA 1KE9A 3F3ZA 4O7ZA 3R2BA 4I21A 1OB3A 3EKKA 4I0TA 4IM3A 5HG8A 3SD0A 2WU6A 1J1BA 4L3PA 4FTNA 2QCSA 4FKOA 4M3QA 4Z55A 3G15A 2X4FA 1PXPA 2P2IA 2ZV8A 4TYEA 4TWPA 5E4HA 1OUYA 3FHIA 3OS3A 3JUHA 2IW9A 3A61A 2C68A 4MXYA 4U45A 3E93A 3R1YA 2UW3A 4R77A 3IECA 4C2WA 4EK8A 1YRPA 3GP0A 4R5YA 3ZRLA 3TXOA 3R30A 3DK7A 4PNIA 5D1JA 4MWIA 3A2CA 5LARA 4I24A 2Y8OA 1YOLA 3LXKA 3W2CA 3VUMA 3HL7A 2C6TA 3LCSA 3QQHA 4IB5A 3WF8A 4BI1A 4TT7A 4EH4A 4F6WA 3RM6A 2BKKA 4AA4A 3D15A 4C02A 5ANKA 5CEOA 5HHWA 2GHGA 2VTAA 3R00A 4QPMA 4AGCA 4PTGA 2FSMX 4FTMA 2GQSA 1UV5A 1R0EA 3Q32A 2W4JA 5HO8A 4EK3A 1F5QA 2YDKA 3DZOA 3M42A 3NUSA 4HYUA 4RIWA 5DT3A 4DG3E 4DYMA 3R9NA 3OT8A 4A9UA 4C36A 3KY2A 4IWQA 2PE1A 3LM5A 5HTCA 1TKIA 4DC2A 4FIFA 2W5HA 3FQEA 4N4SA 4MNFA 1H28A 4X3FC 1O6YA 4BGQA 4YJNA 3DKCA 3OCGA 5I4NA 4F1MA 2RIOA 2XK6A 4PP9A 4V04A 4O82A 5AJQA 4RIXA 3MGYA 4TYHB 4EHZA 3MN3A 4OBQA 4C35A 4C2VA 3PE2A 1Y6BA 3PP1A 4EOLA 4J95A 5E1EA 3G9NA 1A9UA 1YI6A 4I0RA 4J98A 5IKWA 5M4IA 3FLNC 1KE8A 5TR6A 3V5PA 3U6JA 2XIYA 2XK7A 3P7BA 2O8YA 4KRDA 5M07A 4WSYA 3LLAA 4U40A 5CVFA 2JBOA 4AQCA 1ZOEA 5CSWA 2VN9A 2YIRA 4EHVA 5JN2A 4IVAA 4UN0C 5HE0A 3GCQA 3TACA 2P55A 2OXYA 4M0YA 4M7IA 3DBDA 4YTCA 2P4IA 3D5XA 3EN7A 3QAME 4IX6A 3UE4A 1LPUA 5DRBA 4D2PA 4IFCA 5JGDA 2RG6A 4W4XA 5AP6A 3W8LA 3P5KA 5AWMA 2IVSA 2XNNA 2PZRA 1H0VA 2WOUA 2G01A 4LUEA 4DFLA 3KCFA 3QTZA 3ZUTA 5HX6A 2QKRA 2E2BA 1Q8ZA 2JDSA 3KRLA 1W98A 4Q5HA 3R8PA 4M15A 3VUKA 4TYHA 5C03A 3QTSA 4YO4A 4QPAA 1ZOGA 2XJ2A 3A8XA 3OEZA 3FL4A 3ORTA 2O64A 4JT3A 4R3CA 4F99A 2OJJA 4TL0A 2VUWA 4AFJA 3PWDA 2OZOA 4RJ8A 4JAIA 3FKLA 2OJIA 4CFFA 3F61A 1PXJA 2WQOA 5IMEA 2A1AB 5FRIA 5JGBA 2YWPA 2YZLA 5LWMA 2YCSA 3T3UA 2VWUA 5KMKA 5TF9A 4IM0A 4O0RA 2GNGA 2VNWA 3FEGA 1UU8A 3DA6A 4FTKA 2RFSA 2WTJA 4O0XA 4FKVA 2BRBA 2C5XA 1OL6A 3GQIA 4ALVA 5C01A 3QKMA 2ONLC 5AFVA 3KMWA 2QLQA 2I0EA 4AGDA 5BNJA 4JG8A 1K2PA 5AP2A 3BLRA 2ZV7A 1S9IA 4IZ5A 3R9DA 3VRZA 2E9VA 3GFEA 3JXWA 2VRXA 2OICA 3TL8A 2CCHA 1KV1A 3ULZA 1REKA 5I9VA 3LLTA 3V5WA 1BL7A 2WMVA 4BWPA 4FEQA 3QF9A 3ZHPC 3QX2A 3V8TA 1MP8A 2UZBA 3E5AA 4UYAA 3VF8A 3HV7A 3RM7A 5AUUA 3ZLWA 5IMXA 4OTRA 4UXLA 5LJJA 1XKKA 4UWYA 3Q04A 4ASXA 4AZFA 2BZIB 1OIRA 5IH4A 1UWJA 2C1BA 3R22A 4IC8A 1I44A 2ZMCA 3TDWA 5GZ8A 1GAGA 2PVRA 5M4FA 3CKWA 3IDBA 4TPTA 5L3AA 3PPKA 2YM4A 4H39A 3U87A 3C7QA 3CP9A 4GS6A 2QNJA 3RVGA 4C37A 4G3GA 3NW6A 1I09A 2FH9A 3M11A 5EI2A 3NR9A 3KU2A 1URWA 5FTGA 1KV2A 1P2AA 4WHZA 2NO3A 5HE3A 4GK2A 4JIAA 1XBAA 5JZJA 3ACJA 3E8DA 4DINA 5HKMA 2QO2A 1H1RA 2V5QA 1OKYA 1M7NA 5C8MA 1U54B 2C6MA 3QYZA 5M06A 5J9ZA 3ZRMA 5HO7A 1XR1A 1WBOA 4FTAA 3RWPA 4QYEA 2PUPA 1Q61A 4FZAB 3FXXA 3LAUA 5G6VA 3L9LA 5JRSA 4O83A 5AUVA 3UIBA 3MH0A 5KUPA 2EVAA 2DWBA 3LXPA 1OMWA 4DFBA 4D4YA 3I0OA 4QMSA 1PKGA 4YJSA 5J79A 3NX8A 3OC1A 3OY3A 4LFIA 3E92A 3EYHA 2R3GA 3E8EA 4N57A 1WCCA 2XM9A 4TTHB 4J96A 5L8LA 4FIHA 4WBOA 4EZ7A 1VR2A 3C1XA 5KBRA 2QOHA 3HKOA 4CFWA 2WO6A 3NNXA 3ORNA 5K5NA 3RCJA 3DQWA 4A07A 3KN5A 3FMLA 4UZHA 5JSMA 4EC9A 3DJ7A 4BDDA 5KO1A 4LL5A 4D58A 1QPDA 1Q5KA 4CMOA 4N6YA 1B6CB 5IQDA 5ETCA 4LGDA 3VQUA 3UPZA 3ZM9A 5C4KA 3VBXA 3RZBA 3WI6A 3C4ZA 1ZAOA 1M2RA 4A9SA 4FX3A 4X6QC 2EXEA 3GU8A 5D9HA 4FKPA 3HV4A 2YLFA 4X3FA 3ZFXA 4YU2A 3KXMA 3NVMB 5KZIA 2EXCX 1NXKA 3BIZA 5DH3A 1Z9XA 4RZWA 4HCVA 2GTMA 2UW0A 3HV6A 4R6VA 4GKIA 4C7TA 2HYYA 2R3FA 5CENA 5L4QA 4TNBA 2C6OA 1LEZA 4QMNA 4XBRA 4C33A 5EH0A 4W8DA 3FV8A 5HCXA 5C27A 1ZMVA 4YC3A 3D7TB 3S3IA 4FOBA 3U51A 1XH4A 2JIUA 1P4OA 3WF7A 3QQUA 4AW0A 3BE9A 3MPMA 4QMLA 5CEQA 5HVJA 4F7SA 4FSTA 4GUEA 4BZDA 2UW6A 3ZO4A 3CQWA 3ZUUA 3ZH8A 3QQKA 3CTJA 1UU7A 4P4CA 4BBMA 3ENMA 3TM0A 4GJ2A 4JDKA 4BYJA 1U4DA 2PMLX 4LRMA 4CEGA 4PMMA 5AV2A 1JQHA 4WG3A 4GG5A 3TTIA 3UOHA 5FUTA 3HAMA 5LXMA 3L1SA 3NDMA 3SW7A 1ZY5A 3C5UA 3FKOA 3GT8A 3QD4A 3IK3A 3WIKA 1SM2A 3L8VA 2NNWB 1Y6AA 3UOLA 1NT2A 5L8JA 4QMZA 4AF3A 3UP7A 2R3QA 4MF1A 4TZRA 5AR4A 3QWKA 5HCYA 4DTKA 3PSDA 4F0IA 4LQMA 4ZSLA 3E3BX 4NCTC 4USFA 4FGRA 1R39A 4IADA 5TOZA 3C4XA 1URCA 2WMXA 3CTQA 4RFZA 4MBJA 4GL9A 4OTDA 4AOTA 5CI6A 3R9RA 1J1CA 4L6QA 4A4LA 2JEDA 2YISA 3DDQA 4MHAA 3D5UA 3PSCA 3QCXA 3LFDA 3HDMA 3HECA 4XV2A 4F9BA 1W84A 2WTWA 2WMAA 4NM0A 1TQPA 3MJ1A 2XK4A 2O63A 4WSQA 5M08A 3KF4A 2OGVA 2R3MA 2R9SA 4LMNA 3SW4A 4O84A 3B2TA 4GT3A 4L3LA 1VJYA 5I3OA 1P5EA 3A7IA 3EN4A 5D7AA 5EYKA 3D14A 2BVAA 3BV2A 3KXHA 3R73A 1UU9A 4AGWA 2ESMA 4FBXA 2WQNA 4KIPA 4MBIA 4PPAA 4MXZA 3VBWA 4BB4A 4AW2A 4Y5QA 2X8IA 3R7IA 3RK7A 4AZWA 1GZNA 3LQ8A 3NYOA 3REPA 4FSQA 4UMTA 2J6MA 5D11A 4NM7A 4DA5A 4FV4A 1ZYJA 1TVOA 2SRCA 3IO7A 4RIWB 4RX7A 2A19B 3ATSA 3PPJA 3QU0A 1YI3A 1ZLTA 2Z2WA 3DNEA 4YJOA 4AN2A 4APCA 4XP2A 4XUFA 3R7UA 2PYWA 1WBWA 2PE2A 4F7JA 4U41A 2HZ4A 3VS1A 3SX9A 4C3RA 4IX5A 3GEQA 2WMWA 5F4NA 3S2PA 1J7UA 3U9NA 4EL9A 2JDRA 4ANNA 1Q8WA 3CE3A 3VJNA 3LKMA 3FMJA 4WNKA 3VVHA 4BN1A 4E7WA 3L9NA 3QD2B 3TZMA 4QYHA 4HZRA 4GRBA 1ZXEA 4KBCA 5LMBA 2O65A 4HGSA 3S1HA 2XUUA 3DLSA 2VO3A 3EFKA 4ZJIA 2IN6A 2QG7A 3UDBA 3DJ6A 4I6HA 1FQ1B 5IQAA 4O0UA 1Q97A 3B8QA 4U42A 5FLFA 3W32A 1L8TA 3V01A 3VIDA 2JBPA 3CR0A 3IDPA 5AADA 3BGZA 4OTGA 2QODA 3EQPA 2C5VA 4G17A 3I4BA 3KMMA 4NM3A 5CT7A 4RC2A 3WYXA 2C5OA 5B0XA 2HW6A 4BGGA 2GS2A 4BICA 1OL7A 4P5ZA 4YSMA 2UUEA 3R0TA 4MH7A 4DLIA 2IZTA 3KL8A 3MFRA 3KC3A 4FT7A 2EU9A 4FSMA 5HGIA 3LQ5A 4F70A 5CASA 4QQTA 2XP2A 2BCJA 2J4ZA 5DEWA 3Q9XA 3ZFYA 1MRVA 2C0OA 3N4TA 3RHXA 3KRXA 2XCKA 5BVNA 4DTBA 2E9UA 5J95A 4DH5A 4L53A 4DE4A 4AZTA 5CNOA 5E92A 1R3CA 4PMTA 1F0QA 1E1VA 2QD9A 4NM5A 4XNEA 5IA1A 4IMYA 3F88A 5IQFA 4QP9A 4ACDA 2X8DA 4RC3A 4MX9A 2C47A 3KF7A 4CGAA 3TIZA 3QYWA 2ERZE 2HXLA 1A06A 2XNEA 2W1IA 4GT5A 4GYGA 5JFVA 2CPKE 3HVCA 1R0PA 4NW6A 2W7XA 4YLLA 2OJFE 4NU1A 5AAGA 4QRCA 3NUAA 3OUKA 4HVHA 4IX3A 3MA6A 2CGWA 2W99B 3MFUA 1CDKA 4BFMA 1H08A 2UZOA 3OMVA 3AOXA 3EHAA 3DS6A 3RPYA 2HELA 4PRJA 5ACKA 3DFCB 4NCTA 4FEXA 3UG2A 4X6RA 5E7RA 3P4KA 4DEBA 3ZO2A 4YZNA 4G3DA 4O2ZA 4DLJA 1ERKA 1CSNA 1Q99A 4KIQA 5D7VA 3WARA 3ZBFA 4DFNA 3JPVA 5AUXA 4O27B 5HESA 3PXKA 2EUFB 3NSZA 4BCMA 2B9JA 2VO7A 3ZS5A 4YPSA 1UKIA 3PXFA 3QTUA 4S2ZA 5L2QA 3ZXZA 1PXIA 5IEVA 3BU3A 4F9YA 4FNWA 2OSCA 4JVGA 3MVLA 3CPCA 3EQIA 4D2VA 4IHPA 4EOJA 4UY9A 5HNBA 4GU9A 4WT6A 4ZSEA 5HBJA 4HNFA 2R5TA 2OH0E 3UVRA 3AXWA 3RAKA 5CEPA 4FG8A 2ZM3A 4QQ5A 3OVVA 1OI9A 3F82A 1BMKA 2WMSA 3GCUA 4YC6A 3PYYA 3FZTA 4X2JA 5GIPE 2WELA 2CCIA 2VWXA 4TN6A 1BI7A 3NUPA 1BI8A 4FNZA 4R3PA 3UIXA 3VAPA 4WNMA 2VX0A 4C8BA 3PDTA 4Y5HA 3TUBA 3QD0A 4IAZA 4O7NA 4I92A 3NYVA 1JAMA 2ZYBA 3Q53A 3GC0A 2B9HA 1Z5MA 3I6UA 3QQFA 4O7YA 3BELA 2YABA 4BHZA 1R1WA 1ZZ2A 4FYOA 2CGVA 5FBOA 4IZYA 3UMXA 2JFMA 4RX8A 2NRUA 4DEAA 3DKFA 4BZNA 3Q2JA 4YJQA 2GSFA 4K11A 4YZDA 3BYOA 3UNKA 1H26A 2WZJA 3ZXTA 2W9FB 4J97A 5HNGA 4CFNA 5EYCA 2XMYA 4I4FA 5IUHA 5HD7A 4LOPA 1IG1A 4QNAA 5BYZA 2GMXA 3MFSA 3PY1A 3SGCA 2XB7A 3GC9A 3O23A 2B54A 3NMUF 2GNJA 1OPLA 3LE6A 4FMQA 4ZY6A 3BCEA 3K5UA 3W2RA 3U9CA 1KUTA 3MDYA 3Q5IA 3D5WA 4BDFA 1YDSE 4YMJA 2H9VA 1AGWA 3BLHA 3FC1X 1YDTE 3VS2A 3NYNA 3TI1A 4L52A 4ASZA 3IG7A 3QALE 3VBTA 4DGMA 1ATPE 1YKRA 2VO6A 3IGOA 3O7LD 4RRVA 3F5GA 2BDJA 3VBYA 4A9RA 2ZAZA 5TE0A 1Z57A 4QP3A 4Z7HA 4CKJA 4G3CA 1NA7A 1PXOA 3FKNA 4BCFA 4ZS0A 3VHEA 5M53A 3SXRA 4CXAA 2FA2A 1ZWSA 3GU6A 1OPJA 4WBBB 4U8ZA 3ATTA 2PUUA 4R7BA 3LCTA 1XBBA 3POZA 5FDXA 5LMAA 3R01A 3FMMA 4L46A 4G3EA 3N9XA 4H3BA 4JBQA 4RSSA 3GGFA 4NEUA 3A7JA 3LJ2A 4U79A 4EJ7A 2C5NA 3W2QA 3PRFA 2FUMA 4OAVB 4BCIA 3ELJA 4X3JA 3ZCLA 3QRUA 4FKQA 4CVAA 4K8AA 1B38A 2XH5A 4OTHA 5IA3A 3GU7A 3QZGA 1LP4A 3DT1A 2Y4PA 3CSVA 2BUJA 3HRBA 3TZ8A 3WZUA 4DBNA 2GFCA 4KKHA 4MEDA 4ANLA 4QMOA 5E8TA 2VTLA 3RCDA 4NIFB 3FLWA 3NLBA 2W5BA 2RFDA 2VNYA 2CGUA 4USDA 5IG1A 3PJ8A 4XCUA 2J5FA 2R7IA 3ZDUA 2ITTA 2PUNA 3CJGA 3DXQA 1VYZA 2WMQA 4FZDB 3I5NA 4A4XA 4ITJA 4LYNA 4YNEA 4L45A 4KSPA 2B52A 5L6PA 3SC1A 2PVJA 5ANGA 4DEIA 2W1GA 4D28A 3OXIA 2GQGA 4RJ4A 4O7WA 3KB7A 4JIKA 3DXPA 3MESA 3QLGA 3KREA 3Q9ZA 3UQFA 3DAJA 2IZRA 4IZAA 1RE8A 3NNUA 2P0CA 4JX7A 4X7QA 4YLJA 4HPUE 1CKPA 3SV0A 1VZOA 3NGAA 3JY9A 3NCGA 4XLIA 3C9WA 5HO6A 4A9YA 3RK9A 1G5SA 4XG8A 5CSHA 4IEBA 4TYIA 2C6DA 3A4PA 5AV1A 4JS8A 5C9CA 4QMUA 3SQQA 3ZLXA 4BI2A 4E5AX 4RA4A 3OEFX 2GS7A 2VTPA 4JRNA 3KULA 4LRKA 3RP9A 2XVDA 2F7EE 4X0MA 2WTKC 4E20A 4E93A 5HE1A 4CYJA 5DPVA 3TCPA 5L6WL 2WQMA 4AA5A 3SA0A 2GQRA 3C0HA 3GOKA 4G6LA 4IAKA 2PVKA 4OW8A 4D9UA 2OJGA 2PMNX 2XIRA 4JXFA 2JIVA 1AQ1A 5CQUA 2QVSE 4CQGA 3WIGA 1Q4LA 3EN9A 4FGBA 3SDJA 1LUFA 2W4KA 4HCTA 4TYGA 4G3FA 4YUQA 1Y8GA 3W2SA 3UNZA 3LFFA 3QHRA 5AA8A 4YBKA 3C5IA 1OVEA 1CKJA 1KWPA 4FV5A 2C6IA 2VTSA 2X39A 2RL5A 1GOLA 3PUPA 5DBXA 4BCNA 4HYIA 3TUCA 4R5SA 5KBQA 3HX4A 2FSTX 4XV1A 1XH5A 4E5BA 2Z60A 3OTVA 3MVMA 4YTIA 4GG7A 1Q8YA 4IXPA 2B4SB 1BYGA 3QRTA 2NRYA 3KVWA 4P2KA 4AGUA 2PULA 2YFXA 2J0JA 2DQ7X 4CMTA 1YQJA 5DYJA 1ZRZA 2QLUA 3MY5A 4YHJA 3SLSA 4RVKA 1AD5A 2E9NA 3UQCA 4JQ8A 3BE2A 3OG7A 3ZRKA 2UW4A 2FSLX 2GHLA 3SAYA 5GJFA 3O7LB 3OD6X 3BU6A 4EWQA 3UP2A 3K3JA 2OH4A 3C0IA 3UVQA 4D4SA 5ETFA 4D1ZA 4CMUA 2GNLA 3TN8A 3O51A 3PIZA 5CANA 4FT0A 5L6OA 3PIYA 3LW0A 4FIGA 4FKTA 3DJ5A 3QGYA 5BVKA 4IB1A 3KGAA 4J7BA 3TZ9A 4CRSA 4ENXA 2X81A 5CEKA 5M44A 4I5HA 3UNJA 4ZY5A 3QTIA 3R1QA 2UVZA 4E3CA 1GNGA 4FVRA 3L8XA 4AAAA 5AUTA 4O91A 5CSPA 3A7FA 4GFMA 2HZ0A 3S4QA 3F5PA 2BHHA 3HMIA 4L7SA 1XQZA 3GC8A 3RAIA 3FYKX 3ORKA 5EKOA 2X2KA 3HNGA 5EDPA 3UC4A 3UZRA 5DEYA 2JDTA 4J1RA 3V5QA 4GKHA 2YDJA 3QA0A 5CU4A 3DOGA 4JI9A 4LG4A 1PKDA 2VWWA 3TG1A 4K2RA 1JKLA 1HCKA 4RMZA 4UX9A 4FG9A 4FV7A 3PWYA 3FY2A 5AR5A 4DH3A 3ERKA 4E6QA 3R8VA 4IFGA 2WXVA 4QYGA 4XOYA 4FR4A 3QZHA 4ZTSA 4FNYA 4MNEA 2OW3A 4LRJA 3GC7A 2X9EA 4PY1A 5CU3A 5E8VA 1OIUA 3RI1A 2V0DA 3DKGA 1IR3A 4O0YA 4XRLA 5FEQA 4IAAA 4F63A 3GCSA 2GNHA 2PHKA 1LR4A 1YOMA 4JQ7A 1T46A 4IDTA 3GOPA 2W5AA 3IW4A 4LOQA 3MV5A 1XWSA 5FQDC 3PZHA 4CT2A 3BI6A 3MJ2A 3P7CA 4RWJA 2OJ9A 4TWCA 4C4EA 4E26A 4EZ3A 2BFYA 4D2SA 3MBLA 3VBVA 4X21A 2XCHA 3IPHA 4I5MA 2IG7A 1FVTA 1JSTA 4WNPA 5IA0A 5BUEA 3IQ7A 4FL3A 4I6QA 3AGLA 4YJVA 4ZZOA 4HNIA 3DTCA 3UJGA 2YAAA 4FG7A 3HUCA 2UW5A 5HQ0A 2F4JA 2OZAB 2QKWB 4I22A 5IEYA 3TKUA 5IQGA 4H1JA 2ITVA 2CKOA 5EDQA 4RIYA 2BPMA 2B9FA 2YIQA 3O71A 4FV6A 2J90A 1Y8YA 4I1ZA 1YHSA 2QHMA 1STCE 2QO7A 4L42A 3CQUA 5DE2A 4CZYB 4EBVA 1TQMA 2XIKA 5JRQA 1JVPP 2KULA 5A4EA 2CSNA 1U59A 2JC6A 4FTLA 4O0VA 4PDSA 2YJSA 4B99A 4CFMA 5HBEA 2UW8A 1JSUA 4QTEA 1XH9A 2AUHA 4G2FA 4EKKA 2R3KA 3DXNA 3R7OA 4MD9E 3CIKA 4ZAUA 3H0ZA 4JRVA 4NW5A 3IW6A 3ULIA 4BCQA 5M09A 1VEBA 5GIOE 4II5A 4YC8A 4IIRA 1JOWB 3ROYA 2QOKA 3CCNA 3AC4A 4I20A 1S9JA 2H6DA 4O7SA 3ET7A 3IS5A 1WAKA 4FT5A 4ZZNA 3HUBA 3QCQA 3ROCA 3AC2A 4O6EA 5BVWA 4L43A 4UB7A 2ZB0A 1OL1A 3LFQA 4E4XA 4MTAA 3AMAA 4QMYA 4FV0A 5IH5A 3W33A 1DM2A 3GQLA 3FXZA 2C1AA 3LFCA 4O6LA 1OECA 5CX9A 4WUAA 4V0GB 5KHXA 3TKIA 5EW9A 2NP8A 4OUCA 4KNBA 3MW1A 3OCBA 2WHBA 3NNVA 4BR3A 1IAJA 4Y85A 3KMUA 3SOCA 4A06A 1OL5A 1IAHA 4YTFA 4TNDA 4OTWA 2CLXA 4G1WA 2G9XA 2PZ5A 5L2SA 4ZLZA 3O2MA 4RJ5A 3E62A 3BYVA 3ORPA 4BCGA 2P3GX 5EW8A 4C62A 3FSFA 3MH1A 5DMZA 2IO6A 4PQNA 3T8OA 3UO4A 4JR3A 4Y95A 4AZEA 3LPBA 3SG8A 4IX4A 2CNUA 4KKGA 1ZYSA 3OWKA 3IDCA 3PLSA 3DLZA 3EQFA 4GK3A 3GXLA 5EFQA 5DR6A 5HG9A 3VUTA 4BGHA 4RJ6A 3JY0A 3BV3A 3JVRA 5E8WA 2BAJA 4LM5A 3VUHA 3AD4A 5E8YA 3S00A 2XKFA 4GFOA 4BWXA 1YDRE 3RTPA 4LGHA 1PMVA 4CRLA 4EH2A 2UZTA 3OHTA 4W8EA 3E7OA 5FXQA 3MB7A 3POOA 3BGQA 5HVYA 5KMLA 2Y9QA 2VU3A 2R3PA 5AP4A 3CBLA 3KCKA 2BFXA 5DN3A 4QMVA 3PG1A 5ACBC 1M17A 4G6OA 4AX8A 1DS5A 2PZPA 4FUXA 2JD5A 3OW3A 4RFMA 3C51A 2BKZA 2OKRA 3QUEA 4JQEA 2I0VA 5LVLA 3OCSA 1MUOA 3GUBA 4KIKA 3WF6A 4BTJA 1XH7A 1W0XC 4MCVA 2IPXA 3F66A 4YZCA 4FTIA 4BTMA 4JBOA 4AE9A 5AAEA 3BBTB 3KRWA 4YURA 1PXLA 5A6OA 3GVUA 2ZB1A 4RJ3A 3WE4A 3A8WA 4R7HA 2QU5A 3FZRA 3OWJA 2UZVA 5I9ZA 4U81A 2BHEA 4EH3A 4BCHA 2YACA 3E7VA 3UO6A 3D94A 5HIEA 5A9UA 3E3PA 3JVSA 4X2NA 4FF8A 5L2IA 4NFMA 3TWJA 1PRYA 5IQCA 5D41A 5KMIA 2Y7JA 4ZZMA 2PK9A 4I23A 4UWBA 5CZHA 4EHGA 1YVJA 4EUUA 4EH8A 3B8RA 4JAJA 3VQHA 2Z7RA 4U9AA 5T6KA 3SRVA 4C58A 5CF8A 1FPUA 2VTMA 4M67A 5HIBA 1ZY4A 2OI4X 1K9AA 2B53A 3HV5A 3O96A 3DU8A 3PE1A 4LL0A 5EHLA 3ZUVA 3ORIA 3R71A 2XRWA 1SZMA 4E8AA 3D2KA 5AA9A 3UYSA 2WTKB 4MXOA 5HEZA 4V0GA 3LMIA 3LFEA 5K9IA 1W7HA 1JKTA 3TNWA 5DA3A 4HVDA 4XMOA 5EQEA 1U5RA 4V01A 5AP3A 3H9FA 4UMPA 2B0QA 2IJMA 1RDQE 4C4IA 4EI4A 5GZAA 1H0WA 2PVNA 4E4NA 1YXUA 1H07A 2HW7A 4BWKA 3UVPA 4C4JA 4Y72A 5LVMA 4M0ZA 4NT4A 3C0GA 4QPSA 4AT3A 4H36A 5AAFA 4BZOA 2W4OA 3HZTA 3EQDA 3PA3A 4M14A 4N0SA 3MB6A 1GIJA 2CN5A 4HGLA 4XP0A 4RWKA 5JGAA 2R3JA 5GNKA 5E90A 2JKMA 4YNOA 4M69A 4XG6A 4MWHA 4NYEA 2WMUA 3PFQA 2Y4IC 5FDPA 5KNJA 4FSWA 4HGTA 3FI8A 3G5DA 4H05A 4DT9A 1FOTA 1QMZA 3OT3A 3TNQB 4IB0A 5HE2A 1J3HA 1Y57A 4KRCA 4O1OA 2V55A 4J99A 2WTCA 4PL5A 4UWCA 3ZTXA 3UC3A 3K2LA 4NSTA 4P7EA 1OUKA 2XEYA 1GZKA 3F5XA 1HCLA 4YSJA 4DN5A 3UPXA 4LV8A 4L01A 3QHWA 4ZY4A 3RHKA 4FTCA 3TZ7A 3HAVA 1JSVA 4FKRA 4KS7A 4MQ2A 5AP7A 4ANOA 3GB2A 4F09A 4XG4A 4Z3VA 5KCVA 5L2TA 2W1EA 4BBEA 3WZKA 3R9OA 2B9IA 4MK0A 4PWNA 4UMQA 1PMNA 2ETRA 4EHEA 4HVGA 3PLAE 2J0LA 3QTXA 4FKGA 1J91A 1YWVA 2X4ZA 4PUZA 4YJPA 4K77A 5AP1A 4F1OA 5CAOA 4X2GA 4FI1A 4ENYA 3WF5A 2PZYA 2J0IA 4ITHA 5DR9A 3H3CA 3EIDA 3WE8A 5I3RA 2PPQA 5A4QA 5J1VA 3AT3A 4QO9A 1XBCA 2YEXA 4KS8A 4FSZA 4QMWA 5C26A 5CAUA 1OBDA 3FMKA 2Y6OA 4IAYA 4W4VA 3V6SA 1PYEA 4AW1A 4AS0A 4RIOA 2XYNA 5C8KA 3FI4A 5T3QA 2PVYA 2QOCA 1QL6A 4OBPA 4XEYA 5DOSA 4AN3A 4EYJA 4BDEA 4AZVA 1H1PA 4B6LA 4MKCA 4DT8A 2C30A 3S0OA 3GNIB 3IONA 2A27A 4GJ3A 4RQVA 5HG7A 4JG7A 4FKLA 4OLIA 4ZOGA 3AC8A 4N6ZA 5EK7A 1YHWA 3H10A 4QYYA 4CKRA 1ND4A 3ZC6A 3EN6A 4RZVA 3ZO1A 4D2RA 5A14A 3S95A 1G8AA 2F2UA 4C4HA 1VYWA 1W8CA 4XRJA 5E8UA 4JR7A 1MRUA 2DUVA 4CV8A 3MPAA 2HY0A 4NFNA 3NEWA 3MS9A 4KBKA 4BDKA 2QO9A 3NW7A 2F2CB 3O8TA 4OAUC 5EW3A 3IOKA 3MH3A 1Y91A 2W1FA 3NVKI 5J87A 5KHWA 4R78A 2X2MA 2EB2A 1KE6A 3A99A 5ANOA 1PYXA 4S32A 4WIHA 1FVVA 1TQIA 1CTPE 2J5EA 3ODYX 4C3FA 3SXSA 3DAKA 4OGRA 4WA9A 4WG5A 4AACA 4GUBA 3ZOSA 3VC4A 3EB0A 1YXSA 4ZTNA 3V6RA 3QC4A 3HP2A 4KSQA 4YGAA 2YITA 3UODA 1RQQA 2Z02A 4O2PA 2UV2A 2HENA 2I0YA 3LMHA 4GVJA 4FTJA 4QP1A 4TW9A 3P78A 4FIIA 3G90X 2OF2A 4Q2AA 4U44A 5CY3A 3PXQA 2PVLA 3D7ZA 3FMEA 3WF9A 4X2KA 3Q3BA 4LV5A 2VTRA 2ZDTA 1QPEA 4NZWB 3DBCA 3H30A 2AC5A 4RVLA 5AP0A 2NPQA 3TIYA 3U54A 3C4EA 3A62A 1H8FA 3R83A 3OCTA 4IE9A 4MF0A 2WMBA 4YZBA 3VS7A 3KN6A 1WFCA 2R64A 4Y73A 3AC3A 4Q5EA 3PPZA 2AC3A 1YOJA 5E8ZA 2C5YA 3QTQA 3HMMA 3I0QA 5EG3A 2X7OA 3UZPA 4YTHA 3DNDA 2C6EA 1UA2A 3QD3A 2GHMA 3C4CA 3R7YA 4FK6A 4IH8A 1OKZA 3UOJA 2W9ZB 2QOIA 4ZS4A 5HZNA 3FLQA 3BU5A 4ZK5A 5EOBA 4BKYA 4FTRA 1PF8A 3OBJA 4BIBA 3FAAA 4C61A 3QZFA 4HZSA 2VTNA 3RGFA 3TV7A 1CMKE 4PTCA 1SVHA 5IDPA 1MQ4A 5AV4A 1JNKA 2QONA 4IWPA 3PZEA 3QRKA 1OKWA 2WMRA 5GJDA 1KE5A 2WFYA 3COIA 2YERA 4WRSA 5FP6A 2VX3A 4BBFA 3TDVA 3KULB 5AP5A 4AZSA 2YM5A 3VUDA 4GYIA 3BYUA 3G0FA 5J9YA 4AFEA 5ANIA 3SOAA 1OITA 2DS1A 4FTQA 1Q8UA 1JBPE 2VTJA 5HICA 4U5JA 1GZOA 4APPA 5GJGA 2PSQA 4FOCA 3SXFA 3UGCA 5M55A 3R8MA 2JLDA 1WBPA 3W8QA 3Q52A 3M2WA 5AIKA 2CKEA 5DI1A 3Q9YA 3QTRA 5EM8A 3UMWA 4EBWA 4RBLA 2JKKA 4C38A 4PPBA 4CG8A 3I6WA 5EM7A 4PX6A 4FVPA 3U4WA 1PMEA 2Z7LA 4O86A 4CTCA 3WZDA 5LWNA 4AP7A 2CDZA 2J9MA 5L8KA 3UTOA 3ZEPA 4E73A 3EZVA 4GEOA 4IDVA 5FTQA 1PXNA 4YP8A 3VHKA 2OBJA 1RJBA 5EHOA 3V3VA 5HTIA 5DIAA 1KOAA 4C4GA 3UG1A 4FKWA 3DGKA 2CHLA 3QKLA 4FTOA 4OTFA 4EOMA 5LOHA 4NL0A 4NIFA 5IQEA 3ACKA 3MYGA 4FZ6A 4GT4A 4OR5A 1WBVA 3N51A 2I40A 4G5JA 4JOAA 3UYTA 1YXXA 3HGKA 3QWJA 2REIA 5A4CA 5K0KA 4NK9A 4MD8E 5KMOA 3P1AA 3V8SA 5AUYA 1XH8A 4E6DA 2OG8A 3GI3A 4NUSA 1ZMWA 3Q6WA 3F3VA 4MVFA 5FEDA 3PVGA 3RK5A 4DEHA 2JGZA 4DF3A 3GFWA 3FL5A 2BALA 2OF4A 4Q9SA 3UIMA 3EQBA 4LGGA 5J5TA 4KINA 5M4UA 4KKEA 5M57A 3VF9A 4CTBA 3LXLA 5EQYA 3F3UA 4PDOA 1IA9A 3LCOA 2IZSA 4TXCA 4D2TA 2ETKA 4HPTE 4ANMA 5D10A 4XH6A 5J9LA 4I6BA 4R8QA 5H8BA 4GIIA 5EYMA 3V5JA 4Y83A 3OW4A 1H4LA 3UBDA 5DVRA 4F0FA 5HD4A 3A4OX 3EQCA 4K0YA 5CSXA 2CNVA 2V22A 4QQJA 3R21A 4BKZA 3DKOA 4L68A 1BUHA 4ZSJA 2IW6A 3ANQA 1APME 4O7LA 2O2UA 4FKIA 3BZ3A 4G9RA 4M68A 3NUUA 3L9PA 3W2OA 2E9OA 4V05A 3HRCA 4EQCA 2BTRA 1H1SA 3GCPA 4C0TA 4XX9A 4DGLC 2ZV2A 2JDOA 3FZSA 3HA8A 2OK1A 4FSYA 4YHFA 3DB6A 2UW9A 3PP0A 5HORA 3VUGA 4MD7E 3PA5A 1V0PA 3NUYA 3ALNA 3VUIA 5LVNA 5FM2A 4DGGA 4F64A 2VGOA 2ITYA 3G0EA 4DAWA 2F57A 1T45A 3B2WA 5ETAA 3KXXA 4AU8A 2Z8CA 4IJPA 3MY0A 4RLLA 4TWNA 3IW5A 4UALA 4ZTRA 1H27A 3M1SA 2LAVA 3Q4TA 3I7BA 5IA4A 5LMKA 2HK5A 4ID7A 2R0UA 3VULA 4BF2A 4RGJA 4LOOA 5EDRA 3V5TA 3Q6UA 2F9GA 3LJ1A 1GIHA 3TKHA 4D1SA 5I9XA 3ENHA 3D5VA 4AOIA 5K0XA 2J0KA 2GTNA 2O0UA 2HCKA 1GIIA 3WBLA 1Q3DA 3QQGA 1PW2A 3P79A 2YM3A 5CEMA 4DEEA 2VX1A 3BX5A 4IJ9A 3ZLSA 2C4GA 3CD8A 3QUPA 2OU7A 3SG9A 4CG9A 1FGIA 4WOVA 2HWOA 4S30A 3AD6A 3QLFA 1NVRA 4NH1A 2J2IB 5IA5A 2V7AA 2C6LA 4MXCA 5C8NA 2QG5A 3UZTA 4UYNA 3BHTA 3C50A 3CGFA 3KKVA 2ONLA 3COKA 4K33A 4AW5A 3E87A 3VRYA 2VO0A 4IWDA 4ZEGA 4TWOA 5BUIA 4XS2A 4PL3A 4CSVA 1ZOHA 4R7IA 5JFWA 3MH2A 2JITA 3TV4A 2YZAA 3VS3A 3BYMA 4RC4A 1BL6A 1UNLA 2Z7SA 3FQHA 5C1QB 5JK3A 1JPAA 4F7NA 3UIUA 5BVFA 3VJOA 4FV2A 4E5WA 3NS9A 3FLZA 2PUIA 3A7GA 1Q41A 2VWBA 2ZVAA 3R7VA 4PP7A 2VAGA 4EWHA 2I7QA 2X7FA 3BHYA 5KMMA 4UBAA 1OGUA 2BRGA 3OF0A 3FPQA 3ZEWA 3ORLA 2XK8A 1QPCA 2IVTA 4GCJA 4BYIA 3RNIA 5DG5A 3F2RA 2C6KA 2OLCA 4QP7A 4QMPA 3IKAA 5TKDA 1M14A 1SMHA 3QFVA 2WIHA 4N70A 1FMKA 5J8IA 4EOSA 3Q96A 2XNOA 3KK8A 3LFNA 3KRJA 4YZ9A 3VWAA 4AT4A 1M52A 3QRJA 4AXAA 4RWIA 1E1XA 3KXGA 2XF0A 5B7VA 3Q9WA 1JLUE 4M66A 5F1ZA 1P4FA 4ZMFA 2KTYA 3CQEA 3ZBXA 4XOZA 1J7IA 3KVXA 3RPRA 1W82A 1H01A 2PL0A 4I0SA 5IISA 2UVYA 3QA8A 5JEBA 3PVBA 5TO8A 3LFAA 5EYDA 5BVDA 4FL2A 2I0HA 1P14A 4QMTA 2P33A 4PV0A 1YI4A 2Y4IB 5KKRB 1ZMUA 2J51A 4XLVA 4B8MA 2A2AA 3AMBA 3PSBA 4ZSAA 1DAWA 2BRHA 4EOIA 2OO8X 4IC7A 5BYLA 1YW2A 1CM8A 2HY81 4RVMA 3MY1A 4BI0A 3RKBA 2QHNA 3NW5A 5IQBA 4G5PA 2CNQA 1XO2B 4DG2E 3AQVA 3NIZA 4DH1A 4ACHA 3DZQA 3LFSA 1IEPA 4RQKA 2GNIA 3CLYA 2UW7A 1JKSA 2UZNA 3EMGA 5DNRA 3AT2A 3VS5A 3MPTA 1BLXA 1UKHA 5HBHA 3KXNA 5T68A 3ZC5A 3BYSA 4KD1A 3IOPA 2PWLA 2YIYA 4P90A 4FE2A 1YWRA 3L8SA 5BVOA 2C0TA 5CF4A 1NVQA 2FYSA 5JFXA 5IUGA 2IVVA 1M2PA 3QX4A 1FBNA 5B2LA 3RNYA 4L44A 2VWIA 2C0IA 3HMPA 3BGPA 5JQ8A 5CF6A 1ZZLA 2C3IB 2BAQA 5DHJA 1PJKA 2R3IA 4U7ZA 4DGNA 3O50A 5FM3A 4D2WA 4RPVA 4DH8A 4EEVA 2YM6A 4FV3A 4EORA 1WBSA 4KAOA 4WG4A 3ZM4A 3RALA 3ZSIA 4HGEA 2QURA 4R1YA 1ZYLA 5M4CA 3TJCA 3KFAA 4XYFA 2R3NA 4FIJA 5CTPA 4U43A 1FINA 3QQJA 5CAVA 4FVQA 1OKVA 2O5KA 4FODA 4GSBA 4F0GA 3OWLA 1SVEA 2FGIA 2H96A 4H3PA 2R3HA 3CGOA 1MQBA 1GZ8A 1G3NA 4J71A 3H0YA 3OROA 4YJUA 3EL7A 3PXZA 2BZHB 2PMIA 1ZYCA 4XV9A 2B7AA 3R9HA 4M69B 1WBNA 2OZAA 4FEUA 2VWVA 4AUAA 2XNPA 3EL8A 5FWKK 4QT1A 4J53A 4CD0A 2ITQA 2CKPA 3ORZA 2F7XE 4ZTLA 2YIXA 3ID6C 3HMOA 5E9EA 3H9OA 3AD5A 3NWWA 2FB8A 3QGWA 5M56A 3N4UA 1NW1A 3C13A 5EM5A 3DFAA 4C59A 2XEZA 3BQRA 3NZ0A 4GK4A 4AWIA 5J5SA 4F4PA 5JT2A 4KB8A 3CEKA 2C3KA 4FT9A 4FSNA 3I1AA 2J50A 4KWPA 4QMXA 3D0EA 3WILA 4JNWA 4RLKA 4CQEA 3VW8A 3PVWA 4ASDA 5J1WA 5AIRA 5IPJA 5B2KA 3DBQA 3DB8A 5H2UA 4E6CA 1O6LA 5FEEA 5A4LA 4EH6A 2YA9A 3MSSA 4CFUA 2WNTA 3Q60A 4MNEB 3KK9A 5EHYA 3SKCA 2R3RA 4GIHA 4I93A 4EZ5A 3CKXA 5AX3A 2G2IA 2XM8A 2ZOQA 4QNYA 2FSOX 3V5LA 2F7ZE 4MXAA 4FSRA 3DV3A 3PJ2A 4ZTMA 4D0WA 1JKKA 4MQ1A 4K1BA 4I3ZA 5FG8A 3ZLYA 2WKMA 2JFLA 2PVFA 4X3FB 2WAJA 1M7QA 1REJA 4IWOA 4ZP5A 4BDIA 3G6HA 4FKUA 2BDWA 3FXWA 4KA3A 3VN9A 3W2PA 4FYNA 4JDJA 4D0XA 3RINA
chains in the Genus database with same CATH superfamily
3PIXA 3TNPC 3KA0A 1YXTA 2A98A 3KRRA 2UZEA 2J7TA 5E1SA 4S34A 4EH7A 3GCVA 5IZFA 4F6UA 5K4IA 4IAIA 4ACMA 3L8PA 5IH6A 1R78A 2FVDA 3R8LA 4XG9A 4HVSA 5A4TA 5TT7A 3SVVA 5AEPA 4YJTA 4JDHA 2JIIA 2XIZA 4ZIMA 2JKOA 5JMSA 1WBTA 4ERWA 4FNXA 4G16A 4BL1A 4UMRA 5CU2A 1LEWA 3NNWA 3Q4ZA 3F2NA 3FYJX 2JDVA 2O3PA 4XJ0A 5I9UA 4PMSA 1EH4A 2UZDA 4EK5A 1BKXA 1YHVA 2ETMA 3EH9A 3SRVB 1J7LA 4ZXTA 4XV3A 2QI8A 3FLYA 2YM8A 2WOTA 3ODZX 3R04A 4WNOA 3LQ3A 2ZFYA 3OUNB 1NVSA 1UNGA 5AR3A 4IVBA 2X2LA 4I4EA 3K5VA 3VW6A 1MRYA 5H8EA 1XJDA 2ITNA 4LUDA 2BRMA 5HG5A 4ANQA 3JR1A 3BBWA 3D2IA 2RKUA 2ITPA 3FPMA 3ITZA 3D9VA 2WTVA 4MBLA 3MI9A 3LCKA 5IUIA 2CKQA 4DHFA 3L9MA 3TIYA 4NKSA 3EFLA 4D4RA 1Q3WA 3AGMA 4L9IA 5DR2A 2PZIA 4QD6A 5BMMA 4F78A 2VZ6A 4JJRA 4KIKB 4D1XA 3ETAA 4U0IA 5KE0A 4O0WA 5EM6A 3V51A 5KMNA 2DYLA 4J8NA 4EOKA 4NKAA 4EOOA 5KMJA 4Z9LA 5M51A 3P0MA 1JWHA 3E63A 4JBVA 4M13A 4PTEA 1WVWA 1FGKA 3IGGA 3BL9A 3RBWA 1WMKA 4I41A 5E91A 2PE0A 2PMOX 4F9WA 5HVKA 4EYMA 3TUDA 3DBEA 3NRMA 1SNXA 3OXTA 5A6NA 3I79A 5HOAA 4TY1A 2WTDA 3HDNA 5F20A 5BX0A 3ORMA 5I9YA 4USEA 4FA2A 3GU4A 5AV0A 5CT0A 1PXMA 3WYYA 4F9CA 4XG7A 2IWIA 5AUZA 4ERKA 3DK6A 2P2HA 4BDGA 5HLPA 3NFFB 5D12A 4CT1A 5JFSA 3QTWA 1E9HA 4KIOA 3WZEA 3AT4A 5EI8A 5ANEA 5E8SA 4A4OA 4UV0A 4DGOA 4Z7GA 5HNIX 2IW8A 2R0IA 4AE6A 2R4BA 3CC6A 5CU6A 2CLQA 2HWPA 4DG0E 2I1MA 4XHKB 3DAEA 3FUPA 3AC5A 5CQWA 4O7RA 2ITWA 2YN8A 2ZMDA 2OXDA 3F2AA 3NPCA 3FMHA 2X6EA 4ZSGA 2HIWA 4AA0A 5ICPA 2X9FA 4TKSA 4QTCA 3ZYAA 2X0QA 4ZLOA 4QYFA 5CSVA 4O1PA 2XYUA 4MYGA 4C4FA 5BMSA 4U6RA 3CY3A 2QOBA 1V1KA 5K4JA 3P9JA 5KZ0A 4IB3A 4JL9A 3GENA 4X2FA 4XG3A 5BPYA 5I5ZA 4PPCA 5HCZA 5EKNA 4BIEA 4PDPA 2PTKA 3EZRA 3FZOA 4HJOA 3G33A 3ZSGA 3CTHA 4HVIA 4B4LA 5CVGA 3QKKA 4B9DA 2G15A 5IQIA 4IBMA 2OXXA 4B0GA 1OIQA 2QC6A 2XNMA 3NUNA 3Q2MA 3QUDA 4CZUA 4FEVA 3FY0A 2VTTA 3QBNA 4YZMA 5H3QA 3VNTA 3W0SA 3BHHA 3I7CA 2EXMA 4BDJA 4CLJA 3FMDA 3LVPA 2UZLA 5LMKC 1XH6A 2X8EA 3EFWA 1YWNA 5AM7A 3W0MA 4G31A 3COHA 2Y0AA 5IQHA 5J7HA 3DTWA 2W05A 2WMTA 3DPKA 5B2MA 3A7HA 5EQPA 4EK4A 3FSKA 1OPKA 4O38A 4KBAA 2X7GA 3OFMA 2VD5A 4EUTA 3LJ0A 4F6SA 4AT5A 3HMNA 3KQ7A 4WKQA 4M12A 3RAHA 3G6GA 2YDIA 5E8XA 2CGXA 4OTPA 3NAXA 3P23A 4QTAA 4IACA 5FGKA 2YLEA 3KXZA 5AR7A 4CLIA 5F9EA 3G9LX 5K5XA 5CYIA 3CPBA 3UO5A 4AN9A 1XHAA 4RIYB 1V0BA 3FJQE 1ZYDA 3QXOA 4J8MA 4F08A 4RIXB 3F3WA 2BR1A 4QP8A 1OL2A 3E88A 3F69A 3K54A 4PNKA 2GS6A 5HLNA 2GDOA 2XRUA 1X8BA 5DRDA 3R02A 3R63A 3HEGA 4RG0A 3UOKA 2RG5A 4EC8A 2UZUE 2GFSA 4QTBA 2JKQA 2W1CA 2W17A 1IRKA 2W96B 4C3PA 4D5KA 3MWUA 4PDYA 4EH9A 3NUXA 2QOFA 1IASA 5JZNA 5I9WA 4FZFB 1U5QA 5J7BA 1B39A 3AC1A 3Q5ZA 2UZWE 2ZDUA 3R8UA 3TNHA 4ALWA 5A46A 3FLSA 1Q62A 3W1FA 4K6ZA 4RJ7A 1K3AA 4U97A 1V0OA 3LM0A 4CV9A 4D4VA 4DBXA 4H58A 5AR8A 4JBPA 4I94A 4QP2A 4E4MA 3R6XA 4YHTA 3FWQA 2VWZA 3QCSA 2WEIA 4U3YA 3W16A 3N4VA 3BWFA 2BAKA 5BYYA 2VTIA 3F3TA 2OIDA 3F9NA 2XK3A 4EOQA 4BCPA 2YHVA 4DCEA 4QP4A 1QPJA 2VWYA 1IA8A 1SYKA 2CJMA 2W1DA 5DFPA 4RX5A 2PU8A 4Q9ZA 4ORKA 2BILB 4YJRA 2B55A 3BHVA 2XIXA 3TEIA 3U6IA 1WVXA 3W18A 3DBFA 4S33A 1U54A 3FI2A 4IW0A 3QXPA 2WU7A 4MAOA 2GPHA 2IF8A 4CYIA 4EKLA 5CXZA 2VGPA 3BQCA 3NAYA 3MIAA 5CAQA 5IEXA 4DTAA 3O8UA 4H1MA 5HU3A 3PVUA 2CN8A 4LMUA 4QOXA 4ACCA 5KKRC 5EOLA 5HLWA 4JMQA 1KSWA 1WZYA 3ANRA 2QOQA 4JX3A 4OBOA 3NFGB 4ARKA 3BKBA 2BROA 3CS9A 4D55A 4OTQA 5ETIA 3ZDIA 1FVRA 5HX8A 3LMGA 2YIWA 3ZO3A 4L3JA 4GV1A 3UQGA 5CS6A 3EN5A 4EJNA 1DAYA 2XBAA 3BEGA 2YCFA 5LVOA 4ASEA 3CXWA 1OM1A 4KUJA 5AMNA 3PA4A 2OWBA 2W06A 3GU5A 3MIYA 4M8TA 2XJ1A 1QCFA 2BTSA 4BIDA 3QRIA 3QL8A 4DCAA 2EWAA 2HZNA 3H9RA 3LIJA 3MVJA 4KABA 5DLSA 3I81A 4ZJJA 3RMFA 3THBA 3VO3A 2AQXA 3IW8A 4EH5A 1PMUA 5HU9A 4E1ZA 5DT4A 3PUFC 3PY3A 4Y46A 5ANDA 5CEIA 4W9WA 2RSVA 3EJ1A 4OT5A 4I5PA 3BWJA 4I6FA 4ITIA 2ZV9A 4DEDA 4FIEA 2JAVA 3U4UA 4XBUA 4G6NA 2G2HA 2HOGA 4E4LA 5IA2A 4WRGA 1H00A 1OBGA 3ZFMA 4L00A 3PRIA 3NYXA 2WQEA 4BY9E 2RF9A 3BEAA 5CALA 4BDCA 5DWRA 4QTDA 3K3IA 1U46A 1WVYA 4IVCA 2RGPA 2WIPA 3OXZA 3PJ1A 3QCYA 2Q83A 2YWVA 3P7AA 3EKNA 3I60A 4ZLYA 5BQ0A 2OIQA 1GJOA 2VTOA 2W1HA 3U8WA 4CCBA 3DDPA 5CXHA 3PJ3A 4EOPA 1UU3A 3LXNA 4AAYA 3DCVA 5HIDA 4FKJA 3I5ZA 2WQBA 3W55A 4DFZE 4YR8A 4BCOA 4FC0A 4BTKA 4O7VA 5FP5A 3LCDA 4BDHA 3KEXA 3EFJA 2XK9A 4FK3A 4FTUA 5F95A 4DFYA 5CU0A 3C4WA 4PF4A 4U80A 3RJCA 3WOWA 1KOBA 3RPOA 2ZJWA 1UVRA 3HYHA 4IM2A 4L67A 1Q24A 4ANBA 4B8LA 1G8SA 5ANJA 2R3LA 3BPRA 4BCKA 4CFXA 4EQUA 3OTUA 4WO5A 5CI7A 1W83A 2ITUA 2C3JA 2YM7A 3W10A 4NJ3A 2WPAA 4Z16A 4IZ7A 1H24A 4EK6A 3VS0A 4ZMEA 4BJJB 4D9TA 3BLQA 2EB3A 3ORXA 4G34A 2I6LA 3FBVA 3TNIA 3PXRA 3QC9A 4R3RA 4M97A 4GFGA 3EQHA 5A3XA 5FD2A 1O6KA 2Y6MA 3MVHA 4FZ7A 3OOMA 3TV6A 1DI8A 3O17A 3JYAA 5AR2A 4CNHA 1O9UA 4B7TA 3T9IA 3LOKA 3EOCA 3QQLA 4ONAA 2ITOA 4BCJA 2H8HA 4A7CA 1ZARA 4L8MA 4F9AA 2V7OA 2C69A 4FTTA 5LVPA 3OZ6A 4K18A 5IF1A 3O8PA 2BRNA 3LZBA 4O22A 4ZTHA 3BHUA 2A0CX 3EYGA 2YJRA 2WD1A 3U55A 2V62A 2ZM1A 2XAOA 3FC2A 2YAKA 4UEUA 4S31A 5FTOA 1FMOE 2ERKA 3MTLA 4HW7A 3AMYA 2X1NA 2Z7QA 3D83A 1SVGA 4FV8A 2PVHA 4YPDA 4ZJVA 3WZJA 2E9PA 3U6HA 5C4LA 3JS2A 2X0GA 4BC6A 5FXRA 3RZFA 4QMQA 4FICA 5CF5A 2WTIA 5AUWA 3RPVA 3C4FA 5LQFA 5ITAA 5JKGA 3NCZA 4WD5A 3FMNA 4FV1A 4XP3A 4PMPA 2GU8A 4Y8DA 3LFBA 4EONA 5KX8A 5CVHA 2WB8A 5DGZA 3QZIA 1M2QA 2J0MB 4HYHA 4JLCA 4RA5A 3VBQA 4U3ZA 4TYJA 3AKKA 4RVTA 2AYPA 4FSUA 4F65A 3EWHA 4HYSA 2XANA 5GZ9A 4BHNA 4QP6A 2BZKB 3DK3A 4IVDA 4BVUA 2XNGA 2BZJA 3Q4UA 2OFVA 3DQXA 3F7WA 4R1VA 4UXQA 5CNNA 2QOLA 3RWQA 4EQMA 4CFVA 4BDBA 3GBZA 3HV3A 3F6XA 2YCQA 4WUNA 2XBJA 2GCDA 4UZDA 3W0QA 3OBGA 3OWPA 2XA4A 2JAMA 2G2FA 4DEGA 4FUYA 5BVEA 4RX9A 2H34A 4W4YA 2GNFA 3TTJA 4ACGA 3ZU7A 1G8JA 3FZ1A 4FEWA 2VTHA 3HP5A 2UVXA 5AM6A 1RW8A 4CZTA 2PY3A 3II5A 3MFTA 4W9XA 4C57A 5IDNA 3T3VA 4ANSA 3RAWA 4RT7A 2X6DA 1HOWA 4BTFA 3D7TA 3VS4A 3MA3A 4AG8A 2R2PA 4O0SA 5GHVA 2ITZA 4YO6A 5F94A 5CLPA 4C34A 4O81A 1UNHA 2CMWA 3R7EA 4FL1A 3P08A 4FV9A 4PL4A 1UWHA 4GH2A 3RPSA 4DH7A 2OFUA 3T9TA 4DFXE 5I0BA 2XKCA 4JDIA 5A54A 2QU6A 3CJFA 4O21A 3FQSA 1KE7A 3O0GA 5DT0A 1YXVA 4UMUA 2C3LA 3IW7A 3F7ZA 1PY5A 2RFNA 3DY7A 2QR8A 3P86A 4L7FA 4O96A 1NY3A 4CKIA 4QMMA 2A4LA 2QR7A 5CZIA 3R8ZA 3HLLA 2R3OA 4DITA 5L2WA 4W4WA 5JH6A 4IANA 4DFUA 3EQRA 2XJ0A 3E8CA 5FBNC 1A48A 2XARA 5GINE 3AG9A 2ITXA 5CWZA 3FDNA 3E8NA 4HOKA 3ZMMA 3V8WA 5CAPA 4IQ6A 4G9CA 1H1QA 4GMYA 3G2FA 4O0TA 4D5HA 3HA6A 3PTGA 3SHEA 4IAFA 4XG2A 2HAKA 4O7TA 3KIOC 2HXQA 4FT3A 5LCJA 4DHZA 3PG3A 2Q0BA 3FHRA 3MTFA 3A60A 4HCUA 2XS0A 5AV3A 3TT0A 3COMA 3R28A 2XKEA 4I5CA 1SNUA 2BDFA 4J52A 5LCKA 4F1TA 4AOJA 4RFYA 2XKDA 3BRBA 3OP5A 2ACXA 5H9BA 5JQ5A 4RWLA 4DHJA 2VTQA 5K3YA 2HZIA 3OY1A 2VV9A 4GVAA 2RFEA 2W1ZA 2QOOA 2ZM4A 3FE3A 3FZPA 1Q8TA 3R1NA 1CKIA 4H3QA 5FXSA 3V04A 2BIYA 4OT6A 3OOGA 1OIYA 3NIEA 5AX9A 4FKSA 1OZ1A 3D4QA 3PJCA 4M84A 4P5QA 4NTSA 4K9YA 5EI6A 3PY0A 3R7GA 4YLKA 3PXYA 5HI2A 4QQCA 1BX6A 3H4JA 2YCRA 3F5UA 2OIBA 2IZUA 2R7BA 2B1PA 1L3RE 4JG6A 3FI3A 4OTIA 5H8GA 4ALUA 3ZSHA 4NJDA 4A9TA 4CCUA 4F7LA 2QQ7A 1ST4A 1DI9A 1H1WA 4E6AA 2W0JA 2XZSA 2WEVA 3HRFA 4GW8A 3TJDA 4BKJA 1H25A 3R2YA 3ZZWA 5HTBA 2FO0A 2IVUA 3ALOA 2PVMA 4TRLA 1GY3A 2BMCA 4YBJA 3E64A 2LGCA 3LHJA 4NWMA 2WGJA 3Q4CA 4BDAA 2G1TA 3R1SA 5BUJA 4LI5A 4NTTA 1PXKA 2XNBA 4MXXA 3VS6A 3ZZEA 3EQGA 4BRXA 2Q0NA 3G51A 2BIKB 4ZTQA 5IU2A 3CY2A 1F3MC 1PHKA 5G1XA 4GU6A 2F49A 3CD3A 3ZONA 1KE9A 3F3ZA 4O7ZA 3R2BA 4I21A 1OB3A 3EKKA 4I0TA 4IM3A 5HG8A 3SD0A 2WU6A 1J1BA 4L3PA 4FTNA 2QCSA 4FKOA 4M3QA 4Z55A 3G15A 2X4FA 1PXPA 2P2IA 2ZV8A 4TYEA 4TWPA 5E4HA 1OUYA 3FHIA 3OS3A 3JUHA 2IW9A 3A61A 2C68A 4MXYA 4U45A 3E93A 3R1YA 2UW3A 4R77A 3IECA 4C2WA 4EK8A 1YRPA 3GP0A 4R5YA 3ZRLA 3TMOA 3TXOA 3R30A 3DK7A 4PNIA 5D1JA 4MWIA 3A2CA 5LARA 4I24A 2Y8OA 1YOLA 3LXKA 3W2CA 3VUMA 3HL7A 2C6TA 3LCSA 3QQHA 4IB5A 3WF8A 4BI1A 4TT7A 4EH4A 4F6WA 3RM6A 2BKKA 4AA4A 3D15A 4C02A 5ANKA 5CEOA 5HHWA 1ST0A 2GHGA 2VTAA 3R00A 4QPMA 4AGCA 4PTGA 2FSMX 4FTMA 2GQSA 1UV5A 1R0EA 3Q32A 2W4JA 5HO8A 4EK3A 1F5QA 2YDKA 3DZOA 3M42A 3NUSA 4HYUA 4RIWA 5DT3A 4DG3E 4DYMA 3R9NA 3OT8A 4A9UA 4C36A 3KY2A 4IWQA 2PE1A 3LM5A 5HTCA 1TKIA 4DC2A 4FIFA 2W5HA 3FQEA 4N4SA 4MNFA 1H28A 4X3FC 1O6YA 4BGQA 4YJNA 3DKCA 3OCGA 5I4NA 4F1MA 2RIOA 2XK6A 4PP9A 4V04A 4O82A 5AJQA 4RIXA 3MGYA 4TYHB 4I6LA 4EHZA 3MN3A 4OBQA 4C35A 4C2VA 3PE2A 1Y6BA 3PP1A 4EOLA 4J95A 5E1EA 3G9NA 1A9UA 1YI6A 4I0RA 4J98A 5IKWA 5M4IA 3FLNC 1KE8A 5TR6A 3V5PA 3U6JA 2XIYA 2XK7A 3P7BA 2O8YA 4KRDA 5M07A 4WSYA 3LLAA 1VLRA 4U40A 5CVFA 2JBOA 4AQCA 1ZOEA 5CSWA 2VN9A 2YIRA 4EHVA 5JN2A 4IVAA 4UN0C 5HE0A 3GCQA 3TACA 2P55A 2OXYA 4M0YA 2XAMA 4M7IA 3DBDA 4YTCA 2P4IA 3D5XA 3EN7A 3QAME 4IX6A 3UE4A 1LPUA 5DRBA 4D2PA 4IFCA 5JGDA 2RG6A 4W4XA 5AP6A 3W8LA 3P5KA 5AWMA 2IVSA 2XNNA 2PZRA 1H0VA 2WOUA 2G01A 4LUEA 4DFLA 3KCFA 3QTZA 3ZUTA 5HX6A 2QKRA 2E2BA 1Q8ZA 2JDSA 3KRLA 1W98A 4Q5HA 3R8PA 4M15A 3VUKA 4TYHA 5C03A 3QTSA 4YO4A 4QPAA 1ZOGA 2XJ2A 3A8XA 3OEZA 3FL4A 3ORTA 2O64A 4JT3A 4R3CA 4F99A 2OJJA 4TL0A 2VUWA 4AFJA 3PWDA 2OZOA 4RJ8A 4JAIA 3FKLA 2OJIA 4CFFA 3F61A 1PXJA 2WQOA 5IMEA 2A1AB 5FRIA 5JGBA 2YWPA 2YZLA 5LWMA 2YCSA 3T3UA 2VWUA 5KMKA 5TF9A 4IM0A 4O0RA 2GNGA 2VNWA 3FEGA 1UU8A 3DA6A 4FTKA 2RFSA 2WTJA 4O0XA 4FKVA 2BRBA 2C5XA 1OL6A 3GQIA 4ALVA 5C01A 3QKMA 2ONLC 5AFVA 3KMWA 2QLQA 2I0EA 4AGDA 5BNJA 4JG8A 1K2PA 5AP2A 3BLRA 2ZV7A 1S9IA 4IZ5A 3R9DA 3VRZA 2E9VA 3GFEA 3JXWA 2VRXA 2OICA 3TL8A 2CCHA 1KV1A 3ULZA 1REKA 5I9VA 3LLTA 3V5WA 1BL7A 2WMVA 4BWPA 4FEQA 3QF9A 3ZHPC 3QX2A 3V8TA 1MP8A 2UZBA 3E5AA 4UYAA 3VF8A 3HV7A 3RM7A 5AUUA 3ZLWA 5IMXA 4OTRA 4UXLA 5LJJA 1XKKA 4UWYA 3Q04A 4ASXA 4AZFA 2BZIB 1OIRA 5IH4A 1UWJA 2C1BA 3R22A 4IC8A 1I44A 2ZMCA 3TDWA 5GZ8A 1GAGA 2PVRA 5M4FA 3CKWA 3IDBA 4TPTA 5L3AA 3PPKA 2YM4A 4H39A 3U87A 3C7QA 3CP9A 4GS6A 2QNJA 3RVGA 4C37A 4G3GA 3NW6A 1I09A 2FH9A 3M11A 5EI2A 3NR9A 3KU2A 1URWA 5FTGA 1KV2A 1P2AA 4WHZA 2NO3A 5HE3A 4GK2A 4JIAA 1XBAA 5JZJA 3ACJA 3E8DA 4DINA 5HKMA 5BV3A 2QO2A 1H1RA 2V5QA 1OKYA 1M7NA 5C8MA 1U54B 2C6MA 3QYZA 5M06A 5J9ZA 3ZRMA 5HO7A 1XR1A 1WBOA 4FTAA 3RWPA 4QYEA 2PUPA 1Q61A 4FZAB 3FXXA 3LAUA 5G6VA 3L9LA 5JRSA 4O83A 5AUVA 3UIBA 3MH0A 5KUPA 2EVAA 2DWBA 3LXPA 1OMWA 4DFBA 4D4YA 3I0OA 4QMSA 1PKGA 4YJSA 5J79A 3NX8A 3OC1A 3OY3A 4LFIA 3E92A 3EYHA 2R3GA 3E8EA 4N57A 1WCCA 2XM9A 4TTHB 4J96A 5L8LA 4FIHA 4WBOA 4EZ7A 1VR2A 3C1XA 5KBRA 2QOHA 3HKOA 4CFWA 2WO6A 3NNXA 3ORNA 5K5NA 3RCJA 3DQWA 4A07A 3KN5A 3FMLA 4UZHA 5JSMA 4EC9A 3DJ7A 4BDDA 5KO1A 4LL5A 4D58A 1QPDA 1Q5KA 4CMOA 4N6YA 1B6CB 5IQDA 5ETCA 4LGDA 3VQUA 3UPZA 3ZM9A 5C4KA 3VBXA 3RZBA 3WI6A 3C4ZA 1ZAOA 1M2RA 4A9SA 4FX3A 4X6QC 2EXEA 3GU8A 5D9HA 4FKPA 3HV4A 2YLFA 4X3FA 3ZFXA 4YU2A 3KXMA 3NVMB 5KZIA 2EXCX 1NXKA 3BIZA 5DH3A 1Z9XA 4RZWA 4HCVA 2GTMA 2UW0A 3HV6A 4R6VA 4GKIA 4C7TA 2HYYA 2R3FA 5CENA 5L4QA 4TNBA 2C6OA 1LEZA 4QMNA 4XBRA 4C33A 5EH0A 4W8DA 3FV8A 5HCXA 5C27A 1ZMVA 4YC3A 3D7TB 3S3IA 4FOBA 3U51A 1XH4A 2JIUA 1P4OA 3WF7A 3QQUA 4AW0A 3BE9A 3MPMA 4QMLA 5CEQA 5HVJA 4F7SA 4FSTA 4GUEA 4BZDA 2UW6A 3ZO4A 3CQWA 3ZUUA 3ZH8A 3QQKA 3CTJA 1UU7A 4P4CA 4BBMA 3ENMA 3TM0A 4GJ2A 4JDKA 4BYJA 1U4DA 2PMLX 4LRMA 4FJVA 4CEGA 4PMMA 5AV2A 1JQHA 4WG3A 4GG5A 3TTIA 3UOHA 5FUTA 3HAMA 5LXMA 3L1SA 3NDMA 3SW7A 1ZY5A 3C5UA 3FKOA 3GT8A 3QD4A 3IK3A 3WIKA 1SM2A 3L8VA 2NNWB 1Y6AA 3UOLA 1NT2A 5L8JA 4QMZA 4AF3A 3UP7A 2R3QA 3W0NA 4MF1A 4TZRA 5AR4A 3QWKA 5HCYA 4DTKA 3PSDA 4F0IA 4LQMA 4ZSLA 3E3BX 4NCTC 4USFA 4FGRA 1R39A 4IADA 5TOZA 3C4XA 1URCA 2WMXA 3CTQA 4RFZA 4MBJA 4GL9A 4OTDA 4AOTA 5CI6A 3R9RA 1J1CA 4L6QA 4A4LA 2JEDA 2YISA 3DDQA 4MHAA 3D5UA 3PSCA 3QCXA 3LFDA 3HDMA 3HECA 4XV2A 4F9BA 1W84A 2WTWA 3UDTA 2WMAA 4NM0A 1TQPA 3MJ1A 2XK4A 2O63A 4WSQA 5M08A 3KF4A 2OGVA 2R3MA 2R9SA 4LMNA 3SW4A 4O84A 3B2TA 4GT3A 3TYKA 4L3LA 1VJYA 5I3OA 1P5EA 3A7IA 3EN4A 5D7AA 5EYKA 3D14A 2BVAA 3BV2A 3KXHA 3R73A 1UU9A 4AGWA 2ESMA 4FBXA 2WQNA 4KIPA 4MBIA 4PPAA 4MXZA 3VBWA 4BB4A 4AW2A 4Y5QA 2X8IA 3R7IA 3RK7A 4AZWA 1GZNA 3LQ8A 3NYOA 3REPA 4FSQA 4UMTA 2J6MA 5D11A 4NM7A 4DA5A 4FV4A 1ZYJA 1TVOA 2SRCA 3IO7A 4RIWB 4RX7A 2A19B 3ATSA 3PPJA 3QU0A 1YI3A 1ZLTA 2Z2WA 3DNEA 4YJOA 4AN2A 4APCA 4BJJA 4XP2A 4XUFA 3R7UA 2PYWA 1WBWA 2PE2A 4AQKA 4F7JA 4U41A 2HZ4A 3VS1A 3SX9A 4C3RA 4IX5A 3GEQA 2WMWA 5F4NA 3S2PA 1J7UA 3U9NA 4EL9A 2JDRA 4ANNA 1Q8WA 3CE3A 3VJNA 3LKMA 3FMJA 4WNKA 3VVHA 4BN1A 4E7WA 3L9NA 3QD2B 3TZMA 4QYHA 4AXFA 4HZRA 4GRBA 1ZXEA 4KBCA 5LMBA 2O65A 4HGSA 3S1HA 2XUUA 3DLSA 2VO3A 3EFKA 4ZJIA 2IN6A 2QG7A 3UDBA 3DJ6A 4I6HA 1FQ1B 5IQAA 4O0UA 1Q97A 3B8QA 4U42A 5FLFA 3W32A 1L8TA 3V01A 3VIDA 2JBPA 3CR0A 3IDPA 5AADA 3BGZA 4OTGA 2QODA 3EQPA 2C5VA 4G17A 3I4BA 3KMMA 4NM3A 5CT7A 4RC2A 3WYXA 2C5OA 4LDTA 5B0XA 2HW6A 4BGGA 2GS2A 4BICA 1OL7A 1XMLA 4P5ZA 4YSMA 2UUEA 3R0TA 4MH7A 4DLIA 2IZTA 3KL8A 3MFRA 3KC3A 4FT7A 2EU9A 4FSMA 5HGIA 3LQ5A 4F70A 5CASA 4QQTA 2XP2A 2BCJA 2J4ZA 5DEWA 3Q9XA 3ZFYA 1MRVA 2C0OA 3N4TA 3RHXA 3KRXA 2XCKA 5BVNA 4DTBA 2E9UA 5J95A 4DH5A 4L53A 4DE4A 4AZTA 5CNOA 5E92A 1R3CA 4PMTA 1F0QA 1E1VA 2QD9A 4NM5A 4XNEA 5IA1A 4IMYA 3F88A 5IQFA 4QP9A 4ACDA 2X8DA 4RC3A 4MX9A 2C47A 3KF7A 4CGAA 3TIZA 3QYWA 2ERZE 2HXLA 1A06A 2XNEA 2W1IA 4GT5A 4GYGA 5JFVA 2CPKE 3HVCA 1R0PA 4NW6A 2W7XA 4YLLA 2OJFE 4FRFA 4NU1A 5AAGA 4QRCA 3NUAA 3OUKA 4HVHA 4IX3A 3MA6A 2CGWA 2W99B 3MFUA 1CDKA 4BFMA 1H08A 2UZOA 3OMVA 3AOXA 3EHAA 3DS6A 3RPYA 2HELA 4PRJA 5ACKA 3DFCB 4NCTA 4FEXA 3UG2A 4X6RA 5E7RA 3P4KA 4DEBA 3ZO2A 4YZNA 4G3DA 4O2ZA 4DLJA 1ERKA 1CSNA 1Q99A 4KIQA 5D7VA 3WARA 3ZBFA 4DFNA 3JPVA 5AUXA 4O27B 5HESA 3PXKA 2EUFB 3NSZA 4BCMA 2B9JA 2VO7A 3ZS5A 4YPSA 1UKIA 3PXFA 3QTUA 4S2ZA 5L2QA 3ZXZA 1PXIA 5IEVA 3BU3A 4F9YA 4FNWA 2OSCA 4JVGA 3MVLA 3CPCA 3EQIA 4D2VA 4IHPA 4EOJA 4UY9A 5HNBA 4GU9A 4WT6A 4ZSEA 5HBJA 4HNFA 2R5TA 2OH0E 3UVRA 3AXWA 3RAKA 5CEPA 4MUQA 4FG8A 2ZM3A 4QQ5A 3OVVA 1OI9A 3F82A 1BMKA 2WMSA 3GCUA 4YC6A 3PYYA 3FZTA 4X2JA 3W0PA 5GIPE 2WELA 2CCIA 2VWXA 4TN6A 1BI7A 3NUPA 1BI8A 4FNZA 4R3PA 3UIXA 3VAPA <