5F21A

Human cd38 in complex with nanobody mu375
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
252
structure length
248
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
total genus 83
structure length 248
sequence length 252
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f21A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f21A02
1ZK3A 4W9NC 1E5LA 2WM3A 4K9DA 3DBHB 3TFOA 4AFNA 5IN4A 1P74A 2HCTA 4UULA 2FMUA 1X7GA 1M75A 3Q6IA 3RUHA 4WNIA 1UP6A 4IDCA 5A5EA 3PGJA 1ADBA 1YQXA 3E9QA 4PLPA 4EITA 2EEZA 5CDYA 1R0SA 2YHIA 3JQ7A 1E1KA 3D7LA 3RBVA 4UVEA 1YBVA 2VHWA 3ICCA 1G0OA 3E1KA 4XDZA 3TN7A 3BTSA 4FR5A 4BMVA 3JQ7B 5TLSA 5FYDA 5BNFA 4IJUA 5MGBA 1PWXA 1S6YA 1GADO 4NBRA 1O94A 3GLQA 2GGSA 1NPYA 2WD8A 2ZATA 3E9NA 1IY8A 1I32A 3EDMA 4DQUA 1NBOA 4JXKA 4GI2A 1KVSA 2W2LA 1CIVA 2FHSA 3TWOA 1UJMA 4AICA 1I33A 5A5FA 5DCWA 3D3WB 3JD0A 1KYQA 5HA5A 2OP1A 1XU9A 2OBYA 5EMHA 3TZQA 1DIGA 2O4CA 5IF3A 2W98A 4PVCA 1O5IA 2JD2A 1U28A 1SOVA 4BVAA 4E33A 5L40A 4XD2A 3ZWPA 4TVBA 4E3ZA 2VUTA 1ZO8A 5A4DA 4EJ6A 1W8DA 4O59O 1JKFA 4D7AA 1BRMA 1PJQA 4Z9FA 5KJ6A 3NTQA 4IS2A 3WGOA 1J49A 1LU9A 1SNYA 4DYVA 4IDFA 5JSFA 3GEDA 1HLDA 3BTOA 1NWHA 3LYLA 2WE8A 1I8TA 1H6AA 5ICMA 2VNSA 1IOLA 2DQ4A 2O7SA 2IZ1A 3IKVA 4J9UE 4UVHA 4JK3A 1NXQA 8ADHA 3WWZA 2PKRA 1EQ2A 5TT1A 4EJMA 1EMDA 2A35A 3VPSA 2O4UX 1OI7A 1OC4A 2DPGA 1HXHA 5TJ9A 1WAMA 2WD7A 3ZU5A 4BNYA 3RFXA 4PZEA 4WLEA 1IUKA 1DIAA 5KIAA 2YYYA 5ITWA 3DHYA 1Y5RA 2LDXA 3QWAA 2VRCA 4R1TA 1EVZA 4BO1A 1NFFA 1G0NA 3GRPA 4WE3A 4Z0PA 1RWBA 1XEAA 3C8MA 3MJSA 4M55A 4PZCA 3AU9A 1A72A 3T4EA 4BS9A 4ZQBA 3NDJA 1NX6A 1LDMA 4EEXA 4WOKA 2NV6A 3G0OA 4GSKA 3KSDO 5KTKA 3MJEA 1GUFA 9LDTA 2C07A 5C37A 1EEHA 3L6DA 4JCOA 1DSSG 3WSVA 1M67A 4ZU3A 4B4VA 1TXGA 5KJFA 1LQTA 1ZXBA 5TIIA 2JFHA 4U0KA 5TGDA 3N7UA 5GY7A 1O8CA 4PLYA 3GVCA 2EHDA 3AFNA 3DAFA 3R0IA 1KBZA 5H81A 3WX0A 4YAIA 3E48A 4XQEA 2DM6A 1DC4A 1G1AA 5JPIA 2PH3A 2I65A 3CKYA 4IJKA 4PG8A 4BO7A 1GZ4A 1P9LA 1ADFA 4YR9A 3D64A 5CPFA 2GD1O 1C0IA 5KNLA 2VOEA 1P1IA 2CDAA 2VWPA 5F5LA 1DIHA 3M6IA 5LC1A 1DOHA 5JLAA 2SCUA 1QLHA 3KEQA 3KETA 5B37A 1Y7TA 4HWKA 5FF9A 4R1SA 3BYZA 3IL2A 1WZEA 3I5MA 1I3KA 1VM6A 1I36A 3V1UA 2BLLA 1EFLA 2PTGA 1OBFO 4I8XA 4BNGA 4R5HA 1WMBA 3RAJA 2J3HA 3X2EA 5KJCA 4XGIA 4N5NA 4YDRA 4RF3A 1ZH8A 3K31A 2C0CA 2B4TO 4R41A 3UFXA 4E2WA 3HB4X 1F8GA 2EIHA 2F1KA 3A06A 5FI3A 4PG4A 3HSKA 5KVVA 3PI7A 4DYDA 3RI3A 3OICA 3GZNA 4FSHA 3WIEA 1Z75A 1NP3A 4B4OA 3FPCA 1NHGA 3KYDB 3H9EO 4H7PA 4JJIA 3HDYA 4Q3DA 4B79A 5IFLA 2NQTA 2E49A 3AU8A 1CDOA 2BRUA 4PLTA 1B16A 1EBUA 2IYPA 4UVDA 4IGFA 4YRDA 3Q0EA 5A3VA 3NDIA 3F3SA 4HBGA 3ZHBA 4CODB 1MB4A 4XJTA 3DBRB 2HK8A 1IPEA 1VPDA 5DCUA 1XKQA 1GV0A 3KM0A 4L76A 4CR8A 4EJ0A 3WBBA 1YXMA 5CP8A 1H94A 3CH6A 3DBRA 5HS6A 4Z6KA 5JCXA 3GY0A 5G0VA 5AOVA 1GQQA 4YWJA 3RKRA 3DMTA 4LSMA 4QXMA 5MDHA 2B0JA 1ONNA 3JV7A 3EHEA 3RU9A 3AJRA 1NNUA 4BNXA 2FSVA 3DBLB 5ILOA 3WIDA 4PFJA 3GN1A 4J9VA 1X7HA 3ZU4A 2OZPA 2XXJA 5CPBA 2X0JA 3GQVA 4L75A 2O2YA 3LSYA 1ID1A 1I10A 2D1YA 3C1AA 2RCYA 3DWFA 5DZSA 3WGTA 4KUGA 1DJQA 2V6FA 1R16A 1X1EA 5JO0A 4ONEA 1C1DA 1XGKA 1M76A 2ZCVA 4XB2A 1LBEA 2NU7A 3QW2A 2FY8A 4CM9D 3KSUA 1TB4A 3PIDA 4KQWA 3HDJA 2IEDA 2PZJA 1C1DB 1B8UA 2WE7A 2EJWA 1AUPA 4I5FA 1CYDA 1LSUA 3JQAA 5C7LO 1BVRA 3TZHA 3E8XA 3P5SA 4J7CA 3K2BA 2Q46A 2ZKLA 3C7CB 2UV8A 1KY4A 3JQ8B 3FNFA 2ZCUA 3A28A 3GF4A 3VVBA 7ADHA 1ENZA 2NSDA 3VKVA 4OHUA 4J0EA 2X22A 2Q2QA 3Q1LA 4DQXA 1C0PA 2NTJA 5JC1A 4YVFA 4MVJH 1HL3A 4ILKA 1QP8A 1HE2A 3D4OA 4U5QA 3BHMA 1FDVA 4MVJA 5TRTA 4ZHSA 3VH3A 4I08A 5IDXA 3COSA 4YA6A 4QO7A 3O38A 4MVJD 4UUMA 1FMCA 2DKNA 4IXTA 3FCOA 3C7AA 4PRKA 3SVTA 2Q3EA 5AXAA 1PR9A 1N1EA 4ESOA 3CZMA 2YDYA 2EG9A 3ADOA 1U3WA 3ST7A 4FJ1A 4MIEA 2X23A 4JP3A 3G1UA 3NAQA 4HADA 5I7VA 2AHRA 1M6WA 1VSUA 1BDBA 3ZWMA 4M54A 4JNKA 4U7WA 3LF2A 3F1KA 4ND2A 5G2OA 1ISHA 1CJCA 3VH4A 4EBFA 1E3JA 2HMVA 4J91A 1JKIA 4FFOA 4B7CA 5CEEA 1MG0A 2EGGA 2X5OA 2ZB3A 4Z9YA 3DFZA 2Q50A 1RM3A 1UZLA 2OL4A 3CEAA 1SPXA 1Y1PA 1IZ0A 2BKAA 3LC2O 1PGQA 1I24A 1HDRA 1EDZA 1KVUA 3IUSA 3OP4A 3RASA 2CVQA 4KTVE 2UUPA 3QRWA 5DN9A 2G1UA 2PY6A 4E2ZA 2JL1A 2TMGA 4R9RA 4ALJA 4E4YA 3PWSA 5ER6A 2ZYAA 1F12A 4Y6SA 2VYNA 4TWRA 4WLVA 4LCEA 4B3IA 3GG2A 3A14A 4EGFA 3FI9A 1T4DA 3GH3A 1V3VA 5EN4A 3BMQB 2EERA 4NJMA 3KYCB 2J3IA 4ALKA 2GN4A 4BNJA 4I1IA 4LSWA 4N5MA 2EXXA 2DC1A 3FR7A 1PJ2A 1YO6A 3S2IA 3ANLA 4M89A 1Y8RA 3RUCA 1PU2A 1VL6A 1P0FA 1TT5B 3F9IA 3EZYA 5K9ZA 3QP9A 1A9ZA 3D3WA 4XA8A 3RJ5A 4QECA 5EIOA 4NQZA 4DIBA 4E5KA 1V3UA 1GYPA 1O89A 1W0CA 3TF5A 2Q49A 5L4NA 4D3FA 2I9PA 2H9IA 2PD4A 2QX7A 3OA0A 4NFHA 3WQQA 4EI2A 1JAXA 1ONOA 1ISMA 3P7MA 4QO8A 1XIVA 4ZD6A 2NU9A 3EY4A 2X4GA 4YT4A 3I1JA 3S55A 1LRLA 2Q1UA 2YZ7A 4FCCA 1K89A 2P9GA 2Y99A 2AW5A 1E1MA 1K6JA 3KEOA 4NZ9A 2Q1WA 2Y1OA 4Z9XA 5IZ4A 1Z74A 3WICA 2WJPA 3CPSA 1Q0QA 4OXNA 2P9CA 4P4LA 3DB2A 5IG2A 2Q99A 4CMIA 1HEUA 3KOUA 5CDTA 2HMWA 3PFWO 2VHZA 3I9OA 3B6ZA 4K26A 4WKGA 2CF6A 4DMMA 3NEPX 3RSHA 3E18A 5DP2A 2AE2A 3GPIA 4E5NA 1TT5A 1EUZA 1K5HA 1QYXA 4GPD1 3W4KA 1PIWA 5TF4A 4G5HA 4F46A 1GYRA 3KLMX 1F14A 1OAAA 2HMTA 4DLAA 5IDWA 4R68A 1GL3A 3K5PA 3KBOA 1PS9A 1DB3A 1LA2A 4TKLA 2C82A 1E6UA 4W6ZA 5THQA 4M87A 4W9NA 3I4CA 4TQGA 2GYYA 2Y0EA 3OETA 4AVYA 2D8AA 4A10A 2GRAA 4ZRNA 3RQSA 4L73A 5JO9A 4J7UA 3SX2A 5IZCC 4PVDA 4BNIA 1SAYA 5C7IO 4QTZA 1RYDA 1EDOA 3C1TA 4CL8A 2EV9A 3QY9A 1U5AA 1WLYA 1CETA 1HDYA 4PGFA 4AJHA 5IJZA 1JLLA 4HUJA 3PLNA 4MIOA 3M1AA 3B1KA 3E6AA 3INGA 3FF4A 3STHA 5K6AC 1HDZA 4OMUA 3JQ6A 1YJ8A 2DBRA 4BGVA 1UXHA 2QRJA 1UDCA 3NTOA 2R2GA 2W2KB 1E7WA 3PHHA 5DBIA 3T7EA 3OBBA 4MP6A 5BT9A 2EF1A 4WCDA 3S2GA 1PGNA 3PPIA 3HDHA 4K28A 4CMKA 2WMDA 1VC2A 1Y8QA 2QQ5A 1UDAA 5F1OA 1Q7GA 3KYDA 4DA9A 1QLJA 2O2SA 2P4HX 4ND4A 1LLCA 2WYUA 4NBTA 2C29D 4E30A 1ZEJA 4YQZA 1PJ4A 3AUSA 3EZLA 3HNPA 3TL2A 4LCJA 4NBVA 2VHYA 2B35A 2EGHA 4EUEA 2OXIA 3QJ5A 3O4RA 2NU8A 3VHRA 1VJTA 4DREA 3NGLA 2VN8A 3OIGA 3OMLA 3ZNNA 4WOJA 5BSFA 1QYVA 2OUIA 3Q2IA 3M2TA 1O9BA 4DLLA 1YRLA 3WTBA 4MKZA 5TQVA 3D0OA 1PS8A 5IN5A 3QWHA 4YT5A 3QE3A 1IZ9A 4JP2A 2ZK7A 4GGOA 2RH8A 3OJEA 2C20A 4TRJA 2O3UA 3HFGA 3MJCA 3E5RA 1T2FA 3KXDA 4OOEA 1LDYA 4IINA 4MVJI 3DMTC 4J90A 5A9RA 1J0XO 1BVUA 3HADA 4M8SA 4FC7A 1A4UA 2CUKA 2GO1A 5JYDA 3H9JA 5I7EA 3TZKA 2QYSA 3PJFA 3ZW9A 5JDCA 1U3VA 3MOGA 2EP5A 2PZMA 3AM4A 4OAQA 3WR5A 5BR7A 4RF5A 3VH1A 1PZEA 1KVQA 3GHYA 4J4TA 2YW9A 4A26A 4TZTA 2VWQA 3L4BA 5JAZA 1RM0A 1U8XX 5TC4A 1ZSNA 1XYGA 1O95A 4TRNA 1L1FA 1IB6A 2E82A 4JJGA 3V2HA 3MJVA 1LQUA 2QZZA 3WFJA 1NTOA 4KUEA 4CQMD 2DBQA 2Y0DA 4CV3A 4D79A 1QV6A 4NFSA 5KVCA 2V65A 1HT0A 2YQ5A 3SC4A 3VPXA 1JN0A 4E21A 1ISJA 4JLWA 4EDFA 1DFIA 1KEVA 4BNVA 5K6AA 4NMHA 3TJRA 3JQGB 4YBZA 4ZQHA 3UOGA 4E0BA 4BO9A 4PN3A 1YGYA 2P5UA 3ANNA 3BMNB 3A9WA 3FD8A 2ZTLA 1LXCA 3TQHA 4CV2A 5KJEA 3ZI0A 3AUTA 4BKRA 3K73O 3IP1A 3PGXA 3IDSA 2YHIB 3DZBA 4J7XA 3BMQA 1PJCA 3MCVA 4CLRA 4I9NA 4ZRMA 2IEBA 1LDBA 1JWBB 2NVUA 3WB9A 4XGNA 2QW8A 1TVEA 3B1FA 4GH5A 5EQFA 5CDSA 1U3TA 2IRWA 5JY6A 1MXFA 1HDGO 3BA1A 3HFSA 4UVGA 2BFAA 3ZWYA 2X58A 1PJLA 4CV0A 3KVOA 2NTNA 1UUFA 3RC1A 1CQIA 3GZNB 1ISIA 2BFOA 3PIIA 1T1RA 4CM7A 1CQJA 1FDUA 3M2PA 2D5CA 4WEQA 5CHEA 2EKLA 1EK5A 3GHHA 4LW8A 5ITVA 3CUKA 4IZIA 5C7OO 2FWMX 1ENOA 4A73A 3EGOA 1BXGB 2X8LA 4ND3A 2D59A 1AE1A 1A9YA 1DAOA 3KSZO 5T5QA 3H9QA 3QLJA 4DRYA 6LDHA 4IDDA 5AYVA 3S2EA 4CLHA 1T2EA 3LT0A 2CVOA 1RM4A 1LRKA 4J6FA 3GDGA 3HWRA 2X9VA 5ES3A 2BELA 4I9HA 5COQA 1MLDA 5DOVA 4RVGA 4XCVA 3VTFA 4Z3DA 3GVPA 3GT0A 1K6IA 1I30A 4INAA 5C3MA 2ZJ0A 1R12A 2RHCA 3ENKA 1VRWA 2PR2A 4JX8A 1HE5A 4Q3EA 2AG8A 1EE2A 5JXWA 1P1FA 2D0IA 4R3NA 1N2SA 4O6VA 2A4KA 1UP7A 1C3VA 3HZZA 4FN4A 3OA2A 1Q7BA 3PJGA 1NPTO 3GAFA 3RFVA 1W73A 4QT0A 3G79A 4XR9A 2Q4BA 4LVCA 1PGPA 4QEDA 4R1NA 3GC6A 5B4TA 3UHAA 5BQFA 3L9WA 4F6CA 4LMRA 3H5RA 1T26A 3ZU3A 1KVRA 1Z6ZA 4D42A 3W8EA 1BWSA 1DJNA 3GRKA 4BNWA 5HBRA 2LDBA 4C4OA 1H5QA 4R54A 4Z0HO 1TLTA 3JYQA 1KEUA 2HKIA 4BUCA 4YJGB 1ISFA 4LRTB 5A02A 1O0SA 2VZ8A 3V1TC 3HQ4O 1PJSA 4EUFA 1BGVA 2J5KA 2X1HA 3SLGA 1N7HA 2PFGA 4RVHA 2B5VA 5FI5A 1I01A 4W82A 3D4PA 2DBVO 4BGUA 4CUZA 2X86A 4FFNA 3OEYA 1D7OA 3HN2A 2YQ4A 3OHSX 3ONEA 1MGOA 2FPGA 3RUFA 1KIFA 3BAZA 3ZV4A 3NJ8A 2GNAA 4YAKA 3F46A 2DLDA 2GDZA 2AEFA 3DAGA 1K0UA 5JAMA 2YHUA 1A27A 3AK4A 4ND1A 3D5QA 1ZCJA 1PGOA 2Y1EA 3V1YA 1E7SA 3E03A 4B4UA 1SEVA 4WJZA 4CM8A 1DIBA 3B1JA 1AGNA 3AUAA 1MA0A 1MC5A 5KOIA 4OYRA 3WS7A 4XB1A 1I3MA 2Q2WA 4FFLA 2C2YA 3W4IA 4J43A 2PNFA 1DIRA 1B3BA 4LMPA 1A5ZA 4W7IA 2UAGA 4J4BA 5T64A 1GPDG 3DZHA 3MTGA 4A03A 1NVMB 3K8ZA 1H6BA 1NPDA 2W8ZA 1LC3A 3DZIA 2GCGA 2OO5A 3DOCA 2Y1CA 4FFPA 5GZ1A 3ZZNA 3DDNA 1WPQA 1JVBA 3B20A 2BHLA 4DL9A 4CLXA 4BKQA 1SB8A 4DPMA 5EPOA 1XHLA 1B14A 4D3SA 4NG5A 2AEMA 1W4ZA 4PZDA 4MP8A 4NBUA 4URFA 5KKAA 3I9JA 3L6EA 3ANMA 4Z0TA 2FSSA 1M2WA 4I9UA 4CR7A 5F3RA 2EW2A 4CL3A 2QZ9A 2C7GA 4RJTA 3DBLA 3PQDA 4BNLA 3WQRA 1R4MB 3PHJA 3OJLA 3KYBA 3PXXA 5ENVA 1G6KA 3V8BA 3V2GA 3VPGA 1YONA 2EP7A 3U4IA 3DOJA 3ORFA 4N7RA 4MDHA 3CZRA 4IZHA 4Y6PA 2FZEA 5LDHA 4G65A 4DPLA 3RKUA 4R1UA 4J4HA 3ZHZA 4NK5A 1HETA 1ISGA 1NFQA 4NK4A 1GPJA 1YQDA 4ZQEA 3ZV5A 5BSEA 4R01A 1WDMA 5ICSA 3C85A 2O3QA 4IPTA 1N8KA 5DDIP 3OFSA 3JQEA 3ROKA 2V6BA 2EWMA 2VHXA 4CLDA 2CZCA 4RPJA 4FS3A 1PJ3A 1D4FA 4F45A 1SEPA 4ZN6A 2DUWA 3GVIA 4IDGA 1HF3A 2PKQO 2FR1A 1LSSA 5HTOA 2Y05A 3H3JA 5F5NA 2W2KA 3OQ6A 4GVXA 4XIYA 4LK3A 1E1NA 1MV8A 2VRBA 4Q3BA 2CVZA 2HLPA 3FBTA 2X9GA 3GEGA 1P45A 1LEHA 3R6DA 3ZW8A 1WXDA 3QWBA 1H2HA 5AVOA 4EUHA 1VJ0A 2ZB7A 4GLOA 4NDNE 1SMKA 4CMAA 3F4BA 1ZSVA 2W4QA 3RVDA 2WYVA 2JAPA 3RIHA 2IXBA 4ZVVA 4BKOA 1UAYA 4CMIB 2CNBA 4O5OA 2HDHA 4Y98A 4NH4A 1QYWA 4EW6A 1H6DA 2D3TA 2P91A 1OFGA 3B70A 4BO0A 1UH5A 1N5DA 4J1NA 4Y6RA 1FXSA 2WD7B 1PJTA 3E5MA 3U0BA 4CLEA 1MXHA 1IL0A 5JW6A 2GF2A 4ZQGA 3MEQA 4OSPA 3I52A 3TOZA 1NHWA 3F5QA 3D1LA 1V3TA 2NLOA 1PX0A 1YH3A 4XZ3A 1Y6JA 4JBGA 4Q3AA 1I0ZA 2CFCA 4A0SA 1IPFA 2H1SA 4DBVO 4J0FA 1P1JA 4O0LA 2X0RA 4CMEA 3GK3A 1BTOA 4L0QA 3AW9A 4YACA 4ZA2A 3UUWA 2Y93A 1DDOA 1EUDA 2CSUA 5CFZA 1SOWA 3DHNA 3NRCA 1V35A 4W4TA 3ZNOA 3DONA 4R4JA 1H93A 3ZNQA 1PQUA 1PS0A 3PHGA 1OC2A 2BD0A 5JYEA 3LQFA 1KVTA 4C7KA 1EK6A 1T25A 2VUUA 3AY6A 3MTJA 3QVSA 4N5LA 1R0KA 5T57A 3S1LA 1R37A 4UUPA 4PG7A 3LT4A 3DZJA 3WFIA 2BGLA 1YWGO 5KVQA 1UR5A 4RPGA 1KOLA 3GGGA 1GUZA 1ENPA 2AE1A 1JA9A 1RKXA 3K30A 3IKTA 3C1OA 2Y1FA 1FDSA 1YS4A 2O3SA 2E37A 1VJ1A 2B37A 3NTRA 2ZB8A 1HKUA 3R3SA 3RD5A 5IAAA 3W4JA 4WPGA 3V2UA 1BXKA 4MVJM 4IBOA 1HWYA 2AQHA 4IXWA 5DT9A 3I6QA 4GQAA 3JD3A 3PP8A 4M1QA 5IXSA 4PLGA 4GX5A 4NR0A 1NASA 1CWUA 3WG9A 2IZZA 3JQFC 4RPLA 1FK8A 3DAPA 1AN9A 2Q4EA 4Q39A 3MJ4A 3RFTA 1LLUA 2VUSA 4DIOA 3U49A 4BO8A 1UXKA 2QYTA 5EQDA 5DP1A 2EKPA 3FNHA 4F3YA 3A1NA 2FR8A 1LDGA 1D3AA 1PZHA 5L45A 3DEYX 1Z82A 1PWZA 2H5LA 4B8ZA 3GG9A 4PLHA 4YTEA 4BB5A 2HAEA 3O26A 1DO8A 1N92A 2BI8A 3EAGA 1U4OA 2P5YA 1U4SA 3H5AA 4IQ0A 4I5GA 3V5NA 4GVLA 1E6WA 1BXGA 3ROMA 1YVEI 4YRBA 1E6EA 4WECA 4RCVA 4DMLA 3WJAA 4CM9A 4FFMA 1P1KA 3LLSA 5JFOA 5A1TA 3DZGA 1EVYA 3WMXA 1B0AA 4PLZA 4GX0A 4OJNA 3AI2A 4MO2A 3WGGA 1P33A 3JQFA 1E92A 5HM8A 1QR6A 1R4MA 3BHIA 3BHJA 1LLQA 2PKQP 4Y8VA 4TKMA 1ZVMA 2JD1A 5EL0A 2JAHA 2OFPA 4KZPA 3GMSA 4GX2A 1XLTA 4AJPA 1FDTA 3PYMA 1WNTA 2O7QA 4M49A 2AMFA 4RVFA 4IDAA 1IHXA 4Y9DA 3GN2A 1U2DA 3QWIA 4GSLA 3JYPA 4WCFB 5T6BA 4S1VA 3UN1A 4XQGA 4HXYA 4RZHA 3K96A 1DEHA 1GR0A 1ZFNA 4RVUA 1AXGA 3X2FA 2HJSA 2AA3A 2I76A 4IS3A 4ITUA 3AY7A 3F6YA 3P19A 4ALNA 4N54A 4BO3A 5ADHA 3IAHA 1XQ6A 3PWKA 1SO8A 2P68A 2PGJA 3WLFA 3IOYA 1JVSA 5JDIC 1GQ2A 3KV3O 1YB1A 5HS4A 1HRDA 1F17A 4MP3A 1EUCA 1MFZA 3TOXA 3ROPA 3JQ9C 5KJ1A 1Y81A 4AJOA 3U09A 3BTVA 5G4LA 4XWYA 4A7PA 3NDRA 3C3XA 1OMOA 3ZWBA 4KOAA 4D0RA 2X9NA 3DL2A 3ZWCA 4BO2A 4GBJA 3ZDFA 4DVJA 1GZ6A 2W2LD 4WCFC 1CF2O 1ZBQA 4FDAA 1Q2XA 2CDBA 1B8VA 1Q7CA 2YDXA 4KDEA 3VZQA 4HFRA 3GPDG 2FOIA 2I5PO 1CRWG 1NR1A 4FGSA 4GKBA 3WOHA 5G4KB 2YV3A 4Q3CA 1D8AA 3GNTA 3L0DA 1Y8RB 2DAPA 3MOIA 4DQVA 4AJLA 4BOYA 3FPLA 1YBAA 4CMEC 3GAZA 2HMSA 4J1QA 1GY8A 2NADA 5TSDA 1R4NB 4XYEA 4RO0A 5I8WA 3GGPA 4YEDA 4D44A 1IULA 4XJSA 4BNUA 2QRLA 3G3EA 5AXCA 3VDRA 4KWHA 3ICPA 3ITDA 4WLUA 5L7WA 1N1GA 3L4SO 4CMCA 2GZ3A 2Y67A 4YAJA 2JKVA 4TZKA 4ALMA 4IDEA 4DTIA 1C0KA 4D41A 5JC8A 1ZZEA 3ZN2A 3HG7A 2VYVA 5U9CA 5G0WA 1A7KA 1NYTA 1MUUA 3GEMA 4HNHA 3AM5A 5L4LA 3UVEA 2DTDA 5T67A 5K0ZA 3VPFA 2UUOA 4RDHA 3ZWNA 2DBZA 1YOVA 3MJTA 3PTZA 3Q3CA 3PZRA 4H3VA 3ON5A 1LX6A 5CDUA 5F21A 4BNMA 5I7FA 3DHEA 2RIRA 3BXXA 1KEPA 3DFUA 4YT2A 2YV1A 4BGIA 1X13A 1A4IA 1H2BA 1HLPA 3DTYA 3CE6A 3EC7A 3DOOA 4OL9A 3EUWA 2NVBA 2X6TA 5C5IA 1DC5A 1NQAO 1IHYA 1MG5A 1ZNQO 1LDEA 3AI1A 3NYWA 3OIDA 2Q1SA 2BGMA 3O9ZA 2X5KO 4QFDA 5JBIA 5GZ6A 3TDKA 3L9XA 1WDKA 3ETEA 3TRIA 3VPHA 2OORA 4CM3A 1CERA 4XKJA 2CD9A 4NHEA 3JQAB 3H5NA 2VOJA 4L4RA 2VT3A 4K1LA 4P22A 5A06A 4OQZA 4L9RA 4R5MA 2P4QA 3T4XA 1KETA 1VKNA 1XWFA 3Q9UA 1NAHA 2PGDA 2HK9A 3H2SA 1LUAA 3GOHA 1RJWA 3O8QA 5JE8A 4HNGA 4GGPA 4BKUA 4CR6A 2JHFA 4NIMA 3SJUA 3KO8A 1NVGA 1L7DA 2HU2A 1B26A 4PIVA 2O3JA 3PRJA 4L4SA 1JDJA 3UH1A 2R00C 2E4AA 1DRVA 1GTMA 3QVWA 1I2BA 3L6OO 3DQPA 2DFVA 3VAZA 2IE0A 2I3GA 3JYLA 4BNHA 4TRRA 3VH2A 4R51A 2G0TA 3LC7O 1Y8QB 2DT5A 2BF7A 1F06A 1K6XA 2DTXA 2B36A 2AQKA 1KEWA 1NWCA 3KUXA 3OSUA 1Y5MA 2V6GA 3H65A 4WLNA 3WGQA 5J23A 4HY3A 3ZCXA 3ZU2A 1VI2A 1X1TA 3IS3A 3AY3A 2FPIA 1SZJG 4TVOA 4DLBA 4CMHA 1U8FO 4D45A 3IP3A 2I99A 4CLOA 2H6EA 4JIGA 4NFYA 2C5AA 5DCYA 1VLLA 1WW8A 5B1YA 4CM5A 3TNLA 2UYYA 5IXYA 5L3ZA 1U1IA 5A9TA 4CM1A 1QV7A 2XF8A 3WXBA 2VZ9A 4EZBA 1BW9B 1XSEA 3U4HA 2VHVA 1UP4A 4FQ8A 3ZH2A 4AG3A 2C54A 3LC1O 3BTUA 3ZWWA 1Z45A 4P4NA 3ITKA 3UCEA 3OQ1A 1AXEA 1BXZA 3PDJA 4Y67A 2E6UX 1UXGA 1ZMOA 1ZXLA 4MVJE 2GZ1A 4XR4A 3K6JA 3TPCA 1PQPA 2GPTA 2JD0A 5TX7A 3U9LA 3QWFA 4ZGWA 4GLLA 3ZHYA 4TSKA 5EJ2A 3NJ4A 1PL8A 2CY0A 5CG1A 2PWZA 1P3DA 1U9JA 1U7HA 1I2ZA 4BO5A 3RJ9A 2G17A 3NX4A 3SLKA 1H9BA 3WWYA 1YQGA 5DULA 4MKXA 3WBFA 2HO5A 1MX3A 4RORA 1HYGA 2FPPA 5BNTA 5JDCC 5L53A 1N9GA 4FJ0A 4RLHA 3F5SA 1NR7A 3DR3A 3NT4A 2GN6A 2ZJ1A 3HN7A 1ONPA 3R1IA 4GAEA 1R4NA 4P4GA 3U4DA 1Q0LA 3TZCA 3MZ0A 2VTDA 3TFQA 4DIFA 4GX1A 4Z3KA 1TT7A 4IJVA 2JCXA 3I9NA 4ND5A 3VZRA 2DVMA 2JCYA 2NTVA 4FJ2A 4CV1A 4GWKA 4BKPA 1YDEA 4E2XA 1E3WB 3OH8A 1ZIDA 5CEFA 1SB9A 2YJZA 2CF5A 5KWEA 4FOOA 3RUEA 2OHXA 1X15A 3CXRA 4LGVA 4PLVA 4XIJA 5B12A 5JS6A 4PG5A 5TT0A 8LDHA 4J16A 2AXQA 5EINA 2DPHA 2F00A 3UXYA 3WNQA 4B7XA 2POQX 4IUYA 3WYEA 3INRA 3CSDA 1TI7A 1ZK4A 3H4VA 2WDZA 1IE3A 1E7YA 2Y1DA 7MDHA 1E5QA 2I66A 1MC4A 4J2HA 2Y1GA 3DZFA 4UEOA 2J6IA 5FFFA 1WWKA 2QHXA 3QV1A 2DFDA 1BHSA 2NNLD 3EVTA 3LT1A 4BV8A 3ZWAA 1KC3A 1C1XB 1JQBA 3FTNA 4CMGA 3I9MA 2BH9A 1HSZA 4E5MA 2O3TA 3UCXA 5JNLA 1P77A 3F1LA 1AHHA 1ZUD1 2YV2A 4IMRA 3BMOB 4BHTA 3JQ8A 4BGEA 3QVTA 1QRRA 3A4VA 1UZNA 3GGOA 3RWBA 1X0VA 1U2GA 3ZV3A 3SBOA 1T1SA 2UDPA 1LTHR 4IY1A 4L4XA 2WYWA 4NU6A 3GUYA 2OBNA 4JN6B 4WLFA 2GSDA 3PLRA 4J2OA 1HE4A 4FD3A 4E32A 3H2ZA 4RF2A 5G4KA 4RF4A 4E13A 2ZTUA 2ZYDA 4K6FA 4A5OA 2GN9A 3H3FA 4MVJG 4C7JA 3RBXA 1L7EA 1OZAA 2C2XA 2B4QA 3LZ6A 4TRMA 1DHTA 4KDFA 1RM5A 3VVCA 3D5TA 3DBHA 1LLDA 2ZTVA 4L8VA 1PJBA 1YL6A 3ZHXA 3I83A 1ZK1A 3I23A 4FW8A 3VOSA 4XYLA 5U4QA 2HRBA 1GD1O 4D3DA 2NM0A 4NU5A 1Z7BA 4BQRA 3ENNA 3F47A 4XYMA 4BIIA 4OQYA 3H9UA 2NU6A 3CINA 4BQPA 4MIYA 1KERA 2X0IA 4IGEA 5I9LA 1LI4A 5COAA 3BMOA 1DC6A 1DAPA 1PZFA 3OECA 4DUPA 3GA0A 1DRWA 4YAGA 3I9KA 4PCVA 2NWQA 1NQ5A 2Y68A 1ULUA 4RQTA 2EW8A 1XELA 1QYDA 3U3XA 1T2CA 1H6CA 1KC1A 2Z5LA 4IQGA 2VRCD 2AQ8A 1LRJA 1P1HA 4QSMA 3L77A 4HFNA 3SJ7A 5B4UA 2OP0A 2GASA 1YB5A 4RPKA 5L7YA 3G1TA 4I5EA 5DNAA 1ARZA 1SC6A 3LDHA 4PLCA 2P9EA 1X0XA 1B7GO 2R00A 3JQDA 1QMGA 1QXSA 3OM9A 4CQLB 2C5EA 4CUJA 3ZGYA 4HP8A 3H7AA 4AJ4A 2RBEA 1EVJA 4CMJA 5LCXA 2DTEA 3SC6A 1ZMTA 1JKJA 4U8GA 3FN4A 2G82A 4BNZA 2ET6A 2VWGA 3PDUA 3KYCA 3FR8A 1YOVB 2FZWA 1DLIA 4XEHA 1HE3A 3JD4A 4CQMA 1YB4A 3ETGA 3QVXA 4UUNA 3P2YA 3PYLA 5KKCA 3FBGA 3UICA 4CPDA 1F8FA 3D4NA 4XGKA 1M6HA 4AJIA 4CQMB 4ROSA 5JAIA 5A3JA 4M86A 1HYEA 1ML3A 2FRDA 3E82A 4RQUA 4RZIA 1KS9A 1YDWA 3VZPA 5CDGA 4PLFA 5A03A 4GKVA 2B5WA 1XDWA 4TMFA 2VT2A 1BDMA 4YPOA 4MVJF 5AXDA 3AUUA 1K3TA 4JBHA 2J3KA 2O48X 3IQDB 4D46A 4MINA 1HSOA 2OMEA 3KRTA 3H6KA 2XPCA 3JQGA 2ZQZA 3RC2A 5I7SA 3UF0A 2TMDA 1C1XA 4KWIA 4W99A 4G81A 4XX0A 3OF2A 1UXIA 2BGKA 3AFMA 1DLJA 3FSRA 3HJAA 4XDYA 1PTJA 5G0UA 1EBFA 2Q1TA 3T7CA 3WYBA 1E3SA 1YL7A 1U7TA 3JQ9A 5H83A 1J5PA 2UVDA 1ULSA 1Z7EA 2GR9A 1O6ZA 4FIZA 4B3HA 3HE3A 3GVHA 1T2DA 4H16A 4OKIA 5JMWA 1P1RA 3O8QB 5CG2A 1NQTA 1TEHA 5KCZA 4WASA 3QQPA 4FBGA 5A04A 1H0KA 5CEJA 4PLWA 4KP7A 3DMYA 1W6UA 1U5CA 1WZIA 3WMWA 3INTA 4AL4A 3WYCA 3G49A 2RH4A 4Q3NA 3HB5X 4S3MA 1GV1A 5BNIA 3GVXA 2J5QA 4YJHB 1P44A 4JJFA 1I5RA 4AJKA 5L7TA 4LRSB 1RYEA 5IZCA 4DWVA 1Q1NA 4CM6A 4AJ2A 3UKOA 3MWEB 4OSOA 3VDQA 3ASVA 2NVWA 1QG6A 4JQCA 1SCUA 1BMDA 4YT8A 4UAGA 5COBA 1DPGA 2R6JA 1P0CA 1EVIA 2A92A 1A71A 5HWSA 4U0JA 5L51A 3TZ6A 2WWRA 1NM5A 1JTVA 4YXFA 1T24A 4GMFA 1X7DA 3TSCA 2IXAA 3JYNA 4KQXA 3BMCB 4EEZA 3OEWA 1ZK0A 2Z95A 3Q9NA 3AOEA 4NI5A 1ZEMA 3OJOA 4YJDA 4HFJA 2Y66A 3NT2A 4OM8A 2CDCA 2AEJA 3FNGA 5FEUA 1GEGA 3PK0A 4HFMA 3W1VA 1WMAA 2PH5A 3ZWXA 3LT2A 4OGWA 1NFRA 1P31A 3DO5A 4YJFA 1PQWA 5L9AA 5GZ3A 1LC0A 2JHGA 2CMDA 4X54A 4OIMA 3BIOA 4GWGA 3PVZA 1GUYA 2IZ0A 1VL0A 4PRLA 4R16A 5L95A 3JQAD 4J3FA 1E3IA 5TS3A 1ZW1A 3LVFO 3JQBA 3NGXA 2ILTA 1E3EA 4WEOA 5JCJD 1HDXA 3RUAA 1E0DA 1V6AA 3JTMA 3Q11A 3LF1A 3RU7A 3GDFA 1ENYA 4RL6A 1LDNA 2Y0CA 4XQ9A 4RVSA 5I9MA 4U6SA 1PL7A 2XAAA 3PQFA 4QQRA 3MWDB 5ENDA 3IJRA 1JWAB 4E2YA 4E31A 3L4BC 4P8RA 4YJFB 4FPXA 4BNNA 3ROQA 3ONDA 4BNFA 2G76A 1FF9A 3S2FA 5ILGA 2IDZA 4P38A 5TNXA 2NACA 1R6DA 1R15A 4II3A 2VTEA 2VNAA 2B83A 1H9AA 2ZIZA 4YJGA 5JDIA 5H82A 2Q2VA 1MFPA 4AJNA 1WVGA 4RDIA 1ADCA 2YFHA 4BO4A 1S7CA 3EMKA 2PZKA 2B4RO 1XA0A 1J6UA 4CMBA 1MP0A 1AHIA 4NJMB 2X0NA 4R9SA 4FGWA 2X5JO 4PG6A 3NUGA 1LJ8A 2NQ8A 1E7MA 2DUUA 4J49A 1UAGA 1C0LA 5TJHA 3ONFA 4FB5A 4WUVA 3IIEA 1GCOA 1HDOA 4ZJUA 2QRKA 5ER9A 5F1PA 3W8FA 3QSGA 2J3JA 5JY1A 5B4VA 2FN7A 2GUGA 2V7PA 1DHRA 1GEEA 1BG6A 2BFMA 3DBVO 2JCVA 2PZLA 3QIVA 4AJEA 4BB6A 2J8ZA 9LDBA 3C7DB 1DRUA 2X7HA 2RAFA 5JMPA 3GZ4A 4R69A 4QUKA 3JCZA 1N9GB 3RUIA 3WTCA 3AM3A 1T4BA 3WDSA 1HTBA 3VC7A 2D4AA 1OOEA 2PV7A 5BSGA 4XRGA 4ZICA 3F4LA 2VQ3A 2Z1MA 1YKFA 2VCYA 4MKRA 2VYND 4YQYA 4MOWA 1VE9A 1XU7A 1ORRA 4YRAA 1JAYA 1KY5A 3M1LA 4TROA 1V8BA 1VL8A 3BMCA 3PHIA 4HKTA 2RHRA 3H8VA 4NPCA 1GFSA 4IMPA 2HRZA 3JD1A 1R0LA 3D3EA 5A05A 5L4SA 1HDCA 5T8KA 4L74A 2HJRA 3IJPA 4J1SA 3QVOA 1GCUA 4W7HA 1EZ4A 3ZWVA 4B7UA 1JW9B 3RC9A 1UDBA 5DF1A 2GZ2A 1XQ1A 4XQCA 3CTMA 2O23A 3EK2A 3K92A 2A9FA 3U62A 4D43A 1EE9A 3KZVA 5DBFA 4IM7A 2JFFA 3RCBA 3RBZA 3WGIA 2DU8A 2AG5A 1NAIA 4JGBA 3U5TA 4OO3A 2PD3A 2JJYA 4H15A 1PEDA 4E6PA 1TA4A 3VZSA 4YYZA 2C7VA 3GMDA 3JSAA 3S8MA 4U6QA 3ZV6A 1I2CA 1E77A 3QA9A 4ALLA 1HZJA 3LLVA 2WSBA 4R3WA 2JFGA 3GFBA 4YCAA 3I3OA 3FTPA 1IYZA 1PR3A 4XYBA 1SBYA 5IDYA 3K9QO 1Y9AA 2D5AA 2ZQYA 2J5RA 4N18A 2O50A 2V6MA 4AJ1A 5F1KA 2I6TA 3W6UA 5FWNA 1QKIA 5G0TA 5THKA 5I9NA 3PJEA 6ADHA 1I3NA 3VKUA 1LSOA 1XR3A 4ID9A 2WTBA 1U3UA 4AJJA 2GN8A 4RPHA 3UGKA 4DPKA 3HDQA 3E9MA 5U1PA 3WLEA 1GQYA 4B8WA 1VKOA 4FC6A 3ASUA 3OJ0A 3DC2A 4HX5A 1ZK2A 3VTZA 4BNKA 1HZZA 3W8DA 4OXYA 3IMFA 2ZB4A 4DGSA 2NUAA 4CM4A 3UCFA 2Z1NA 4BV9A 4EYEA 2HMUA 3SXPA 2HK7A 2EKQA 2BI7A 3WQSB 4A2CA 3JQBC 4DXHA 4CQLA 2QG4A 2C59A 1YBMA 3C24A 3GNQA 1B15A 4NJOA 2W90A 1X14A 1YL5A 4IQ8A 2PGLA 4BL5A 4BMNA 1UZMA 2IYOA 2EJVA 4GMGA 4QFCA 3KTDA 4WCFA 4BNTA 3PFFA 2PK3A 3ABIA 2BMAA 4D0SA 2VWHA 4WGGA 3AWDA 3NKLA 1B3RA 1B8PA 1DC3A 1GZ3A 4OOFA 4F6LA 4DC0A 4I5DA 1QSGA 4E12A 5DBGA 5EESA 5A9SB 1K2WA 1CEQA 3OJFA 4NNJA 4E5YA 3OQBA 2I67A 5I8ZA 5AXBA 5CAEA 2E48A 2NVUB 4IJWA 2ZTMA 4UEJA 3CMCO 4MVJP 2YFQA 2GERA 1D1SA 2Q45A 3W6ZA 4OXKA 3JQCA 3WNVA 4O63O 1ZSYA 3NV9A 1LSJA 2D2IA 3PYXA 3PEFA 4FFRA 2I3AA 1R66A 1F0YA 1T2AA 3TL3A 4CUKA 5KVSA 4LISA 1Z73A 4MJLA 1VSVA 3UW3A 3WGYA 4WLOA 3RROA 3QHAA 3N58A 1DFHA 2G5CA 4J1TA 2YY7A 3EW7A 3SEFA 3OIFA 2BFPA 4BMSA 4CJXA 5IDQA 2OOSA 2B69A 3FHLA 3WSWA 1PL6A 2H63A 3PWZA 4YAEA 3BMNA 1WP4A 1LNQA 2O3RA 3K2EA 3AOEC 1V0JA 4II2A 4CLOB 3RUDA 2GLXA 3EYWA 2FP4A 4G2NA 4WNCA 3IUPA 1NVTA 4CLRB 5HRUA 3ULKA 1PSDA 5A9SA 4KTTE 5DOZA 4K6CA 4O1MA 4LN1A 4UEKA 5EERA 4OH1A 4UUOA 4YJHA 5T8KC 4DBZA 4CM8B 2XXBA 3GFGA 3UAGA 1Y9EA 2PD6A 3BZUA 3DZKA 1GU7A 1HYHA 1E7RA 3FWNA 1E3LA 1GDHA 1B2LA 2OGUA 1QORA 4Q9NA 1PGJA 3L07A 4UREA 3DTTA 3I4FA 3ZWOA 3PJDA 4JBIA 1V9LA 4IDBA 3CMMA 1ZJYA 2VYVD 3IC5A 4ZQFA 5GMOA 3RC7A 4B4WA 5BSHA 3U4CA 4RVDA 1NQOA 1ZKMA 1GAEO 2PLAA 4JROA 3AOGA 3HUDA 2VZ0A 3GR6A 2FR0A 3ETDA 4XRRA 1YJQA 1BSVA 1Q0HA 4XYGA 2HSDA 4A27A 2PA3A 4RV9A 2P2SA 4HV4A 4QX6A 1UXJA 3CIFA 1XCBA 4IIUA 1QYCA 1YE3A 3WJ7A 2HQ1A 1D1TA 4UVIA 3LU1A 1RPNA 1WDLA 1BW9A 2XOXA 1E7QA 3ZNPA 3FRJA 3FNEA 3G17A 1ADGA 3ADPA 3NT5A 1GYQA 2AQIA 1JU9A 4IIVA 5G0SA 3EVNA 3GUCA 3LK7A 5JCJA 2QIOA 4RLSA 4ALIA 4CM4B 5LDGA 4KUHA 1ZJZA 3PHLA 4LVUA 5AQ1A 4E5PA 3Q2KA 4BO6A 3WGHA 1EFKA 3P2OA 1E3WA 3PZBA 1DFGA 3GNSA 1XG5A 1EQUA 1E1LA 3FWZA 3JD2A 4GL4A 4OKNA 1J4AA 3JYOA 4DC1A 1FJHA 1N7GA 2IODA 2A94A 3DXFA 4FOSA 2WEKA 3KLPX 3R3JA 4RGBA 1A7AA 1C14A 3KHUA 4WK6A 4MPDA 5JAQA 3GDOA 3PQEA 4B3JA 2HUNA 3KB6A 1PZGA 2ZYGA 2YUTA 4KMSA 3H9GA 4YB8A 3AI3A 1DBVO 3N74A 4NBWA 3I9LA 3HHPA 3WGZA 1M66A 3I6IA 1FDWA 3O03A 1DXYA 1I3LA
chains in the Genus database with same CATH superfamily
1EIZA 1P9WA 1LFDB 2FUG1 2IXGA 2WM3A 2X0KA 4FMCB 4HNAA 2RI6A 4Y1RB 4YXWD 3EBOA 2W8BB 4QJBA 3S1SA 1E1RD 1P74A 1WSDA 4UULA 3RUHA 3GH1A 1K8XB 3GUUA 3K5IA 5A5EA 3AJ8A 1WHSB 2HSWA 3ET4A 3IDZA 2A5DA 5G3YA 4EITA 1XRMA 4Z4QA 1T5TA 3T34A 3VOTA 1EFVA 3I28A 1ZL0A 4FYYA 4BJHB 4L2IA 1DV1A 2XVAA 1LFAA 4JI5B 1V7ZA 5DHRA 3D7LA 3C5VA 3GRUA 1OAKA 4RWZA 2VHWA 1C9YA 1NC1A 3TTWA 1FVOA 5CB4F 1MOPA 2FPKA 5CA0F 4EO7A 5TLSA 3FJ1A 1HA3A 3L6UA 3TQTA 5KNBD 3ZCTA 4BFYA 2HWUA 4F5EA 5BV7A 1GADO 4GQIA 1VYVA 3VU9B 4UDNA 1NPYA 1TQ6A 3E9NA 3PNOA 1GQFA 3UTDA 2G6TA 3EDMA 3G59A 3TWOA 7REQB 2VPXA 2YN0A 3L8EA 5A5FA 3T0IA 2QORA 3WHIA 3IV9A 3LLUA 3OCYA 3OMWA 3JD0A 4DAOA 4F5WA 1II0A 4NJEB 1S01A 1ODTC 5LQSA 3TZQA 4KXQA 2C4NA 2O4CA 3EZXA 2F43A 1XXHA 1O5IA 4PVCA 4GQBA 4WVLA 1YF3A 2A1TS 1L5SA 1SOVA 4E33A 3KQMA 2OBMA 2XYHA 2CW5A 5L40A 3OKFA 3ZTYA 2CEAA 1JDBC 1UEJA 3ZWPA 2H2FA 1XRSB 3OTIA 4CKZA 1VJCA 4MGHA 4FUQA 4OU5A 2B82A 2VDLB 5DLEA 1T4MA 4J29A 2FF5A 3AF0A 3CB2A 4HATA 5F9FA 2VRNA 2OHFA 1K5GA 2QP3A 1P6XA 2EARA 3LUKA 1J49A 1DWQA 4MVWA 2H9AA 2BHTA 3CLUD 1T29A 1HLDA 5E2AA 1UBUS 3OTHA 2OV4A 3TM5A 4DIKA 2O8FA 1SWWA 1I8TA 1DARA 1AKRA 3SQNA 1WZCA 3R24A 4Z1MD 5ICMA 2WTUA 4L5AA 2FXIA 3IKVA 1DAHA 1OASA 4UVHA 4MARA 1HV8A 1NXQA 4RAQA 3IIKA 3QV2A 5IK2A 3WRVA 5TARA 4OM7A 1DDIA 1N77A 2PKRA 2O8FB 4D97A 3KALA 4EJMA 3I1IA 2VKQA 1EMDA 3AUXA 5CXXA 4CL2A 4U7PB 2HNBA 1FU7A 1WMFA 2AFHE 2JASA 4B3CA 4AXBA 4BRWA 1YVDA 4IOLA 2O4UX 4N5IX 1OC4A 1JZQA 4DDWA 2DPGA 2KE5A 4H08A 8ATCA 2PZGA 4IQ4A 3SHOA 5CDHA 1DIAA 3QE9Y 2FEOA 3W78A 4Q5IA 4UM8B 2QI9F 3DHYA 3FFTA 3EPJA 4RFSA 1F2VA 3MT7A 4Z0PA 1XFAA 5EVJA 2ZRKA 1RBZA 3RGGA 3WRYA 3PD1A 2IWRA 1JHXA 1RQPA 3MJSA 4IVPA 4M55A 3K1TA 3WBJA 5K4HA 3U19A 1A72A 3PPXA 5JH7A 3N07A 1MT0A 3NDJA 4EEXA 2WYOA 3G0OA 2JA1A 1KK3A 3EXHC 2JIDA 4X8MA 5KTKA 1T9HA 3RDPA 2B0CA 2WRZA 5JEDA 3KEGA 2C07A 4JBWA 1EEHA 5C37A 4ZMSA 3WSVA 1JMYA 2G77B 4Q1BA 5JXGA 3BXPA 4X44A 3VNAA 2FUEA 1N0UA 3C6YA 2JATA 1TYAE 2MSCB 3E58A 3SJBA 2IYTA 3PITA 5GY7A 1O8CA 4R7ZA 4PLYA 5D3ZA 2EHDA 2G04A 2NIPA 2I1LA 1N6PA 1KBZA 2FUKA 2R68A 3AFNA 4JL8A 4LOIA 3JR7A 5H81A 4BZWA 4E11A 1DC4A 1G1AA 3U4QA 5LZ5A 1NRIA 3VJMA 1XT6A 1HC7A 1P9LA 2CL5A 2RMKA 3Q0TA 1TJYA 2XWJI 1K7EB 3EEBA 4DY6A 4JYZA 4PHFA 3KR2A 2GHQA 4YR9A 2YXNA 3VZBA 5CPFA 2AC4A 1C0IA 2QUBA 4G5OA 5LQCA 1FTGA 3JQRA 5CVUA 1P1IA 2CDAA 1EFDN 2IW1A 3R3WA 3PGVA 1T3SA 3AYZB 4FWBA 4G4JA 4H6VA 1YA6A 1DOHA 4X93A 4B2IA 4MUBA 1BCRB 4Y9RA 1X87A 2HSGA 5B37A 3H04A 1P3Y1 4H1VA 2EZUA 4YUWA 1M1UA 1WZEA 3CRRA 1X3SA 4QPPA 3I0ZA 3HJGA 4Q9KA 5DXAA 1OBFO 1PT6A 4BNGA 1CUCA 1I0IA 5BPHA 4L8YA 5C46F 2LWIA 1U1CA 3EF0A 3RAJA 3DJFA 1USUA 4OSEA 5KJCA 2DHDA 4E1VA 1O58A 4LRYA 4BVKA 4RF3A 3PFIA 4EAAA 1TM3E 3AFOA 3DEZA 3HB4X 5DIFA 3ACCA 1CVLA 1TYDE 5T7BA 4MI9A 2IHVA 2NO1A 1Q1QA 4BIMA 4YROA 1GT6A 1TCBA 2WZDA 2BJWA 1FB5A 5IYZA 1GGVA 1U8ZA 3OPVA 3PI7A 3OICA 3ZH9B 4FSHA 2PZBA 4G26A 5DK4A 2NSJA 5CTAA 5AVWA 3FPCA 1ZR2A 4X5OA 3ICEA 1AMNA 3PEWA 3RNOA 1M8KA 3H9EO 3KYDB 4H7PA 4Q3DA 1SVLA 3I5UA 4JC4A 1DL5A 1PFKA 2DR0A 1GKIA 4PLTA 3S1AB 3UJCA 2O6LA 4UVDA 4YRDA 2ZWOA 1NG1A 3F3SA 1XMSA 3NDIA 3ZHBA 5AJZA 4Q47A 1IPEA 2ZOSA 3IKLA 3TIIA 3KM0A 2ADMA 3ND6A 4KR6A 3F9CA 4MQBA 2GAFA 1L2TA 2OTCA 3UJ6A 1YJXA 3DBRA 4TN5A 5FV7A 4ETMA 1QIKA 4MR8A 5LKRA 4PF1A 1KI6A 3RYHA 4C87A 1VKZA 4DFDA 4G5XA 3QBTA 2QVLA 4IIHA 1RHJA 5ELLA 4ZVPA 1G6OA 1ONNA 1G2PA 3JV7A 5A6SB 4EY4A 3AJRA 3H5IA 4EARA 1IZYA 3IIIA 3T4UA 1Q50A 3AB3A 1U99A 3GN1A 3H11A 1YU6A 4FMCF 1CXZA 4O4LA 3B1VA 4YCDA 2XXJA 4JYMA 1CB0A 1YR6A 4LBYA 4X91A 5CPBA 4LXQA 4R6WA 1I10A 1HT1E 1VECA 2DX7A 2IDMA 5UKDA 4RTMA 5FBKA 3O47A 3P27A 4MI3A 3LKDA 4HOYA 1HH4A 3ZGVA 1X1EA 3ZHUA 3BSFA 3EOBI 1TUIA 2XUOA 4HDNA 5AVQA 2H08A 2DWQA 1E66A 1DC7A 3D81A 5HX7A 4N7MA 3KSUA 5JE8A 3TLMA 2PZJA 4D4LA 4ZAFA 2NO7A 4CKBA 1B8UA 5J47A 2YVLA 1SCBA 3HRHA 3MT8A 2H2DA 1EWTA 1NP6A 2O9JA 3TG2A 3GOQA 3W6OA 3E8XA 3P5SA 2NG1A 2C8LA 2F64A 3HFRA 2UV8A 3JQ8B 3WI7A 3TLBA 2HF2A 2O0KA 3COZA 1T6NA 4L15A 1Z47A 2WIAA 1OF1A 2ES4A 4NZPA 4F1JA 1MHTA 4F6RA 3CYFA 3ROXA 2QJRA 4ZPXA 4OHUA 5A4FS 4J0EA 2QKYA 4TPKA 1G60A 1YBFA 3Q1LA 3SY8A 3ZIAA 1XZMA 1C0PA 2LIVA 2NTJA 5JC1A 2PPVA 1HL3A 1G6HA 2R85A 3D4OA 4OP2A 3BHMA 1XEXB 2DPYA 3AR5A 1JKXA 4YRCA 5DNDA 4IMJB 4MVJA 3ICQB 4HNQA 2X2PA 4ZHSA 3E9DA 2FA9A 1RWNA 1CKEA 1RYBA 2QUAA 2CJYA 3L41A 4Y6LA 5KAMA 3TPFA 3MQ2A 4M99A 1Y1TA 1ZM3A 5EZYB 3BEOA 4IYRA 5JFTA 3FCOA 5E95A 1Y7HA 4GLBA 1CUYA 3ZIAD 3EEOA 1E9RA 2IY9A 1WXWA 2A30A 3E3OA 5KKNB 1VHQA 4XTRA 5AXAA 1NE7A 2XUJA 4M0LA 3DE3X 2G9NA 3WGJA 3TUIC 2EG9A 5LMZA 2ZRIA 4E5VA 3ADOA 4OUDA 2V0CA 4FJ1A 2P40A 1PFGA 2GNOA 5HZMA 1NVXQ 4HADA 4PIMA 1CULC 1PVVA 4C03A 2A9RA 1VSUA 4Q6BA 4CWAA 4NYMR 4QOIA 3BD9A 2ECKA 5BWNA 1I6WA 2V7XA 4M54A 3WLOA 1Z3IX 4H4CA 1SCJA 1LVHA 1DKLA 1E9CA 3CU5A 3LUBA 5LWHA 1NQUA 1E3JA 1S3FA 1H1LA 3HWSA 1BFDA 1EGQA 2FFAA 3JWPA 3VHXA 3ZDDA 4DM7A 5CEEA 1D2EA 1MG0A 3TQSA 2GSWA 1PYDA 5JWOA 3DFZA 2R0QC 4ZAXA 1GNQA 1M2EA 3PKZA 2FLWA 1IZ0A 2BKAA 2JB9A 3FCEA 1X19A 2PEYA 1BVYF 1C9KA 3KUCA 3QF4B 3IOCA 2YRXA 2H65A 3IQXA 5B3AA 3D2CA 2GF9A 2AMLA 3FUTA 1ZRSA 2QTVB 4KMRA 1RVV1 3HDGA 1PNQA 4E2ZA 3DKKA 3FYHA 2G63A 4U2FA 2Y76A 3PWSA 4NEGA 1HG1A 2O1SA 3LY8A 5CLJA 2X6QA 4H17A 5GIPE 4KDRA 2ZYHA 2R66A 4EGFA 4O5AA 1BKYA 1V3VA 2EX0A 4MV7A 3UAZA 3K1AA 1QHHA 2NV0A 1EFRA 3FHJA 4NJMA 3TRDA 4BNJA 2C2OA 3BFKA 2G9QA 5HK9A 1NSTA 2XTAA 3TTTA 1GARA 2GTPA 3QKRA 3ANLA 4Y9TA 4AM8A 2F1HA 1BGXT 3TAXA 1PU2A 1VL6A 2ETXA 2X76A 4O3MA 4FHEA 2CLFB 3QP9A 5IULC 4MULA 1YIOA 3I1FA 3RJ5A 4QD3A 1O97C 4QECA 3OPMA 5EIOA 3OE7D 4YDQA 5BQOA 3LVBA 1GYPA 4MV8A 2QX7A 3OA0A 1WPRA 1T36A 2X77A 2X6RA 2ZGVA 4NDAA 4EI2A 1U2DC 5K0GA 4RYDA 1QG4A 1ONOA 1QB7A 5K03A 4UXHA 1ISMA 3I6BA 3I2KA 2NU9A 4QULA 5CIYA 1BMQA 1RYHA 2BC9A 2O14A 2RKWA 1LRLA 4KWEA 4I66A 4FCCA 2P9GA 3ZCSA 4CF3A 3KEOA 4IH4A 2CLKB 4S04A 4TLEA 3MBKA 2QTHA 2JIZD 2VJYA 1J39A 2WJPA 4OXNA 4PYIA 4P4LA 1W4LA 2QYOA 3GX1A 3NWEA 1HEUA 2GPBA 3MWFA 4IGIA 3T35A 5CDTA 1UBFA 3DLIA 3VV3A 2NYUA 2KWIA 2XTJA 3W3AA 1U1GA 2H0AA 4NENB 1NBMD 4WN9B 1AZSC 4D8TA 1J24A 2IH5A 2XKAA 2J3LA 5C9ZA 2JH8A 3CISA 3WLQA 2WIBA 3U7RA 2BFEB 6GPBA 2NAPA 2PG3A 1NW9B 3KHKA 3H6GA 1WB4A 5A1JA 4GPD1 3KPJA 3W4KA 2LKCA 3MG9A 1ISPA 1QOQB 3G6WA 5FH9A 3ZS8A 1K27A 1T6YA 1I4EB 3VR6A 4OHFA 1GYRA 3PD7A 2GLUA 2G8LA 1T5IA 4FQ5A 2K7ZA 3KLMX 4WK2B 3U9SA 5E6RA 2QL6A 1GU0A 4QTUB 3ENWA 5SY9A 4F8EA 1LPOA 1VE6A 2NU7B 3KBOA 1PS9A 4CDRA 3HB7A 1CR4A 1EA5A 1IEQA 1NLMA 1Q0SA 3BBPA 4H7KA 2PQ2A 4RKFA 4MDFA 1WQ4A 3I4CA 4AVYA 2D8AA 3MAGA 1X7YA 4L73A 1T8RA 1XJCA 5HUQA 2FG6C 4K9LA 1P4AA 4OXRA 5C34B 4BCBA 4HH0A 4DNOA 5C1BA 1D6SA 3K35A 1P0IA 1YZLA 1JJIA 1JQLB 3OPYI 3SEAA 3SQDA 2QX6A 4D81A 2GKSA 1EDOA 4CL8A 5FA6A 5CFMA 5AVKA 4N6NA 1CETA 4RNCA 3LXXA 4KQCA 4BMYA 2P0EA 4PGFA 4Q66C 4AJHA 2I71A 2VPQA 1UM9A 5DNVA 3PLNA 3SYRA 3M1AA 3EJWA 3VKFA 2O8BA 3IPAA 4GMXA 3STHA 1W25A 5K6AC 4OMUA 3LBNA 1FYWA 1UBTS 1PLJA 4GR5A 4BGVA 2HA6A 3B60A 4F38A 1CUJA 3FYDA 1UBHS 5C8YA 4MWZA 3ISVA 2KYRA 1W0JA 1BS1A 4GOKA 2EF1A 3D1JA 4ZCIA 1L5KA 5KWJA 1FFXA 2W22A 3G2LA 2GAOA 2ZVQX 4K28A 2BZ1A 4RGQA 1VC2A 1Y8QA 4TMTA 1KAOA 1UDAA 5F1OA 1Q7GA 1VSTA 3LT5A 3V7NA 4DA9A 4RMIA 4EPVA 1FP2A 1W7AA 5JSZB 2YWRA 2AH5A 2P4HX 3P45A 3VSDA 5HIAA 4KNYA 5JATA 5IWAB 4L57A 3KQOA 4QASA 2C29D 4RTJA 2XUKA 5JXJA 3ZE0B 1PJ4A 3FMPB 3M7IA 3WISA 1E94E 5KQPA 3QE2A 2WHEA 1COWA 3HA5A 2B35A 4N03A 1XCOA 5K51A 5JZSA 3UW1A 1D2GA 4LXXA 4QYMA 2OXIA 2Z9DA 3A1UA 4QELA 1IHPA 5FPSA 2NU8A 4FFSA 1VJTA 5BORA 4D99A 3P96A 4DREA 1RJFA 2VN8A 2HLDA 1D4OA 3OMLA 3PTLA 3ZNNA 2VQFB 3Q2IA 4QEZA 3M2TA 4CRWB 3UXEA 1H5UA 4A4DA 4JELA 4YMHA 1YNOA 2GAIA 3K8YA 1JG7A 1FDOA 1P6QA 3LA6A 3JWEA 2ZK7A 3DE7X 4D9BA 2MR6A 2C20A 3DA8A 3EUEA 4DSZA 3MJCA 2XNJA 1LDYA 5AUPB 2WM9B 4XD7D 1UQRA 2IHZA 3I42A 3QTBA 5C5DA 4M8SA 4FC7A 1GPWB 1TQ8A 2CUKA 1YUBA 4LXYA 4YASA 1EFPB 4YRFA 1BJTA 3TZKA 1ANKA 2IH4A 2XNKA 4I9FA 3IPXA 1KYWA 1CCWA 4F2HA 3FWPA 2QR3A 4HLDA 4M0DA 2EP5A 1RWMA 5BR7A 1T9KA 3N3AC 1PV4A 3TOCA 1OLXA 3M6VA 3DFFA 1ZC3A 2RGDA 2DFNA 3KXLA 1ORHA 2LCIA 1RM0A 2ZVDA 4LXGA 3AR8A 5DGIA 1S2LA 3IHTA 2CV2A 4EHBA 4UTVA 3RC8A 1NUTA 3ASZA 2E82A 4JJGA 2Y6VA 4UDXX 5KYKA 1WP9A 4B3SB 3OE1A 4HD8A 2VHQA 3TCNA 3V2HA 1YFLA 2HQSA 3AUYA 3CZCA 1F8UA 1N1MA 1CDZA 1XE3A 2Q9BA 3H3XA 1HEYA 3FDXA 3NLLA 3NIFB 4WZAB 1NTOA 1O1YA 4KUEA 4ZXFA 1FZQA 4QRIA 2FF7A 3FRHA 4HR7A 2GDJA 5AJTA 4G3XA 5JD3A 2M6LA 4K9MA 4R31A 2HFJA 1AB5A 5HIKA 2YQ5A 2AWOA 1JIJA 4JI3B 4K05A 1JDNA 4NMHA 5FWYB 3R74A 4Y1RA 4H59A 1GJRA 3FPSA 1Z4PX 3JXEA 3UOGA 3LY5A 4UNNA 4NV3A 4M9ZA 1A77A 2NZ2A 2WKPA 4N40A 5EHQA 4ETWA 3FD8A 1OXMA 5FP0A 3W2IA 2QBYB 3HN6A 5FTJA 5KJEA 4C1NA 1EE1A 2FFRA 2PUBA 1WXIA 2A78A 3GD7A 3M4XA 3K73O 2ARKA 2OZLA 3IP1A 4U8HA 5CVEA 2YHIB 1MRNA 4J7XA 3MELA 3E5NA 3CT4A 2JFYA 3MCVA 2M9MA 4ZHQB 1XZNA 1ML4A 2X42A 2CBXA 3RS7A 4D9CA 1DOAA 1XVAA 2D2XA 3FIUA 4AP9A 1WIWA 2VDNB 3OU7A 1RTTA 4HDSA 1DBRA 5EXEA 4R6XA 1F9EA 4RGVA 3QVUA 3ZVMA 2GCPA 3T3PB 1KMMA 1KJNA 2Q0XA 3G8CA 4JH0A 1U3TA 3FUVA 5CDSA 1I6LA 4ZALA 3VI3B 1RXIA 3HFSA 3ICOA 3SAJA 2BFAA 2VAXA 2X58A 1JBEA 2OSBA 3K20A 4P53A 1H2ZA 1RD4A 1UUFA 4RLQA 5FOWA 3RSQA 5HKBA 3P0IA 3E5HA 1G20B 1WX1A 3DYBA 3MGAA 3WQHA 1FDUA 4KR2A 3EODA 2D5CA 2WJIA 4P3OA 5LJLA 3NBYC 5AUQA 1KFCB 5G1OA 2CMHA 2I22A 3KKZA 2E87A 1YK0A 1SOMA 2EBHX 4KL8S 5EHNA 5B58T 2FDCA 5C7OO 4EW1A 2MMCA 2W0MA 3IIMA 1QPGA 4ND3A 2D59A 1DAOA 4UJ3A 2BFFB 3KSZO 1M73E 3ZCUA 2CD7A 3NHRA 6LDHA 4GE0A 4IDDA 1IHUA 4P5EA 5EKDA 2Z43A 2GYUA 3S2EA 5I9BA 4MLZA 2QS9A 3Q3EA 3QVVA 4F3TA 3TKLA 1EK2A 4KRXA 1QYIA 3IOMA 3K0HA 3CEPB 3JASA 4MMXB 3P26A 4ARUA 2X9VA 3O4IA 3UGJA 5KNCH 1FVHA 2BELA 4QU9A 3QIAA 2WT8A 4U2DA 1M5RA 3MS7A 4B17A 2JLCA 3NBFA 3LVQE 3L5KA 2ID9A 3LFHA 4EZIA 4YUZA 2DSNA 3CZPA 1QIJA 5AI8A 2FFBA 1I30A 4INAA 3N2EA 4QQFA 4ZJYA 5C3MA 2OV8A 5FNVA 3T3DA 3TECE 2QX8A 1KYTA 3QBDA 4FYJA 3E7WA 4G97A 4Z2YA 5BSVA 2A88A 1VRWA 3VDMA 3GJ5A 4OCZA 4IIYA 4ZVKA 5IBRA 3WIBA 2JFBA 4Q3EA 2AG8A 2RAPA 4R8VA 2XGJA 2C2WA 1Y7IA 3I2IA 3QKUA 4JVMA 1UDXA 1N2SA 2QGFA 1Q14A 3ORYA 3VZCA 3NH9A 5KDDA 5KSYA 3M34A 4I4LA 1NKSA 1C3VA 3M3PA 4AMZA 4CIDA 1QP4A 1OJLA 2A5LA 3PJGA 3UK6A 1UK7A 3GAFA 1F3OA 1ZU5A 1YTUA 3GZTB 1EU1A 3N87A 3RRBA 2VHCA 4ITVA 4E7PA 2OFFA 1M7HA 3GD5A 3P2EA 1SULA 3K5WA 1DV2A 2YWBA 3GC6A 2O6HA 4MITA 4BQSA 1L0BA 3KD3A 3KK0A 1AG9A 1T26A 4B3MB 1N5LA 4D42A 1U8UA 4FYVA 5JSKA 3W8EA 3WZ2A 1DJNA 3DZCA 3GRKA 3L5OA 2LDBA 5HBRA 1JSRA 1J20A 3ZDBA 3EF1A 5HYVA 2HKIA 1O4WA 2FH5B 3GFFA 1QFSA 3VNUA 5DRTA 2IEZA 4C06A 4NYMQ 3H2KA 2PX6A 3WKDA 3HQ4O 1QCDA 2I4LA 4NE7A 3D8HA 1Q1BA 2J0EA 3BE8A 1N7HA 1IQRA 4RM3A 3QEKA 4RVHA 2OC9A 1FJ2A 1I01A 3GLKA 2AMJA 3BSWA 3BGDA 3TDMA 4IZ6A 1WZUA 3EWAA 1SUBA 1N3IA 1GUBA 3ONEA 1EUDB 3ZK7A 4U7FA 3RUFA 2H07A 3ZGOA 3WMGA 1V9SA 4ER5A 4AMGA 5IKXA 1P19A 4B84A 3O5AA 2GDZA 3QOYA 4I4TB 5LP6C 1BDIA 4M4SA 3LWZA 1YI1A 2HDNB 3GBSA 5LXTA 1DG3A 5LQMA 4CXMA 2HA0A 2IDJA 1XZGA 2ZS9A 2ERCA 5LXTF 3DDZX 3AK4A 4ND1A 4CG0A 3R40A 1XKTA 1ISSA 1PGOA 1UT6A 2G5GX 3V1YA 4D6PA 2MSWA 4U63A 3N8KA 4TXMA 2IU3A 1LPNA 3B1JA 3GAAA 1I2DA 1AGNA 3AUAA 3NVAA 3H9CA 5E7MA 5FXMA 3FYUC 4KJZA 1MC5A 2QLLA 4EB6A 1JIIA 2G0NA 4OYRA 1PQ4A 5K8TA 4EHIA 2PUCA 4JXZA 1NVFA 4DB4A 1W1UA 1AXRA 1TCAA 4TL7A 1Q7TA 1K6EA 1YMVA 1RZRD 4YO7A 1JQ3A 1DIRA 1YIAA 2QENA 3C41J 2UAGA 1GCIA 1S4QA 2VPYA 3ABZA 3DXZA 3MTGA 3K8ZA 1NPDA 4I99A 4LE2A 3PT9A 2Q4RA 3C43A 1G5QA 5EE1A 2BT4A 5LLSA 3UJHA 3DZIA 3V3TA 1I1NA 3DOCA 3DDNA 4UNIA 3H84A 1XV5A 4DL9A 4DV2B 3HUFA 3IQEA 2EQAA 5AW4A 1QG0A 1SB8A 2YHBA 4YQEA 5EPOA 2VCEA 4DPMA 1XHLA 2YX1A 1NI4A 1WHTA 2GJAA 1UMDB 1WLSA 4D3SA 5BV0A 1Y3IA 1HBJA 4H3HB 4HX9A 1MV5A 2HA2A 4PZDA 4NF2A 1B1CA 3UZUA 3WDLA 2VF5X 2I2AA 5HSGA 3BG5A 4PYNA 4URFA 3G0IA 2XDAA 5KKAA 4KRGA 2CFSA 3BULA 4DOMA 1VG9B 1FU8A 1W49A 4Z49A 2EW2A 2Z0MA 3PDIB 3PNVA 1UF9A 4B9AA 1M9NA 1NW6A 1UPTA 5DB4A 4YJ2A 4LTNA 1SZPA 3PWTA 3IEUA 3L4JA 3WQRA 1ESZA 2AOUA 2BUCA 3PNKA 4HQOA 4W5WA 3WLMA 1R4MB 3PHJA 5JTUA 3PXXA 2D0PB 1X1AA 5ENVA 3V8BA 3GDHA 3V2GA 1YONA 4PSVA 3VPGA 5EA2A 3ESRA 3RSCA 3A10A 3GFVA 1QCCA 4XDGA 5DTIA 5CDFE 1N36B 4GR4A 4IZHA 4Q1CA 3A7DA 4V0ME 3H2JA 4DIUA 1EP3B 1J5XA 1XZPA 2GK3A 3RKUA 3IAFA 2XE6A 4J4HA 1YS6A 2Q3LA 3AHIA 1ISGA 1NFQA 3HVIA 1GPJA 1YQDA 1VLJA 4NK5A 3S99A 2JI9A 4Q9LA 3TLXA 1OQAA 3ZY6A 1A8HA 4KGDA 3P2JA 1QIIA 1SR8A 5DDIP 3MQ4A 1YJAA 1NTRA 2V6BA 3UC5A 4AAYA 3WKEA 1TIBA 2CZCA 3LFTA 4FS3A 3SP1A 1D4FA 5KWIA 1FYXA 3ADCA 1CJTC 3R9XA 4TYWA 1J06A 1KDRA 3MF4A 3IE0A 5BWCA 1MO6A 4FKBA 4BFTA 1JAIA 1MKYA 3BWDD 1BD4A 4GYJA 4Q00A 1ZX1A 4ZN6A 5HMLA 2C4KA 1FRQA 5EMMA 3TX2A 1JFTA 2FMFA 5JMTA 1VHTA 1QR2A 3DBOB 5F5NA 2BFDA 5JNSA 4GVXA 1TKAA 4XIYA 2TMKA 3N5CA 4AKSA 3NHYA 3NOVA 4D3XA 1J25A 5CA1B 3JS5A 2JZNA 4MUAA 1E0AA 1CS0B 1CJMA 4HNSA 2CVZA 2HLPA 2E6KA 2X9GA 4JB3A 2G83A 4KSCA 1BE0A 3GEBA 1LEHA 1XU4A 1PR2A 3AVVA 3KJEA 1WXDA 2AI1A 3O3OB 3QWBA 5AVOA 4H3SA 5DXJA 3L1UA 4GLOA 5FUBA 3N70A 5JISA 2XZOA 3RVDA 5LYJF 2GVNA 2JAPA 1AY0A 1ZD8A 1ZA1A 1MHPA 4ZVVA 4BKOA 1UAYA 1OVMA 4CMIB 2ISSD 2CNBA 5DI9A 3SCZA 3O84A 3ZLVA 3RVQA 2WJ4A 2HDHA 3HU5A 1OD6A 4JUDX 2P5SA 2A9QA 4BBJA 3GEEA 1OCEA 1FFHA 2D3TA 4WVFA 4BO0A 3QYJA 9ABPA 1MH1A 1UH5A 1FXSA 1L4NA 2WD7B 1IJEA 5D85A 2PCJA 3WLIA 3JARB 5A3QA 3SU8A 4MS4B 5GVRA 3JATB 3WLLA 4DQDA 3TX6A 2VQDA 3U0BA 1KI4A 1CP3A 2YFKA 5KTOA 4ESVA 4TMXA 2B92A 4HVAA 5CT5A 4ZQGA 2NXWA 3U9TA 1OAOC 1NHWA 3IBTA 2IYLD 2VF7A 4U39A 4X7PA 3T1VA 5CITA 4FGJA 2A8YA 4LZWA 1Y6JA 1KZ7B 1QP7A 4X1YA 2RGGA 4BU1A 3FMVA 4JBGA 1AHPA 2A4MA 3LBHA 4DLTA 2BGIA 2FWIA 1RBQA 3O2JA 1E3DA 3TTUA 3TUZC 4JYBA 5H0IA 3H6HA 1BTOA 3G2KA 4JKIA 1H05A 4KDCA 4YACA 5MN5A 1DDOA 1EUDA 3FDZA 2HD4A 2OGZA 4G1UC 5ES4B 4B3RB 1KP2A 3D9QX 1GTG1 3H1GA 1SOWA 4F9TA 4F3CA 2A9VA 3SZ3A 1BMFA 2C2KA 4EW2A 4DCJA 1M2OB 1CFJA 2ZBUA 3DHNA 3NRCA 1FSGA 4PC7A 4W4TA 2WWHA 3RC3A 3T9FA 1RQ2A 3ZNOA 3NWOA 1G20E 4KI0A 5JVDF 1GKKA 3ZNQA 4U7HA 5LNK1 3AVYA 1PS0A 2D06A 3PHGA 4Z9BA 4C0SA 1G5FA 5JLJA 2QUIA 2YYSA 4NZNA 3EA5A 3VO2A 4EX6A 3A3YA 1AVTA 1KVTA 4C7KA 1EK6A 2VUUA 4U9IS 4N5LA 1R0KA 5T57A 1WXFA 4O4JB 5K3AA 2P6PA 3AEQB 4MWSA 4Q9JA 3LT4A 4KE7A 1VCIA 1ACJA 2XQFA 1U02A 4KO8A 5HG0A 1UR5A 3S40A 3T95A 1XTSA 4QM7A 3LI2A 3GGGA 3QUAA 2CFIA 1BA3A 5JPDA 2AE1A 1JA9A 1RKXA 1RLTA 2VQ6A 3AIIA 1A69A 4UOEA 4UATA 3K30A 3MXOA 1TPZA 3TQFA 4RTQA 2QPLA 2W6JA 3UTCA 2O3SA 1VJ1A 3BZBA 2B37A 3OM8A 4KH1A 1HKUA 5HFAA 3TRFA 1DKMA 1PR0A 2AMVA 3MA0A 3W4JA 2PYIA 1M2HA 2YNMC 121PA 3K0FB 4K8OA 3V4VB 4IBOA 3ZU6A 3I6QA 4V03A 5JAUA 3BK1A 3SXUB 1Y7PA 1PFUA 1WEHA 4GX5A 5EJMA 4BQOA 2IYVA 1OA1A 4BKMA 1MT3A 4FXPA 3OWXA 1GNPA 3RVLA 3STXA 3IVGA 5I51A 2QGNA 4PSKA 5FR1A 1SOUA 3QTLA 4ZO6A 4Q39A 5TF0A 3ABOB 2YZGA 1GKYA 1WO8A 3RR2A 5I7OA 2J9RA 5A4JA 5BN4B 4Z1MA 3MYRA 2AN1A 1B6TA 1NF2A 3BIJA 2I4NA 4L02A 3I09A 4BO8A 3KTOA 2DQSA 5EQDA 2BEVA 2QYTA 5EUMA 3OZWA 5DP1A 2LCQA 3N2LA 1VSBA 2EKPA 4B45A 2IGTA 2OC4A 3FGNA 1CEXA 1WU7A 5GVSA 3AJEA 2QXUA 5M5BA 5L45A 4AP5A 4B8ZA 4U2KA 2AOVA 1WTCA 2QJOA 4H7DA 4OGFA 3OG9A 4JS0A 4OX9Y 1DO8A 3KCNA 3O3CA 4ZVSA 3Q9SA 1XTIA 3N5KA 4FHFA 1KO8A 2A1IA 3PE3A 1XCJA 3CKLA 3R3XA 4MTLA 4CTOA 1VHDA 3V5NA 1KOGA 2J5XA 2XD4A 2VDUE 3DD5A 4MK4A 3OOYA 4DMLA 4M3NA 4HWRA 3WLKX 4B3BA 3IR6A 5B2ZA 4V1CI 5EJ8A 5JFOA 5A1TA 1ECGA 5AI0A 3WMXA 4PLZA 2J9ZB 2CUNA 4XM2A 5CD9A 2RHWA 3HEAA 4OJNA 3L0YA 4QU8A 5G41A 3ZVRA 1P33A 3AF6A 1JEOA 1MOQA 1VDMA 1I2AA 1VLVA 3ROGA 2QQEA 2WF7A 2JK0A 5HM8A 3NGMA 4OLHA 1QR6A 3RIYA 1J2JA 1G8GA 3BHIA 3KQTA 3RSLA 2G28A 2QG6A 4F6RB 2VHEA 1KGDA 1UBOS 1PR1A 1YE5A 5H02A 3CQ9A 1XLTA 4AJPA 4O4HA 3ZDEA 3FF1A 3IVXA 1KI2A 2O7QA 1OB5A 3VXKA 3PC2A 5HBGA 1IHXA 1T91A 1U2DA 1XLVA 2FNAA 1VOTA 2ZS8A 3QWIA 5AK6A 4KAFA 1XAIA 4M76B 4ZYYA 4DR5B 5TMBA 3CLKA 3F8TA 5GJWC 1V8FA 1CE8A 3K96A 4NYIR 1PL0A 4RVUA 1AGXA 1AXGA 1DKOA 1ZJJA 4QDZA 4TUYA 1ZMRA 3QX8A 4I1PA 4XLZA 2I76A 2QRVB 4EVIA 4KWTA 3F6YA 5L3SA 3P19A 2QBYA 1FUKA 2FTKE 4YCSA 4NL4H 3E7PA 3ZGNA 2IYSA 1THMA 1YR1A 2VHJA 3OQVA 2MYNA 4N54A 2F9LA 4LJ5A 2XA2A 2A3RA 4ZWNA 1IUPA 4MGIR 3WZMA 4NY1A 5ALZA 3STYA 1O6BA 2DMRA 2HRDA 3KV3O 1F51E 4S0ZA 5BN3B 1F17A 2EL9A 4MP3A 4RD3A 4LZPA 2B8NA 2QP9X 3IUQA 3IUJA 4M0UA 2PKEA 1KARA 1NVUQ 1VI5A 1YGPA 1V8PA 2J46A 3OFKA 3ROPA 2OHIA 5E9AA 5KJ1A 3U09A 2IF2A 4QREA 4Y6OA 3IQZA 1XQWA 4XWYA 4DRZA 1S8OA 1V4BA 1SVKA 1ZM2A 2P7IA 2PX0A 3MINA 3P9RA 4DUGA 5JCOC 4ITRC 2DWPA 4KOAA 3DP9A 1IN8A 1SBQA 4PPYA 4D0RA 4GBJA 3VGJA 4BX9A 2D13A 1GZ6A 3NEAA 1OZFA 4UDYX 1CF2O 1QRAA 5BV1A 5DYNA 4FKMA 4KDEA 1Y6QA 3GPDG 3OP1A 3MRVA 2C3MA 2NO0A 3QENA 5JWHA 4ZZ1A 1CRWG 1NR1A 2C58A 4I9GA 4RXMA 2C5GA 5FUMA 1PV2A 5M2QA 4C01A 1RWOA 4YH1A 3UV3A 5DASA 5G4KB 3PUWA 1C3JA 1OWLA 5CM2Z 1E2MA 4FBLA 2VYQA 3EFBA 4DQVA 5HP4A 1G8MA 2J31A 4H6XA 3FPLA 2ZZNA 3GAZA 2JI7A 4ZCSA 1GY8A 1XD8A 2HXSA 3EFOB 3N2IA 3TXYA 3KXKA 3WXMA 3AETA 3LHDA 3C6ZA 4PEVA 4KQ6A 5AXCA 2IPLA 3ICPA 3ITDA 1UBKS 3R5SA 1KJYA 3L4SO 3LD9A 2GZ3A 1EM6A 3MBIA 4LBVA 5FULA 4GLFA 4ERXA 1VL2A 4YRTA 1SCUB 2A0FA 4ZGBA 4DTIA 1C0KA 4ZMBA 3AIOA 4S12A 4NARA 5EY5B 2I62A 3LA8A 3ZCRA 3MVEA 4L5JA 3UVEA 2H5JA 3IV6A 5T67A 1QZTA 1FFDA 2UUOA 4LDJA 4RDHA 1YOVA 4TXNA 1NNI1 1VBKA 5F7XA 1LPMA 3FTFA 3MQFA 1R6TA 4H3VA 4IMIB 4OBWA 1LX6A 2FW0A 3UBMA 5LDDC 4BNMA 4MQ6A 2IH2A 1A97A 1PZXA 1W44A 1Z17A 3ILXA 3NKVA 2YV1A 2NPFA 1QGZA 3LO5A 3GCZA 1XTUA 3OCVA 4M7OA 3QMWA 3U60B 1A4IA 1H2BA 3KVNA 3M6UA 5DX1A 1B74A 3CE6A 3VSBA 3WNZA 3BDAA 1DC5A 4KQIA 3CLTD 1H2YA 2R8PA 4HEA6 3W5SA 1IHDA 3URKA 4BLOA 3T0FA 5KYWB 1ZNQO 3FYUA 3NVDA 2Q28A 4OHMA 3ZKWB 1D5CA 4DQKA 5IUNC 1QK5A 1YJ5A 4PCUA 5IT0A 2BTQA 3OZVA 3WVNA 1Q11A 4C1BA 4DMHA 2BGMA 1TM1E 3L8MA 5GWXA 3O0DA 1LI5A 1H8HA 1EXNA 4QFDA 4ZK6A 1B93A 3OU6A 2D00A 4GPZA 1KY2A 3EIFA 2N46A 3ETEA 5FKJA 5CLHA 5FX2A 5GIOE 4AURA 2VJNA 3TRIA 3QYFA 3CLRD 2WU3A 1XMOB 2COKA 4XKJA 2QPTA 4P6VF 4PBRA 4A8JB 5GONB 4E1BA 3H5NA 4L4RA 4V3BA 4YGXB 4K1LA 4P22A 3ZY2A 5KHAA 3RTBA 1VL1A 1VJ5A 3SSNA 4OQZA 4OMFG 1KEZA 1DKRA 4QAQA 2C4HA 2X14A 3EIQA 1VHJA 2ECOA 1FYVA 1E99A 1OX4A 2WM2A 3E3MA 3L04A 5FTWA 4NABA 1YC5A 2QR2A 5C80A 10MHA 1Z2PX 3ZXSA 1GCAA 4AZ0B 3S70A 3ZHSA 4PX9A 1OZGA 2VC2B 2VXBA 3B3JA 2WPDD 1V39A 1QAQA 1YZHA 2ZG6A 2XMDA 3JASB 4LC0A 1IM5A 4DXDA 1RSZA 2HNAA 4D9IA 2HU2A 1KAQA 4A0GA 2I6UA 3RTAA 4GUAA 3OLZA 4L4SA 1N7JA 1CHNA 1H3EA 5DM70 4ZYLA 2FPOA 3EH2A 4B74A 1DRVA 2E18A 3SWWA 3L6OO 2QEQA 1T9AA 3T5CA 2IE0A 2I3GA 3NWJA 1JSCA 3F9RA 5LYYA 4BNHA 1TE2A 4ZVTA 3TNYA 5H4GA 2GK7A 1Y8QB 1OI4A 2CB0A 1T1JA 4RD4A 1CRPA 1VDZA 3QLUA 4ECEA 5FBZA 1AKWA 2BOVA 3OMXA 3ZDZB 1XHFA 4EG0A 1SKBA 3E4DA 3EISA 2B36A 2AQKA 1KEWA 3BRQA 3O1LA 3V7FA 2GD0A 1YA8A 4Q21A 1P8AA 4HY3A 4XPIA 1RIFA 3P32A 3A11A 3IS3A 1I1HA 1S8AA 3UWSA 4RM2A 4FS8A 2PL1A 1ZP6A 5LA6F 3NASA 4DEXA 1N5OX 3BERA 1B0UA 1BO6A 3HCWA 4ERNA 1XCMA 3IP3A 4C2AA 2HUPA 4MQFA 1H2FA 4CLOA 1NBAA 2H6EA 5DCYA 1EVEA 1JXQA 2VQEB 1RWVA 3ZD7A 1UODA 2WVAA 3ELYA 5ICCA 3QHQA 3SBEA 3UGQA 3GJTA 4D2IA 3ED1A 1RC1A 1OXKB 1SA0B 3V1KA 4KAJA 2ZUWA 1H8EA 1XROA 1KQGA 3U4HA 3LQYA 3LBFA 2VHVA 3CR3C 3EWNA 4FQ8A 4UXIA 3ZH2A 3PSHA 4RTOA 2C54A 4MRVA 1K8YB 3KQKA 5EFZA 1JJFA 3L6BA 1KKUA 4JJAA 3TE7A 1P72A 3JY6A 3G6KA 3ITKA 2A9OA 1ODFA 2A2ZA 3PEYA 1W5AA 1LKZA 2OILA 4BVGA 5BURA 2ZJYA 4Y67A 5AM2A 4JJ4A 1QFYA 1NZJA 1KI1A 3R23A 4UBLA 1YNSA 2GZ1A 5B64A 4L4UA 1RP1A 5A4DA 4CQJA 2JD0A 3U9LA 1QHGA 3FLEA 3QWFA 3KWJA 1A9QA 4PU0A 2GCEA 3EZ7A 1RPJA 2V7VA 4MV5A 3SYTA 4GLLA 4HH1A 2IOYA 1UKEA 2E0IA 3KUUA