5F21A

Human cd38 in complex with nanobody mu375
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
252
structure length
248
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
total genus 83
structure length 248
sequence length 252
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f21A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f21A02
4NI5A 3PHJA 3WMXA 5KJFA 2BGKA 4ZICA 1D3AA 5F1OA 1UZNA 2NWQA 3C85A 4PCVA 3GHYA 3GC6A 1T1SA 3HDHA 4FFMA 5AQ1A 1P1JA 3P2OA 4BGUA 2HLPA 4BGIA 3QWIA 3ANNA 2ZYAA 4BNGA 4BNYA 4R5MA 2R2GA 4YRAA 1QV6A 4KUGA 5JCJD 5HBRA 4CMEA 1O94A 1P1RA 3DBLB 3DL2A 4J4HA 2Y93A 1FXSA 4B8ZA 3WGYA 3MTGA 4ZRNA 1JW9B 4R1TA 5L4LA 3LT1A 4J3FA 3SJUA 1GV0A 5BSHA 4XJTA 2EW2A 3G1TA 4FCCA 5B37A 2NQ8A 3H9GA 3TL2A 5A02A 2WE8A 2Z5LA 3W4IA 1FJHA 2VYND 3MJ4A 1E6EA 4NH4A 2AQIA 3GMSA 4QFCA 4W9NA 4YJGB 1WLYA 1UXKA 2WYWA 3GGGA 3PQFA 2UYYA 4BO3A 3U09A 2HRZA 2Q1SA 3PVZA 4MVJF 2Q4EA 3JD2A 2CUKA 1LTHR 2PFGA 4FC7A 4XEHA 3ETGA 2JFGA 3KETA 2VOJA 2NACA 3VAZA 2Y0EA 4GI2A 4HV4A 3QWBA 4RCVA 2X0JA 3BMQA 3EK2A 3EMKA 3OHSX 3WYBA 3E9QA 1BGVA 3UVEA 3WSVA 1UXIA 1NYTA 4WK6A 3G0OA 2WTBA 2V65A 1O95A 5ICMA 3VPFA 4GKBA 4UVGA 3F4LA 4I5FA 1N8KA 2PH5A 1PS9A 1F8FA 1W6UA 4XCVA 5A9RA 1GAEO 2AHRA 4GLLA 3V1UA 1O9BA 4LRSB 3IMFA 2P68A 3GFGA 4E5YA 2VRCA 1ZH8A 3M1LA 3JQFA 4FIZA 1A9YA 1BXGB 2IRWA 3O26A 5T8KA 4WEOA 4E5MA 1TT5B 5A04A 1DLIA 1P1FA 4FJ1A 1M2WA 1BRMA 2VWQA 3JD0A 4DC0A 3VH4A 4RLSA 4BHTA 4DBVO 2P5YA 4R54A 4CUZA 3HG7A 1E3LA 3ANLA 4CMJA 1WDLA 2GN8A 4HFMA 1HSOA 1WDMA 3BMCA 4UEKA 5KJCA 4LRTB 3AM3A 4ROSA 3W4KA 3F47A 3MJEA 4OOFA 4IJUA 3FPCA 3RSHA 4HP8A 2X7HA 1BVRA 1LDNA 1FDWA 2LDBA 4CM4B 4HWKA 5ER9A 5K6AA 3GZNB 4ZGWA 3CINA 4UUNA 1W8DA 1H6CA 4FR5A 3TDKA 4J0FA 3GPIA 4RVGA 4DLBA 5EINA 3F6YA 1U8XX 2CY0A 4C7KA 3WGZA 4NU6A 1F17A 4AJEA 1A5ZA 3PFWO 3ON5A 2SCUA 3QW2A 4KTTE 3TNLA 4F6CA 1A7KA 3AK4A 2VYVA 4XB2A 3LT0A 2CF6A 4GX2A 3Q11A 3LDHA 1U3UA 1OC2A 4NR0A 1H6BA 5U9CA 1X0XA 1SNYA 4MVJP 1C14A 3ZV3A 1YQXA 2Z1NA 2P4HX 1OZAA 2VWPA 3QVOA 2RH8A 4CM1A 5I7EA 4WECA 3VKVA 1GEGA 5TS3A 2NLOA 1WDKA 1W73A 4A0SA 3AI1A 4AL4A 1QLJA 2ZJ0A 3ONDA 3MTJA 1WMAA 1GTMA 2VTDA 1DAPA 1U5CA 3AY3A 3D4PA 4W82A 4OXNA 1LRKA 3S2EA 1GL3A 1BW9A 4FQ8A 2EXXA 4HKTA 2Y1FA 2Z1MA 6LDHA 3F3SA 4YJDA 5T64A 2HK7A 4U8GA 1JN0A 1KS9A 3KEOA 5LDHA 4BKUA 5I7SA 2PH3A 1R0KA 3L9WA 4DIFA 2R00C 4J7UA 4AJPA 4JXKA 3VH1A 1MXFA 1RM0A 3D0OA 4GLOA 3VTFA 3WGOA 1R6DA 3F9IA 5JE8A 1KEWA 3PGXA 4R16A 2Q1UA 3LC2O 4B4OA 3B1FA 2NSDA 4LCEA 2O3SA 2FY8A 1UXGA 4TVBA 3NT2A 4DA9A 1PIWA 4DYVA 1P3DA 4GBJA 5GMOA 3UF0A 2IYOA 1SCUA 4BNUA 4YAIA 3GZ4A 1MXHA 2IEDA 3ITKA 4DWVA 1I33A 1WWKA 2AQHA 1HEUA 5TRTA 4IJVA 2Q2QA 1LX6A 3S8MA 2ZYGA 3IIEA 5FI5A 1YQGA 3PIIA 4WOJA 2YV1A 2A9FA 4BV8A 1HDGO 1P45A 3RUCA 1HZJA 2AEFA 2OFPA 5TIIA 3WJ7A 5JYDA 3I9JA 5JDCC 3LQFA 1VL8A 2Q3EA 1U2GA 3NT5A 3RKRA 5JW6A 3DHEA 2D59A 4YJHB 4OXKA 4ZU3A 4RZHA 1SAYA 3HDYA 4BUCA 1EFKA 4IUYA 4YAJA 3JV7A 4AJKA 3D64A 3ZN2A 3DZBA 1PGNA 5JO9A 2P91A 3F4BA 2H1SA 3WQSB 2B4RO 4E6PA 3FPLA 3L4BC 1XQ6A 1C0KA 3I3OA 3MOIA 3RC7A 4TRMA 2O3QA 4H3VA 4W99A 4UREA 1DOHA 2DLDA 4CUKA 3ZWMA 3IP3A 3DDNA 1XSEA 1NXQA 3QWAA 1EQUA 3WIDA 3TRIA 4G65A 5U4QA 3VOSA 4A10A 4DQVA 1IULA 1HDZA 1LA2A 5KIAA 2WMDA 1ZFNA 1B7GO 4ZQEA 3U4IA 4CMEC 4ZQFA 3PZBA 1ZJYA 1I2CA 3GY0A 1VLLA 3U5TA 4GGOA 1PZEA 3ZWXA 1PU2A 2IEBA 4BL5A 3EGOA 1Q0LA 3CEAA 4PLGA 1I2ZA 1H9AA 2Q1TA 8LDHA 1ISIA 4A5OA 2JAPA 4LK3A 3I9OA 4OAQA 4D3SA 3HB5X 3FN4A 1DFIA 2I5PO 2P4QA 3ZNNA 4EUFA 1E7RA 2UDPA 5JS6A 3L4SO 2C82A 1I5RA 1CEQA 2D3TA 3DOOA 4S3MA 2AW5A 3H4VA 3P19A 1VI2A 3D3WA 2GRAA 5L4SA 3CTMA 5COBA 4XDYA 3AUUA 4IXTA 4D0SA 3FI9A 3JQAB 5DCWA 1NFRA 1ZW1A 2POQX 1JQBA 3Q9NA 2QZ9A 4DIOA 3QA9A 3PEFA 1ZSVA 2NU8A 4NBRA 2OHXA 1VPDA 3OA0A 2FP4A 1LSJA 4E30A 4WLOA 4BVAA 4NMHA 1ZBQA 1QR6A 1Z74A 3B70A 3OA2A 3NEPX 4CM8A 1D4FA 2PKQO 1KEUA 3L6EA 4IIVA 4CMHA 4DYDA 5BSGA 4J2HA 2GF2A 3I4CA 2ZB7A 2X8LA 3T7EA 2PD6A 1XIVA 5CPBA 4XIYA 1K3TA 1SO8A 5CPFA 1BDMA 2X58A 4CV0A 3F5QA 4A03A 4B3IA 4CQMD 5G0SA 1XU9A 1V9LA 2JAHA 4M49A 3F46A 3RD5A 4GL4A 5TJHA 1HL3A 2GERA 3QVTA 3FR7A 4MVJI 4Z3KA 4GVLA 5C7IO 1T2EA 2VUSA 5EPOA 3I9KA 1MGOA 3VPSA 4TKLA 4Z0PA 3OETA 2HJSA 3ROPA 1CWUA 4Q3NA 4R3WA 4CV1A 4YT8A 5L53A 1K5HA 2JJYA 1QG6A 3PI7A 1HDCA 4YRDA 2H9IA 2DQ4A 4EYEA 3GZNA 2X1HA 5JLAA 2VUTA 4L74A 1E5QA 3FR8A 1YS4A 5CG2A 4HUJA 1IPEA 4J0EA 4E2WA 3QRWA 3KYDB 1JAXA 5EJ2A 2WD7B 1K0UA 2GN4A 2O23A 2NVBA 3GK3A 3TJRA 4D46A 5DZSA 2TMDA 4NHEA 5AXDA 4D41A 2A4KA 3AY6A 3CMMA 1UDAA 5FYDA 4BO8A 4I8XA 1F0YA 2D4AA 3BIOA 4RPLA 4LCJA 4Z6KA 5C5IA 4K6FA 1E0DA 3DZJA 4ID9A 2P9CA 3F1KA 2FZWA 2NVWA 2GR9A 4PLYA 4LN1A 2NU7A 2EKPA 2G76A 1B8UA 4CR7A 3V2UA 1EVJA 4UVDA 3VC7A 3L4BA 4BQPA 2P9GA 5A5EA 4Y9DA 4AJIA 1ZZEA 3BMNB 3WGGA 3DMTA 4NBTA 3DMTC 4KQXA 2CDCA 4BNIA 4BB6A 2PKQP 1DC4A 4IM7A 3UUWA 4FFNA 2FPGA 1ZIDA 3GRKA 1JA9A 4WASA 1NHGA 4XZ3A 2GPTA 3GG9A 4BO7A 1QKIA 4I5GA 4RVHA 3JQGB 5GZ6A 4LSWA 4OJNA 3IAHA 4IY1A 2EHDA 2LDXA 4IZHA 5JNLA 3CPSA 2ZTVA 1ARZA 2HU2A 3N7UA 3WR5A 1DEHA 4K1LA 1B8PA 4WJZA 3I9LA 3LC7O 3BYZA 4C4OA 3DO5A 4O6VA 5C37A 2O3RA 3L07A 3MWDB 3I83A 2FPPA 5CEEA 1E5LA 4ZQHA 2DC1A 4BIIA 3WSWA 3N74A 1AN9A 4R9RA 4Y67A 4PG7A 3NDRA 4Z0HO 2ZB4A 2YDXA 5CHEA 2GZ3A 2YHIA 3ONFA 3BTUA 2VT2A 1JVBA 2VCYA 5L51A 4BO0A 1F06A 2DTEA 3OM9A 5BT9A 4EGFA 1KIFA 2Y66A 5JY1A 2J5KA 4EITA 3LU1A 1NQOA 3JYPA 2WJPA 4XDZA 3VKUA 1IHYA 3KYCA 4ALJA 3G3EA 1NM5A 1RWBA 5B12A 4XKJA 5EESA 3QE3A 3CIFA 5BSEA 4N5MA 4L4RA 4IGEA 4TRNA 1I32A 4XQGA 5F5NA 1YOVA 1TB4A 4AJHA 3QQPA 1Y5MA 3FRJA 2EERA 3PTZA 4BNNA 1EE2A 1CETA 1IE3A 1XCBA 2PD3A 5HS6A 1ONPA 3PPIA 1CF2O 2GN6A 4BNZA 1R16A 1HZZA 1R0LA 3WJAA 1M6WA 2BFPA 2P2SA 3I23A 3VH2A 2DFVA 2Y0CA 3TZCA 4XB1A 4F46A 3NDIA 5LC1A 5A1TA 1BHSA 1SC6A 1UP4A 2D2IA 1E6UA 3TOZA 4FFPA 4CMIB 4Q3EA 2NUAA 1YKFA 2O2YA 4MVJH 5DN9A 1YJQA 1ZEMA 5BSFA 1VJ0A 2DPGA 1MG0A 1EUCA 2DBRA 1R4NA 2GCGA 4DGSA 4E12A 3H65A 3B1KA 1K89A 3L6OO 3DBRB 4BO6A 5G4KB 5THQA 2EW8A 4EUEA 4B8WA 4QT0A 4PLTA 1VL0A 1YDWA 2CD9A 3GN2A 5DBIA 4BNXA 1JLLA 5GY7A 3A28A 3BA1A 4WKGA 4CMKA 2EP7A 3PHLA 1B0AA 4E31A 5IF3A 3FWZA 2HK9A 3E18A 4MOWA 2BH9A 2DUWA 2X9VA 4OMUA 1KVRA 3KO8A 4H7PA 3DR3A 1U2DA 3HDQA 3WLEA 4L75A 4ZN6A 4Q3CA 3L9XA 3NAQA 5DBFA 2ZTUA 2CF5A 2HO5A 5A9TA 1KVUA 1P0FA 1E1NA 3OJOA 1ZXBA 4CQLB 4GQAA 3KYCB 1LNQA 5I9MA 1BXGA 3QVWA 4PRKA 4RL6A 1HYHA 1RPNA 3NRCA 5IN4A 2G1UA 4WLNA 2WD7A 3GRPA 3WOHA 3RBVA 1LXCA 1ULUA 1DC6A 1PX0A 4WLEA 5IZCC 3WFIA 5G4KA 4GGPA 1YWGO 2QRJA 1AXEA 1IUKA 1NASA 4LMRA 4Z0TA 2H5LA 3ZI0A 4FC6A 2VOEA 3F5SA 3ZNPA 1YO6A 1NBOA 1ZUD1 2QG4A 4Q3BA 3I6IA 1C1XB 4F3YA 4WEQA 4CR8A 4GWKA 3D3EA 1GDHA 2QQ5A 3C1OA 4PLHA 3HHPA 1PJTA 1PJ4A 2CSUA 1HTBA 2EEZA 4BMNA 1E1KA 2CNBA 2DKNA 4WGGA 5TLSA 3GEMA 4OSOA 4UULA 1TT5A 2Z95A 4PLPA 3DB2A 1UP7A 3IL2A 1PGPA 1YB1A 3NKLA 3OIGA 4M55A 4OQYA 1LEHA 2IXBA 1LRJA 1HWYA 2PD4A 4PG5A 3A9WA 1DSSG 1KY5A 3OIFA 5L45A 3AUTA 1PWZA 3ZWNA 2UAGA 1P77A 1NX6A 2DBVO 4KWIA 4B4VA 3RJ9A 1DAOA 4DL9A 4UEJA 3ZHBA 1EMDA 4DPKA 4IQGA 4UAGA 4NFSA 1SB9A 5DCUA 1T2FA 4DQUA 4IXWA 3EZLA 4OH1A 3H9JA 4RGBA 4LVUA 1LLUA 1OFGA 1PGOA 1PL7A 1V0JA 1HE3A 5A4DA 1HT0A 2RHRA 1U4OA 2HQ1A 1MA0A 4J9VA 4Y8VA 1H0KA 3COSA 3ROKA 2GZ1A 1YBVA 4B79A 3AFMA 1F8GA 4NZ9A 3PDUA 3UCEA 1HYEA 2FZEA 1K6XA 4E2XA 2X5JO 4OXYA 2DUUA 3C1TA 2VRCD 2BHLA 5AOVA 1HKUA 2BRUA 4D79A 5I9NA 5KVSA 1UJMA 1A4UA 4GX0A 3JQBC 5JYEA 2JHGA 4Y6SA 3CE6A 1DXYA 2ZCUA 2HSDA 4E4YA 2O2SA 3WB9A 2Y1DA 5FF9A 2EF1A 4BNTA 1DIGA 3UW3A 2AA3A 5L9AA 2J5RA 2X0IA 2GO1A 3PIDA 3FNEA 3LT4A 4JK3A 1KYQA 1KY4A 2YHUA 1HF3A 4L0QA 2R6JA 4IJWA 3RFXA 2ZQYA 4YVFA 2PNFA 3T7CA 4WCFC 3U3XA 1N9GB 2Q45A 3C3XA 1EQ2A 1U1IA 4IJKA 4EZBA 5JC8A 5JDCA 5LDGA 1IPFA 2HK8A 1ISGA 1QYWA 3SJ7A 4ZVVA 2OOSA 3GUCA 5DF1A 3I9NA 3CXRA 3WQQA 4E2YA 4A73A 1LU9A 4CLDA 3PLRA 1G1AA 1GUFA 2XXBA 2PR2A 5DOZA 3KTDA 4W7IA 1I30A 3IS3A 3SLKA 3LLVA 1KEVA 1DJQA 3K6JA 1QYCA 1GPDG 2NTJA 3Q2KA 4GH5A 3H9QA 4TSKA 3HADA 2VNAA 1Q0HA 1FDTA 4CM9A 1PZFA 2NM0A 1TA4A 4BO9A 3FD8A 1HRDA 3PHGA 2A92A 2XAAA 1Y9AA 2V6FA 3QVSA 4XGIA 1H5QA 1X1TA 3ADOA 3DONA 3KVOA 3MZ0A 4WCDA 5HTOA 1QORA 3S2IA 3ZCXA 2EGHA 2EKQA 1X13A 3AU8A 4J1TA 5CDUA 4FFRA 2NTVA 2HMWA 1EBFA 3H8VA 3K5PA 4JP3A 3BHIA 1N92A 4P4GA 1ENOA 3M6IA 1UDCA 1V3VA 3NDJA 3EY4A 4MP8A 3RU7A 2XF8A 2QHXA 4MIEA 5A3VA 4BKOA 2V6BA 4IDGA 4TVOA 4TMFA 4KZPA 3WMWA 4BS9A 1V35A 3BMOA 3NT4A 1H93A 3OF2A 5ITVA 4IDEA 4YRBA 2HCTA 3ZH2A 2C7GA 3H5NA 4O5OA 1XLTA 2NVUA 4NK5A 2FMUA 1GPJA 2IE0A 3A4VA 1NR1A 1PJ2A 1L1FA 3Q0EA 1IOLA 4AFNA 4BNWA 4ZQGA 1E1LA 4M54A 4R3NA 4EDFA 1ADCA 2P5UA 2O3TA 1PS8A 3G1UA 5CDGA 3H2SA 1CIVA 2H63A 3FNFA 2B5VA 4Z3DA 1YGYA 3GNSA 1O89A 3JYLA 4WLVA 4CLOA 4IGFA 2BFMA 4XQCA 1XU7A 3KUXA 4JJIA 1W4ZA 3C7DB 3IUPA 4AJJA 1H2BA 2HAEA 5C7LO 1BW9B 1JWBB 1LLCA 1YVEI 1D1SA 1HYGA 3CZRA 4RDHA 3GN1A 3QHAA 4QSMA 3GHHA 1HSZA 1Z75A 3KHUA 1MP0A 4WOKA 1GQYA 1JU9A 4ND5A 3KBOA 3FNHA 5ICSA 4QX6A 4NK4A 4YJHA 2HJRA 2FRDA 1T2AA 4S1VA 4YCAA 2GN9A 5I7FA 3D3WB 1KOLA 3K92A 4ZA2A 5A9SA 4BNHA 1PGQA 2BD0A 1LLQA 1O6ZA 5HS4A 4IS3A 3AI3A 3R6DA 4MKXA 3TWOA 3C7AA 3DQPA 3OH8A 5IZ4A 2HMUA 2X23A 4J1SA 4RV9A 2VHWA 5KVVA 4GSLA 3KSUA 3R3SA 3TPCA 1EFLA 3ETDA 4ZHSA 1SBYA 5H83A 4YQZA 4GMGA 4XIJA 3O4RA 5EERA 2Y1CA 4FW8A 3L6DA 3B20A 5JPIA 2UUOA 3HNPA 4YWJA 3VDRA 2X5OA 4MO2A 4NPCA 3DZIA 2JCXA 3HDJA 1EZ4A 3FF4A 3P2YA 3C7CB 4CLOB 1VJ1A 4D3DA 2B37A 5EL0A 3NJ4A 4CLHA 2YZ7A 1OI7A 4CQMA 3AM5A 5JDIA 1C1DA 3NTQA 1QSGA 4P8RA 5KOIA 4CL8A 1TVEA 3S2GA 2BI8A 4UVIA 1JVSA 1XEAA 1LDBA 3ZDFA 4DXHA 4D44A 1HE4A 3JYOA 1HE5A 2VHYA 4FS3A 4ONEA 2AMFA 4RORA 3GDOA 4Y6PA 3OJEA 1HE2A 3HJAA 4RJTA 2RAFA 4PG6A 2GD1O 3S55A 1YL6A 1A72A 2Q2VA 2B83A 2A94A 3CH6A 5DP2A 2W2KA 3SXPA 1ZKMA 3MOGA 3CUKA 4OQZA 1E3WB 2QIOA 4B3JA 3WGTA 2EJVA 3K96A 5T67A 3LF2A 3QV1A 2WYVA 3VDQA 2O4CA 2OORA 5CFZA 3JTMA 1ISFA 1DO8A 1WXDA 3DOCA 4BNMA 2Y67A 3ZWOA 3O38A 1I3LA 4CMCA 4CJXA 4NFHA 4W7HA 1Z73A 3ROMA 1C0PA 3KB6A 3ABIA 2PWZA 3PFFA 1RYDA 4R69A 4RPJA 1E3EA 2Q2WA 2UUPA 4ND4A 4OKIA 1X15A 2Q4BA 4ND2A 4P22A 4DVJA 3PYMA 1DC5A 3E82A 3E6AA 3MEQA 2BF7A 1X0VA 2DT5A 1PZGA 1HETA 3DBHB 3GAZA 3PLNA 4A26A 4GWGA 1YL5A 4QECA 3MJCA 4RQTA 4UUPA 4XGNA 3UCXA 4NBWA 3WXBA 1DHTA 3VZQA 5A5FA 1Y7TA 3BHJA 4GAEA 4XA8A 4ZD6A 5T8KC 4RDIA 2DAPA 1QYDA 2AG5A 4Q3DA 3ZWBA 1KVQA 1LBEA 3WBBA 3PDJA 4UUOA 5IDWA 2X0RA 3F1LA 1V3UA 4MVJG 3KZVA 8ADHA 4M1QA 5ILOA 1PR9A 2Y68A 1JTVA 1B16A 4BMSA 5K9ZA 1NVTA 1MX3A 4CLRB 4R41A 3ZWAA 3HN7A 1Q0QA 4I1IA 3V2GA 4Q3AA 5FFFA 1NVGA 4NJMA 5DBGA 5KKAA 4PLFA 1AE1A 2EKLA 2EP5A 3PHHA 4FSHA 1YJ8A 2XPCA 4HX5A 2YFHA 1DLJA 2DFDA 5JAQA 3W4JA 3I52A 5DCYA 1R4NB 1VC2A 2IXAA 3TZ6A 4JROA 3UGKA 3GPDG 3K2BA 1UXHA 1YE3A 1IL0A 3KLPX 4LGVA 3WNQA 5ER6A 5F21A 3D5TA 3DOJA 3PGJA 5JSFA 4HFJA 3EUWA 1AUPA 1U3TA 3L77A 2VZ9A 5TF4A 3UH1A 3NGLA 2PV7A 3EAGA 1PJQA 1LDMA 4IPTA 3PP8A 1Y8QA 4L9RA 3RVDA 4WCFB 3ZNQA 4CMAA 1RYEA 2WSBA 3WIEA 3ENKA 4C7JA 4AJNA 4INAA 2Y1OA 2DBZA 1R4MA 3PWSA 2C54A 2ILTA 3JD4A 4D0RA 4E3ZA 2EG9A 4OIMA 3RCBA 4ALLA 1P33A 1V3TA 4CMBA 3BTSA 1VKOA 4UVHA 1YB4A 4RVDA 4EI2A 3OP4A 5KJ1A 3INTA 4MP6A 4YJGA 1YQDA 1GZ4A 3HUDA 5F3RA 2J8ZA 3HSKA 3ZW9A 3ONEA 3OICA 4YXFA 5IXSA 5IXYA 1WMBA 3SX2A 3FWNA 4JNKA 3GOHA 1EDOA 4N5NA 1G0OA 1B3RA 4TZKA 3RBXA 4AVYA 4YR9A 2BGMA 3BZUA 3E9MA 1GZ3A 3DBVO 1LSSA 1LC0A 3IKVA 1C0IA 3E1KA 3JQ9A 5G4LA 3DXFA 4FGSA 1N1GA 1TEHA 1HDRA 2OMEA 2Y1GA 2E82A 3QLJA 2OUIA 3JQBA 1Y81A 5BQFA 4B7XA 4KWHA 3E9NA 1YL7A 1AHHA 3U9LA 2W98A 3TN7A 4NJMB 4YT2A 3GVPA 1N2SA 3ZWPA 2O7SA 4YAEA 1T2CA 4MJLA 1AXGA 1U7HA 3BMCB 3H9UA 4O59O 3W8FA 1PJ3A 4IDAA 4W6ZA 3ROQA 1Q7GA 2BGLA 3GAFA 2PK3A 4GPD1 2C0CA 3ASUA 3AJRA 3RUHA 3TZQA 1OC4A 2ZATA 4WCFA 3WQRA 1L7DA 2J3JA 5KJEA 1BMDA 3QP9A 1ZVMA 1N1EA 4KUEA 4N5LA 3TZKA 5K6AC 3ZWWA 1GZ6A 5EQDA 4J1QA 1P1KA 4XYLA 3D4NA 2I3GA 3KLMX 2E37A 1GY8A 1B26A 1LQUA 4UEOA 4E5PA 5DDIP 5J23A 1KBZA 4O1MA 2OP1A 5AVOA 3R0IA 5BNFA 4WE3A 4UVEA 2PGDA 2B4TO 2V7PA 2YHIB 2FR8A 1U3VA 5A06A 3OJLA 1Z45A 4IMRA 3IUSA 3PHIA 3Q2IA 4YA6A 1BTOA 2PKRA 1K2WA 3JQ8B 4JJGA 5JCXA 3M1AA 5GZ1A 2G5CA 3QIVA 2BI7A 1ONNA 4AJ1A 4HNGA 3O8QA 4KQWA 1GUYA 4O63O 4Q9NA 3E5RA 1K6IA 3DAPA 5KCZA 3E8XA 2E48A 1SB8A 1UP6A 2BKAA 4BNVA 1PWXA 3ZGYA 4ALMA 3RAJA 4FB5A 4E32A 1GCOA 2OO5A 2IDZA 2YFQA 2ZQZA 4FJ0A 4IDCA 3WICA 1I01A 5COQA 3EW7A 2JCYA 4CM6A 5BNIA 4MVJM 4CR6A 3MCVA 3WGHA 4CQMB 3JQ7B 5TC4A 5IN5A 1ZNQO 4B3HA 3OEWA 5TJ9A 1UH5A 3BMNA 5DP1A 1E92A 3SVTA 4KP7A 4MKRA 1NQ5A 1DBVO 3GF4A 3DTYA 4H15A 5G0TA 3WNVA 2G0TA 3RC9A 2RH4A 2BFAA 3ZHYA 4D43A 7MDHA 3GEGA 3AOEC 3H5RA 4YAKA 5IDXA 3RUIA 2CVQA 2P9EA 4CM3A 4FN4A 3I1JA 1PR3A 2GNAA 4EJMA 1G6KA 1JWAB 2JFHA 3ZW8A 4LVCA 3ZU5A 4D7AA 1XDWA 3KOUA 3AOGA 5MDHA 2YQ5A 4YEDA 4NU5A 3PWZA 1CDOA 5AXAA 1W0CA 4DUPA 1M67A 3TFQA 2VYNA 4B4UA 3CZMA 3DBHA 3FBTA 1YBAA 3JSAA 4CM8B 3NX4A 3FTNA 3ZNOA 5GZ3A 5KTKA 3DHNA 1T2DA 3GNQA 1YONA 3A06A 4R68A 3GNTA 1U28A 2FSSA 3OSUA 3JQDA 1E6WA 2HMTA 1ZK2A 1H6AA 1GYQA 3C24A 3IP1A 2VZ0A 3WYEA 1SZJG 4YT5A 3WFJA 1Z7EA 2JFFA 5CDSA 2IYPA 1EE9A 2JHFA 3UAGA 1C3VA 2I76A 2Y05A 2QYSA 4J49A 1TI7A 5JC1A 1BG6A 4JBHA 4CODB 1LLDA 2QRLA 2VRBA 3AUAA 3ZV6A 4BGVA 1KC3A 2C59A 3GGOA 1EK6A 4WLUA 4WUVA 3PRJA 1C1DB 2YY7A 3QWFA 1ID1A 4LSMA 9LDBA 4AICA 1BXZA 4U5QA 1PQWA 2QW8A 3SC6A 3FHLA 2NV6A 1ZEJA 1SOVA 1PQPA 1DDOA 4AJLA 3RI3A 3I9MA 1B15A 1DFGA 2XOXA 4NFYA 3CSDA 4GX1A 1YOVB 3KXDA 1E7WA 4ND1A 4DREA 1Y8QB 3RFTA 4MVJA 3G17A 3TOXA 3V8BA 4E13A 3MJTA 4PRLA 4RF2A 4QEDA 2X0NA 1T25A 1ZXLA 1L7EA 3H3JA 2FOIA 5CEJA 5JXWA 1IYZA 4YACA 1P1IA 4JJFA 1DIBA 1Y6JA 1K6JA 1QXSA 1IZ9A 3ZU3A 5TNXA 4G5HA 3IJRA 3GGPA 3V2HA 1LDGA 2PZJA 2X9GA 1GD1O 1YDEA 4M86A 1GV1A 3GG2A 4KTVE 3BMOB 4HFNA 3RUEA 3SEFA 5TT1A 3LSYA 1HLDA 1RKXA 2JD0A 4TROA 4U7WA 3SC4A 2I3AA 4AJ2A 1GEEA 5IAAA 3DZHA 1HLPA 3RUAA 4QQRA 2C5AA 4YAGA 2D0IA 3ST7A 2W90A 4BKQA 5T5QA 2WM3A 1WNTA 1UR5A 3RFVA 1U7TA 3TQHA 1FMCA 5JMPA 4BNFA 3WDSA 1YH3A 4K6CA 3X2EA 2RBEA 1LRLA 4YTEA 3H9EO 5L4NA 3D5QA 3I6QA 3FSRA 1I24A 2JKVA 1UZMA 2C7VA 4FDAA 2OGUA 3DZKA 1T1RA 1D1TA 3D4OA 4DLAA 1D7OA 1YB5A 4RQUA 3GVXA 1CYDA 1BXKA 3E5MA 2X5KO 4OOEA 4PGFA 3LYLA 1B14A 2ZIZA 1ENYA 5L7YA 3JQEA 3B1JA 4WPGA 4Z9XA 3UICA 2D1YA 1T24A 1DIHA 1QYVA 1VJTA 1EUDA 1WVGA 4GSKA 2VTEA 1WZEA 2BMAA 3RQSA 4CM9D 1FK8A 1EEHA 4RF3A 2W2LA 3U0BA 4CLEA 1Q2XA 3EC7A 2Q99A 3WWYA 3IDSA 5KWEA 1GQQA 2GZ2A 2NU6A 2OP0A 3RROA 1H94A 3RIHA 1LJ8A 1YRLA 3NTOA 4OYRA 1I3NA 5I8ZA 2E49A 1IY8A 2EIHA 3K9QO 4JBIA 4BGEA 1H6DA 3AW9A 1U4SA 5CAEA 3AOEA 2UV8A 2E4AA 3JQAD 1NP3A 1A71A 1H2HA 1NAHA 1VE9A 1NTOA 9LDTA 4NNJA 5TGDA 4IZIA 1XYGA 4L76A 1NFFA 3H5AA 3KEQA 2IZ1A 2Q50A 1Z7BA 3A14A 1ZSYA 3D1LA 1CQJA 4IINA 5L3ZA 1I10A 3QVXA 3DC2A 5CG1A 1MV8A 7ADHA 1MC5A 1Y5RA 2YV2A 2EJWA 2IZ0A 2VUUA 5A9SB 2AE1A 4MKZA 4OO3A 5AYVA 2VHZA 4YYZA 3PXXA 5FWNA 2RIRA 3PJEA 3ORFA 1UDBA 4QO7A 5C7OO 4CV2A 1U9JA 3I4FA 1TXGA 3ADPA 3OJ0A 3PWKA 4P4LA 4JIGA 1A9ZA 3KSZO 5IDQA 1E3SA 4DC1A 4L4XA 3W6ZA 3C8MA 4X54A 4I5EA 3DEYX 1KVSA 3ANMA 2IODA 1PL8A 2PTGA 1SMKA 2WD8A 4HFRA 1LDYA 4MVJE 5COAA 2ZKLA 2HRBA 4CL3A 2W2LD 2VYVD 3DAFA 1MG5A 1FF9A 3PK0A 3JYNA 3K73O 2JCVA 4XX0A 2VHVA 4PLCA 3QSGA 5I9LA 5G2OA 1NQAO 1XGKA 2G17A 4H16A 1XHLA 2RCYA 4TQGA 4AG3A 4N18A 1VRWA 3WS7A 5JO0A 1QRRA 4MDHA 4RPGA 1DRWA 2WWRA 4MVJD 3ZHXA 1MUUA 3OQ1A 3H3FA 4FD3A 4B4WA 3DBRA 1J0XO 2I9PA 1BSVA 2JD1A 3H6KA 3NV9A 2D5AA 3OECA 3IOYA 3ZZNA 1C0LA 3I5MA 3W8EA 1EVIA 2X86A 2X6TA 1I36A 3LZ6A 1TT7A 1XQ1A 4FJ2A 2FPIA 5THKA 5KVQA 5B1YA 2B35A 3UKOA 2PZLA 2J6IA 3DMYA 4WNCA 4CM7A 4EUHA 3ZWCA 4B7UA 4EW6A 4J9UE 2ZB8A 2YUTA 4IQ8A 1B3BA 1HDYA 2HMSA 4HNHA 4G81A 1HDXA 2GLXA 2CVOA 3RWBA 4J6FA 1KVTA 1I0ZA 1I2BA 4BNJA 1P9LA 1LDEA 5JCJA 4KOAA 5G0WA 3HN2A 1LSOA 4XJSA 2J3IA 3G79A 3GDGA 4BMVA 5FI3A 2VNSA 3ZU4A 2AE2A 1UXJA 1Q7BA 1R4MB 4DMLA 4KMSA 4NG5A 3LLSA 4CM4A 4E0BA 1T4BA 1DFHA 4U6QA 4BO1A 4YPOA 5L95A 2C2YA 4G2NA 1SOWA 2WEKA 3OEYA 4JP2A 1ONOA 4IDFA 2ET6A 1UAYA 1PZHA 5H82A 4NBVA 1ADGA 1WAMA 3EVTA 2Q1WA 4NIMA 3DZFA 1D8AA 1P1HA 5B4UA 4BB5A 4FFOA 2HDHA 1S7CA 5HM8A 4BKRA 1GADO 4FOOA 1BWSA 4FOSA 5L40A 3P5SA 1NPYA 1PJBA 2H6EA 4ALIA 1LQTA 1Y8RA 2NADA 3W6UA 1RM3A 2B5WA 3DBLA 3R1IA 3Q3CA 4R9SA 1NNUA 1EDZA 3EYWA 4TRRA 2PGLA 2AG8A 4W4TA 4RF5A 2CFCA 3IQDB 4ZJUA 5C3MA 3OBBA 1IB6A 4LMPA 2C29D 3QY9A 1GCUA 3LVFO 3ICPA 5DULA 1NQTA 4GVXA 3HWRA 3RUDA 3O8QB 4ALNA 2O48X 5F1KA 1A4IA 4CMIA 4E2ZA 4EEZA 2V6MA 4CPDA 3KM0A 1RM5A 1JKJA 1ADBA 4II2A 1DB3A 4K9DA 4Q39A 4YT4A 2WDZA 3DFZA 4M87A 4OGWA 3EZYA 5F5LA 3ZHZA 2VZ8A 1FDUA 3O9ZA 1GU7A 3RU9A 1BDBA 4PN3A 2FR1A 1HXHA 2X22A 4JCOA 4XRGA 3AI2A 4PG4A 3GMDA 2WYUA 2YW9A 3MWEB 4CLXA 4U6SA 5MGBA 3DHYA 2NU9A 4GX5A 4QUKA 3U62A 3AM4A 3BXXA 4UUMA 2B4QA 5JDIC 2OXIA 1Y8RB 4MPDA 1O5IA 4JGBA 1AHIA 1PJLA 1PJCA 4XQEA 3UOGA 5KKCA 1J5PA 1QMGA 4P4NA 4ZQBA 4MP3A 1PTJA 1PSDA 5DT9A 1Z6ZA 2ZB3A 3GR6A 4DBZA 3KRTA 3GVHA 5CDTA 3GUYA 2YDYA 4IIUA 1WPQA 2CDBA 3VPHA 2AXQA 4XYGA 1P74A 2O50A 4PLZA 3KSDO 5G0VA 4F45A 3U4HA 1P44A 5IDYA 2HUNA 3TZHA 2YQ4A 5TT0A 1GYRA 1OOEA 3W8DA 2JL1A 3PJDA 1F14A 1Y1PA 2DU8A 2I67A 1NPTO 3K31A 4QO8A 5DOVA 4D45A 5JY6A 3VZRA 3D7LA 4FPXA 2GGSA 2DTDA 1NWHA 1CRWG 3CKYA 5HA5A 4Z9YA 4K28A 1ZMOA 4I08A 3SBOA 4W9NC 2GSDA 4ZRMA 1N7HA 3RC1A 1LI4A 1MFPA 3Q1LA 2VQ3A 4NJOA 4J43A 1R37A 3EVNA 2ZTLA 3BTVA 4YBZA 4E5KA 2CVZA 3WG9A 1XR3A 1LUAA 1E3JA 1ISHA 5G0UA 1EVZA 2J3HA 1RJWA 3A1NA 3PQEA 3ENNA 4BNLA 4F6LA 2PZMA 2BFOA 2W2KB 1AGNA 1PL6A 3NUGA 2VWHA 2FSVA 3JD3A 4OSPA 1A27A 5FEUA 5JBIA 3IJPA 4L8VA 4BO5A 5I7VA 4J90A 3U4CA 3JQCA 1Y9EA 2I6TA 5BNTA 4I5DA 1I3KA 3KYBA 4R5HA 3TSCA 3WGQA 1PGJA 3JQ6A 3L0DA 1I8TA 1B8VA 1CQIA 3C1AA 3UHAA 5T57A 1ZSNA 3JD1A 4RPHA 3Q9UA 1S6YA 3JQFC 4OKNA 1DJNA 3AUSA 1JDJA 4AJOA 4NQZA 4ITUA 1R0SA 4J4TA 3AU9A 2AQKA 3K8ZA 2PZKA 3DTTA 1ADFA 3GFBA 3JYQA 2VT3A 3OIDA 2DM6A 2ZCVA 3BMQB 4RLHA 3V1TC 4A2CA 3NJ8A 4DPLA 4XQ9A 2GUGA 4BOYA 4BO4A 1XELA 4LW8A 1OAAA 3RC2A 4DIBA 1KEPA 1U5AA 2OBNA 4BKPA 4YJFB 3JQAA 3ITDA 1EBUA 5HRUA 3HQ4O 2EWMA 1F12A 1SEVA 1LSUA 1VL6A 1MB4A 4JX8A 1HDOA 1R15A 2X4GA 1PS0A 1VSUA 1OMOA 2BLLA 2DTXA 2PA3A 4DPMA 3ZU2A 1XG5A 3ZWVA 5ES3A 1NVMB 3STHA 3MJSA 4E33A 3OFSA 3WLFA 1ZK4A 1ENPA 4IMPA 4I9NA 4DRYA 1TLTA 5BR7A 3BTOA 2VHXA 3VVBA 2B0JA 3Q6IA 3UXYA 4O0LA 3W1VA 5HWSA 4EJ0A 2IZZA 1YXMA 1X7DA 2A35A 2AQ8A 3JQGA 4OHUA 4RPKA 4TKMA 1DHRA 3GA0A 4JQCA 4WNIA 3FTPA 3G49A 1VM6A 5CP8A 4DMMA 6ADHA 3PYXA 3GVIA 4PZDA 3PZRA 4RF4A 4U0KA 4EJ6A 3AY7A 2UVDA 5JFOA 1WP4A 3H2ZA 1UZLA 1XWFA 2NQTA 3HFGA 3RUFA 5L7WA 5H81A 1KETA 5AXBA 5IG2A 3BAZA 4QTZA 3H7AA 3ICCA 1IZ0A 1J49A 2C5EA 4PG8A 2B36A 5IFLA 4ILKA 3GH3A 4II3A 4KDFA 4L4SA 1UUFA 3WX0A 1GYPA 2C20A 3EDMA 5L7TA 3ASVA 4A7PA 2QX7A 3VH3A 3ETEA 1U8FO 1N5DA 4FBGA 3P7MA 1CJCA 4YDRA 3KYDA 1QP8A 1ORRA 5T6BA 4MINA 3RJ5A 1RM4A 3WTCA 5JAZA 3ZWYA 3O03A 2C2XA 4IDBA 5EN4A 5ENDA 1V8BA 5K0ZA 4RVUA 4J1NA 3WYCA 2GYYA 1ZCJA 1E7MA 3JCZA 1U3WA 3LT2A 1WZIA 2ZTMA 1P0CA 5JMWA 3LF1A 2DVMA 3OQ6A 4MIYA 5IZCA 4P38A 3QWHA 2ZK7A 1M76A 4J16A 3EHEA 1SEPA 3B6ZA 4XRRA 2GDZA 1GFSA 1DRVA 2I99A 2W4QA 5EIOA 2F1KA 3DFUA 3U49A 1A7AA 1X7GA 3GDFA 4E21A 1E3WA 1ZJZA 1ZK3A 3IC5A 1H9BA 4PVCA 4QXMA 4YB8A 4BO2A 4EBFA 3DZGA 3TL3A 5JAIA 1ISJA 4U0JA 1Q1NA 1NR7A 4BQRA 1JKIA 2W8ZA 5I8WA 3TF5A 5A05A 4PLVA 2EV9A 3NTRA 4YQYA 5B4TA 4XYEA 5AXCA 2V6GA 1E7QA 2YJZA 2J5QA 1O0SA 2FN7A 4JN6B 4LISA 2XXJA 1VSVA 2AEJA 4JBGA 3OQBA 4NDNE 1NPDA 1PJSA 1M75A 3JQ7A 4TRJA 3VHRA 4PFJA 1MFZA 3K30A 2Q46A 4J4BA 4R1UA 4M8SA 4ESOA 2BELA 2DBQA 1QV7A 1WW8A 3KV3O 1PQUA 4A27A 1QLHA 3NGXA 1MLDA 1ZK1A 3CMCO 3HE3A 4R01A 4L73A 3AFNA 4IS2A 1OBFO 1ISMA 2FHSA 3V5NA 4HXYA 1DIAA 2O3JA 1QYXA 4I9HA 1M66A 1DC3A 5ENVA 3NYWA 4BV9A 1E7YA 2O3UA 4XWYA 4R51A 4DQXA 5A3JA 2FR0A 2CZCA 3HB4X 3WGIA 4IDDA 1EUZA 5EMHA 3X2FA 1G0NA 5LCXA 3JQ8A 4URFA 3HZZA 4RVFA 4D3FA 4BNKA 4RVSA 5F1PA 2J3KA 3ULKA 1KC1A 2WE7A 1N9GA 2FWMX 4IBOA 1YBMA 4XYBA 4HADA 4B7CA 4YJFA 3VVCA 2I65A 4PZCA 3RBZA 2CMDA 1KERA 3UCFA 2E6UX 5JAMA 3VPGA 2O7QA 3IKTA 1O8CA 1P31A 4XGKA 5DNAA 4Y98A 4J7CA 2ZJ1A 1E1MA 3VTZA 1UAGA 1J4AA 2Q49A 5ADHA 1JAYA 4XD2A 1X7HA 1BVUA 3FNGA 4PVDA 4XR4A 1Z82A 2D8AA 4KDEA 1IHXA 3AWDA 1ZK0A 2Y1EA 4HY3A 4PLWA 4DTIA 1E7SA 1XA0A 3SLGA 5TX7A 2TMGA 3LK7A 4R1SA 3RKUA 2YYYA 4RZIA 2F00A 3PQDA 2YV3A 4FFLA 1B2LA 2OL4A 1NHWA 1X1EA 1NFQA 3K2EA 4QFDA 2NVUB 2Y0DA 3DWFA 3DAGA 3FBGA 4HBGA 1GR0A 5U1PA 1PEDA 3OJFA 1R66A 3T4EA 1E77A 3INRA 3FCOA 1FDVA 4DLLA 4IQ0A 1XKQA 4PZEA 4CQLA 2I66A 2QZZA 1C1XA 3JQ9C 4J2OA 3GVCA 3GEDA 3S1LA 1ML3A 5KNLA 1M6HA 1LC3A 3GLQA 4OM8A 1GQ2A 1EK5A 4TZTA 5TQVA 2ZYDA 3PJGA 5KVCA 1DRUA 4Z9FA 1EVYA 2OZPA 4GMFA 4WLFA 3N58A 4RO0A 4AJ4A 2RHCA 3WTBA 3ZV5A 1X14A 4I9UA 4CMGA 1I3MA 1ZMTA 1NAIA 4N54A 5EQFA 3LC1O 2HKIA 3E48A 2AEMA 4XR9A 1DPGA 4M89A 2VN8A 4K26A 4J91A 3QJ5A 1NWCA 3GQVA 5A03A 1VKNA 5TSDA 4R4JA 3R3JA 4OL9A 2D5CA 3GT0A 3E03A 3ZV4A 4CV3A 3V1YA 4E5NA 5B4VA 5IJZA 1CERA 2QYTA 1DIRA 2PY6A 1R12A 1GUZA 2DPHA 2OBYA 4R1NA 2NNLD 4Y6RA 3VZPA 5ITWA 3INGA 5CEFA 3VZSA 2JD2A 4N7RA 2Y99A 4ALKA 5KJ6A 1ENZA 1FDSA 2GASA 4EEXA 4ND3A 1N7GA 4XYMA 3MJVA 2EGGA 4JLWA 1JKFA 1SPXA 2QRKA 3HFSA 4CUJA 1ZO8A 2VWGA 3PYLA 1Q7CA 3OMLA 2HMVA 4GKVA 4MIOA 2C07A 3S2FA 3WWZA 3M2TA 1J6UA 3RASA 3UFXA 4CM5A 1MC4A 4TWRA 3WBFA 1T26A 4PIVA 1T4DA 2X9NA 4J7XA 2CDAA 3UN1A 2NTNA 1V6AA 4KUHA 2R00A 3PJFA 3TFOA 4CLRA 3VPXA 5ILGA 4FGWA 3T4XA 2B69A 2O4UX 3BHMA 4D42A 1ULSA 1E3IA 2PGJA 2G82A 4NBUA 2PLAA 3U4DA 5CDYA 3M2PA
chains in the Genus database with same CATH superfamily
2WV7A 3SSNA 3OPMA 4AS2A 4JOBA 1E20A 2BGKA 3HZHA 4ZICA 1UZNA 2XITA 2YHAA 3HKBB 4UCQA 3GC6A 4EP1A 4YO8A 3K9GA 5AQ1A 2AR9A 3A1DA 4RVOA 4HPWA 3EEYA 2DFNA 2QGNA 3HYCA 3WL3A 2P77A 1SXJD 4ENPA 3N2ZB 1U0EA 1BWRA 4HNAA 1XKLA 1KMCA 4BNYA 4G4JA 4R5MA 4BNGA 3ZVMA 5FOSA 2PEYA 9MHTA 1QV6A 4GLBA 4KUGA 5JCJD 2YCBA 2EP8A 4PGMA 5HBRA 4NYMR 1EQAA 1O94A 5CNJA 1WETA 1AOXA 4V2UA 1QPZA 3VV3A 3DL2A 4UU8A 3IP9A 4V39A 5TPZA 2Y93A 1IK4A 1AS3A 3WGYA 2Q5LA 4ZRNA 1AG9A 4OU5A 3LT1A 1ZLXA 2OO3A 3BWYA 4KZKA 4I55B 1WP9A 1FQKA 4MVXA 3CY6A 4FCCA 2QY6A 2V3WA 5B37A 1M72A 4LC0A 4HRVA 3TL2A 5A02A 5I48A 2GMWA 2PRJA 1WCWA 2A1IA 3FE2A 3UATA 1HZZC 2F9FA 5H3CA 2ZGVA 5K8TA 4EA6A 5BQ3A 1E6EA 1UPCA 2X19A 3ICWA 2ZQ5A 3GMSA 3B3GA 4YJGB 3ZDDA 4LF5B 1UXKA 1QNLA 4XFKA 2IJGX 1F2UB 1ZJ5A 2GF0A 3PVZA 3OPQA 4BWFB 3RF7A 3D2AA 1M2KA 2IZ5A 5IH7A 1IBKB 3H97A 2JFBA 3FPBA 1S01A 2HD4A 2FPXA 3BDVA 4YRFA 1DUIA 1ESCA 5EWLA 2Y0EA 4HV4A 5KI6A 1NBWB 2QTBA 2GZSA 3B9PA 1Y4SA 4INZA 4RENA 3PC2A 1U7WA 2YIVX 1Z22A 3IHKA 3IMEA 1NL3A 4ZJZA 2WTBA 2NO5A 5JQWA 4N41A 3ZG6A 3DF7A 1XTSA 1O95A 2EQ5A 1NJ8A 1SBZA 2YZNA 2O2CA 1MJNA 3GFSA 4GKBA 1XZAA 2A9JA 1VA4A 2PH5A 4XPIA 5CFNA 4Z99A 1W6UA 2ZT8A 4XCVA 1CJTC 4ZI2A 1GAEO 3DEKA 3V1UA 2PLFA 3B60A 5A4MS 2XSZA 3HMQA 4E5YA 3M49A 3M1LA 4FIZA 3IVCA 3ZHQA 3VM6A 3H11B 3IAFA 3C6ZA 5A5DA 5D1NA 4KJZA 5T8KA 2R65A 5JSKA 3O4HA 4MWGA 4IIJA 2HK6A 2RGUA 4E5MA 4FJ1A 1M2WA 1HG0A 5A04A 4YMUA 3IEPA 4V1CA 4JI0B 3IVXA 3JR7A 3LV8A 1RFGE 2AFIE 2P5TB 3KQVA 3KP1A 3OM0A 3WB0A 2JLVA 1JXAA 5E38A 4EQZA 3ANLA 1A88A 1WDLA 4FB4A 2FLVA 3ZCRA 1EP1B 4B34A 5JNRA 3PJRA 1TJ3A 4KRGA 3E3OA 3MA0A 2H7XA 3MJEA 4L7QA 1RZ3A 2ARKA 3OLWA 3U6BA 4IJUA 2WIDA 2BV3A 3NASA 4MRAA 1U04A 4X65B 5B1SA 1V95A 1JHYA 3D8TA 3L49A 4HGZA 4DM3A 3RSLA 5ADWA 1P0MA 3IIIA 3A1CA 2PSHA 4OFBA 4HWKA 5ER9A 2PZEA 1ZOPA 2XCOA 3OX2A 4FR5A 1IN4A 2D3WA 1NSFA 3ABOB 2XMBA 3GPIA 3OO0A 2FUG1 5H9VA 1G3MA 5DMXA 5FNZA 1D07A 2CY0A 5IXJA 3PEVA 4F38A 4M1SA 1IRXA 1UMKA 1V7QA 3CNHA 1A5ZA 3TKLA 4JEMA 1GZVA 2P9ZA 4U7TB 4B1FA 5AM3A 1BCRA 2P0EA 3C3KA 3ON5A 3HNRA 2PMBA 3QW2A 4KTTE 2ATVA 3TNLA 4WKCA 3THXA 2VYVA 2CLSA 5AWFC 4EFKA 5HP4A 2DWUA 3LDHA 4QG3A 1NBEA 4U39A 2YWEA 1OC2A 3A36A 3ZGVA 4NCBA 3SEQA 2YUIA 4O08A 1X0XA 1W5FA 1AMUA 4ZCLA 1VIDA 3FPKA 3TO5A 4ZDIA 4W8OA 1C14A 4C0QC 2BTEA 2FN8A 2P4HX 1L8AA 2H9AA 2ODQA 2PUJA 5A62A 2IU4A 4JAVC 4RD2A 1QTIA 2H2WA 4WECA 2ZUTA 4CTKA 5KTYA 5TS3A 2D8MA 2HMYB 2KS6A 5E9AA 2SKCA 2G4VA 2XUOA 3WDMA 1QLJA 4K9NA 3USZA 4CDMA 1K6MA 2B1IA 3N2NA 4WOPA 1DAEA 2VTDA 4UC0A 4L5IA 3ZX5A 2PRSA 3E8MA 5GADl 4OXNA 4DCGA 4DAOA 1HY3A 2QJOA 1BW9A 2EXXA 2HU7A 3PNBA 1H3NA 5U4XA 4YJDA 3GROA 2Z4RA 4IGKA 2QLJA 1SZCA 5TVGA 4RZQA 3SDSA 2YOFA 3ZDEA 2P40A 4QJ5A 2HK7A 4U8GA 4LHYA 1RRMA 1AKMA 1QGZA 2ZJYA 1KQPA 3L7YA 1NIPA 3TLEA 5IF9A 5LDHA 2PH3A 3GLHB 4XFDA 1W30A 4CHGA 4DIFA 4UD2A 4RIHA 4RMJA 5LUBA 5FV7A 1RM0A 2SNIE 1H05A 3D0OA 3HKEB 3VTFA 2QJFA 2RCNA 4MV7A 4J1TC 3QGMA 4TVSA 1MX9A 4R16A 4MZDA 3RYHB 4EPRA 4B4OA 2RAPA 2VAVA 1AMOA 1R5OA 4L85A 4TMKA 2FY8A 6YASA 3FFTA 3I01M 3OU6A 4IV0A 4L7VA 4G41A 4REQB 5LR6A 1CQPA 1S0UA 2ZTSA 4GBJA 1SCUA 5FTMA 3EFBA 1W59A 3E5HA 1RYHA 4GGMX 2L69A 2IEDA 4B83A 1Z5UA 4IJVA 2NU7B 4JLSA 1YU9A 3HBMA 4QNRA 2OM6A 3TD6A 5E7IA 2YV1A 4BV8A 4U5XA 3V32A 1DV2A 4GXRA 3RUCA 2AEFA 1FQWA 3FPAA 4P3NA 5MN4A 2QG9A 3WJ7A 5JYDA 2R62A 2NXEA 5UKDA 3M5CA 2G88A 2J9ZB 2NUBA 4HWTA 4EL5A 4DUYB 1P3JA 1XNHA 1L4FA 3DKRA 4L15A 4M0PA 4D5EA 3EB9A 2AI1A 5IC6A 4ESHA 5JW6A 2VNKA 1GU0A 3T1QA 1EWKA 4DLVA 1FL9A 1LPNA 4UMEA 3DQQA 4RGVA 5H9WA 2JDIA 3HDYA 1J0DA 2ZYSA 1BJRE 1K7CA 3DZBA 2HX1A 3COVA 3JW8A 2P91A 4JOSA 5JO9A 1U8YA 1Z6TA 2H1SA 2PKEA 5BQ5A 4E6PA 5CITA 3OQHA 3L4BC 2LCQA 3OX1A 4MA0A 1XQ6A 3MOIA 3QU7A 3RWMB 1IHOA 1YK0A 3ZHSA 2XQKA 5K5EA 1TMGE 2RE8A 1R74A 4CUKA 4AURA 3IPLA 1F5NA 4PCLA 1ISPA 4HGYA 1GILA 3SYMA 4D8TA 1PX2A 2XE8A 4ZFNA 3LPCA 5M5BA 3TRIA 2BGGA 1P3Y1 4G65A 1PJZA 1WCXA 4A10A 2JJQA 1CR1A 4DQVA 1HDZA 1LA2A 3JRXA 1NMYA 3AEQB 4ZQEA 1URPA 4CMEC 4HEA1 4KFTA 4B82A 3MCUA 3PZBA 4R2XA 5SYMA 5BMVF 5BVHB 3GPBA 2GCOA 5EHZA 3U5TA 2H85A 2SBTA 2NSLA 1NG9A 2WNIA 1EFPB 3MD9A 1WHTB 3CEAA 2ZS8A 3DBOB 3FDFA 4Q7JB 2GETA 1Z0AA 3AG6A 2Q1TA 2X2EA 3O9VA 3NMUF 3VOAA 2RD2A 9ABPA 2I6FA 1XZ8A 3F6PA 4IXNA 3A0UA 2R1TB 4XLTA 5CXSA 4EHJA 3EUAA 4OAQA 4RTOA 4XTCS 3T1HB 3E2IA 1S4QA 3HB5X 3LE8A 2WWTA 4DCCA 4DSTA 5B58C 1QK5A 3PNVA 5CGQB 5ALLA 3IBYA 4EUFA 1MT0A 5CB0A 3EVCA 3R8FA 1EPUA 2ZT6A 5JS6A 4CCAA 1G16A 2Q6KA 1H8EA 4RPIA 1OI2A 3E5NA 3UA3A 4F0JA 2HOQA 3DOOA 3C14C 4MI3A 4S3MA 4RULA 4IWNA 3NATA 1GN9A 4OLBA 1EXNA 4LDQA 5AI5A 1KO4A 5L4SA 1Q1ZA 3AUUA 1UDRA 2PZAA 1VSBA 2VA8A 2Z3VA 2D1SA 3NIGB 2HSEA 1XEXA 1ZW1A 2J4DA 2UVPB 2VAMA 3E84A 5E0KB 1L7XA 4E4TA 2HPVA 2JIZD 4FWBA 5HZHA 1ID8A 2D74A 1T4MA 4WOBA 2JIOA 2ERCA 5AW2A 1X3LA 5FBHA 3C6YA 2PGOA 3K71B 3A4YA 2R44A 2O8NA 2DKOA 3V55A 1TF2A 5EMJA 3OA0A 2FP4A 4LF8B 4E88A 1LSJA 1OXMA 2Y0PA 4KR3A 3O8OA 2ZT7A 1C9YA 1Z74A 3B70A 3H9BA 1X39A 3HY6A 4Z49A 1JFFA 2AXNA 4DYDA 3OT5A 4CMHA 5BSGA 1EWYA 4V3CA 4BJ1A 3I4CA 1EM8B 2FXIA 1VGVA 4L5CA 5C1BA 1ESEA 1NXOA 4M1KA 4C0KA 1G8GA 1YZQA 2EZUA 3VDNB 4CI0B 5JASA 1T43A 1K3TA 5FOVA 5CPFA 5C7YA 5IHXA 3AHJA 1BDMA 2FZKA 1GPNA 3QF7A 3RSSA 1S2NA 3EXEA 1XU9A 1RP7A 1DBSA 1V9LA 5IVHA 3MG9A 5P8WA 1XHFA 5AT1A 2C83A 3AF1A 5KYXA 4GL4A 1RLUA 1CY1A 3TINA 5IP5A 1XDZA 2WSYB 1Z2DA 1FYFA 4GMXA 1V8OA 4TZ6A 2Q28A 4DJJA 1NVFA 5C7IO 3G82C 1T2EA 3P0IA 4O1HA 1QHXA 3ZJVA 2UXCB 4RTLA 3IE2A 5BQOA 1RQPA 4HZIA 4Z0PA 1NQWA 4R3WA 4HDAA 3T94A 4B5KA 5AW1A 5CK4A 5C52B 4QXRA 3PB3A 4H4DA 2LBPA 1QG6A 4GT1A 1PN3A 3MJDA 1E9FA 5KQGA 4QUEA 4CF4A 3LPLA 5JLAA 2NOAA 5AJYA 3RJTA 3HYRA 1AB6A 1T8TA 1CUCA 2I2AA 4UPVA 1VDMA 2I2CA 3TXYA 4BX9A 4JI7B 3FR8A 1YS4A 2IBTA 4HUJA 4MKGA 4RK6A 1KQFA 3ILVA 2VH1A 1VPWA 4XDGA 3S2ZA 3PC7A 4Z4GA 2WD7B 3SR0A 1K0UA 2O23A 3GK3A 3BPSA 3PNPA 3DLTA 1T2NA 3RSQA 2JI8A 1RXCA 5ESDA 1TPZA 4NSNA 2A4KA 1J07A 4AY2A 5FYDA 1PKXA 2I6QA 2D4AA 4I8XA 3BIOA 4Z6KA 5C5IA 2PJZA 1W52X 5DT2A 3F1KA 2FZWA 1E0KA 4G8CA 4GOND 3V2UA 1JHQA 1UMCB 2M6RA 4NBKA 4V03A 3QYPA 1JIIA 1R9NA 4Y9DA 4IKPA 4AJIA 4OBWA 2O2GA 2GT1A 3EBPA 3W5VA 1UFQA 1KI8A 2P9JA 1Q2UA 4KQXA 3T5BA 3VSCA 2N9UA 4INOA 4MYSA 5EJAA 4PXYA 2IZ7A 3ZWDA 1GAXA 1TJ4A 3C5CA 4FDUA 1FSZA 3TGWA 3GG9A 4DLZA 1QKIA 4I5GA 4V3BA 3JQGB 1W5AA 3T3NA 1UJ2A 3JXEA 2QRQA 4LRQA 1BA2A 1IU9A 2HU8A 2KLHA 2A4MA 3U9TA 3THXB 4DIKA 2EHDA 2HZ7A 2LDXA 3PXUA 2YFKA 5HMLA 4ZAYA 1F60A 3T7TA 1IY1A 1OA0A 2GLTA 3U3KA 4MUBA 3O3OB 3QMMA 3B82A 4U1RA 5F33A 4R71A 2EF0A 2HWUA 3RVLA 3DO5A 4LJKA 4LWQA 1EGQA 1KOGA 3TOCA 1USKA 4FNMA 3PUKA 1XWIA 3F67A 1AN9A 4YGXB 4F6RA 3DNFA 1J90A 3CNEA 1OTHA 4PG7A 4Y67A 4Z0HO 1SUPA 2YJNA 4BE9A 2ZB4A 1RE0A 2YDXA 2B25A 4N5DA 2YHIA 1XRNA 2CXRA 4O4IF 4CKBB 4PYIA 3ROEA 4YMTA 4NJEB 5EJ8A 3SQXA 1JLKA 2JZNA 1COWA 1H2EA 1XPRA 4HTFA 3L1UA 4F4FA 1UM9B 2JGAA 3LPDA 3WLMA 3TTXA 4GI5A 3UJNA 5LQAA 2QUAA 3FOAA 2L82A 4XKJA 2B98A 4N47A 1TTHA 3OC6A 1M7BA 1SQGA 1V47A 2CJYA 1P5HA 1I32A 2ZXEA 3AL3A 3BDAA 3GJQA 1UKVY 3PNOA 4IGEA 5BY2A 4JV5B 3GLHE 1GCAA 5CRIA 4XCQA 3QQPA 1LVGA 4URUR 3E3MA 4QYTA 2CMGA 3V8RA 4F91B 1E1YA 4YLYA 3L1JA 2VPQA 3PTZA 1EE2A 3TRHA 2BLNA 1IE3A 2OZKA 3UANA 4B47A 4O4LB 2IOHA 1WE2A 3ZXYA 2BZGA 2ZXUA 4Q1VA 1GHTA 3EDRA 5FNVF 1C7FA 1FNDA 2EX0A 2CUNA 3F2VA 4YROA 2YJGA 3V4PB 5KYUB 2A9QA 3OOWA 1YR1A 5FBKA 2CHFA 5H59A 4D2IA 4INPA 3A7EA 5LQKA 3NDIA 5LC1A 1QP4A 3CX4A 3KFLA 4IIFA 1E6UA 2MDTA 1ZVVA 5JWHA 2D54A 2FUKA 1EB9A 2G0NA 3ABQB 4DR2B 1YZ3A 3TQCA 4Q3EA 1GAWA 5F7ZA 1K97A 2EFJA 1R0RE 4M2LA 5CGZA 5DN9A 3B1YA 2D7DA 4HRXA 2RAVA 4RJIA 3HO8A 2ECKA 1W1UA 1VJ0A 2P90A 2DPGA 4RM2A 1XC7A 1TCUA 1MG0A 1RS0A 2CW5A 1EUCA 1U8UA 4M76B 2LUOA 2GEDA 4E12A 4Q93A 4ZAWA 4F8JA 3LCVB 1YJBA 1K89A 1Z25A 4BO6A 5G4KB 4Y2RA 1LJLA 2CBZA 3W2HA 4HNAB 5JH7A 2H65A 4OMFG 4PLTA 1ZR4A 4I50B 4MTLA 1JLLA 2FEMA 3WK7A 3A28A 3KDAA 1XAIA 1T3SA 2W37A 2ZPUA 4MS4A 2GK4A 1HGXA 4CMKA 2CLIB 3D31A 1SKQA 2ZBVA 2JIBA 3KO8A 3DR3A 3KKMA 1CUJA 5B3JC 5MF6A 3NAQA 4F72A 5A9TA 2GD6A 2R60A 2VS1A 1UKZA 2WP8J 5C3UA 4CQLB 3TMKA 1XRQA 4LRUA 1Q16A 3F8SA 4MMYB 4ED9A 2FQYA 3ZXUB 1LNQA 5I7AA 2G72A 1TKCA 1R10A 1RPNA 1L5OA 5FEMA 1WXWA 2YVLA 3KCQA 1UC4B 1ZKDA 2XNDD 4UFPA 3L41A 3WOHA 4FU0A 1ULUA 2CHGA 4LF4B 3BQNB 2BVNA 1E9VA 1TF7A 4FR2A 4IICA 5G4KA 3WYGA 4MR9A 1EM6A 2FA9A 1IUKA 1OV6A 4LMRA 4Q4DA 1XKTA 4I1YA 4Z0TA 1GIAA 5F3DA 1I2MA 2VOEA 3F5SA 4HMPA 1NBOA 2J4FA 3RIYA 2XNCA 3I6IA 5I5EA 4P54A 2PRIA 2OCKA 1XLUA 3H19A 4WEQA 4CR8A 5EA2A 3MMNA 3MWJA 1RHQA 4J16C 1P8AA 4ZKDA 1A5BB 2QLTA 2I54A 2O2EA 2FR8C 2DCUA 4BQEA 5BUCA 2EEZA 4F3TA 4FYWA 3PNYA 2CNBA 2DKNA 1F51E 1ND6A 4WGGA 1MIHA 1U02A 1YACA 3GEMA 2Z8YM 4UULA 1KDVA 3X1DA 2XOEA 3KQUA 2O07A 4JC8A 2C98A 3QKSB 3DB2A 4PLPA 2W6JA 1QO7A 5BSKA 4DA4A 1HV8A 1PGPA 1A97A 3TCXB 5BQPA 1M2EA 1LRJA 4MS1A 2BGNA 3PGMA 1X1AA 1YFZA 2PD4A 1QK3A 3OQIA 3T6KA 5E2BA 1EVQA 1QH1A 2MMGA 3C4QA 1DSSG 4HN9A 1KY5A 4JLKA 2GBLC 4YMIA 3OFNA 4HVCA 1G5HA 4QA9A 1HFKA 3TUIC 5DM4A 4L5JA 1NX6A 2DBVO 4KWIA 1D2MA 3ZVLA 1ZAKA 2NZXA 3D3KA 5DTEA 3FMOB 1RP1A 5JJIA 2C2OA 3AILA 3L8MA 4I14A 1UEJA 2IS1A 3O93A 3P2IA 4GDMA 1NG1A 2QAGC 3GJ4A 1UBNA 4Q66C 4N3BA 5DCUA 4DQUA 3B78A 4OH1A 4IX9A 4RGBA 4LVUA 5KDDA 1XROA 3B13B 2B8WA 3C45A 1LLUA 3IT1A 3KLBA 2HT1A 3U40A 1HT0A 2RHRA 4KLNA 5FPYA 2HQ1A 4YGYA 2Q5IA 3VDMA 3R5SA 4J9VA 3COSA 5DBOA 1GRCA 2QP9X 1WQ3A 2Z6UA 4JEUA 4B79A 3IDFA 3QJGA 3Q2OA 1HYEA 2FZEA 1MEJA 2IPAB 3M7IA 1TW2A 2ICAA 3P8ZA 4OXYA 1O96A 3T1OA 1YZVA 3PR3A 2WLSA 3C1TA 1M2OB 2WYIA 3GMTA 1HKUA 3UG7A 4AZ0B 2WNHA 5I9NA 2AIRA 4GDFA 5A0TA 1L4YA 3ESQA 5JYEA 2WR8A 2E18A 3AHGA 1O95D 1J25A 5PGMA 5BWCA 2FYTA 3UT6A 1CZOA 2ZCUA 4D56A 2WDPA 4HN4B 3WB9A 3MJHA 4N0DA 1IMOA 3WRVA 3OCXA 2POCA 2VNHA 3H04A 5FF9A 5BPFA 2EF1A 4BNTA 1DI0A 1DIGA 4LX0A 5L9AA 2QBYA 2W2QA 1KSJA 3G2JA 3PIDA 2OKGA 4NMLA 4A6XA 1EE1A 2XBMA 5FWXB 3LT4A 1BX1A 4L27A 5FORA 3OOEA 1XZGA 2R8RA 1KY4A 1R7RA 2YHUA 2VYQA 2R6JA 4IJWA 3RFXA 3JQRA 1ECBA 1YI1A 2PNFA 2N1BA 2GAOA 2JJMA 4S1WA 3ESCA 2ECOA 3DL4A 5LDGA 4X3OA 2XZPA 4HI0E 4KPGA 4MS3A 1QYWA 3SJ7A 4QEZA 4ZVVA 3NAZA 3AIMA 3GUCA 4X1YA 1PT7A 5DF1A 4P33A 3WQQA 4BRWA 3Q5DA 4A73A 2PO5A 3PLRA 3ROZA 5ESRA 5DOZA 4BMZA 4ENTA 4KSBA 4QLAA 1I30A 3TNJA 1CYEA 3IS3A 3SLKA 2DHRA 4CT5A 1DQSA 1RHRA 2NTJA 5BV8A 3KJXA 2XT9A 3CPHA 3H9QA 2IEIA 3N07A 3IEXA 2J0UB 5BUQA 1YCHA 1NUQA 2NM0A 3UMCA 1DOZA 1VCIA 3FD8A 1CEXA 2A92A 2OGZA 3L79A 3PHGA 2MSNA 5K3DA 2WU4A 1X1TA 3ADOA 4F21A 4ENUA 4XLLA 1I51A 2KYRA 3QU2A 2RGGA 5HTOA 3G9QA 1QORA 4RWZA 4ZZIA 1JQAA 1RMTA 3EQ7A 4OJYA 4ZCQA 1T9BA 3ZCXA 1U2SA 1X13A 3DM5A 4BPRA 1P2UA 1ZA2A 5G0VA 3AFGA 3H8VA 3U39A 3BHIA 1QIIA 3NDJA 3BS4A 1OIVA 3EY4A 2IIVA 4MP8A 3RU7A 4B5LA 2JANA 2QHXA 4MIEA 4XX0B 2QL6A 1Q50A 3O91A 4BKOA 3WMWA 3Q8MA 4TMFA 3V6MA 2FSUA 3NT4A 2H18A 5ERGB 4AWBA 5ITVA 4KGZA 4BLPA 5IFKA 4OY3A 1C7RA 3H4IA 3ZPXA 1EFHA 3TJZA 4HNQA 3ZH2A 2ENUA 2C7GA 4O2BA 4PSDA 4WNAA 1MT3A 4DE5A 2VA9A 1TAHA 3HB7A 2FWRA 1DV1A 5FUYA 4NK5A 1X7YB 1UIMA 1UMBA 4TKVA 2ZRHA 3R3VA 1XRLA 1NR1A 1PJ2A 1Y0BA 2VAXA 3U26A 1KAEA 4N49A 3BSWA 4EQ6B 3AL0C 4BNWA 4OEHA 4GMDA 4M54A 4PAMA 3N7TA 1FSFA 4DIEA 1CUYA 4BXOA 2WAYA 1AURA 1CIVA 2H63A 2JFPA 4QASA 4JLVA 1YGYA 5F5XA 2JCSA 2MCFA 1L2TA 1O89A 1U94A 3I09A 2W2VA 3L0SA 3LNCA 4PPNA 4RHUA 4WLVA 1GLGA 4HB2A 1E2FA 3UV3A 2NSYA 3OBIA 4YJ2F 1W4ZA 3IUPA 3DKVA 3WLLA 4JI5B 5C7LO 1JWBB 5HM6A 3CZRA 1TMKA 4JJZA 4UBJA 3FCUB 2OMKA 2C9OA 2Q9AA 4YQFA 1JU9A 1JR3E 3AM1A 4MB0A 4QX6A 3EDYA 2QVCA 4BLRA 1Y3BE 1P80A 4JU8A 4X6UA 4YCAA 4YCMA 2PUFA 3U3JA 5LYYA 4PZUA 1JJIA 1AS2A 1UWCA 5THXA 1KOLA 2ZT5A 1GR1A 4N03A 1MB9A 1BMFA 1SBQA 1TF5A 3C7AA 3OH8A 3U3DA 3ZLVA 1H0SA 2GEBA 5E7MA 4I81A 4RV9A 4ZVUA 4EI8A 4MI9A 3WMRA 4GSLA 5ICGA 1TO1E 1LZLA 1VECA 2YY6A 3CF6R 3ZWQA 5H3LA 3IDZA 2BEUA 4UAUA 5CUQA 2C4TA 3KOWA 1BDJA 1USUA 2AB0A 1PG2A 4OQNA 1CK4A 5GM2A 4KPYA 2R6DA 3I2JA 5TY0A 1KJJA 1AA9A 5EERA 2BMEA 1FU4A 4US1R 1OTXA 3CIOA 4YN3A 3RYTC 1M8JA 2GWRA 3EQ6A 3SX4A 3SS9X 1XF1A 4KIGA 4QOSA 4RS4A 2O8FA 1FFXB 3R7WA 2JCXA 3PXDA 1WABA 4U7DA 1EZ4A 3VUFA 1N8SA 3C7CB 4L1KA 5J9FA 3WNBA 3WNCA 3T9CA 4WXRA 1CG6A 2SHKA 3PFHA 3SXJA 4F2WA 2B37A 4KRXA 2HY7A 1OYWA 1N2CE 2NYAA 1C1DA 3NTQA 5KOIA 4P8RA 4RY2A 1J9ZA 1H8HD 3E1SA 4K0KB 3HB1A 2OXTA 5BSWA 3O84A 3G2KA 1W0KA 2BI8A 4R8VA 4BNNA 3KQMA 3HI4A 5ESXA 4DXHA 1PT5A 3A6ZA 3SC2A 4NY1A 4ONEA 3TDMA 4RORA 2ASVA 3AVPA 3OJEA 3LJKA 1J0CA 5BOSB 3HJAA 2JLRA 5BNWA 3EXHA 2B83A 4V2IA 1PF7E 4EPYA 4CIWA 2OGWA 4H7DA 3LBIA 4ND6A 1EKXA 1P6XA 1KU0A 2Y27A 3MOGA 4HWRA 3SXPA 2H4XA 1QH1B 3W6PA 1ZL0A 3CUKA 4K6GA 4OQZA 3T99A 1VCOA 3LO5A 4K9MA 5MGNA 2FPLA 2CL5A 3WGTA 4C2TA 2ZM6B 1V4VA 2NO4A 4R2WA 4D0SA 2AZXA 1U3DA 3LF2A 5T67A 4IIJB 3QV1A 1E9DA 3PE4A 3TLAA 3WKAA 3O3MB 4OM7A 1P5JA 1VBMA 3LWBA 5FOTA 2HJGA 4GKAA 4J0JA 2OORA 5DGCA 3BSSA 4DLKA 3STXA 4DG8A 1ISFA 5KYYA 3O4JA 1GKYA 1K3UB 1KBOA 2IXDA 2XCRB 1E2GA 4CJXA 2OR3A 2O8EB 3AI7A 4PQFA 1Z73A 3V7WA 3ROMA 3NYQA 1M6VA 2R5NA 5CLLA 5BV0A 4M83A 3PFFA 1RYDA 4R69A 3D8BA 1YQEA 1EJ2A 3HCBA 4GXNA 4M37A 1P2VA 4M7OA 5FFMA 1HPLA 2P9YA 3CPEA 1C29B 2YICA 1Y6FA 5JAPA 5KNBA 3FPFA 1WM1A 2BGRA 1HETA 1MQ9A 3DDSA 4A26A 3L8CA 4GWGA 1YL5A 4QECA 4XGNA 3UEOA 2R66A 4JJKA 4A2PA 3UCXA 4CG0A 1K5DA 5JRDS 3LBYA 4QRDA 4GAEA 1X92A 2RHJA 3ZLUA 5K2OA 3VNQA 4JLBA 2W4IA 4PONA 4LYEA 3RRNA 3OURA 2E6KA 1A8HA 2W2TA 1WB9A 2GBPA 3KLOA 3O21A 2XF2A 4PHHA 4YI5A 2AG5A 4BX3A 1U0HC 1W1WA 3ZWBA 4XIIA 3OC0A 3J81k 4Q3LA 3R09A 4IOMA 5IDWA 1N78A 3F1LA 4LHZA 4LUCA 1NATA 2NQ2C 2WUGA 3VSBA 4AYWA 1HTTA 3GEBA 2I91A 4QKQA 1EFCA 3C2QA 3IR5A 2O0LA 4DG5A 1B16A 4U7PB 1OGIA 2QN8A 1VG9B 4C2UA 2AF4C 3KQWA 2ZULA 5BO5A 2AC4A 2AT1A 3CN9A 2XWJI 3AHCA 2KI5A 3DSRA 4M0KA 1VLZA 1XZMA 1GZDA 4HDQB 3DDZX 3VJLA 4AAYA 3KKQA 1KJIA 1XZEA 3EQ9A 1ZMXA 4IIJF 4Q3AA 5FFFA 4NJMA 5KKAA 4KMOA 4QUAA 1OD6A 4QGBA 3PXAA 4PLFA 4RK7A 3RNOA 1U9IA 2EP5A 4FSHA 5T4EA 4BBAA 1ODCA 3GJ7A 2XE6A 3R3UA 4XUEA 3L1VA 1MPXA 5J1SB 1NE7A 2IEGA 2J9YB 2QTVB 1RXVA 5JXJA 3PEUA 1DLJA 3HDTA 3W4JA 1Q84A 3I52A 4Q3KA 1G2OA 1VC2A 2JAWA 3D5EA 4PF1A 4JROA 4WN9A 3RYIB 3JALA 4XX1A 1DPFA 2JFYA 2RH9B 1CEEA 2XOKD 4OXRA 1LTQA 3ACCA 3BFXA 4LHVA 3UJAA 3QNMA 3L82B 2H0RA 3ZEAA 2J3EA 3OZGA 1CIJA 2H54A 3E8SA 1MAWA 2ZS9A 3L77A 2VZ9A 3UH1A 3NGLA 4QRHA 4IMIB 4W5OA 1V2HE 1FLDA 2DY1A 2H92A 2ZDHA 1JEJA 5DCLA 3V4FA 4KFSA 3KKEA 2HCJB 1CUXA 4MYHA 3RAFC 3UO8B 4BMYA 3DT9A 3ENKA 2YKGA 2XNSA 3HWWA 1E2KA 1X38A 3PWSA 2WILA 1U90A 3JD4A 1UM9A 4PQEA 4E3ZA 3E2PA 3RCBA 1P33A 4P9NA 1NU6A 1S89A 2GCEA 1NW9B 2O7VA 4M22A 3BTSA 1JYSA 1U0JA 4OHMA 3TCNA 4CEJB 4JI3B 2NP6A 3I34X 4TV8F 4YX9A 4MP6A 4DCPA 4G63A 4EDHA 1FYEA 1M8FA 3TXXA 2J8ZA 1N0IA 4AULA 4KXMA 3Q7PA 1I4TD 4EYSA 5DV9A 5IXSA 3SEAA 5IXYA 4L8GA 3SX2A 3WLQA 1BEEA 1EDOA 5AP9A 3RBXA 4KV9A 1Y8AA 1SXJC 4AVYA 1V6SA 2ZWMA 4UFOA 3PUVA 2CCKA 2V03A 1IHDA 5J3JA 1VXRA 1XXLA 3JQ9A 1YKGA 3FPHA 3DXFA 1N1GA 1KJQA 2F1RA 2OMEA 2H2FA 2I4RA 1Y81A 1SELA 3H16A 3LOQA 3GJSA 3NLLA 5FTWA 1PNQA 2F43B 3E9NA 1FNNA 2EVWX 1J70A 2Q9UA 2XTJA 2R6GA 1WZUA 2W2OA 3BE6A 3C87A 3K5HA 4DGQA 4GBMA 5T3UA 5HKAA 5DYIA 3U9LA 1PD0A 1S1CA 2D62A 2O7SA 1T2CA 3R3XA 1RI2A 3RC3A 4PN7A 5JCPA 1KNXA 3LRPA 3JAMA 4KPEC 4CXMA 1LBIA 3BMCB 3W8FA 3PUJA 1XZKA 5CM9C 3WKBA 3I6BA 1IOVA 1CE8A 3ROQA 1Q7GA 1RW4A 1GZ7A 2PK3A 3FWKA 3HDVA 5DLEA 4JMLA 3ZW7A 4W5HA 4AG6A 4WCFA 1S8OA 5EJMA 1JBEA 1AM4D 5KJEA 1BMDA 5AHWA 4N8SA 1QE5A 1SN7A 4TWBA 3HACA 1F20A 1GZ6A 1KMHB 1P1KA 3KLMX 3K4HA 3K09C 4WFIA 1IONA 2E37A 1GY8A 1C4KA 4JLDA 1KI7A 1BO6A 3ETLA 4LBVA 4BUZA 5J23A 5H80A 1SG0A 3BL8A 3L6CA 3GLFA 2VTKA 2Q7DA 1Y9JA 4UVEA 4EHBA 4XD7A 2GBLA 2E4WA 4PC7A 1ZWLA 2V7PA 4NONA 2ZUFA 3O92A 1L5LA 5F2NA 1MDBA 2W2PA 2VJDA 4R83A 1O77A 4MIKA 1BROA 5HGXA 1LH0A 4K86A 2AVNA 3M1AA 1Y7HA 5K0JA 3QIVA 2BI7A 1ONNA 1VLHA 1XYVA 4AJ1A 3EARA 4DOMA 4FFDA 4ZHQB 1MEOA 2HV8A 2Q3DA 4P2GA 1H69A 2PWYA 1N5OX 3E5RA 3IUYA 2V5AA 3DEAA 1K6IA 2P41A 1DWQA 4RD4A 3IEKA 4B6JA 5TPZD 1Z2CA 2WT4A 1CR6A 1DEXA 3WADA 4BMCA 4MTCA 1SB8A 4YO7A 1CJSA 4FFWA 3ZGYA 2I4TA 3LNTA 3D81A 2VPYA 1GCOA 4R2JA 2OO5A 2DGDA 4JHXA 3NH9A 5AW6A 1G42A 2EKBA 4YJ3F 4UQPA 3WICA 1I01A 1QQ5A 5DM2A 3UXMA 4MVJM 4CR6A 2ZJ4A 3N3AC 4P80A 2HREA 2CJWB 4CQMB 1Y7PA 5CLFA 2FRVA 1YR6A 2PG3A 1ZNQO 4C14A 5IASA 3G85A 1IN5A 5DP1A 1E92A 1VI6A 3REGA 3R2JA 3OY2A 1XKXA 2ZZNA 3W3AD 5K0LA 4LDNA 1YD7A 5C8YF 4YECA 5CCBA 4H15A 1AV6A 2GJKA 1RZUA 2VTVA 4BWGA 5C80A 5EHXA 2RH4A 2Z4SA 2PUCA 1G6OA 2OHHA 4BNDB 3VR5D 4WZAB 2Z08A 2VQEB 4YAKA 1DWPA 3H5RA 4FDTA 3LECA 1RAAA 4CTJA 4ARIA 2CVQA 4CM3A 3DFMA 3Q0IA 4PYLA 1PR3A 4F11A 1IFXA 3IJEB 3L40A 3VMFA 3RVJA 4P5PA 5FWAA 1JWAB 4QZVA 4AMUA 4F93B 4F9GA 2KMLA 3MUFA 3AV0B 1AUXA 1D9XA 5KYYB 7GPBA 2XVYA 3ZKAA 4H3HB 3FFXA 1IOZA 3GIWA 3R6TA 4C5BA 2VP6A 4QEKA 2VPXA 4ECAA 4Y2SA 1YBAA 1FBTA 1Z4NA 4Q15A 4AZSA 1JFFB 3KK0A 3UY4A 3ZNOA 2FPRA 1C4WA 1ULAA 2JPDA 3A9TA 3NKFA 4LTMA 4M1YA 2BEWB 1T2DA 7REQB 2YW2A 3A06A 3QVMA 1FTNA 3EWSA 2LWIA 4FE3A 1OF1A 1TOAA 1R64A 2JRLA 3OSUA 2XEDA 1FP6A 2PQMA 4KE8A 3QUTA 1E6WA 1M34B 2P4UA 3LHIA 4JENA 1H6AA 4KVAA 4MRPA 4OK3A 5FPHA 1GYQA 5LQRA 2CUZA 1W85A 1S4MA 3C24A 3HN6A 4BC1A 3LWNA 3WFJA 1QGAA 1WMSA 2AD1A 2IOYA 3RDPA 2IBSA 1EE9A 2JHFA 1SQSA 2I76A 1TI7A 5JC1A 3HBAA 2Y9MB 4WSOA 1YB7A 3OKAA 1ZZGA 2PXCA 1J22A 2QRLA 2V7EA 2VRBA 3PXCX 1RPAA 4WESB 4CODB 1KC3A 4Q1CA 3BAFA 2O05A 4AMBA 4AI6A 4WLUA 1YC2A 4KQJA 3QVKA 4LSMA 3QWFA 1C4XA 3FVQA 1DUVG 3PR2B 5KQPA 3N2GA 4ZK6A 4U5QA 3V9PA 2YVAA 4CIXA 1PQWA 4KNWA 4YASA 5MFZA 1GGMA 3H1EA 1PR5A 2AD5A 3FHLA 1OIWA 1C3XA 1WF3A 1QRAA 2CBXA 3K5WA 2OG1A 2XOXA 1B15A 2XKJE 3G5TA 3HLTA 3CSDA 4HDKA 4Z5XA 5JADA 1QHFA 3U80A 1G4AE 1E7WA 3O7WA 2M6LA 1J5XA 2A33A 3RFTA 1Y5IA 3IDQA 4MVJA 3EVDA 3W34A 2XXAA 3MVEA 1OPXA 4FKMA 5KMGB 3LRTA 4E13A 5AK6A 3H83A 1SK9A 4PRLA 4Q7QA 5LOVB 2B3TA 3AKDA 2X0NA 3P4UA 1QIDA 2WJHA 4DDMA 2WYOA 1L7EA 2A78A 2FOIA 2VJOA 4E5UA 4WXEA 2I71A 5HKBA 3CG0A 3FF1A 2ZSHA 3NOOA 4JJFA 1PUJA 4AKEA 3OKCA 1Z6PA 1NE2A 1IZ8A 4NABA 4Y1EA 3ZU3A 1I4LD 1EB8A 1JG1A 2PX8A 3IJRA 4G5HA 4XFJA 5ERXA 3GGPA 5K3BA 3ZZ1A 4CEHB 1I4EB 1X42A 2PZJA 5JANA 1TQ8A 4MWZA 1CEYA 2BSXA 1OT3A 1GD1O 3EIUA 2OQRA 3LH5A 1GV1A 3NIDB 4KTVE 4QD3A 3OEHD 3SEFA 3RUEA 4EG4A 1DQRA 3HUTA 3LSYA 1RKXA 1A0OA 2HDWA 2NTEA 1LLFA 1N0WA 4U7WA 2P9HA 1HLPA 3CH7A 3CEMA 4L9AA 1Z3CA 3RUAA 5IEBA 1XD2A 3B5EA 4MA4A 2V55B 3G2OA 4U9IS 3ST7A 2VT7A 4BKQA 1O0BA 5T5QA 1U1DA 2ZJ8A 3DMPA 3EHDA 1VL1A 2YWXA 3GFFA 3IX7A 1E4OA 4A92A 4B3CA 5KX5F 1MV5A 3TQHA 3HJNA 2CB0A 2FZVA 3AR9A 4K6OA 5DPMA 2XUAA 1AQYA 2IEYA 4JA2A 5TMBA 4RIEA 3AIOA 1JMYA 4C22A 2X3YA 4AK9A 3PE6A 1AF4A 3QJYA 1FUKA 1GUAA 2PJUA 3KC2A 3CZCA 3SM3A 2OCGA 1W8IA 3Q88A 3GJ6A 3I6QA 4HDMB 3L7BA 4NZMA 3LTNC 3SX0A 1I24A 2JKVA 4PYKA 3GLFE 1PW7A 1M6EX 1MX1A 4ZDKA 3DZKA 2AI2A 1CIPA 1T1RA 3E53A 2XIQA 4Z86A 3ZJ4A 3ISJA 4RKQA 4DJFC 1CYDA 1SHJA 3ZU4A 2Q0XA 3FSJX 2OBLA 1ONBA 4GHWA 4F84A 1JFRA 2ZIZA 4LSZA 1QG4A 1EP9A 4O4IB 1NMXA 3QVGB 3SN6A 3ABRB 5HQTA 5CBPA 4FEAA 4XDHA 2PX2A 4JSTA 3S6JA 4ARZA 3B1JA 5ITSA 3W5DA 1QMPA 1FP4B 4DG9A 3E9RA 4EL0A 3TNDA 5C32A 1C2TA 5DM70 4DR7B 1VJTA 1WVGA 1WMDA 4U6NA 4R8RA 3B2EA 4OHBA 5AVWA 5AHRA 3TW6A 5JVDF 3D8HA 1Q2XA 3CUVA 2XLBA 1CQIB 2NU6A 2OP0A 2OSVA 4GE0A 2Q5FA 4TTIA 1XT6A 3NTOA 4OYRA 1R6TA 3T52A 1REQB 4OXIA 3SC3A 1ULZA 1Y4UA 1OHHD 1QKJA 1XQYA 1S7GA 3AW9A 3P4XA 4DDWA 1OYOA 1REQA 3AOEA 3KG2A 4FMBB 1DBQA 3RWOA 2J0UA 1UFRA 1VI5A 1OAKA 3EXHC 3PHCA 4XM1A 2OK7A