5F27A

Structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 2 at 1.68a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
187
Chain Sequence
DRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A fragment merging approach towards the development of small molecule inhibitors of Mycobacterium tuberculosis EthR for use as ethionamide boosters.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator EthR
total genus 80
structure length 187
sequence length 191
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5f27A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5f27A02
2PMZN 3E7QA 4MLOA 3CCYA 4D5FA 1WPKA 5CXGA 4DYCA 2RHAA 4KWAA 1TWGJ 5IPAA 3BR5A 3BG5A 5EYRA 3O60A 1JKPC 1X2NA 2YS9A 4LOCA 2R5YB 4DZJA 3IUVA 2UXOA 3K7AJ 3MVPA 3VPRA 3UKGA 4BBRJ 2NVYJ 1ZGWA 1RKTA 3HOWJ 3S17J 5FKLA 3TP0A 3ZQIA 2HYJA 4AYBN 4IHYA 3OOUA 2EZKA 2L0KA 5JLXA 4GCTA 4XIDA 4GFBA 3VVXA 4MO7A 4XRSA 4JL3A 4A3DJ 3BTLA 2KT0A 3ON2A 4BKXA 2HOAA 2ZCXA 2XDNA 1JTYA 3PM1A 5CXIA 2YVHA 2L7MP 3BJBA 1QVUA 1EF4A 5C44J 3ZQGA 2R5YA 1YRNB 2N8GA 3G7RA 3HTJA 1MH4A 3LSGA 3VW2A 2NOGA 1DU6A 5IP9J 1NTCA 1VFCA 3EUPA 3G1OA 3BR1A 4D7MA 2DMUA 3JSJA 5JLWA 2AO9A 2M8GX 2ID6A 1QVTA 2KDZA 4GCLA 2DA4A 1XS9A 1U9NA 4XICA 2K9NA 2LY9A 1BL0A 2JA5J 4MXMA 4A3KJ 4CGRA 3LSPA 3BTCA 1JKQC 3HOYJ 2DMPA 1ZQ3P 3HTIA 4I76A 2MW8A 1MBKA 3D1NI 1GVDA 5J1YA 5E3MA 2D5VA 1YRNA 1ZKGA 4M3FA 4BXXJ 5HBUA 1AHDP 3HB9A 3S2HJ 2OI8A 3HOVJ 1Q1VA 4JX4A 2D6YA 1W0TA 1IG7A 4JYKA 1Z0XA 4C3JJ 2Y0SN 4FE7A 4XK4A 1JTXA 3QPSA 1E3OC 4A3LJ 3KZ9A 3FK6A 2HDDA 2Y9ZA 4IHWA 1GUUA 1I50J 3BG9A 2G7SA 2DN0A 5GPCA 2NP5A 3G1MA 2GFNA 2AHQA 3S2DJ 3BR2A 1IJWC 5EZGA 5E3OA 3S1RJ 1HOMA 1LE8B 2QOPA 4J19A 3ZOBA 1CQTA 2OF7A 4A3MJ 2ZOYA 1SGMA 3ON4A 3CMYA 3A03A 3JRDA 1G2HA 3SDGA 2UXUA 2UXPA 5H9TA 2JA7J 5GPAA 2LFBA 1RKWA 2FD5A 2QF7A 2PBXA 1HCRA 1ETXA 3HDDA 3RH2A 2XPWA 4X6AJ 4GCKA 3HEFA 4M3EA 3SJMA 4UDSA 1JUPA 5F04A 4QTRA 3VW1A 4FISA 1NK3P 1XG1A 1ETVA 1IDZA 1K61A 1SFOJ 4UUSB 2GLOA 5FHPA 3BG3A 3S14J 3NNRA 1D5YA 3TP3A 1MNMC 3T6NA 2TCTA 5E3LA 5IYBJ 3OSFA 1AU7A 1FTZA 1Y1VJ 1FIAA 4V2GA 5K7FA 5EFYA 1WGXA 3I4NJ 2WB1N 3VP5A 3BNIA 3IH4A 1IRZA 2R5ZB 1I6HJ 1B72B 1NK2P 2VPRA 2DA7A 3JRIA 2HQ5A 5K7HA 4ICHA 3B6AA 3B81A 1IV6A 2LR8A 2EH3A 1JJ6C 1ORKA 3GBGA 5EZHA 5F1JA 2H1KA 3Q3SA 4I6ZA 1QRYA 2JA6J 1IC8A 1JGGA 2H8RA 4A93J 1UI6A 2NVTJ 2QIBA 3FIWA 4NN1A 3DEWA 3LOCA 4A69C 4IHXA 3NI7A 2R92J 3VOKA 1WI3A 3L1PA 3NARA 1UI5A 3A02A 3RQIA 2B63J 3P9TA 2XRLA 2O7TA 2DMTA 4D7NA 3NPIA 2L9RA 2REKA 2JWTA 3IH2A 3BTIA 2OPTA 2NP3A 1WCMJ 1WH7A 2CQQA 3GTQJ 3AQSA 2EZHA 5FKKA 2LD5A 2GENA 5F0CA 3GZIA 3LWJA 2QTQA 5BNGA 1TC3C 3V6GA 3BR6A 3C07A 2WV1A 4M3BA 5K58A 2WUIA 1OCTC 2R7ZJ 1ZTRA 3HGGA 1F43A 2K40A 2ELKA 3NAUA 1GV2A 3MN2A 2DJNA 2RASA 2DA5A 5EG0B 4UUTA 2ZB9A 3HBLA 1BJZA 3BRUA 1JKRC 2EBIA 3HIMA 2TRTA 3S5RA 1OFCX 4A3BJ 1X58A 3DPJA 2HOTA 2JJ7A 3I4MJ 5F08A 5D1RA 2E2IJ 5C4YA 2LVSA 4C3HJ 2ZOZA 3LJLA 3MKLA 4D5CA 1B72A 3S16J 2DG7A 2IEKA 1H89C 2OERA 3O8GA 4YZEA 3HTHA 1TWAJ 2ID3A 2ME0A 1BW6A 3HOZJ 4B1RA 1VI0A 3GEUA 2LKXA 1OCPA 1RESA 4MFDA 4EEFG 2XGEA 3VUQA 3HOUJ 1RR7A 4A3IJ 1T33A 4BBSJ 2L7ZA 2VKEA 4UUSA 4FCYA 3Q0UA 3VW0A 2ME6A 3ZQLA 3QPLA 1FEXA 3AQTA 4NDLA 2YUSA 2CRGA 1HDDC 2G7GA 3Q0WA 3M3YJ 2JA8J 2Y30A 2E19A 4JNNA 2FQ4A 3OIOA 1UG2A 2QKOA 3FISA 1AKHB 4S0HB 5IYCJ 3PO3J 3JRGA 2P81A 1DU0A 2Y31A 5M3FJ 1RETA 3RZDJ 1IDYA 2NS8A 3WHCA 1O4XA 2DG8A 2CJJA 2CUFA 2M34A 2E2JJ 1U8BA 3LSJA 2XSDC 1ETQA 1WH5A 1ZK8A 3JR9A 3S1QJ 3IH3A 3HTAA 4BY1J 4G12A 1FJLA 4A3EJ 1U78A 1H8AC 1GDTA 3JRHA 2Y9YA 1B8IB 1APLC 2HYTA 4B3AA 5F27A 9ANTA 3F1BA 2ZCNA 3BQYA 3COLA 2DTZA 2V57A 3BT9A 4CYCB 4AC6A 4JX5A 3PASA 2HKUA 2DA1A 1ETOA 1JT0A 5D18A 2QWTA 2W53A 2GUHA 1R9TJ 2RAEA 4X1EA 3CDLA 5DTDA 3PPBA 3JRFA 5FLVA 4A3FJ 3TW6A 5J1UA 4JKZA 4PXIA 4M3DA 3NRGA 3GTMJ 1ZR4A 1QPIA 2EZIA 1AKHA 3TW7A 3JRBA 5EEAA 4AC0A 1TWCJ 4AUXA 3S15J 3V78A 3KKDA 2XPVA 4MIMA 4W1UA 1ZR2A 3GTKJ 2YVEA 2LTPA 1JUMA 1POGA 4B4CA 3K2AA 5FJ8J 3OSGA 3Q0VA 3HKZN 1I3QJ 1GT0C 1ETKA 1A5JA 5IP6A 5K7ZA 4IHVA 3CRJA 3GTJJ 5F0HA 5DS9A 3G56A 3KKCA 4GFKA 2FBQA 5F0FA 1UMQA 3TEDA 3WHBA 2E1OA 3G1LA 1Z77A 4CYCA 1XC5A 2XB5A 5M5XJ 2NVXJ 5FGLA 2IAIA 1K83J 1T56A 5HODA 3IV5A 5FKOA 3HGYA 5DAJA 3KNWA 5EGOA 4AF5A 4V2FA 1B8IA 1ITYA 4DW6A 1U9OA 3A01B 1VNDA 3GTGJ 2FJ1A 2ZCMA 5M3MJ 2X9DA 2XB0X 1TWFJ 5IYDJ 3LNQA 3VOXA 4NELA 2XGCA 2HXIA 1LFBA 1ETYA 4A3JJ 1ENHA 3C2BA 5M5WJ 1X2MA 1MBJA 4MFEA 5J1RA 3H0GJ 3NXCA 2HXOA 3VVZA 2ECBA 4C2MJ 2IU5A 5FKNA 2CQXA 3LHQA 3S1MJ 3E7LA 2VI6A 4M6VA 2XPUA 3ZQHA 2I10A 5CW8A 2JK3A 2FX0A 3BTJA 2Y2ZA 2CUEA 1ETWA 2HI3A 1HDPA 3QKXA 5HSZA 2LP0A 3HOXJ 3FK7A 4QIWN 2EQRA 4MK6A 2W48A 1TWHJ 2UXIA 2O8KA 1MBHA 5C4XJ 3F0CA 3BHQA 4RBOA 1JUSA 1PUFB 3DCFA 3B6CA 3S1NJ 3QQAA 2R93J 3M4OJ 2L7FP 2PZ9A 2DA6A 3JRCA 2K9SA 1P7JA 1FTTA 1MBGA 4JP0A 4HKUA 2IBDA 1GV5A 5EF6A 4FE4A 2COBA 4L5EA 5FLMJ 5D19A 3O8HA 2O7OA 2JMWA 4W97A 5GP9A 1MSFC 1LFUP 3EGQA 2G3BA 4QSHA 1W0UA 2NX4A 2M9HA 2WAQN 3ZQCA 1MBFA 2WGBA 1Y1WJ 5FMPA 2CU7A 2UXHA 3JREA 2NS7A 5HAWA 5EG0A 1VF9A 4FTHA 1PUFA 3RKQA 4GFLA 3JRAA 2HOSA 5IOZA 1MSEC 4A3CJ 2XGDA 5C4JJ 3GTPJ 1S7EA 1BA5A 1SANA 4IEJA 4DZPA 2DMNA 4DYRA 3GTLJ 2NVQJ 2F07A 2YU9J 2X48A 3ZQFA 3HM5A 1F36A 1UHSA 1P7IA 4XRMA 1HF0A 3QBMA 1BW5A 3MNLA 1JT6A 4ME9A 3H3VK 2EZLA 3ANGA 4DYQA 3BQZA 2G7LA 2JN6A 4RDUA 1OJLA 2DA2A 5FKMA 3SFIA 3FKIJ 3GTOJ 2K9QA 3VIBA 2LK2A 1FIPA 2E2HJ 2QCOA 3RD3A 3CQZJ 2ECCA 1JJ8C 3LSRA 1LE8A 4HNVA 3VVYA 5AQCA 2O9LA 3A01A 3HE0A 1MBEA 4ACIA 4L62A 3CWRA 5M5YJ 2R5ZA 5C3EJ 5EGOB 2R0QC 2MSYA 1IUFA 2MG4A 5IOYA 2MGQA 2M2EA 2M0CA 3PO2J 5J3LA 1A6IA 5E3NA 4ABZA 2Q24A 2DA3A 2GBYA 3BCGA 2VKVA 3BR0A 5EDNA 5IP7J 3RZOJ 4XRSG 2DMQA 4M3GA 2GM4A 3FRQA 3BR3A 3CJDA 2G0EA 1RPWA 4C3IJ 3ANPA 2X6OA 4A3GJ 1HLVA 1MH3A 1IGNA 4BY7J 3W6VA 4Y52J 2LLKA 1JKOC 4Y7NJ 1H88C 4JX6A 2VUMJ
chains in the Genus database with same CATH superfamily
4AIJA 4HG2A 3E7QA 4KJZA 5DDGA 1VQPI 3DQVC 4ZYGA 4NC6A 2RHAA 3DWLE 3HZJA 3OOPA 4CCLA 1HKTA 3WTZA 3BG5A 5IPAA 3O60A 5DEQA 2YS9A 3FXUA 3HIFA 4LOCA 1R4NB 3WTXC 1EV7A 4DZJA 3ECOA 4Y13A 2FA5A 2UXOA 3I53A 3VPRA 2M0MA 2NVYJ 1XGMA 3HOWJ 5FKLA 3PNTA 4AWXB 3ZQIA 1BC8C 2WY7Q 3EDPA 3OOUA 2L0KA 3ABMH 4LLNA 4GFBA 4HX8A 4A3DJ 3CO6C 1VQMI 2HOAA 4PCQA 3GFIA 2L9VA 2R7VA 5CXIA 4G7HF 1BR2A 2L7MP 5J6XA 3BY6A 5H20A 5KVRA 1QVUA 2KHMA 2Z2SB 1EF4A 1HSTA 3BJOA 1YRNB 2N8GA 2DT5A 2VT2A 2KIFA 3CCJI 2VIXA 4N9HA 3EUPA 4DBRA 1FX7A 1MGTA 3EQLF 1IRXA 3MZ8A 4D7MA 5FB2A 4OAZA 3SZGA 2FNAA 2JUCA 2NYXA 3BG7A 2M8GX 1EA3A 4BYYA 1FBQA 1U9NA 3OL4A 2LY9A 1ON2A 1BL0A 2A6TA 4AU7A 4CCNA 4Q48A 4CGRA 2KMUA 1YITI 3RDIA 1JKQC 3BP8A 2RV8A 1T0FC 4LG0A 3HOYJ 3CMAI 1MDMB 4M72A 1KA8A 1MBKA 3LSHA 2RGVA 2NVUB 4M3FA 2CGPA 4BXXJ 2LY2A 1JI8A 2HS5A 5HBUA 1VQ8I 1USTA 5J4YA 3HB9A 1GLNA 4RB3C 2JSPA 5CQEA 4JX4A 4HZFA 2BY2A 1W0TA 1YG2A 2P7VB 4XK4A 3KZ9A 3DEEA 3FK6A 1F5TA 2PFBA 4CZZA 4IHWA 4PDKA 3SWHA 3U1DA 4Z2YA 2KJCA 4XLAA 2AHQA 4AIHA 3DPUA 2XAFA 1LE8B 2GQQA 1X4PA 2OF7A 2ZSIB 1J9IA 3TO7A 3DLAA 3CMYA 2HQAA 2UXPA 2MC3A 1S8NA 3K4MA 2VBYA 2QF7A 1G4DA 2E7XA 3E3VA 1ETXA 4E7KA 2LY1A 4I98B 3HXLA 2DQRA 4UDSA 4BEHA 2BV6A 4QTRA 2XF6A 2YVXA 1BIAA 4ESFA 1Q1HA 2XASA 3Q5FA 3FX3A 1JHFA 2PMHA 3VFZA 4IKFA 1WZ2A 5DUKA 3WE2A 2V6CA 3JW4A 3F8FA 4QPOA 3LSKA 5E3LA 5IYBJ 1Y1VJ 1O7FA 2ZC2A 3RTRA 3J80K 5D5UB 3I4NJ 2CG4A 3VP5A 4M9SA 2M8EA 2UV1A 3IH4A 5FLXZ 1P4AA 3NWTA 4CUGA 4A5MA 1RC9A 1XX5A 2HQ5A 5K7HA 3R0AA 1FSHA 2K27A 3OYEA 1CF7B 4KICA 4ICHA 3KE2A 1QA6A 4U7BA 5EZHA 4IO9F 1YLFA 5F1JA 4A0XA 2H1KA 4G8XA 4PUSA 3GZNB 4S05A 1JGGA 5D4SA 2H8RA 1ZYRF 2RNJA 4NN1A 3I59A 3DEWA 5L3GA 2VQGA 3HJEA 1OMIA 3VOKA 1WI3A 5CYVA 1UI5A 4IX7A 1YS6A 1YTYA 2D1HA 2XRLA 3BCAA 3ZCOA 2VODA 1TT0A 2HWVA 2L9RA 2JWTA 5ED4A 2OPTA 3PSFA 1FSEA 3O6BB 2ZMEB 2LF7A 5LHGA 4OIOF 1RZ4A 4OMZA 1TC3C 1UHMA 1OCRH 3C07A 2ELHA 3PFIA 4I7HA 3U21A 3PUBA 3OMYA 1SFKA 3MN2A 4P5OA 2WAQA 1KU7A 2DA5A 4XLCA 4I99C 2WTEA 2X6XA 1OFCX 2HOTA 1D8KA 5F08A 3S93A 2ZNZA 4ETSA 5JR3A 1LUJB 2K9MA 3ESWB 4GO1A 3P9CA 4LB6B 2VBZA 1HKSA 3E0JB 3GMEA 3HTHA 1Z7LA 3M07A 1YI2I 3OR1C 1BW6A 2VLAA 2DW4A 4C2UA 4R1HA 1I3AA 1S29A 4G7ZF 1OLTA 3P5JA 4EEFG 2O5RA 2XGEA 2IGMA 3WODF 4EM1A 3L09A 1ZG1A 2DQLA 4RLQA 1A6QA 3Q0UA 3OYIA 2ME6A 2DJIA 1VQLI 2IT0A 5KNLA 1FEXA 4LD5A 4PSWA 3FHNA 3AQTA 2EWNA 2CRGA 2RQPA 4A12A 1HDDC 3Q0WA 3CD6I 2QSFX 4P9UA 4XL9A 1BOAA 3HKZA 1ZH5A 1UG2A 2KRCA 3BZCA 5J4VA 2F5DA 3PUFA 1AKHB 3G4SI 3GFJA 3MKWB 3RZDJ 3GO5A 1RETA 4OOIA 1SFEA 2ZSHB 4WXCA 1O4XA 4BHBA 3BCBA 4CZCA 2E2JJ 1U8BA 5HLGA 1ZK8A 1UG0A 3JTHA 1BR1A 2OUMA 5J40A 2M5WA 4MQVA 1YJWI 4A3EJ 2XUBA 3CJTB 3JRHA 2Y9YA 1EH8A 1T6SA 1QNTA 3REOA 3TKYA 4B3AA 1APLC 4HDVA 2HYTA 4WF2A 5F27A 4U7DA 3JSPA 3BQYA 2DTZA 3HSRA 2RKHA 5GTIC 3K1NA 2K9LA 3R6SA 2ZXWH 4XKBA 2OU2A 3KZZA 3CDHA 4UVAA 3P9KA 1HC8A 2W7NA 5DD8A 4UV8A 5D4RA 4UVBA 3G71I 3CDIA 2W53A 3HRTA 5L3FA 2RAEA 5DTDA 3PPBA 2L7KA 3JRFA 1Y39A 3HPHA 4EATA 1U6GA 2VC1A 2PX9A 1ZR4A 1B6AA 2EZIA 1U3EM 1N77A 1LEAA 4AC0A 3S15J 3U9GA 2ISYA 2ADUA 2XPVA 4U87A 2QYOA 1JUMA 1POGA 3K2AA 3FMQA 3OSGA 3Q0VA 2A5WA 2FBKA 1H0MA 2R3SA 3ISPA 1I3QJ 2K7LA 1GT0C 4XONA 4UHTA 4RA2A 2L54A 1D1BA 5F0HA 3SHFA 3ZPLA 3V7CA 2BOLA 2DFFA 4IRHA 1TLHB 2E1OA 1EH7A 5DV5A 1VQ7I 1XC5A 3M7GA 4KUMA 1K6OA 4YFKF 1T56A 4UVCA 3IV5A 3HGYA 1IF1A 2W00A 3E5UA 3P9IA 1B8IA 1SD6A 2PLYA 1IRGA 3BPXA 2STTA 2CSOA 4DQ2A 5IYDJ 1D0ZA 2P0WA 2ZY9A 5J8CA 1ETYA 2W1OA 4RB2C 1FYKA 2QBYB 3H0GJ 2EPFA 1V5GA 2R7DA 4KT6A 2OC6A 1U5TA 1YE9A 1UAAA 1NG6A 2ZJQF 2I10A 2WV0A 1ZRCA 4HSRA 2FMYA 2FX0A 2DK5A 2HVSA 3M8JA 2L9NA 4G6QA 3VSLA 1HDPA 3I71A 3GZ5A 3HOXJ 3FK7A 2EQRA 4CCKA 5TGTA 4IZZA 2CW0F 4CICA 3PJRA 2UXIA 4LJZF 3GLLA 3K4KA 1MBHA 3O2PE 4AYBA 2ZJRF 4UB6C 1PP8F 1WHUA 3M4OJ 3E97A 2PZ9A 3H5NA 2D1VA 2DA6A 3JRCA 5DD4A 1ONVA 5EF6A 4FE4A 5FLMJ 5D19A 3MCZA 1J09A 1B59A 2PJRA 2HOEA 3I5UA 2NX4A 1XGOA 2QM3A 1QBJA 1MBFA 3JCUC 3ZN1A 1Y1WJ 2WGBA 5FMPA 1D0YA 1S3JA 3K10A 1WJFA 3EUHA 4IHSA 4I09A 4GYIA 5EEHA 4BJ6C 5IY5H 4E7LA 1MMDA 4RS8A 2ZXJA 3GTPJ 1UB9A 2FXAA 3UR3C 1S7EA 3E5XA 2J5OA 2Y0MA 4IEJA 3D5RC 1UFMA 2JZYA 3L7WA 1DUXC 3TO6A 2X48A 3HM5A 4OWRB 4XNFA 3COAC 1UHSA 5AONA 4BE1A 2DFIA 2ELJA 3LFKA 3H3VK 1BC7C 4XLPF 2M7BA 2VONA 5LGUA 4EJOA 2HGCA 4RDUA 1MJBA 1OJLA 1SD4A 3FKIJ 2FF4A 1N25A 2LK2A 3CUQC 4WIBA 4L9JA 1PUEE 3CQZJ 3KCCA 1I39A 1R22A 3AKZA 3N4MA 3RJPA 5E20A 4HNVA 1YJ9I 3WTUC 4ON0A 1HQCA 1J0RA 1YS7A 1FNNA 3A4CA 1F4KA 1FOXA 3AL0B 2YSRA 5M5YJ 3L2CA 1P4XA 2R5ZA 1IUYA 2RVCA 3E6MA 1QGPA 3GWZA 1DPRA 3GFLA 3ZGKA 4X0GA 2OTLI 2DT7B 5J3LA 2A61A 3RKYA 1A6IA 5JFRA 4ABZA 4LG3A 4UUVA 2MH2A 3LA7A 2PMZA 3IWZA 2P6SA 2FEZA 2W24A 1BBYA 4MGRA 3VODA 3FRQA 1FLIA 1O3TA 2K5CA 3CJDA 2GIVA 1Y8QB 4C3IJ 2PFVA 2Z16A 4A3GJ 1HLVA 2E34A 1IGNA 3CUQB 4BY7J 4BGDA 5DCFA 3HRMA 1X3ZB 4Y7NJ 5K5RA 3MZHA 4JX6A 1I5ZA 2LRDA 5D5VB 3ZMUA 5CVVA 2WWYA 4DYCA 4Y4RA 4KWAA 2EIKH 3H9GA 3BR5A 4RGSA 3LFUA 1JKPC 5AIQA 4BACA 5D5WB 1KYWA 2F5VA 3IUVA 4YEJA 1LNWA 3MVPA 1J7KA 1RKTA 2W57A 4E7IA 3S17J 1R36A 2EZKA 2JUGA 5JLXA 5E18F 4DOZA 3MKZA 4EQQA 2IS2A 3BTLA 2FQ3A 1X1AA 2KT0A 1W5CC 4BKXA 1R58A 4OIRF 5D6EA 2R7XA 2YVHA 4NNJA 3ZMVA 3W2WA 1DDNA 3WE3A 1OCOH 2JRMA 4IPAA 2CFOA 2R5YA 2F5CA 2HKXA 2HQRA 2M45A 5DM7F 5LEKA 2O6GE 5IP9J 1DU6A 5BS6A 1NTCA 1ODDA 1DGWY 4PSXA 4A6DA 1WJBA 3BR1A 2E1MC 2DMUA 1MJ9A 1FOKA 3JSJA 4B8XA 3U2RA 5JLWA 2AO9A 3RCOA 1QVTA 2KDZA 4GCLA 2EV6A 1IV8A 2B0LA 3CZ6A 4QLCU 4DIQA 3HUGA 4A3KJ 2DI3A 1WJAA 1S7AA 2PEXA 3L2RA 3LSPA 3MKYB 1MZBA 3TQNA 4YIRX 3GUDA 1R00A 2EFWA 1U0JA 2L4MA 4CDGA 3D1NI 1Y8RB 3FMSA 3FXQA 2D5VA 1VQ4I 4XSZF 3T8TA 1HSJA 1AHDP 1NH3A 4NQWA 1VQ6I 4BHCA 3K4LA 4ESBA 3OYKA 3HOVJ 3DBRB 3WG7H 4ZH4F 1IG7A 4JYKA 5ICGA 3T1BA 2Y0SN 4FE7A 1JTXA 4XR6A 3H5AA 1LDDA 1GUUA 4A0ZA 3G2BA 4L9NA 1O7LA 2R4GA 3G1MA 4ZZDA 4I0BA 1X1BA 4S04A 1FMVA 2Z5UA 3S1RJ 2QOPA 2A69F 4J19A 4BE2A 2VJ5A 2ZJ2A 2ZOYA 3ON4A 1K78B 3JRDA 1TNSA 3SDGA 1OCZH 3CF5F 4L18B 2UXUA 5H9TA 4ZYEA 2JA7J 5GPAA 4PGHA 1D5VA 1RKWA 2FD5A 1Y56A 2KIMA 3QP6A 1KZHA 2PBXA 4KT5C 2V9VA 2VJ4A 2FBIA 2XPWA 3H5RA 4GCKA 1QZYA 1YYVA 1V5EA 1R7JA 2ISZA 2XC7A 2ZMEA 2V1NA 3W3CA 1XG1A 3H3ZA 5DCMA 3CTAA 4OIPF 2NRAC 1ETVA 3CMEI 1SFOJ 4UUSB 4EMSA 1D5YA 1Z21A 4XLHA 1SEUA 4XLEA 6PAXA 4EJUA 2XF7A 2LC2A 2TCTA 1AU7A 3OSFA 4BDYA 4V2GA 1FIAA 4AVPA 1WGXA 4XKWA 5ERIA 4J01A 4QPQA 3E6CC 2L01A 1D1CA 5CVJA 2DBBA 1A35A 2RNGA 1BM9A 4KDPA 3VWBA 2R5ZB 5B1AH 3ZN0A 1B72B 4Z6YA 4EM2A 2VPRA 2JPCA 2QA4I 3QWLA 3J7AY 1WVRA 3ABUA 3B81A 5CVIA 1IV6A 1XMAA 2VT3A 4OIQF 4WK8F 2VKDA 5HDKA 1SFUA 4R79A 5HNFA 3W2AA 2AXLA 2UXXA 2F2EA 1QRYA 3RIRA 2OZUA 1IC8A 4A93J 1UI6A 2QIBA 2Y48A 2R7WA 4IHXA 2R92J 1UELB 4IRIA 2LMDA 3P9TA 2MFZA 4KA4A 3J7AO 2X51A 3OWTA 4JK1X 3NEUA 1UCRA 1I1GA 3IH2A 3BTIA 5D5XB 2HDCA 2NP3A 2CQQA 3T0YA 1TL8A 2COMA 2F5EA 1KQ0A 3CCLI 2LD5A 2VJJA 2HPIA 5F0CA 2W4SA 4MHGA 4EJTA 2B1EA 3I3LA 2OTJI 3G6EI 2DOFA 1QPMA 2WV1A 5K58A 4KIFA 2NS0A 1ZTRA 2NNYA 2RASA 3NI7A 5FLXK 1QHGA 5F1RA 4UUTA 3BRUA 3HIMA 3KX2A 1JKRC 2EBIA 2IGOA 1YHQI 1F9NA 2TRTA 1QO0D 2LOOA 1Z9CA 1GXPA 1VQ9I 2Y75A 1WI9A 2V4JC 3HSFA 2HEOA 1FY7A 3MKLA 4D5CA 3FKJA 4RM2A 2FUG2 4HPQA 1TWAJ 2ID3A 2ME0A 3L2UA 4CHUA 2GA2A 4ESJA 3Q9VA 3R0JA 1LKXA 1VI0A 3DU6A 4CYDA 2LKXA 2CQNA 2D2WA 1OCPA 2ACJA 1RESA 1LDKB 2EIJH 5LRRA 5BPDA 4HF0A 1FZPB 3VUQA 4B3XA 1RR7A 3KPHA 4A3IJ 2L7ZA 2VKEA 3BJAA 3EPZA 4RGXA 2VJIA 2P5VA 5F64A 1DP3A 5LRSA 1HA8A 2K85A 3ZQLA 3KEQA 2P7CB 2W84A 4E6KG 1AWCA 5HLTA 2YUSA 4LG0B 3GEZA 4M9XA 3KZYA 1S5LC 3M3YJ 4BQAA 2VE8A 2JA8J 1ERDA 4U0YA 3OIOA 3KETA 4KIBA 4DNCA 1MD0A 3KYLA 2ZKZA 5AIPA 2QKOA 3ZRGA 3PO3J 2CW7A 3JRGA 2DOAA 3E1SA 3OR2C 5M3FJ 3BROA 1LFPA 2CUFA 2Y69H 4ASNA 1ZRFA 2H27A 3LSJA 3IC7A 1IN7A 1N78A 3JR9A 1WH5A 2YR2A 3IH3A 3HTAA 2FMLA 3KP4A 1XDUA 3V8JA 2E7WA 2KISA 1XMXA 3FXRA 4ZYHA 1B8IB 1JGSA 1A04A 2BGCA 1AA7A 4HA8A 9ANTA 3OYAA 4AIKA 2O61A 2V57A 4II3A 3K4BA 3O3KA 2A5YB 1G3YA 4JX5A 4UV9A 3OY9A 1BOBA 2I8DA 1RR8C 3KFWX 2HKUA 3W6KB 4PFOA 2C6YA 2KDOA 4NB5A 2DTRA 4AD9A 2M4GA 2QWTA 2BXZA 2GUHA 4PJMA 2VQCA 3DKXA 4HV5A 1R9TJ 4X1EA 2F4OB 3OYNA 5FLVA 1YIJI 3TW6A 5J1UA 1X1CA 4PXIA 4YFXF 1DPUA 3GTMJ 1S7OA 3OYCA 2RQQA 1IN5A 2FOWA 2BVMA 3GLXA 4I01A 3JRBA 2M30A 3EYIA 3C7JA 3DBHB 2KIUA 3KKDA 1G3SA 2VE9A 2YVEA 1RNLA 5FJ8J 2V9KA 3I64A 2EFQA 4C30A 3HKZN 1YOVB 4YIFA 1ETKA 5IP6A 2K4JA 5CQGA 3K70D 2R7OA 4V19K 3GTJJ 1MMAA 3G56A 3KKCA 1T39A 5F6FA 2CFXA 2BE5F 1FYLA 3F21A 2ZCWA 1Z77A 4OU0A 5M5XJ 1VQNI 1W5TA 1T0FA 5E17F 5FGLA 5HODA 5FKOA 1HW1A 3UNGC 3KNWA 2L2OA 4R8HA 1ITYA 2XKOA 3H92A 1U9OA 1VQKI 5CPRB 2FJI1 2EFPA 2OZ6A 4ZTJA 1Z3YA 3KLNA 3QYBA 3V42A 1CGPA 2E35A 5J47A 2R7TA 1TWFJ 3VOXA 2VN2A 3VYTB 2GA1A 1ENHA 5L3DA 2AS5F 5M5WJ 4RAGA 2HYFA 1MBJA 3PSIA 4MFEA 4G94A 4LB5A 3VVZA 1OR7A 2IU5A 4ITVA 3TMOA 1R1TA 3S1MJ 2IGNA 1TBXA 3AG4H 4RAZA 5CW8A 1X4OA 2DYRH 4OINF 3HHGA 2X1CA 2Y2ZA 4PFPA 1RUOA 3QP5A 1ETWA 1B4AA 5HSZA 1XTAA 3JTGA 2BHYA 3ASNH 3F22A 5GTHC 3K0LA 1TWHJ 5JVTA 3IRRA 2PI0A 1TTYA 1XSXA 3ZMZA 3G3ZA 4RAYA 2QSGX 2BVLA 2ZMEC 2CV0A 3DCFA 3B6CA 3DTKA 2DAOA 4WXHA 2R93J 1DQUA 5HS8A 2L7FP 2K9SA 1FP1D 1P7JA 2RREA 3DLLF 1FTTA 2GXBA 1GV5A 3QYFA 3TBIA 1NHAA 4N0BA 3SXYA 4W97A 4CH7A 1LEBA 1W36C 4Y3OA 2IXSA 2M9HA 5BQTA 4G9YA 3DP7A 2UXHA 5HAWA 2X1DA 2B9SA 4GFLA 2HOSA 1MSEC 4A3CJ 3ZR8X 1WKMA 5C4JJ 3DFGA 1BA5A 4HV6A 1FT9A 4DYRA 4DZPA 3QAHA 3K1PA 1ZN2A 3HSEA 1T95A 2F07A 2VKHA 3ZQFA 1F36A 4XRMA 5ILUA 4BE0A 1RI7A 1BW5A 3MNLA 2XF5A 4L5IA 2KP6A 4IQ4A 4B48A 4EVIA 1SMYF 3F6OA 3SDBA 2QSHX 4A6EA 1BN5A 5A2QZ 3CCUI 3AL0C 4LITA 3SFIA 1U5TC 3I59B 2HU9A 3DPTA 3NWSA 1LB2A 2K9QA 3QRFF 3VIBA 3FWEA 4RAFA 2QCOA 3RD3A 4HW0A 4ENJA 2JRTA 1G8XA 2UZKA 3U1KA 1P9QC 2HFHA 2VQHA 3ZXSA 1CF7A 3ONQA 4ACIA 4U0WA 2KFDA 3I58A 3S2WA 5C3EJ 4CXFA 2MSYA 2L5QA 3S8PA 2M2EA 2M0CA 4P9FA 3PO2J 2B7EA 3V4GA 1LJ9A 3BZ6A 3C2HA 1N75A 1WRJA 1L3LA 1SAUA 4NQWB 2UWMA 2F4IA 2Q24A 2GOXB 1OCCH 2GBYA 2OV7A 4L9VA 3BR0A 4L5JA 5EDNA 2KZVA 4PZJA 4ZDOA 2GM4A 4BQQA 3BR3A 2CUJA 3LL7A 4DBQA 1RPWA 3ANPA 2XAHA 1MH3A 3W6VA 3PFYA 2FOKA 1KYZA 1YW9A 3F8BA 4HX7A 4L62A 1EH6A 3CCYA 4D5FA 2DYSH 1O3SA 1ZHFA 2JVGA 5EYRA 5LD2C 3BOQA 1XB4A 1X2NA 3CUOA 3R61A 2E60A 2R5YB 1USSA 4H4KC 2ETHA 3LSIA 2XAUA 2R7QA 3QOPA 2QGUA 4M71A 3ULQB 3OS1A 2PBIA 3ERMA 1ZGWA 2A6EF 2X4HA 3M1EA 5EEGA 3CP8A 2HYJA 3C18A 4E7ZA 4IHYA 1D8JA 1T98A 2CV1A 5FD6A 3VVXA 4MO7A 3CJRB 1HBXG 3KYCB 2ZCXA 1FPQA 1JTYA 4PGGA 2HDWA 3PM1A 1WJDA 3MFKA 3BJBA 4Q4ZF 4J00A 3IAS2 3HTJA 3G7RA 2XV4S 3L2QA 1MH4A 3VW2A 1G3WA 2KPMA 3OS2A 5EJCA 3VYRB 1YW8A 1R5HA 2LYCA 1X1PA 3E6DA 4XICA 2IJLA 1YW7A 3OYHA 4OD5A 4MXMA 2L9SA 1SVMA 3RSNA 2G7UA 2K02A 2ZFWA 2E36A 3BTCA 1TQMA 3CUQA 2DMPA 2MW8A 2NAZA 4YELA 5J1YA 5E3MA 1YRNA 1ZKGA 4BS9A 4E4HA 4IHTA 3LAPA 3S2HJ 3ZMTA 5L3BA 4E7HA 4HEA2 3K4NA 2Z9OA 1Z0XA 2IS4A 3SFZA 3T8RA 4A3LJ 5H6RA 4DJAA 2Y9ZA 4B09A 4KISA 3RI4A 1YQAA 2LF8A 2V79A 3CP2A 4FASD 5LGTA 5GPCA 2VC0A 2NP5A 4G6TB 2GFNA 1ZGJA 2WY8Q 5D6FA 3I0TA 1HOMA 4F93B 3ZOBA 4CGZA 4A3MJ 1V4RA 3CESA 1G2HA 2VBXA 2EB7A 2DXIA 2KZGA 1IZ1A 2VPLA 3GX4X 1T8IA 2L4AA 4LIVA 3RH2A 3HDDA 2RN7A 3MQ0A 3HRUA 3BDDA 2XGXA 5JHFA 1D0XA 3SJMA 1JUPA 1VQ5I 1PJRA 5KHDA 1EKEA 1JHHA 4FISA 1NK3P 5HVQC 1SVOA 3WG9A 4WX9A 2QVOA 4RB1A 3KIOA 4RLFA 1IDZA 2GLOA 5FHPA 2HR3A 1QZEA 3NNRA 2EFOA 3KYDB 3W2VA 1BI2A 2J5PA 3TP3A 1MNMC 3LSMA 1FTZA 4CCMA 1ON1A 5DUIA 5D8LB 3C3WA 5K7FA 1LVKA 4FX0A 5L3EA 2BXYA 2WB1N 4XKCA 3BNIA 1I6HJ 5KAIC 1R1UA 2DA7A 2H09A 3J81K 4ENKA 3BPVA 4BXFA 1ZG5A 3K69A 1JJ6C 1NG7A 1ORKA 1W1WE 4XSXF 2OQGA 2A2FX 4KITB 1HW5A 3Q3SA 3FDYA 2PN6A 2UXNA 3IWFA 1DP7P 5K5OA 2NVTJ 3VSKA 3L00A 3N05A 4C9YA 2CWEA 3A02A 3RQIA 2IW5A 5IT9K 1SAXA 2O7TA 2DMTA 3NPIA 3GYHX 2REKA 2DPDA 3VYUB 4HLYA 1B1BA 2WC2A 2YPRA 3I9V2 4EM0B 4BHPA 2V6EA 1X3WB 2XRNA 2KJBA 2EZHA 4N4OB 3AQSA 2H94A 1QU3A 1U5TB 1XMKA 5B1BH 2QTQA 1FOWA 3FXKA 3BR6A 2K3FA 2IS6A 2WUIA 2OAZA 1OCTC 2R7ZJ 2QBYA 3HGGA 1B9MA 4HNTA 3T5XA 3OYMA 3NAUA 2R7RA 1F43A 1GV2A 3FXOA 2GXAA 2VOOA 4L9TA 3IAM2 1UHWA 5EG0B 2ZB9A 3HBLA 1ZLJA 2V26A 2RDPA 3HG9A 1OPCA 1E0EA 3S5RA 2JQ7A 3DPJA 4MQ9F 3I54A 3I4MJ 1QHHD 2Q1ZB 4LLLA 4C3HJ 1XGSA 2ZOZA 3LJLA 1J2XA 4Y15A 1B72A 2IGKA 2IEKA 1H89C 1YX3A 2OERA 3O8GA 3H36A 4FQGA 1KQ9A 2ZBKA 4UXNA 3CJQB 4B1RA 3M9AA 3OS0A 2H6CA 3F23A 2CQKA 2HQNA 1RIOH 2MLKA 1FC3A 3HOUJ 1HXDA 2P4WA 4BBSJ 1S9HA 4I02A 4UUSA 4FCYA 2F48A 2VXZA 4KMFA 2OQRA 1ZREA 4C2MA 4ZDLA 2A3SA 5FGMA 2DODA 5DCMB 4ANJA 3CC7I 2R7UA 3OL3A 3H9QA 3VDXA 2K86A 4FX4A 3K70C 4BU2A 4KFCA 4F52A 5HDGA 3TDZC 3HOTA 2Y30A 1V3FA 4JNNA 2IA0A 1LDJA 2FQ4A 3CO7C 2HZDA 1LQ1A 1P2FA 1D1AA 1I27A 4B47A 2MBFA 3WGGA 1Z3XA 4S0HB 3GCMA 1DU0A 4HYEA 1PYVA 2KLOA 2MD0A 3PL8A 1K78A 2Z99A 2DG8A 2CJJA 2M34A 2XSDC 1DGRM 1ETQA 3S1QJ 3CMMA 2WAFA 4XMYA 4G12A 1U78A 1H8AC 3GFMA 2IRFG 2BHZA 3S3MA 1ZRDA 2YU3A 3F8MA 2VQLA 4WWCA 2ZCNA 4IVNA 3F72A 1GXQA 3GXOA 2EA4A 3BT9A 4UB8C 4AC6A 4FETA 1BI1A 2R7SA 2QQ9A 4XM3A 3LA3A 2DA1A 1H9TA 1ETOA 4K2EA 1JT0A 3ZQ7A 3SEQA 2FNPA 2A07F 2Q2EB 2QQAA 5H6QA 2I5UA 4Y17A 4BQOA 2FE3A 2JSCA 1KQ8A 2CMPA 3FXMA 2ICWG 3HUGB 1VTNC 5HDNA 3FBIB 3TW7A 1AKHA 3GW2A 3G73A 3V78A 3I4PA 4MIMA 4W1UA 4IRVA 2STWA 1MJAA 1Z05A 2KRHA 3Q9SA 1R1VA 3AG2H 4D0PA 3CCQI 5CLSA 1J59A 2TDXA 4NHJA 1Z67A 1G59A 3CRJA 3KP3A 5E1XA 5DS9A 1W36D 3VTIA 4GFKA 2V1UA 2FBQA 3DKYA 3TEDA 3N97A 3DF8A 4A5NA 1VZ0A 2Y0SA 2ZXIA 3R60A 5E8GA 4CYCA 2IVMA 2XB5A 2HZTA 3OIQA 3EUAA 4LK0F 3TOBA 1J5YA 3IKTA 2NVXJ 2IAIA 5ILSA 3WU2C 2HKOA 5B66C 3ERED 4EV0A 1XSDA 5DAJA 4KN4X 4IOCF 5EGOA 5HLHA 4V2FA 3OV8A 3RKWA 3A01B 1IXRC 4LIUA 3WTSC 2FJ1A 1WQ2A 5FRNA 5JI6A 4RM3A 2X9DA 4P96A 3R4KA 2G9WA 3V8LA 1E17A 2HYGD 3DPLC 2GXGA 1LFBA 4A3JJ 2CQ7A 2V1XA 3RPUA 2P8TA 3WGIA 1X2MA 5J1RA 2QENA 3KP6A 3NXCA 2QLZA 1W7PD 2ECBA 2XIGA 2LNBA 4C2MJ 5FKNA 2CQXA 1S72I 3LHQA 3WTYC 2Q8KA 5ICEA 2DLLA 1YJNI 3OYDA 4M6VA 3ZQHA 4UY8I 2PG4A 4KYWA 4YG2F 2JK3A 4XLFA 3BTJA 2R7FA 1X19A 3ZMDA 3RYRA 2L02A 2LP0A 3ZMSA 4O3MA 5GAHJ 4QIWN 1ZLKA 5J8FA 3ROUA 2OD5A 2VBWA 2O8KA 3V7SA 2YX4A 3F0CA 3BHQA 4RBOA 2LG4A 2CYYA 1P92A 1PUFB 3S1NJ 2BEOA 4G7OF 2ZJPF 3JAMZ 1J75A 4HKUA 1MBGA 4JP0A 2IBDA 3CF2A 3MWMA 2V9PA 2COBA 2FU4A 4L5EA 3CCMI 4XN0A 2GOMA 3O8HA 2O7OA 2JMWA 5DYMA 5GP9A 1MSFC 1LFUP 3EGQA 5ICCA 4QSHA 1W0UA 2P6TA 2EV0A 2WAQN 3V8KA 3CC4I 2CU7A 2BYVE 1IN6A 2BZTA 5KCMA 2NS7A 3JREA 3C2GA 4MTDA 2ZXHA 4FTHA 3WTTC 1PUFA 2FRHA 2LBFB 3MZYA 3JRAA 2RC4A 2BW3A 3OYJA 2XGDA 2HVRA 1SC7A 1WJCA 5H2FC 4HNUA 2NVQJ 4JQFA 2YU9J 2LKSA 3WGHA 1BR4A 4MEXF 3EYYA 1P7IA 4PJLA 5A2QK 3NS4A 3QBMA 1IXCA 5CJ9A 4ME9A 1JT6A 2YX7A 1RRJA 3NQOA 3ANGA 4DYQA 2H1LA 2MYSA 3BQZA 2G7LA 2JN6A 1O57A 4Q47A 1R23A 1ZAOA 2DA2A 2ZO4A 5FKMA 3IHUA 3L9FA 4KIGA 3ML6A 1Z7UA 1PVEA 3KZIC 1FIPA 2E2HJ 1VQOI 4RB0A 2DU9A 4ZZLA 2ECCA 3PNVA 1XSVA 1MKMA 4E7JA 3LSRA 1LE8A 2HNHA 2BY0A 2PJRB 3VVYA 4D1QA 1C0WA 5HS9A 4HSTA 5TISC 3A01A 3S3NA 1MBEA 2VL8A 4LK1F 2X6WA 1RUNA 3CWRA 2DCEA 1G6NA 3F9KA 5EGOB 2GAUA 5LFAA 3CCSI 3HYIA 4N9IA 2MGQA 4OAYA 2NXNB 5B3SH 4A0YA 5LGNA 2P5KA 5LLQA 4GYGA 3KEYA 1IW7F 3C1DA 3H35A 2KRFA 3A2KA 5E3NA 2ZNYA 3KLOA 5E79C 2DA3A 3LWFA 4PK4A 4XORA 1MNDA 3BJ6A 1TP4A 2CS3A 2W85A 3RZOJ 2DMQA 4M3GA 3CCEI 2A6HF 4KMUX 4HQMA 2NOJB 1MW7A 1REPC 1I1SA 3DBLB 1WSUA 3WU1B 4HBLA 2M87A 2LLKA 2MD5A 2MC4A 2VUMJ 2PMZN 3QPTA 3FM5A 4MLOA 2QUFA 1AOYA 1TZLA 1WPKA 2FBHA 5CXGA 3SZTA 1TWGJ 4EJWA 3LSTA 4H0EA 2Q2EA 2A05A 1WFXA 1WJ5A 4GDFA 2A68F 2DO7A 3CJNA 1TQIA 2GIZA 5FRMA 1KGSA 5ICFA 3K7AJ 3UKGA 4BBRJ 2QKMB 5DM6F 1OQYA 3TP0A 3IUOA 4AYBN 1W7PB 2M4KA 4IRGA 5FFXA 3K4CA 4GCTA 5TJJA 4XIDA 3LAJA 4RGRA 4XRSA 4JL3A 5ILVA 2EA2A 4LGWA 2DFEA 3BZKA 3FM3A 4LMYA 3OYFA 1IAWA 2XDNA 3ON2A 3X2QH 2BY3A 5B5EC 1HKQA 5C44J 2F6CA 3ZQGA 3F3XA 2O3FA 3LSGA 2WB1A 2NOGA 2V1DA 1R6RA 2IS1A 1VFCA 1TT5B 3G1OA 3ZQQA 5FD5A 4D9JA 4F92B 2EV5A 2VXDA 2BY1A 2ID6A 3VEPA 3EUHC 4M9ZA 2DA4A 1XS9A 2K9NA 2JA5J 1EJ9A 4LLGF 4NC7A 3TDUC 1V5FA 2G7HA 4U88A 2IPQX 4AM3A 4DGWB 4ZTFA 1ZQ3P 3HTIA 4I76A 1GVDA 4MTEA 2DK8A 3HTUA 1R5GA 2XROA 3TOAA 3LQRA 5LBQA 1IXSB 1SFXA 3JSOA 2OI8A 5BOXA 1Q1VA 2D6YA 4NBQA 4C3JJ 3QPSA 3A0BC 1E3OC 2E1NA 4BUPA 2HDDA 1W7PA 5BMZA 3TGNA 1QQIA 1S6LA 1I50J 4RGUA 3BG9A 2H6BA 4B44A 3DU5A 3K6GA 2DN0A 2G7SA 1Y0NA 2F4MB 5LHIA 3S2DJ 1YFHA 3BR2A 3K1MA 4KN7X 2IA1A 1IJWC 5EZGA 4AVZA 5E3OA 5GAEJ 3HTSB 1CQTA 5HOOA 1SGMA 4OD4A 3A03A 4YRVA 2JT1A 5KAFC 4ZDPA 1TNTA 1ACIA 2IP2A 2LFBA 2O03A 1UJ8A 2Z1DA 4ENNA 4PJ0C 1P4WA 3SYTA 3I55I 1HCRA 5K5QA 2XDVA 2F5FA 4X6AJ 3GVAA 3HEFA 4M3EA 3ELKA 4OMYA 5F04A 3FXLA 3OYBA 3M8EA 3VW1A 3DKWA 1M1EB 2AQEA 3QODA 3QU6A 1XDSA 1K61A 3S32A 4BQNA 2XKPA 2EFNA 3BG3A 3AAFA 4NC8A 3GZ6A 3S14J 5D8KB 3ABKH 2D45A 2MH9A 2X1EA 3T6NA 2GWRA 3PQJA 2DT6A 3VB2A 5EFYA 4XLNF 4BL0B 1LPQA 3DEUA 5CKTA 3H9JA 2ESHA 1ZARA 2AXTC 1IRZA 1KONA 1WJEA 1NK2P 3JRIA 3MD2A 2DFHA 3J80Z 3NRVA 3B6AA 3ECHA 2VOPA 2LR8A 4HX4A 2EH3A 4AIDA 2XVCA 3GBGA 3GF2A 3IP4B 2VASA 1WWXA 3WU0A 2OCEA 4I6ZA 2JA6J 1R71A 3J81Z 3I56I 2CW8A 3FIWA 2X85A 3LOCA 1D3YA 4M73A 4N4NB 4A69C 3AFHA 1SMTA 3H0DA 2EINH 4HF1A 5FFZA 4L0YB 3L1PA 1R4MB 1OYIA 3NARA 1UZCA 2B63J 3PQKA 3V7RA 3IL2A 3M1CA 3TO9A 4HDUA 5L3CA 4D7NA 2QEXI 3BC8A 4F91B 1K4SA 3HOSA 1WCMJ 1WH7A 1KU9A 3GTQJ 3ASOH 5FKKA 2GENA 3H1CA 1E3PA 1SVLA 3CCVI 2MLGA 5HLIA 3GZIA 3LWJA 5BNGA 3V6GA 1Y6IA 1ZELA 3MEXA 3B73A 4P55A 4M3BA 1FBUA 3LMMA 5TRDA 2BW3B 3HPGA 2K40A 2ELKA 2LBFA 2DJNA 4XKVA 4BJTA 4XN3A 2QZ8A 3CLOA 2MABA 1BIBA 1XN7A 1BJZA 3D5SC 3PIPF 3AG3H 1G3TA 1HW2A 1E3HA 1X58A 3CLQA 4A3BJ 1XCBA 2JJ7A 2AQFA 2M3AA 2E2IJ 5D1RA 1SD7A 5C4YA 2K4BA 2OJED 4M6XA 2LVSA 1FOYA 4XOPA 2DG7A 3S16J 2ZFUA 4P1WA 4YZEA 1YX5A 4E7SA 1IO2A 3WTWC 3D0SA 5JVGF 2Q0OA 3HOZJ 5IT9Z 1STZA 1R49A 3GEUA 5JHUA 2OCCH 4U9LA 1MMGA 1Z91A 4MFDA 4YFNF 2W82A 4DVYP 2JPBA 2UUZA 4CSWA 3S3OA 3FBNB 1T33A 3FF5A 1B9NA 4WCGA 3VW0A 2EK5A 3QPLA 2XAJA 2W25A 3RPUD 4NDLA 1K7AA 2G7GA 4BEHB 3PIOF 5FO5A 2X6YA 2QQBA 3IKVA 5IT3A 2E19A 1L0OC 5GADJ 1V55H 4I0AA 4II2A 1ZG3A 1KU3A 3SEZA 3FISA 4Q5SF 5IYCJ 1OYWA 3EUKL 2P81A 2Y31A 2FSWA 1IDYA 4B43A 2NS8A 2JVHA 3WHCA 2M1BA 1XD7A 3BG6A 1Z6TA 3A1YA 2XAQA 5E1WA 1ULYA 4BY1J 1ZGAA 3F8NA 4MEYF 2EILH 3MMYB 1FJLA 2DPUA 2O8XA 1BJAA 1GDTA 2M7AA 3FZVA 2HTJA 1U2WA 2DDBA 3KEOA 4L0ZB 3F1BA 1K6YA 3COLA 4F7ZA 1FYMA 3CC2I 4CYCB 3B02A 3TL4X 1FBSA 3PASA 3WTVC 3RQ4A 2KKOA 4E70A 1KU2A 1PDNC 4HQEA 4BAYA 4CA0A 2NNNA 5D18A 1IRFA 3QYEA 4C2TA 1T38A 1O3QA 4LFUA 1MDMA 3CDLA 1I6XA 4MNUA 5LEJA 2BBYA 4HRIA 2OBPA 2KIQA 1FWZA 4A3FJ 4JKZA 1IN4A 4M3DA 3MAJA 3NRGA 4IL6C 1QPIA 1GHCA 2CO5A 5EEAA 3E6BA 1FP2A 2XHKA 1TWCJ 4XOTA 4AUXA 3K9TA 1ZR2A 1Z6RA 2QWWA 4ZYAA 3GTKJ 1E2XA 4HAMA 1PP7U 2LTPA 4GRIA 4B4CA 1BI3A 1YIOA 4ZC3A 2WBMA 3SZPA 4PJJA 4ENMA 3H3UA 1OYYA 1A5JA 5K7ZA 4GXOA 4M74A 4IHVA 1TQPA 4IQJA 2QQ8A 2X0LA 3RPQA 1F1ZA 3QPHA 4UNOA 1LVAA 2PJPA 1P6RA 5F0FA 1UMQA 2DOEA 3CCRI 3WHBA 4BDZA 3G1LA 1XGNA 5BPIA 1T2KA 2HPMA 5LHHA 2LSOA 1K83J 2QKLB 1X1DA 3LA2A 4JOMA 4AF5A 4IXAA 5CVRA 3VOEA 3F6VA 4DW6A 1O3RA 2OA4A 1VNDA 3GTGJ 3KP5A 4F55A 4HLXA 5KK1A 2MA3A 2ZCMA 5M3MJ 2V7FA 2XB0X 1MMNA 3LNQA 4NELA 2XGCA 1JXSA 4XBFA 2HXIA 1OISA 2JA2A 4GCVA 4YIIA 4ZYDA 2B3WA 3C2BA 4TV7A 4WXDA 2WA0A 3DV8A 2HXOA 3OYLA 2E71A 4G6DA 1A36A 2GZWA 3E7LA 2VI6A 3HRSA 2XPUA 3FMRA 4XRFA 5HS7A 3RYPA 4NUBA 4RMNA 2O0YA 2CUEA 3A0HC 4EGYA 2IA2A 2HI3A 3K2ZA 3W6JB 4GGGA 3QKXA 4MK6A 2W48A 3ABLH 4KNYA 2PQ8A 1FMWA 1IN8A 5FROA 5C4XJ 1BI0A 3L2WA 1GVJA 3ABTA 1JUSA 2XSJC 3QQAA 2XAGA 3RKXA 1XPXA 3QU3A 4IOAF 2ESNA 3M8FA 4BH9A 4CO8A 3DTEA 1W4MA 3HHHA 4IF4A 4IJAA 2G3BA 2P5LC 1T08B 3ZQCA 3AG1H 3JAMK 2LKPA 3ZP5A 2JTVA 1TW3A 3OIPA 1QZZA 5EG0A 1VF9A 1OKRA 1OR7C 4M6YA 4QWQA 3RKQA 5IOZA 3DTIA 2H8WA 5CVUA 1YO5C 1XCVA 3F8CA 3KP2A 1SANA 2K3PA 1MNEA 4F3QA 2DMNA 3GTLJ 3DXJF 3K4JA 3FXJA 1H9GA 1K4TA 5E1ZB 4ZJZA 2E1MB 3FHZA 2HVQA 2Z3YA 4XQFA 1HF0A 1JE8A 4O5VA 1W5SA 3E5QA 2EZLA 3PNYA 1SD5A 1MMSA 1V54H 3HL2A 3KP7A 4PJNA 3L2VA 2PMUA 1Z1DA 4O6JA 2HTSA 2EJRA 1R5ID 3GTOJ 1K79A 1X3UA 2Z33A 5HNHA 4FT8A 2KL4A 3QOEA 2DDAA 1JJ8C 2EIMH 2KQRA 4HF2A 2WAEA 3LQQA 4CCJA 2CUZA 4U0VA 2E5ZA 4Y33A 1TW2A 3D5LA 1U8RA 4BXUA 5AQCA 2LDUA 2O9LA 1Y0UA 3HE0A 4HOBA 3K8PC 4EJVA 4BJ5C 2CH0A 2R0QC 2E1CA 3HC7A 1IUFA 1MIJA 2MG4A 3EETA 3P7NA 5IOYA 3J7YJ 4EGZA 2CV2A 3BLYA 3J7ZI 4FHTA 2LH9A 3BCGA 5E8IA 2VKVA 4BNCA 2VB6A 5IP7J 4XRSG 3OYGA 3VYSB 1A31A 4U9NA 2L3DA 4CCOA 4I2OA 2G0EA 2X6OA 5GAGJ 2WADA 2LREA 4Y52J 4A2UA 3IRQA 4JBAA 2E5NA 3SQNA 5K1YA 1JKOC 3BWGA 1H88C
chains in the Genus database with same CATH topology
2PMZN 3E7QA 4MLOA 3CCYA 4D5FA 1WPKA 5CXGA 4DYCA 2RHAA 4KWAA 1TWGJ 5IPAA 3BR5A 3BG5A 5EYRA 3O60A 1JKPC 1X2NA 2YS9A 4LOCA 2R5YB 4DZJA 3IUVA 2UXOA 3K7AJ 3MVPA 3VPRA 3UKGA 4BBRJ 2NVYJ 1ZGWA 1RKTA 3HOWJ 3S17J 5FKLA 3TP0A 3ZQIA 2HYJA 4AYBN 4IHYA 3OOUA 2EZKA 2L0KA 5JLXA 4GCTA 4XIDA 4GFBA 3VVXA 4MO7A 4XRSA 4JL3A 4A3DJ 3BTLA 2KT0A 3ON2A 4BKXA 2HOAA 2ZCXA 2XDNA 1JTYA 3PM1A 5CXIA 2YVHA 2L7MP 3BJBA 1QVUA 1EF4A 5C44J 3ZQGA 2R5YA 1YRNB 2N8GA 3G7RA 3HTJA 1MH4A 3LSGA 3VW2A 2NOGA 1DU6A 5IP9J 1NTCA 1VFCA 3EUPA 3G1OA 3BR1A 4D7MA 2DMUA 3JSJA 5JLWA 2AO9A 2M8GX 2ID6A 1QVTA 2KDZA 4GCLA 2DA4A 1XS9A 1U9NA 4XICA 2K9NA 2LY9A 1BL0A 2JA5J 4MXMA 4A3KJ 4CGRA 3LSPA 3BTCA 1JKQC 3HOYJ 2DMPA 1ZQ3P 3HTIA 4I76A 2MW8A 1MBKA 3D1NI 1GVDA 5J1YA 5E3MA 2D5VA 1YRNA 1ZKGA 4M3FA 4BXXJ 5HBUA 1AHDP 3HB9A 3S2HJ 2OI8A 3HOVJ 1Q1VA 4JX4A 2D6YA 1W0TA 1IG7A 4JYKA 1Z0XA 4C3JJ 2Y0SN 4FE7A 4XK4A 1JTXA 3QPSA 1E3OC 4A3LJ 3KZ9A 3FK6A 2HDDA 2Y9ZA 4IHWA 1GUUA 1I50J 3BG9A 2G7SA 2DN0A 5GPCA 2NP5A 3G1MA 2GFNA 2AHQA 3S2DJ 3BR2A 1IJWC 5EZGA 5E3OA 3S1RJ 1HOMA 1LE8B 2QOPA 4J19A 3ZOBA 1CQTA 2OF7A 4A3MJ 2ZOYA 1SGMA 3ON4A 3CMYA 3A03A 3JRDA 1G2HA 3SDGA 2UXUA 2UXPA 5H9TA 2JA7J 5GPAA 2LFBA 1RKWA 2FD5A 2QF7A 2PBXA 1HCRA 1ETXA 3HDDA 3RH2A 2XPWA 4X6AJ 4GCKA 3HEFA 4M3EA 3SJMA 4UDSA 1JUPA 5F04A 4QTRA 3VW1A 4FISA 1NK3P 1XG1A 1ETVA 1IDZA 1K61A 1SFOJ 4UUSB 2GLOA 5FHPA 3BG3A 3S14J 3NNRA 1D5YA 3TP3A 1MNMC 3T6NA 2TCTA 5E3LA 5IYBJ 3OSFA 1AU7A 1FTZA 1Y1VJ 1FIAA 4V2GA 5K7FA 5EFYA 1WGXA 3I4NJ 2WB1N 3VP5A 3BNIA 3IH4A 1IRZA 2R5ZB 1I6HJ 1B72B 1NK2P 2VPRA 2DA7A 3JRIA 2HQ5A 5K7HA 4ICHA 3B6AA 3B81A 1IV6A 2LR8A 2EH3A 1JJ6C 1ORKA 3GBGA 5EZHA 5F1JA 2H1KA 3Q3SA 4I6ZA 1QRYA 2JA6J 1IC8A 1JGGA 2H8RA 4A93J 1UI6A 2NVTJ 2QIBA 3FIWA 4NN1A 3DEWA 3LOCA 4A69C 4IHXA 3NI7A 2R92J 3VOKA 1WI3A 3L1PA 3NARA 1UI5A 3A02A 3RQIA 2B63J 3P9TA 2XRLA 2O7TA 2DMTA 4D7NA 3NPIA 2L9RA 2REKA 2JWTA 3IH2A 3BTIA 2OPTA 2NP3A 1WCMJ 1WH7A 2CQQA 3GTQJ 3AQSA 2EZHA 5FKKA 2LD5A 2GENA 5F0CA 3GZIA 3LWJA 2QTQA 5BNGA 1TC3C 3V6GA 3BR6A 3C07A 2WV1A 4M3BA 5K58A 2WUIA 1OCTC 2R7ZJ 1ZTRA 3HGGA 1F43A 2K40A 2ELKA 3NAUA 1GV2A 3MN2A 2DJNA 2RASA 2DA5A 5EG0B 4UUTA 2ZB9A 3HBLA 1BJZA 3BRUA 1JKRC 2EBIA 3HIMA 2TRTA 3S5RA 1OFCX 4A3BJ 1X58A 3DPJA 2HOTA 2JJ7A 3I4MJ 5F08A 5D1RA 2E2IJ 5C4YA 2LVSA 4C3HJ 2ZOZA 3LJLA 3MKLA 4D5CA 1B72A 3S16J 2DG7A 2IEKA 1H89C 2OERA 3O8GA 4YZEA 3HTHA 1TWAJ 2ID3A 2ME0A 1BW6A 3HOZJ 4B1RA 1VI0A 3GEUA 2LKXA 1OCPA 1RESA 4MFDA 4EEFG 2XGEA 3VUQA 3HOUJ 1RR7A 4A3IJ 1T33A 4BBSJ 2L7ZA 2VKEA 4UUSA 4FCYA 3Q0UA 3VW0A 2ME6A 3ZQLA 3QPLA 1FEXA 3AQTA 4NDLA 2YUSA 2CRGA 1HDDC 2G7GA 3Q0WA 3M3YJ 2JA8J 2Y30A 2E19A 4JNNA 2FQ4A 3OIOA 1UG2A 2QKOA 3FISA 1AKHB 4S0HB 5IYCJ 3PO3J 3JRGA 2P81A 1DU0A 2Y31A 5M3FJ 1RETA 3RZDJ 1IDYA 2NS8A 3WHCA 1O4XA 2DG8A 2CJJA 2CUFA 2M34A 2E2JJ 1U8BA 3LSJA 2XSDC 1ETQA 1WH5A 1ZK8A 3JR9A 3S1QJ 3IH3A 3HTAA 4BY1J 4G12A 1FJLA 4A3EJ 1U78A 1H8AC 1GDTA 3JRHA 2Y9YA 1B8IB 1APLC 2HYTA 4B3AA 5F27A 9ANTA 3F1BA 2ZCNA 3BQYA 3COLA 2DTZA 2V57A 3BT9A 4CYCB 4AC6A 4JX5A 3PASA 2HKUA 2DA1A 1ETOA 1JT0A 5D18A 2QWTA 2W53A 2GUHA 1R9TJ 2RAEA 4X1EA 3CDLA 5DTDA 3PPBA 3JRFA 5FLVA 4A3FJ 3TW6A 5J1UA 4JKZA 4PXIA 4M3DA 3NRGA 3GTMJ 1ZR4A 1QPIA 2EZIA 1AKHA 3TW7A 3JRBA 5EEAA 4AC0A 1TWCJ 4AUXA 3S15J 3V78A 3KKDA 2XPVA 4MIMA 4W1UA 1ZR2A 3GTKJ 2YVEA 2LTPA 1JUMA 1POGA 4B4CA 3K2AA 5FJ8J 3OSGA 3Q0VA 3HKZN 1I3QJ 1GT0C 1ETKA 1A5JA 5IP6A 5K7ZA 4IHVA 3CRJA 3GTJJ 5F0HA 5DS9A 3G56A 3KKCA 4GFKA 2FBQA 5F0FA 1UMQA 3TEDA 3WHBA 2E1OA 3G1LA 1Z77A 4CYCA 1XC5A 2XB5A 5M5XJ 2NVXJ 5FGLA 2IAIA 1K83J 1T56A 5HODA 3IV5A 5FKOA 3HGYA 5DAJA 3KNWA 5EGOA 4AF5A 4V2FA 1B8IA 1ITYA 4DW6A 1U9OA 3A01B 1VNDA 3GTGJ 2FJ1A 2ZCMA 5M3MJ 2X9DA 2XB0X 1TWFJ 5IYDJ 3LNQA 3VOXA 4NELA 2XGCA 2HXIA 1LFBA 1ETYA 4A3JJ 1ENHA 3C2BA 5M5WJ 1X2MA 1MBJA 4MFEA 5J1RA 3H0GJ 3NXCA 2HXOA 3VVZA 2ECBA 4C2MJ 2IU5A 5FKNA 2CQXA 3LHQA 3S1MJ 3E7LA 2VI6A 4M6VA 2XPUA 3ZQHA 2I10A 5CW8A 2JK3A 2FX0A 3BTJA 2Y2ZA 2CUEA 1ETWA 2HI3A 1HDPA 3QKXA 5HSZA 2LP0A 3HOXJ 3FK7A 4QIWN 2EQRA 4MK6A 2W48A 1TWHJ 2UXIA 2O8KA 1MBHA 5C4XJ 3F0CA 3BHQA 4RBOA 1JUSA 1PUFB 3DCFA 3B6CA 3S1NJ 3QQAA 2R93J 3M4OJ 2L7FP 2PZ9A 2DA6A 3JRCA 2K9SA 1P7JA 1FTTA 1MBGA 4JP0A 4HKUA 2IBDA 1GV5A 5EF6A 4FE4A 2COBA 4L5EA 5FLMJ 5D19A 3O8HA 2O7OA 2JMWA 4W97A 5GP9A 1MSFC 1LFUP 3EGQA 2G3BA 4QSHA 1W0UA 2NX4A 2M9HA 2WAQN 3ZQCA 1MBFA 2WGBA 1Y1WJ 5FMPA 2CU7A 2UXHA 3JREA 2NS7A 5HAWA 5EG0A 1VF9A 4FTHA 1PUFA 3RKQA 4GFLA 3JRAA 2HOSA 5IOZA 1MSEC 4A3CJ 2XGDA 5C4JJ 3GTPJ 1S7EA 1BA5A 1SANA 4IEJA 4DZPA 2DMNA 4DYRA 3GTLJ 2NVQJ 2F07A 2YU9J 2X48A 3ZQFA 3HM5A 1F36A 1UHSA 1P7IA 4XRMA 1HF0A 3QBMA 1BW5A 3MNLA 1JT6A 4ME9A 3H3VK 2EZLA 3ANGA 4DYQA 3BQZA 2G7LA 2JN6A 4RDUA 1OJLA 2DA2A 5FKMA 3SFIA 3FKIJ 3GTOJ 2K9QA 3VIBA 2LK2A 1FIPA 2E2HJ 2QCOA 3RD3A 3CQZJ 2ECCA 1JJ8C 3LSRA 1LE8A 4HNVA 3VVYA 5AQCA 2O9LA 3A01A 3HE0A 1MBEA 4ACIA 4L62A 3CWRA 5M5YJ 2R5ZA 5C3EJ 5EGOB 2R0QC 2MSYA 1IUFA 2MG4A 5IOYA 2MGQA 2M2EA 2M0CA 3PO2J 5J3LA 1A6IA 5E3NA 4ABZA 2Q24A 2DA3A 2GBYA 3BCGA 2VKVA 3BR0A 5EDNA 5IP7J 3RZOJ 4XRSG 2DMQA 4M3GA 2GM4A 3FRQA 3BR3A 3CJDA 2G0EA 1RPWA 4C3IJ 3ANPA 2X6OA 4A3GJ 1HLVA 1MH3A 1IGNA 4BY7J 3W6VA 4Y52J 2LLKA 1JKOC 4Y7NJ 1H88C 4JX6A 2VUMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ N;  3E7Q A;  4MLO A;  3CCY A;  4D5F A;  1WPK A;  5CXG A;  4DYC A;  2RHA A;  4KWA A;  1TWG J;  5IPA A;  3BR5 A;  3BG5 A;  5EYR A;  3O60 A;  1JKP C;  1X2N A;  2YS9 A;  4LOC A;  2R5Y B;  4DZJ A;  3IUV A;  2UXO A;  3K7A J;  3MVP A;  3VPR A;  3UKG A;  4BBR J;  2NVY J;  1ZGW A;  1RKT A;  3HOW J;  3S17 J;  5FKL A;  3TP0 A;  3ZQI A;  2HYJ A;  4AYB N;  4IHY A;  3OOU A;  2EZK A;  2L0K A;  5JLX A;  4GCT A;  4XID A;  4GFB A;  3VVX A;  4MO7 A;  4XRS A;  4JL3 A;  4A3D J;  3BTL A;  2KT0 A;  3ON2 A;  4BKX A;  2HOA A;  2ZCX A;  2XDN A;  1JTY A;  3PM1 A;  5CXI A;  2YVH A;  2L7M P;  3BJB A;  1QVU A;  1EF4 A;  5C44 J;  3ZQG A;  2R5Y A;  1YRN B;  2N8G A;  3G7R A;  3HTJ A;  1MH4 A;  3LSG A;  3VW2 A;  2NOG A;  1DU6 A;  5IP9 J;  1NTC A;  1VFC A;  3EUP A;  3G1O A;  3BR1 A;  4D7M A;  2DMU A;  3JSJ A;  5JLW A;  2AO9 A;  2M8G X;  2ID6 A;  1QVT A;  2KDZ A;  4GCL A;  2DA4 A;  1XS9 A;  1U9N A;  4XIC A;  2K9N A;  2LY9 A;  1BL0 A;  2JA5 J;  4MXM A;  4A3K J;  4CGR A;  3LSP A;  3BTC A;  1JKQ C;  3HOY J;  2DMP A;  1ZQ3 P;  3HTI A;  4I76 A;  2MW8 A;  1MBK A;  3D1N I;  1GVD A;  5J1Y A;  5E3M A;  2D5V A;  1YRN A;  1ZKG A;  4M3F A;  4BXX J;  5HBU A;  1AHD P;  3HB9 A;  3S2H J;  2OI8 A;  3HOV J;  1Q1V A;  4JX4 A;  2D6Y A;  1W0T A;  1IG7 A;  4JYK A;  1Z0X A;  4C3J J;  2Y0S N;  4FE7 A;  4XK4 A;  1JTX A;  3QPS A;  1E3O C;  4A3L J;  3KZ9 A;  3FK6 A;  2HDD A;  2Y9Z A;  4IHW A;  1GUU A;  1I50 J;  3BG9 A;  2G7S A;  2DN0 A;  5GPC A;  2NP5 A;  3G1M A;  2GFN A;  2AHQ A;  3S2D J;  3BR2 A;  1IJW C;  5EZG A;  5E3O A;  3S1R J;  1HOM A;  1LE8 B;  2QOP A;  4J19 A;  3ZOB A;  1CQT A;  2OF7 A;  4A3M J;  2ZOY A;  1SGM A;  3ON4 A;  3CMY A;  3A03 A;  3JRD A;  1G2H A;  3SDG A;  2UXU A;  2UXP A;  5H9T A;  2JA7 J;  5GPA A;  2LFB A;  1RKW A;  2FD5 A;  2QF7 A;  2PBX A;  1HCR A;  1ETX A;  3HDD A;  3RH2 A;  2XPW A;  4X6A J;  4GCK A;  3HEF A;  4M3E A;  3SJM A;  4UDS A;  1JUP A;  5F04 A;  4QTR A;  3VW1 A;  4FIS A;  1NK3 P;  1XG1 A;  1ETV A;  1IDZ A;  1K61 A;  1SFO J;  4UUS B;  2GLO A;  5FHP A;  3BG3 A;  3S14 J;  3NNR A;  1D5Y A;  3TP3 A;  1MNM C;  3T6N A;  2TCT A;  5E3L A;  5IYB J;  3OSF A;  1AU7 A;  1FTZ A;  1Y1V J;  1FIA A;  4V2G A;  5K7F A;  5EFY A;  1WGX A;  3I4N J;  2WB1 N;  3VP5 A;  3BNI A;  3IH4 A;  1IRZ A;  2R5Z B;  1I6H J;  1B72 B;  1NK2 P;  2VPR A;  2DA7 A;  3JRI A;  2HQ5 A;  5K7H A;  4ICH A;  3B6A A;  3B81 A;  1IV6 A;  2LR8 A;  2EH3 A;  1JJ6 C;  1ORK A;  3GBG A;  5EZH A;  5F1J A;  2H1K A;  3Q3S A;  4I6Z A;  1QRY A;  2JA6 J;  1IC8 A;  1JGG A;  2H8R A;  4A93 J;  1UI6 A;  2NVT J;  2QIB A;  3FIW A;  4NN1 A;  3DEW A;  3LOC A;  4A69 C;  4IHX A;  3NI7 A;  2R92 J;  3VOK A;  1WI3 A;  3L1P A;  3NAR A;  1UI5 A;  3A02 A;  3RQI A;  2B63 J;  3P9T A;  2XRL A;  2O7T A;  2DMT A;  4D7N A;  3NPI A;  2L9R A;  2REK A;  2JWT A;  3IH2 A;  3BTI A;  2OPT A;  2NP3 A;  1WCM J;  1WH7 A;  2CQQ A;  3GTQ J;  3AQS A;  2EZH A;  5FKK A;  2LD5 A;  2GEN A;  5F0C A;  3GZI A;  3LWJ A;  2QTQ A;  5BNG A;  1TC3 C;  3V6G A;  3BR6 A;  3C07 A;  2WV1 A;  4M3B A;  5K58 A;  2WUI A;  1OCT C;  2R7Z J;  1ZTR A;  3HGG A;  1F43 A;  2K40 A;  2ELK A;  3NAU A;  1GV2 A;  3MN2 A;  2DJN A;  2RAS A;  2DA5 A;  5EG0 B;  4UUT A;  2ZB9 A;  3HBL A;  1BJZ A;  3BRU A;  1JKR C;  2EBI A;  3HIM A;  2TRT A;  3S5R A;  1OFC X;  4A3B J;  1X58 A;  3DPJ A;  2HOT A;  2JJ7 A;  3I4M J;  5F08 A;  5D1R A;  2E2I J;  5C4Y A;  2LVS A;  4C3H J;  2ZOZ A;  3LJL A;  3MKL A;  4D5C A;  1B72 A;  3S16 J;  2DG7 A;  2IEK A;  1H89 C;  2OER A;  3O8G A;  4YZE A;  3HTH A;  1TWA J;  2ID3 A;  2ME0 A;  1BW6 A;  3HOZ J;  4B1R A;  1VI0 A;  3GEU A;  2LKX A;  1OCP A;  1RES A;  4MFD A;  4EEF G;  2XGE A;  3VUQ A;  3HOU J;  1RR7 A;  4A3I J;  1T33 A;  4BBS J;  2L7Z A;  2VKE A;  4UUS A;  4FCY A;  3Q0U A;  3VW0 A;  2ME6 A;  3ZQL A;  3QPL A;  1FEX A;  3AQT A;  4NDL A;  2YUS A;  2CRG A;  1HDD C;  2G7G A;  3Q0W A;  3M3Y J;  2JA8 J;  2Y30 A;  2E19 A;  4JNN A;  2FQ4 A;  3OIO A;  1UG2 A;  2QKO A;  3FIS A;  1AKH B;  4S0H B;  5IYC J;  3PO3 J;  3JRG A;  2P81 A;  1DU0 A;  2Y31 A;  5M3F J;  1RET A;  3RZD J;  1IDY A;  2NS8 A;  3WHC A;  1O4X A;  2DG8 A;  2CJJ A;  2CUF A;  2M34 A;  2E2J J;  1U8B A;  3LSJ A;  2XSD C;  1ETQ A;  1WH5 A;  1ZK8 A;  3JR9 A;  3S1Q J;  3IH3 A;  3HTA A;  4BY1 J;  4G12 A;  1FJL A;  4A3E J;  1U78 A;  1H8A C;  1GDT A;  3JRH A;  2Y9Y A;  1B8I B;  1APL C;  2HYT A;  4B3A A;  5F27 A;  9ANT A;  3F1B A;  2ZCN A;  3BQY A;  3COL A;  2DTZ A;  2V57 A;  3BT9 A;  4CYC B;  4AC6 A;  4JX5 A;  3PAS A;  2HKU A;  2DA1 A;  1ETO A;  1JT0 A;  5D18 A;  2QWT A;  2W53 A;  2GUH A;  1R9T J;  2RAE A;  4X1E A;  3CDL A;  5DTD A;  3PPB A;  3JRF A;  5FLV A;  4A3F J;  3TW6 A;  5J1U A;  4JKZ A;  4PXI A;  4M3D A;  3NRG A;  3GTM J;  1ZR4 A;  1QPI A;  2EZI A;  1AKH A;  3TW7 A;  3JRB A;  5EEA A;  4AC0 A;  1TWC J;  4AUX A;  3S15 J;  3V78 A;  3KKD A;  2XPV A;  4MIM A;  4W1U A;  1ZR2 A;  3GTK J;  2YVE A;  2LTP A;  1JUM A;  1POG A;  4B4C A;  3K2A A;  5FJ8 J;  3OSG A;  3Q0V A;  3HKZ N;  1I3Q J;  1GT0 C;  1ETK A;  1A5J A;  5IP6 A;  5K7Z A;  4IHV A;  3CRJ A;  3GTJ J;  5F0H A;  5DS9 A;  3G56 A;  3KKC A;  4GFK A;  2FBQ A;  5F0F A;  1UMQ A;  3TED A;  3WHB A;  2E1O A;  3G1L A;  1Z77 A;  4CYC A;  1XC5 A;  2XB5 A;  5M5X J;  2NVX J;  5FGL A;  2IAI A;  1K83 J;  1T56 A;  5HOD A;  3IV5 A;  5FKO A;  3HGY A;  5DAJ A;  3KNW A;  5EGO A;  4AF5 A;  4V2F A;  1B8I A;  1ITY A;  4DW6 A;  1U9O A;  3A01 B;  1VND A;  3GTG J;  2FJ1 A;  2ZCM A;  5M3M J;  2X9D A;  2XB0 X;  1TWF J;  5IYD J;  3LNQ A;  3VOX A;  4NEL A;  2XGC A;  2HXI A;  1LFB A;  1ETY A;  4A3J J;  1ENH A;  3C2B A;  5M5W J;  1X2M A;  1MBJ A;  4MFE A;  5J1R A;  3H0G J;  3NXC A;  2HXO A;  3VVZ A;  2ECB A;  4C2M J;  2IU5 A;  5FKN A;  2CQX A;  3LHQ A;  3S1M J;  3E7L A;  2VI6 A;  4M6V A;  2XPU A;  3ZQH A;  2I10 A;  5CW8 A;  2JK3 A;  2FX0 A;  3BTJ A;  2Y2Z A;  2CUE A;  1ETW A;  2HI3 A;  1HDP A;  3QKX A;  5HSZ A;  2LP0 A;  3HOX J;  3FK7 A;  4QIW N;  2EQR A;  4MK6 A;  2W48 A;  1TWH J;  2UXI A;  2O8K A;  1MBH A;  5C4X J;  3F0C A;  3BHQ A;  4RBO A;  1JUS A;  1PUF B;  3DCF A;  3B6C A;  3S1N J;  3QQA A;  2R93 J;  3M4O J;  2L7F P;  2PZ9 A;  2DA6 A;  3JRC A;  2K9S A;  1P7J A;  1FTT A;  1MBG A;  4JP0 A;  4HKU A;  2IBD A;  1GV5 A;  5EF6 A;  4FE4 A;  2COB A;  4L5E A;  5FLM J;  5D19 A;  3O8H A;  2O7O A;  2JMW A;  4W97 A;  5GP9 A;  1MSF C;  1LFU P;  3EGQ A;  2G3B A;  4QSH A;  1W0U A;  2NX4 A;  2M9H A;  2WAQ N;  3ZQC A;  1MBF A;  2WGB A;  1Y1W J;  5FMP A;  2CU7 A;  2UXH A;  3JRE A;  2NS7 A;  5HAW A;  5EG0 A;  1VF9 A;  4FTH A;  1PUF A;  3RKQ A;  4GFL A;  3JRA A;  2HOS A;  5IOZ A;  1MSE C;  4A3C J;  2XGD A;  5C4J J;  3GTP J;  1S7E A;  1BA5 A;  1SAN A;  4IEJ A;  4DZP A;  2DMN A;  4DYR A;  3GTL J;  2NVQ J;  2F07 A;  2YU9 J;  2X48 A;  3ZQF A;  3HM5 A;  1F36 A;  1UHS A;  1P7I A;  4XRM A;  1HF0 A;  3QBM A;  1BW5 A;  3MNL A;  1JT6 A;  4ME9 A;  3H3V K;  2EZL A;  3ANG A;  4DYQ A;  3BQZ A;  2G7L A;  2JN6 A;  4RDU A;  1OJL A;  2DA2 A;  5FKM A;  3SFI A;  3FKI J;  3GTO J;  2K9Q A;  3VIB A;  2LK2 A;  1FIP A;  2E2H J;  2QCO A;  3RD3 A;  3CQZ J;  2ECC A;  1JJ8 C;  3LSR A;  1LE8 A;  4HNV A;  3VVY A;  5AQC A;  2O9L A;  3A01 A;  3HE0 A;  1MBE A;  4ACI A;  4L62 A;  3CWR A;  5M5Y J;  2R5Z A;  5C3E J;  5EGO B;  2R0Q C;  2MSY A;  1IUF A;  2MG4 A;  5IOY A;  2MGQ A;  2M2E A;  2M0C A;  3PO2 J;  5J3L A;  1A6I A;  5E3N A;  4ABZ A;  2Q24 A;  2DA3 A;  2GBY A;  3BCG A;  2VKV A;  3BR0 A;  5EDN A;  5IP7 J;  3RZO J;  4XRS G;  2DMQ A;  4M3G A;  2GM4 A;  3FRQ A;  3BR3 A;  3CJD A;  2G0E A;  1RPW A;  4C3I J;  3ANP A;  2X6O A;  4A3G J;  1HLV A;  1MH3 A;  1IGN A;  4BY7 J;  3W6V A;  4Y52 J;  2LLK A;  1JKO C;  4Y7N J;  1H88 C;  4JX6 A;  2VUM J; 
#chains in the Genus database with same CATH topology
 4AIJ A;  4HG2 A;  3E7Q A;  4KJZ A;  5DDG A;  1VQP I;  3DQV C;  4ZYG A;  4NC6 A;  2RHA A;  3DWL E;  3HZJ A;  3OOP A;  4CCL A;  1HKT A;  3WTZ A;  3BG5 A;  5IPA A;  3O60 A;  5DEQ A;  2YS9 A;  3FXU A;  3HIF A;  4LOC A;  1R4N B;  3WTX C;  1EV7 A;  4DZJ A;  3ECO A;  4Y13 A;  2FA5 A;  2UXO A;  3I53 A;  3VPR A;  2M0M A;  2NVY J;  1XGM A;  3HOW J;  5FKL A;  3PNT A;  4AWX B;  3ZQI A;  1BC8 C;  2WY7 Q;  3EDP A;  3OOU A;  2L0K A;  3ABM H;  4LLN A;  4GFB A;  4HX8 A;  4A3D J;  3CO6 C;  1VQM I;  2HOA A;  4PCQ A;  3GFI A;  2L9V A;  2R7V A;  5CXI A;  4G7H F;  1BR2 A;  2L7M P;  5J6X A;  3BY6 A;  5H20 A;  5KVR A;  1QVU A;  2KHM A;  2Z2S B;  1EF4 A;  1HST A;  3BJO A;  1YRN B;  2N8G A;  2DT5 A;  2VT2 A;  2KIF A;  3CCJ I;  2VIX A;  4N9H A;  3EUP A;  4DBR A;  1FX7 A;  1MGT A;  3EQL F;  1IRX A;  3MZ8 A;  4D7M A;  5FB2 A;  4OAZ A;  3SZG A;  2FNA A;  2JUC A;  2NYX A;  3BG7 A;  2M8G X;  1EA3 A;  4BYY A;  1FBQ A;  1U9N A;  3OL4 A;  2LY9 A;  1ON2 A;  1BL0 A;  2A6T A;  4AU7 A;  4CCN A;  4Q48 A;  4CGR A;  2KMU A;  1YIT I;  3RDI A;  1JKQ C;  3BP8 A;  2RV8 A;  1T0F C;  4LG0 A;  3HOY J;  3CMA I;  1MDM B;  4M72 A;  1KA8 A;  1MBK A;  3LSH A;  2RGV A;  2NVU B;  4M3F A;  2CGP A;  4BXX J;  2LY2 A;  1JI8 A;  2HS5 A;  5HBU A;  1VQ8 I;  1UST A;  5J4Y A;  3HB9 A;  1GLN A;  4RB3 C;  2JSP A;  5CQE A;  4JX4 A;  4HZF A;  2BY2 A;  1W0T A;  1YG2 A;  2P7V B;  4XK4 A;  3KZ9 A;  3DEE A;  3FK6 A;  1F5T A;  2PFB A;  4CZZ A;  4IHW A;  4PDK A;  3SWH A;  3U1D A;  4Z2Y A;  2KJC A;  4XLA A;  2AHQ A;  4AIH A;  3DPU A;  2XAF A;  1LE8 B;  2GQQ A;  1X4P A;  2OF7 A;  2ZSI B;  1J9I A;  3TO7 A;  3DLA A;  3CMY A;  2HQA A;  2UXP A;  2MC3 A;  1S8N A;  3K4M A;  2VBY A;  2QF7 A;  1G4D A;  2E7X A;  3E3V A;  1ETX A;  4E7K A;  2LY1 A;  4I98 B;  3HXL A;  2DQR A;  4UDS A;  4BEH A;  2BV6 A;  4QTR A;  2XF6 A;  2YVX A;  1BIA A;  4ESF A;  1Q1H A;  2XAS A;  3Q5F A;  3FX3 A;  1JHF A;  2PMH A;  3VFZ A;  4IKF A;  1WZ2 A;  5DUK A;  3WE2 A;  2V6C A;  3JW4 A;  3F8F A;  4QPO A;  3LSK A;  5E3L A;  5IYB J;  1Y1V J;  1O7F A;  2ZC2 A;  3RTR A;  3J80 K;  5D5U B;  3I4N J;  2CG4 A;  3VP5 A;  4M9S A;  2M8E A;  2UV1 A;  3IH4 A;  5FLX Z;  1P4A A;  3NWT A;  4CUG A;  4A5M A;  1RC9 A;  1XX5 A;  2HQ5 A;  5K7H A;  3R0A A;  1FSH A;  2K27 A;  3OYE A;  1CF7 B;  4KIC A;  4ICH A;  3KE2 A;  1QA6 A;  4U7B A;  5EZH A;  4IO9 F;  1YLF A;  5F1J A;  4A0X A;  2H1K A;  4G8X A;  4PUS A;  3GZN B;  4S05 A;  1JGG A;  5D4S A;  2H8R A;  1ZYR F;  2RNJ A;  4NN1 A;  3I59 A;  3DEW A;  5L3G A;  2VQG A;  3HJE A;  1OMI A;  3VOK A;  1WI3 A;  5CYV A;  1UI5 A;  4IX7 A;  1YS6 A;  1YTY A;  2D1H A;  2XRL A;  3BCA A;  3ZCO A;  2VOD A;  1TT0 A;  2HWV A;  2L9R A;  2JWT A;  5ED4 A;  2OPT A;  3PSF A;  1FSE A;  3O6B B;  2ZME B;  2LF7 A;  5LHG A;  4OIO F;  1RZ4 A;  4OMZ A;  1TC3 C;  1UHM A;  1OCR H;  3C07 A;  2ELH A;  3PFI A;  4I7H A;  3U21 A;  3PUB A;  3OMY A;  1SFK A;  3MN2 A;  4P5O A;  2WAQ A;  1KU7 A;  2DA5 A;  4XLC A;  4I99 C;  2WTE A;  2X6X A;  1OFC X;  2HOT A;  1D8K A;  5F08 A;  3S93 A;  2ZNZ A;  4ETS A;  5JR3 A;  1LUJ B;  2K9M A;  3ESW B;  4GO1 A;  3P9C A;  4LB6 B;  2VBZ A;  1HKS A;  3E0J B;  3GME A;  3HTH A;  1Z7L A;  3M07 A;  1YI2 I;  3OR1 C;  1BW6 A;  2VLA A;  2DW4 A;  4C2U A;  4R1H A;  1I3A A;  1S29 A;  4G7Z F;  1OLT A;  3P5J A;  4EEF G;  2O5R A;  2XGE A;  2IGM A;  3WOD F;  4EM1 A;  3L09 A;  1ZG1 A;  2DQL A;  4RLQ A;  1A6Q A;  3Q0U A;  3OYI A;  2ME6 A;  2DJI A;  1VQL I;  2IT0 A;  5KNL A;  1FEX A;  4LD5 A;  4PSW A;  3FHN A;  3AQT A;  2EWN A;  2CRG A;  2RQP A;  4A12 A;  1HDD C;  3Q0W A;  3CD6 I;  2QSF X;  4P9U A;  4XL9 A;  1BOA A;  3HKZ A;  1ZH5 A;  1UG2 A;  2KRC A;  3BZC A;  5J4V A;  2F5D A;  3PUF A;  1AKH B;  3G4S I;  3GFJ A;  3MKW B;  3RZD J;  3GO5 A;  1RET A;  4OOI A;  1SFE A;  2ZSH B;  4WXC A;  1O4X A;  4BHB A;  3BCB A;  4CZC A;  2E2J J;  1U8B A;  5HLG A;  1ZK8 A;  1UG0 A;  3JTH A;  1BR1 A;  2OUM A;  5J40 A;  2M5W A;  4MQV A;  1YJW I;  4A3E J;  2XUB A;  3CJT B;  3JRH A;  2Y9Y A;  1EH8 A;  1T6S A;  1QNT A;  3REO A;  3TKY A;  4B3A A;  1APL C;  4HDV A;  2HYT A;  4WF2 A;  5F27 A;  4U7D A;  3JSP A;  3BQY A;  2DTZ A;  3HSR A;  2RKH A;  5GTI C;  3K1N A;  2K9L A;  3R6S A;  2ZXW H;  4XKB A;  2OU2 A;  3KZZ A;  3CDH A;  4UVA A;  3P9K A;  1HC8 A;  2W7N A;  5DD8 A;  4UV8 A;  5D4R A;  4UVB A;  3G71 I;  3CDI A;  2W53 A;  3HRT A;  5L3F A;  2RAE A;  5DTD A;  3PPB A;  2L7K A;  3JRF A;  1Y39 A;  3HPH A;  4EAT A;  1U6G A;  2VC1 A;  2PX9 A;  1ZR4 A;  1B6A A;  2EZI A;  1U3E M;  1N77 A;  1LEA A;  4AC0 A;  3S15 J;  3U9G A;  2ISY A;  2ADU A;  2XPV A;  4U87 A;  2QYO A;  1JUM A;  1POG A;  3K2A A;  3FMQ A;  3OSG A;  3Q0V A;  2A5W A;  2FBK A;  1H0M A;  2R3S A;  3ISP A;  1I3Q J;  2K7L A;  1GT0 C;  4XON A;  4UHT A;  4RA2 A;  2L54 A;  1D1B A;  5F0H A;  3SHF A;  3ZPL A;  3V7C A;  2BOL A;  2DFF A;  4IRH A;  1TLH B;  2E1O A;  1EH7 A;  5DV5 A;  1VQ7 I;  1XC5 A;  3M7G A;  4KUM A;  1K6O A;  4YFK F;  1T56 A;  4UVC A;  3IV5 A;  3HGY A;  1IF1 A;  2W00 A;  3E5U A;  3P9I A;  1B8I A;  1SD6 A;  2PLY A;  1IRG A;  3BPX A;  2STT A;  2CSO A;  4DQ2 A;  5IYD J;  1D0Z A;  2P0W A;  2ZY9 A;  5J8C A;  1ETY A;  2W1O A;  4RB2 C;  1FYK A;  2QBY B;  3H0G J;  2EPF A;  1V5G A;  2R7D A;  4KT6 A;  2OC6 A;  1U5T A;  1YE9 A;  1UAA A;  1NG6 A;  2ZJQ F;  2I10 A;  2WV0 A;  1ZRC A;  4HSR A;  2FMY A;  2FX0 A;  2DK5 A;  2HVS A;  3M8J A;  2L9N A;  4G6Q A;  3VSL A;  1HDP A;  3I71 A;  3GZ5 A;  3HOX J;  3FK7 A;  2EQR A;  4CCK A;  5TGT A;  4IZZ A;  2CW0 F;  4CIC A;  3PJR A;  2UXI A;  4LJZ F;  3GLL A;  3K4K A;  1MBH A;  3O2P E;  4AYB A;  2ZJR F;  4UB6 C;  1PP8 F;  1WHU A;  3M4O J;  3E97 A;  2PZ9 A;  3H5N A;  2D1V A;  2DA6 A;  3JRC A;  5DD4 A;  1ONV A;  5EF6 A;  4FE4 A;  5FLM J;  5D19 A;  3MCZ A;  1J09 A;  1B59 A;  2PJR A;  2HOE A;  3I5U A;  2NX4 A;  1XGO A;  2QM3 A;  1QBJ A;  1MBF A;  3JCU C;  3ZN1 A;  1Y1W J;  2WGB A;  5FMP A;  1D0Y A;  1S3J A;  3K10 A;  1WJF A;  3EUH A;  4IHS A;  4I09 A;  4GYI A;  5EEH A;  4BJ6 C;  5IY5 H;  4E7L A;  1MMD A;  4RS8 A;  2ZXJ A;  3GTP J;  1UB9 A;  2FXA A;  3UR3 C;  1S7E A;  3E5X A;  2J5O A;  2Y0M A;  4IEJ A;  3D5R C;  1UFM A;  2JZY A;  3L7W A;  1DUX C;  3TO6 A;  2X48 A;  3HM5 A;  4OWR B;  4XNF A;  3COA C;  1UHS A;  5AON A;  4BE1 A;  2DFI A;  2ELJ A;  3LFK A;  3H3V K;  1BC7 C;  4XLP F;  2M7B A;  2VON A;  5LGU A;  4EJO A;  2HGC A;  4RDU A;  1MJB A;  1OJL A;  1SD4 A;  3FKI J;  2FF4 A;  1N25 A;  2LK2 A;  3CUQ C;  4WIB A;  4L9J A;  1PUE E;  3CQZ J;  3KCC A;  1I39 A;  1R22 A;  3AKZ A;  3N4M A;  3RJP A;  5E20 A;  4HNV A;  1YJ9 I;  3WTU C;  4ON0 A;  1HQC A;  1J0R A;  1YS7 A;  1FNN A;  3A4C A;  1F4K A;  1FOX A;  3AL0 B;  2YSR A;  5M5Y J;  3L2C A;  1P4X A;  2R5Z A;  1IUY A;  2RVC A;  3E6M A;  1QGP A;  3GWZ A;  1DPR A;  3GFL A;  3ZGK A;  4X0G A;  2OTL I;  2DT7 B;  5J3L A;  2A61 A;  3RKY A;  1A6I A;  5JFR A;  4ABZ A;  4LG3 A;  4UUV A;  2MH2 A;  3LA7 A;  2PMZ A;  3IWZ A;  2P6S A;  2FEZ A;  2W24 A;  1BBY A;  4MGR A;  3VOD A;  3FRQ A;  1FLI A;  1O3T A;  2K5C A;  3CJD A;  2GIV A;  1Y8Q B;  4C3I J;  2PFV A;  2Z16 A;  4A3G J;  1HLV A;  2E34 A;  1IGN A;  3CUQ B;  4BY7 J;  4BGD A;  5DCF A;  3HRM A;  1X3Z B;  4Y7N J;  5K5R A;  3MZH A;  4JX6 A;  1I5Z A;  2LRD A;  5D5V B;  3ZMU A;  5CVV A;  2WWY A;  4DYC A;  4Y4R A;  4KWA A;  2EIK H;  3H9G A;  3BR5 A;  4RGS A;  3LFU A;  1JKP C;  5AIQ A;  4BAC A;  5D5W B;  1KYW A;  2F5V A;  3IUV A;  4YEJ A;  1LNW A;  3MVP A;  1J7K A;  1RKT A;  2W57 A;  4E7I A;  3S17 J;  1R36 A;  2EZK A;  2JUG A;  5JLX A;  5E18 F;  4DOZ A;  3MKZ A;  4EQQ A;  2IS2 A;  3BTL A;  2FQ3 A;  1X1A A;  2KT0 A;  1W5C C;  4BKX A;  1R58 A;  4OIR F;  5D6E A;  2R7X A;  2YVH A;  4NNJ A;  3ZMV A;  3W2W A;  1DDN A;  3WE3 A;  1OCO H;  2JRM A;  4IPA A;  2CFO A;  2R5Y A;  2F5C A;  2HKX A;  2HQR A;  2M45 A;  5DM7 F;  5LEK A;  2O6G E;  5IP9 J;  1DU6 A;  5BS6 A;  1NTC A;  1ODD A;  1DGW Y;  4PSX A;  4A6D A;  1WJB A;  3BR1 A;  2E1M C;  2DMU A;  1MJ9 A;  1FOK A;  3JSJ A;  4B8X A;  3U2R A;  5JLW A;  2AO9 A;  3RCO A;  1QVT A;  2KDZ A;  4GCL A;  2EV6 A;  1IV8 A;  2B0L A;  3CZ6 A;  4QLC U;  4DIQ A;  3HUG A;  4A3K J;  2DI3 A;  1WJA A;  1S7A A;  2PEX A;  3L2R A;  3LSP A;  3MKY B;  1MZB A;  3TQN A;  4YIR X;  3GUD A;  1R00 A;  2EFW A;  1U0J A;  2L4M A;  4CDG A;  3D1N I;  1Y8R B;  3FMS A;  3FXQ A;  2D5V A;  1VQ4 I;  4XSZ F;  3T8T A;  1HSJ A;  1AHD P;  1NH3 A;  4NQW A;  1VQ6 I;  4BHC A;  3K4L A;  4ESB A;  3OYK A;  3HOV J;  3DBR B;  3WG7 H;  4ZH4 F;  1IG7 A;  4JYK A;  5ICG A;  3T1B A;  2Y0S N;  4FE7 A;  1JTX A;  4XR6 A;  3H5A A;  1LDD A;  1GUU A;  4A0Z A;  3G2B A;  4L9N A;  1O7L A;  2R4G A;  3G1M A;  4ZZD A;  4I0B A;  1X1B A;  4S04 A;  1FMV A;  2Z5U A;  3S1R J;  2QOP A;  2A69 F;  4J19 A;  4BE2 A;  2VJ5 A;  2ZJ2 A;  2ZOY A;  3ON4 A;  1K78 B;  3JRD A;  1TNS A;  3SDG A;  1OCZ H;  3CF5 F;  4L18 B;  2UXU A;  5H9T A;  4ZYE A;  2JA7 J;  5GPA A;  4PGH A;  1D5V A;  1RKW A;  2FD5 A;  1Y56 A;  2KIM A;  3QP6 A;  1KZH A;  2PBX A;  4KT5 C;  2V9V A;  2VJ4 A;  2FBI A;  2XPW A;  3H5R A;  4GCK A;  1QZY A;  1YYV A;  1V5E A;  1R7J A;  2ISZ A;  2XC7 A;  2ZME A;  2V1N A;  3W3C A;  1XG1 A;  3H3Z A;  5DCM A;  3CTA A;  4OIP F;  2NRA C;  1ETV A;  3CME I;  1SFO J;  4UUS B;  4EMS A;  1D5Y A;  1Z21 A;  4XLH A;  1SEU A;  4XLE A;  6PAX A;  4EJU A;  2XF7 A;  2LC2 A;  2TCT A;  1AU7 A;  3OSF A;  4BDY A;  4V2G A;  1FIA A;  4AVP A;  1WGX A;  4XKW A;  5ERI A;  4J01 A;  4QPQ A;  3E6C C;  2L01 A;  1D1C A;  5CVJ A;  2DBB A;  1A35 A;  2RNG A;  1BM9 A;  4KDP A;  3VWB A;  2R5Z B;  5B1A H;  3ZN0 A;  1B72 B;  4Z6Y A;  4EM2 A;  2VPR A;  2JPC A;  2QA4 I;  3QWL A;  3J7A Y;  1WVR A;  3ABU A;  3B81 A;  5CVI A;  1IV6 A;  1XMA A;  2VT3 A;  4OIQ F;  4WK8 F;  2VKD A;  5HDK A;  1SFU A;  4R79 A;  5HNF A;  3W2A A;  2AXL A;  2UXX A;  2F2E A;  1QRY A;  3RIR A;  2OZU A;  1IC8 A;  4A93 J;  1UI6 A;  2QIB A;  2Y48 A;  2R7W A;  4IHX A;  2R92 J;  1UEL B;  4IRI A;  2LMD A;  3P9T A;  2MFZ A;  4KA4 A;  3J7A O;  2X51 A;  3OWT A;  4JK1 X;  3NEU A;  1UCR A;  1I1G A;  3IH2 A;  3BTI A;  5D5X B;  2HDC A;  2NP3 A;  2CQQ A;  3T0Y A;  1TL8 A;  2COM A;  2F5E A;  1KQ0 A;  3CCL I;  2LD5 A;  2VJJ A;  2HPI A;  5F0C A;  2W4S A;  4MHG A;  4EJT A;  2B1E A;  3I3L A;  2OTJ I;  3G6E I;  2DOF A;  1QPM A;  2WV1 A;  5K58 A;  4KIF A;  2NS0 A;  1ZTR A;  2NNY A;  2RAS A;  3NI7 A;  5FLX K;  1QHG A;  5F1R A;  4UUT A;  3BRU A;  3HIM A;  3KX2 A;  1JKR C;  2EBI A;  2IGO A;  1YHQ I;  1F9N A;  2TRT A;  1QO0 D;  2LOO A;  1Z9C A;  1GXP A;  1VQ9 I;  2Y75 A;  1WI9 A;  2V4J C;  3HSF A;  2HEO A;  1FY7 A;  3MKL A;  4D5C A;  3FKJ A;  4RM2 A;  2FUG 2;  4HPQ A;  1TWA J;  2ID3 A;  2ME0 A;  3L2U A;  4CHU A;  2GA2 A;  4ESJ A;  3Q9V A;  3R0J A;  1LKX A;  1VI0 A;  3DU6 A;  4CYD A;  2LKX A;  2CQN A;  2D2W A;  1OCP A;  2ACJ A;  1RES A;  1LDK B;  2EIJ H;  5LRR A;  5BPD A;  4HF0 A;  1FZP B;  3VUQ A;  4B3X A;  1RR7 A;  3KPH A;  4A3I J;  2L7Z A;  2VKE A;  3BJA A;  3EPZ A;  4RGX A;  2VJI A;  2P5V A;  5F64 A;  1DP3 A;  5LRS A;  1HA8 A;  2K85 A;  3ZQL A;  3KEQ A;  2P7C B;  2W84 A;  4E6K G;  1AWC A;  5HLT A;  2YUS A;  4LG0 B;  3GEZ A;  4M9X A;  3KZY A;  1S5L C;  3M3Y J;  4BQA A;  2VE8 A;  2JA8 J;  1ERD A;  4U0Y A;  3OIO A;  3KET A;  4KIB A;  4DNC A;  1MD0 A;  3KYL A;  2ZKZ A;  5AIP A;  2QKO A;  3ZRG A;  3PO3 J;  2CW7 A;  3JRG A;  2DOA A;  3E1S A;  3OR2 C;  5M3F J;  3BRO A;  1LFP A;  2CUF A;  2Y69 H;  4ASN A;  1ZRF A;  2H27 A;  3LSJ A;  3IC7 A;  1IN7 A;  1N78 A;  3JR9 A;  1WH5 A;  2YR2 A;  3IH3 A;  3HTA A;  2FML A;  3KP4 A;  1XDU A;  3V8J A;  2E7W A;  2KIS A;  1XMX A;  3FXR A;  4ZYH A;  1B8I B;  1JGS A;  1A04 A;  2BGC A;  1AA7 A;  4HA8 A;  9ANT A;  3OYA A;  4AIK A;  2O61 A;  2V57 A;  4II3 A;  3K4B A;  3O3K A;  2A5Y B;  1G3Y A;  4JX5 A;  4UV9 A;  3OY9 A;  1BOB A;  2I8D A;  1RR8 C;  3KFW X;  2HKU A;  3W6K B;  4PFO A;  2C6Y A;  2KDO A;  4NB5 A;  2DTR A;  4AD9 A;  2M4G A;  2QWT A;  2BXZ A;  2GUH A;  4PJM A;  2VQC A;  3DKX A;  4HV5 A;  1R9T J;  4X1E A;  2F4O B;  3OYN A;  5FLV A;  1YIJ I;  3TW6 A;  5J1U A;  1X1C A;  4PXI A;  4YFX F;  1DPU A;  3GTM J;  1S7O A;  3OYC A;  2RQQ A;  1IN5 A;  2FOW A;  2BVM A;  3GLX A;  4I01 A;  3JRB A;  2M30 A;  3EYI A;  3C7J A;  3DBH B;  2KIU A;  3KKD A;  1G3S A;  2VE9 A;  2YVE A;  1RNL A;  5FJ8 J;  2V9K A;  3I64 A;  2EFQ A;  4C30 A;  3HKZ N;  1YOV B;  4YIF A;  1ETK A;  5IP6 A;  2K4J A;  5CQG A;  3K70 D;  2R7O A;  4V19 K;  3GTJ J;  1MMA A;  3G56 A;  3KKC A;  1T39 A;  5F6F A;  2CFX A;  2BE5 F;  1FYL A;  3F21 A;  2ZCW A;  1Z77 A;  4OU0 A;  5M5X J;  1VQN I;  1W5T A;  1T0F A;  5E17 F;  5FGL A;  5HOD A;  5FKO A;  1HW1 A;  3UNG C;  3KNW A;  2L2O A;  4R8H A;  1ITY A;  2XKO A;  3H92 A;  1U9O A;  1VQK I;  5CPR B;  2FJI 1;  2EFP A;  2OZ6 A;  4ZTJ A;  1Z3Y A;  3KLN A;  3QYB A;  3V42 A;  1CGP A;  2E35 A;  5J47 A;  2R7T A;  1TWF J;  3VOX A;  2VN2 A;  3VYT B;  2GA1 A;  1ENH A;  5L3D A;  2AS5 F;  5M5W J;  4RAG A;  2HYF A;  1MBJ A;  3PSI A;  4MFE A;  4G94 A;  4LB5 A;  3VVZ A;  1OR7 A;  2IU5 A;  4ITV A;  3TMO A;  1R1T A;  3S1M J;  2IGN A;  1TBX A;  3AG4 H;  4RAZ A;  5CW8 A;  1X4O A;  2DYR H;  4OIN F;  3HHG A;  2X1C A;  2Y2Z A;  4PFP A;  1RUO A;  3QP5 A;  1ETW A;  1B4A A;  5HSZ A;  1XTA A;  3JTG A;  2BHY A;  3ASN H;  3F22 A;  5GTH C;  3K0L A;  1TWH J;  5JVT A;  3IRR A;  2PI0 A;  1TTY A;  1XSX A;  3ZMZ A;  3G3Z A;  4RAY A;  2QSG X;  2BVL A;  2ZME C;  2CV0 A;  3DCF A;  3B6C A;  3DTK A;  2DAO A;  4WXH A;  2R93 J;  1DQU A;  5HS8 A;  2L7F P;  2K9S A;  1FP1 D;  1P7J A;  2RRE A;  3DLL F;  1FTT A;  2GXB A;  1GV5 A;  3QYF A;  3TBI A;  1NHA A;  4N0B A;  3SXY A;  4W97 A;  4CH7 A;  1LEB A;  1W36 C;  4Y3O A;  2IXS A;  2M9H A;  5BQT A;  4G9Y A;  3DP7 A;  2UXH A;  5HAW A;  2X1D A;  2B9S A;  4GFL A;  2HOS A;  1MSE C;  4A3C J;  3ZR8 X;  1WKM A;  5C4J J;  3DFG A;  1BA5 A;  4HV6 A;  1FT9 A;  4DYR A;  4DZP A;  3QAH A;  3K1P A;  1ZN2 A;  3HSE A;  1T95 A;  2F07 A;  2VKH A;  3ZQF A;  1F36 A;  4XRM A;  5ILU A;  4BE0 A;  1RI7 A;  1BW5 A;  3MNL A;  2XF5 A;  4L5I A;  2KP6 A;  4IQ4 A;  4B48 A;  4EVI A;  1SMY F;  3F6O A;  3SDB A;  2QSH X;  4A6E A;  1BN5 A;  5A2Q Z;  3CCU I;  3AL0 C;  4LIT A;  3SFI A;  1U5T C;  3I59 B;  2HU9 A;  3DPT A;  3NWS A;  1LB2 A;  2K9Q A;  3QRF F;  3VIB A;  3FWE A;  4RAF A;  2QCO A;  3RD3 A;  4HW0 A;  4ENJ A;  2JRT A;  1G8X A;  2UZK A;  3U1K A;  1P9Q C;  2HFH A;  2VQH A;  3ZXS A;  1CF7 A;  3ONQ A;  4ACI A;  4U0W A;  2KFD A;  3I58 A;  3S2W A;  5C3E J;  4CXF A;  2MSY A;  2L5Q A;  3S8P A;  2M2E A;  2M0C A;  4P9F A;  3PO2 J;  2B7E A;  3V4G A;  1LJ9 A;  3BZ6 A;  3C2H A;  1N75 A;  1WRJ A;  1L3L A;  1SAU A;  4NQW B;  2UWM A;  2F4I A;  2Q24 A;  2GOX B;  1OCC H;  2GBY A;  2OV7 A;  4L9V A;  3BR0 A;  4L5J A;  5EDN A;  2KZV A;  4PZJ A;  4ZDO A;  2GM4 A;  4BQQ A;  3BR3 A;  2CUJ A;  3LL7 A;  4DBQ A;  1RPW A;  3ANP A;  2XAH A;  1MH3 A;  3W6V A;  3PFY A;  2FOK A;  1KYZ A;  1YW9 A;  3F8B A;  4HX7 A;  4L62 A;  1EH6 A;  3CCY A;  4D5F A;  2DYS H;  1O3S A;  1ZHF A;  2JVG A;  5EYR A;  5LD2 C;  3BOQ A;  1XB4 A;  1X2N A;  3CUO A;  3R61 A;  2E60 A;  2R5Y B;  1USS A;  4H4K C;  2ETH A;  3LSI A;  2XAU A;  2R7Q A;  3QOP A;  2QGU A;  4M71 A;  3ULQ B;  3OS1 A;  2PBI A;  3ERM A;  1ZGW A;  2A6E F;  2X4H A;  3M1E A;  5EEG A;  3CP8 A;  2HYJ A;  3C18 A;  4E7Z A;  4IHY A;  1D8J A;  1T98 A;  2CV1 A;  5FD6 A;  3VVX A;  4MO7 A;  3CJR B;  1HBX G;  3KYC B;  2ZCX A;  1FPQ A;  1JTY A;  4PGG A;  2HDW A;  3PM1 A;  1WJD A;  3MFK A;  3BJB A;  4Q4Z F;  4J00 A;  3IAS 2;  3HTJ A;  3G7R A;  2XV4 S;  3L2Q A;  1MH4 A;  3VW2 A;  1G3W A;  2KPM A;  3OS2 A;  5EJC A;  3VYR B;  1YW8 A;  1R5H A;  2LYC A;  1X1P A;  3E6D A;  4XIC A;  2IJL A;  1YW7 A;  3OYH A;  4OD5 A;  4MXM A;  2L9S A;  1SVM A;  3RSN A;  2G7U A;  2K02 A;  2ZFW A;  2E36 A;  3BTC A;  1TQM A;  3CUQ A;  2DMP A;  2MW8 A;  2NAZ A;  4YEL A;  5J1Y A;  5E3M A;  1YRN A;  1ZKG A;  4BS9 A;  4E4H A;  4IHT A;  3LAP A;  3S2H J;  3ZMT A;  5L3B A;  4E7H A;  4HEA 2;  3K4N A;  2Z9O A;  1Z0X A;  2IS4 A;  3SFZ A;  3T8R A;  4A3L J;  5H6R A;  4DJA A;  2Y9Z A;  4B09 A;  4KIS A;  3RI4 A;  1YQA A;  2LF8 A;  2V79 A;  3CP2 A;  4FAS D;  5LGT A;  5GPC A;  2VC0 A;  2NP5 A;  4G6T B;  2GFN A;  1ZGJ A;  2WY8 Q;  5D6F A;  3I0T A;  1HOM A;  4F93 B;  3ZOB A;  4CGZ A;  4A3M J;  1V4R A;  3CES A;  1G2H A;  2VBX A;  2EB7 A;  2DXI A;  2KZG A;  1IZ1 A;  2VPL A;  3GX4 X;  1T8I A;  2L4A A;  4LIV A;  3RH2 A;  3HDD A;  2RN7 A;  3MQ0 A;  3HRU A;  3BDD A;  2XGX A;  5JHF A;  1D0X A;  3SJM A;  1JUP A;  1VQ5 I;  1PJR A;  5KHD A;  1EKE A;  1JHH A;  4FIS A;  1NK3 P;  5HVQ C;  1SVO A;  3WG9 A;  4WX9 A;  2QVO A;  4RB1 A;  3KIO A;  4RLF A;  1IDZ A;  2GLO A;  5FHP A;  2HR3 A;  1QZE A;  3NNR A;  2EFO A;  3KYD B;  3W2V A;  1BI2 A;  2J5P A;  3TP3 A;  1MNM C;  3LSM A;  1FTZ A;  4CCM A;  1ON1 A;  5DUI A;  5D8L B;  3C3W A;  5K7F A;  1LVK A;  4FX0 A;  5L3E A;  2BXY A;  2WB1 N;  4XKC A;  3BNI A;  1I6H J;  5KAI C;  1R1U A;  2DA7 A;  2H09 A;  3J81 K;  4ENK A;  3BPV A;  4BXF A;  1ZG5 A;  3K69 A;  1JJ6 C;  1NG7 A;  1ORK A;  1W1W E;  4XSX F;  2OQG A;  2A2F X;  4KIT B;  1HW5 A;  3Q3S A;  3FDY A;  2PN6 A;  2UXN A;  3IWF A;  1DP7 P;  5K5O A;  2NVT J;  3VSK A;  3L00 A;  3N05 A;  4C9Y A;  2CWE A;  3A02 A;  3RQI A;  2IW5 A;  5IT9 K;  1SAX A;  2O7T A;  2DMT A;  3NPI A;  3GYH X;  2REK A;  2DPD A;  3VYU B;  4HLY A;  1B1B A;  2WC2 A;  2YPR A;  3I9V 2;  4EM0 B;  4BHP A;  2V6E A;  1X3W B;  2XRN A;  2KJB A;  2EZH A;  4N4O B;  3AQS A;  2H94 A;  1QU3 A;  1U5T B;  1XMK A;  5B1B H;  2QTQ A;  1FOW A;  3FXK A;  3BR6 A;  2K3F A;  2IS6 A;  2WUI A;  2OAZ A;  1OCT C;  2R7Z J;  2QBY A;  3HGG A;  1B9M A;  4HNT A;  3T5X A;  3OYM A;  3NAU A;  2R7R A;  1F43 A;  1GV2 A;  3FXO A;  2GXA A;  2VOO A;  4L9T A;  3IAM 2;  1UHW A;  5EG0 B;  2ZB9 A;  3HBL A;  1ZLJ A;  2V26 A;  2RDP A;  3HG9 A;  1OPC A;  1E0E A;  3S5R A;  2JQ7 A;  3DPJ A;  4MQ9 F;  3I54 A;  3I4M J;  1QHH D;  2Q1Z B;  4LLL A;  4C3H J;  1XGS A;  2ZOZ A;  3LJL A;  1J2X A;  4Y15 A;  1B72 A;  2IGK A;  2IEK A;  1H89 C;  1YX3 A;  2OER A;  3O8G A;  3H36 A;  4FQG A;  1KQ9 A;  2ZBK A;  4UXN A;  3CJQ B;  4B1R A;  3M9A A;  3OS0 A;  2H6C A;  3F23 A;  2CQK A;  2HQN A;  1RIO H;  2MLK A;  1FC3 A;  3HOU J;  1HXD A;  2P4W A;  4BBS J;  1S9H A;  4I02 A;  4UUS A;  4FCY A;  2F48 A;  2VXZ A;  4KMF A;  2OQR A;  1ZRE A;  4C2M A;  4ZDL A;  2A3S A;  5FGM A;  2DOD A;  5DCM B;  4ANJ A;  3CC7 I;  2R7U A;  3OL3 A;  3H9Q A;  3VDX A;  2K86 A;  4FX4 A;  3K70 C;  4BU2 A;  4KFC A;  4F52 A;  5HDG A;  3TDZ C;  3HOT A;  2Y30 A;  1V3F A;  4JNN A;  2IA0 A;  1LDJ A;  2FQ4 A;  3CO7 C;  2HZD A;  1LQ1 A;  1P2F A;  1D1A A;  1I27 A;  4B47 A;  2MBF A;  3WGG A;  1Z3X A;  4S0H B;  3GCM A;  1DU0 A;  4HYE A;  1PYV A;  2KLO A;  2MD0 A;  3PL8 A;  1K78 A;  2Z99 A;  2DG8 A;  2CJJ A;  2M34 A;  2XSD C;  1DGR M;  1ETQ A;  3S1Q J;  3CMM A;  2WAF A;  4XMY A;  4G12 A;  1U78 A;  1H8A C;  3GFM A;  2IRF G;  2BHZ A;  3S3M A;  1ZRD A;  2YU3 A;  3F8M A;  2VQL A;  4WWC A;  2ZCN A;  4IVN A;  3F72 A;  1GXQ A;  3GXO A;  2EA4 A;  3BT9 A;  4UB8 C;  4AC6 A;  4FET A;  1BI1 A;  2R7S A;  2QQ9 A;  4XM3 A;  3LA3 A;  2DA1 A;  1H9T A;  1ETO A;  4K2E A;  1JT0 A;  3ZQ7 A;  3SEQ A;  2FNP A;  2A07 F;  2Q2E B;  2QQA A;  5H6Q A;  2I5U A;  4Y17 A;  4BQO A;  2FE3 A;  2JSC A;  1KQ8 A;  2CMP A;  3FXM A;  2ICW G;  3HUG B;  1VTN C;  5HDN A;  3FBI B;  3TW7 A;  1AKH A;  3GW2 A;  3G73 A;  3V78 A;  3I4P A;  4MIM A;  4W1U A;  4IRV A;  2STW A;  1MJA A;  1Z05 A;  2KRH A;  3Q9S A;  1R1V A;  3AG2 H;  4D0P A;  3CCQ I;  5CLS A;  1J59 A;  2TDX A;  4NHJ A;  1Z67 A;  1G59 A;  3CRJ A;  3KP3 A;  5E1X A;  5DS9 A;  1W36 D;  3VTI A;  4GFK A;  2V1U A;  2FBQ A;  3DKY A;  3TED A;  3N97 A;  3DF8 A;  4A5N A;  1VZ0 A;  2Y0S A;  2ZXI A;  3R60 A;  5E8G A;  4CYC A;  2IVM A;  2XB5 A;  2HZT A;  3OIQ A;  3EUA A;  4LK0 F;  3TOB A;  1J5Y A;  3IKT A;  2NVX J;  2IAI A;  5ILS A;  3WU2 C;  2HKO A;  5B66 C;  3ERE D;  4EV0 A;  1XSD A;  5DAJ A;  4KN4 X;  4IOC F;  5EGO A;  5HLH A;  4V2F A;  3OV8 A;  3RKW A;  3A01 B;  1IXR C;  4LIU A;  3WTS C;  2FJ1 A;  1WQ2 A;  5FRN A;  5JI6 A;  4RM3 A;  2X9D A;  4P96 A;  3R4K A;  2G9W A;  3V8L A;  1E17 A;  2HYG D;  3DPL C;  2GXG A;  1LFB A;  4A3J J;  2CQ7 A;  2V1X A;  3RPU A;  2P8T A;  3WGI A;  1X2M A;  5J1R A;  2QEN A;  3KP6 A;  3NXC A;  2QLZ A;  1W7P D;  2ECB A;  2XIG A;  2LNB A;  4C2M J;  5FKN A;  2CQX A;  1S72 I;  3LHQ A;  3WTY C;  2Q8K A;  5ICE A;  2DLL A;  1YJN I;  3OYD A;  4M6V A;  3ZQH A;  4UY8 I;  2PG4 A;  4KYW A;  4YG2 F;  2JK3 A;  4XLF A;  3BTJ A;  2R7F A;  1X19 A;  3ZMD A;  3RYR A;  2L02 A;  2LP0 A;  3ZMS A;  4O3M A;  5GAH J;  4QIW N;  1ZLK A;  5J8F A;  3ROU A;  2OD5 A;  2VBW A;  2O8K A;  3V7S A;  2YX4 A;  3F0C A;  3BHQ A;  4RBO A;  2LG4 A;  2CYY A;  1P92 A;  1PUF B;  3S1N J;  2BEO A;  4G7O F;  2ZJP F;  3JAM Z;  1J75 A;  4HKU A;  1MBG A;  4JP0 A;  2IBD A;  3CF2 A;  3MWM A;  2V9P A;  2COB A;  2FU4 A;  4L5E A;  3CCM I;  4XN0 A;  2GOM A;  3O8H A;  2O7O A;  2JMW A;  5DYM A;  5GP9 A;  1MSF C;  1LFU P;  3EGQ A;  5ICC A;  4QSH A;  1W0U A;  2P6T A;  2EV0 A;  2WAQ N;  3V8K A;  3CC4 I;  2CU7 A;  2BYV E;  1IN6 A;  2BZT A;  5KCM A;  2NS7 A;  3JRE A;  3C2G A;  4MTD A;  2ZXH A;  4FTH A;  3WTT C;  1PUF A;  2FRH A;  2LBF B;  3MZY A;  3JRA A;  2RC4 A;  2BW3 A;  3OYJ A;  2XGD A;  2HVR A;  1SC7 A;  1WJC A;  5H2F C;  4HNU A;  2NVQ J;  4JQF A;  2YU9 J;  2LKS A;  3WGH A;  1BR4 A;  4MEX F;  3EYY A;  1P7I A;  4PJL A;  5A2Q K;  3NS4 A;  3QBM A;  1IXC A;  5CJ9 A;  4ME9 A;  1JT6 A;  2YX7 A;  1RRJ A;  3NQO A;  3ANG A;  4DYQ A;  2H1L A;  2MYS A;  3BQZ A;  2G7L A;  2JN6 A;  1O57 A;  4Q47 A;  1R23 A;  1ZAO A;  2DA2 A;  2ZO4 A;  5FKM A;  3IHU A;  3L9F A;  4KIG A;  3ML6 A;  1Z7U A;  1PVE A;  3KZI C;  1FIP A;  2E2H J;  1VQO I;  4RB0 A;  2DU9 A;  4ZZL A;  2ECC A;  3PNV A;  1XSV A;  1MKM A;  4E7J A;  3LSR A;  1LE8 A;  2HNH A;  2BY0 A;  2PJR B;  3VVY A;  4D1Q A;  1C0W A;  5HS9 A;  4HST A;  5TIS C;  3A01 A;  3S3N A;  1MBE A;  2VL8 A;  4LK1 F;  2X6W A;  1RUN A;  3CWR A;  2DCE A;  1G6N A;  3F9K A;  5EGO B;  2GAU A;  5LFA A;  3CCS I;  3HYI A;  4N9I A;  2MGQ A;  4OAY A;  2NXN B;  5B3S H;  4A0Y A;  5LGN A;  2P5K A;  5LLQ A;  4GYG A;  3KEY A;  1IW7 F;  3C1D A;  3H35 A;  2KRF A;  3A2K A;  5E3N A;  2ZNY A;  3KLO A;  5E79 C;  2DA3 A;  3LWF A;  4PK4 A;  4XOR A;  1MND A;  3BJ6 A;  1TP4 A;  2CS3 A;  2W85 A;  3RZO J;  2DMQ A;  4M3G A;  3CCE I;  2A6H F;  4KMU X;  4HQM A;  2NOJ B;  1MW7 A;  1REP C;  1I1S A;  3DBL B;  1WSU A;  3WU1 B;  4HBL A;  2M87 A;  2LLK A;  2MD5 A;  2MC4 A;  2VUM J;  2PMZ N;  3QPT A;  3FM5 A;  4MLO A;  2QUF A;  1AOY A;  1TZL A;  1WPK A;  2FBH A;  5CXG A;  3SZT A;  1TWG J;  4EJW A;  3LST A;  4H0E A;  2Q2E A;  2A05 A;  1WFX A;  1WJ5 A;  4GDF A;  2A68 F;  2DO7 A;  3CJN A;  1TQI A;  2GIZ A;  5FRM A;  1KGS A;  5ICF A;  3K7A J;  3UKG A;  4BBR J;  2QKM B;  5DM6 F;  1OQY A;  3TP0 A;  3IUO A;  4AYB N;  1W7P B;  2M4K A;  4IRG A;  5FFX A;  3K4C A;  4GCT A;  5TJJ A;  4XID A;  3LAJ A;  4RGR A;  4XRS A;  4JL3 A;  5ILV A;  2EA2 A;  4LGW A;  2DFE A;  3BZK A;  3FM3 A;  4LMY A;  3OYF A;  1IAW A;  2XDN A;  3ON2 A;  3X2Q H;  2BY3 A;  5B5E C;  1HKQ A;  5C44 J;  2F6C A;  3ZQG A;  3F3X A;  2O3F A;  3LSG A;  2WB1 A;  2NOG A;  2V1D A;  1R6R A;  2IS1 A;  1VFC A;  1TT5 B;  3G1O A;  3ZQQ A;  5FD5 A;  4D9J A;  4F92 B;  2EV5 A;  2VXD A;  2BY1 A;  2ID6 A;  3VEP A;  3EUH C;  4M9Z A;  2DA4 A;  1XS9 A;  2K9N A;  2JA5 J;  1EJ9 A;  4LLG F;  4NC7 A;  3TDU C;  1V5F A;  2G7H A;  4U88 A;  2IPQ X;  4AM3 A;  4DGW B;  4ZTF A;  1ZQ3 P;  3HTI A;  4I76 A;  1GVD A;  4MTE A;  2DK8 A;  3HTU A;  1R5G A;  2XRO A;  3TOA A;  3LQR A;  5LBQ A;  1IXS B;  1SFX A;  3JSO A;  2OI8 A;  5BOX A;  1Q1V A;  2D6Y A;  4NBQ A;  4C3J J;  3QPS A;  3A0B C;  1E3O C;  2E1N A;  4BUP A;  2HDD A;  1W7P A;  5BMZ A;  3TGN A;  1QQI A;  1S6L A;  1I50 J;  4RGU A;  3BG9 A;  2H6B A;  4B44 A;  3DU5 A;  3K6G A;  2DN0 A;  2G7S A;  1Y0N A;  2F4M B;  5LHI A;  3S2D J;  1YFH A;  3BR2 A;  3K1M A;  4KN7 X;  2IA1 A;  1IJW C;  5EZG A;  4AVZ A;  5E3O A;  5GAE J;  3HTS B;  1CQT A;  5HOO A;  1SGM A;  4OD4 A;  3A03 A;  4YRV A;  2JT1 A;  5KAF C;  4ZDP A;  1TNT A;  1ACI A;  2IP2 A;  2LFB A;  2O03 A;  1UJ8 A;  2Z1D A;  4ENN A;  4PJ0 C;  1P4W A;  3SYT A;  3I55 I;  1HCR A;  5K5Q A;  2XDV A;  2F5F A;  4X6A J;  3GVA A;  3HEF A;  4M3E A;  3ELK A;  4OMY A;  5F04 A;  3FXL A;  3OYB A;  3M8E A;  3VW1 A;  3DKW A;  1M1E B;  2AQE A;  3QOD A;  3QU6 A;  1XDS A;  1K61 A;  3S32 A;  4BQN A;  2XKP A;  2EFN A;  3BG3 A;  3AAF A;  4NC8 A;  3GZ6 A;  3S14 J;  5D8K B;  3ABK H;  2D45 A;  2MH9 A;  2X1E A;  3T6N A;  2GWR A;  3PQJ A;  2DT6 A;  3VB2 A;  5EFY A;  4XLN F;  4BL0 B;  1LPQ A;  3DEU A;  5CKT A;  3H9J A;  2ESH A;  1ZAR A;  2AXT C;  1IRZ A;  1KON A;  1WJE A;  1NK2 P;  3JRI A;  3MD2 A;  2DFH A;  3J80 Z;  3NRV A;  3B6A A;  3ECH A;  2VOP A;  2LR8 A;  4HX4 A;  2EH3 A;  4AID A;  2XVC A;  3GBG A;  3GF2 A;  3IP4 B;  2VAS A;  1WWX A;  3WU0 A;  2OCE A;  4I6Z A;  2JA6 J;  1R71 A;  3J81 Z;  3I56 I;  2CW8 A;  3FIW A;  2X85 A;  3LOC A;  1D3Y A;  4M73 A;  4N4N B;  4A69 C;  3AFH A;  1SMT A;  3H0D A;  2EIN H;  4HF1 A;  5FFZ A;  4L0Y B;  3L1P A;  1R4M B;  1OYI A;  3NAR A;  1UZC A;  2B63 J;  3PQK A;  3V7R A;  3IL2 A;  3M1C A;  3TO9 A;  4HDU A;  5L3C A;  4D7N A;  2QEX I;  3BC8 A;  4F91 B;  1K4S A;  3HOS A;  1WCM J;  1WH7 A;  1KU9 A;  3GTQ J;  3ASO H;  5FKK A;  2GEN A;  3H1C A;  1E3P A;  1SVL A;  3CCV I;  2MLG A;  5HLI A;  3GZI A;  3LWJ A;  5BNG A;  3V6G A;  1Y6I A;  1ZEL A;  3MEX A;  3B73 A;  4P55 A;  4M3B A;  1FBU A;  3LMM A;  5TRD A;  2BW3 B;  3HPG A;  2K40 A;  2ELK A;  2LBF A;  2DJN A;  4XKV A;  4BJT A;  4XN3 A;  2QZ8 A;  3CLO A;  2MAB A;  1BIB A;  1XN7 A;  1BJZ A;  3D5S C;  3PIP F;  3AG3 H;  1G3T A;  1HW2 A;  1E3H A;  1X58 A;  3CLQ A;  4A3B J;  1XCB A;  2JJ7 A;  2AQF A;  2M3A A;  2E2I J;  5D1R A;  1SD7 A;  5C4Y A;  2K4B A;  2OJE D;  4M6X A;  2LVS A;  1FOY A;  4XOP A;  2DG7 A;  3S16 J;  2ZFU A;  4P1W A;  4YZE A;  1YX5 A;  4E7S A;  1IO2 A;  3WTW C;  3D0S A;  5JVG F;  2Q0O A;  3HOZ J;  5IT9 Z;  1STZ A;  1R49 A;  3GEU A;  5JHU A;  2OCC H;  4U9L A;  1MMG A;  1Z91 A;  4MFD A;  4YFN F;  2W82 A;  4DVY P;  2JPB A;  2UUZ A;  4CSW A;  3S3O A;  3FBN B;  1T33 A;  3FF5 A;  1B9N A;  4WCG A;  3VW0 A;  2EK5 A;  3QPL A;  2XAJ A;  2W25 A;  3RPU D;  4NDL A;  1K7A A;  2G7G A;  4BEH B;  3PIO F;  5FO5 A;  2X6Y A;  2QQB A;  3IKV A;  5IT3 A;  2E19 A;  1L0O C;  5GAD J;  1V55 H;  4I0A A;  4II2 A;  1ZG3 A;  1KU3 A;  3SEZ A;  3FIS A;  4Q5S F;  5IYC J;  1OYW A;  3EUK L;  2P81 A;  2Y31 A;  2FSW A;  1IDY A;  4B43 A;  2NS8 A;  2JVH A;  3WHC A;  2M1B A;  1XD7 A;  3BG6 A;  1Z6T A;  3A1Y A;  2XAQ A;  5E1W A;  1ULY A;  4BY1 J;  1ZGA A;  3F8N A;  4MEY F;  2EIL H;  3MMY B;  1FJL A;  2DPU A;  2O8X A;  1BJA A;  1GDT A;  2M7A A;  3FZV A;  2HTJ A;  1U2W A;  2DDB A;  3KEO A;  4L0Z B;  3F1B A;  1K6Y A;  3COL A;  4F7Z A;  1FYM A;  3CC2 I;  4CYC B;  3B02 A;  3TL4 X;  1FBS A;  3PAS A;  3WTV C;  3RQ4 A;  2KKO A;  4E70 A;  1KU2 A;  1PDN C;  4HQE A;  4BAY A;  4CA0 A;  2NNN A;  5D18 A;  1IRF A;  3QYE A;  4C2T A;  1T38 A;  1O3Q A;  4LFU A;  1MDM A;  3CDL A;  1I6X A;  4MNU A;  5LEJ A;  2BBY A;  4HRI A;  2OBP A;  2KIQ A;  1FWZ A;  4A3F J;  4JKZ A;  1IN4 A;  4M3D A;  3MAJ A;  3NRG A;  4IL6 C;  1QPI A;  1GHC A;  2CO5 A;  5EEA A;  3E6B A;  1FP2 A;  2XHK A;  1TWC J;  4XOT A;  4AUX A;  3K9T A;  1ZR2 A;  1Z6R A;  2QWW A;  4ZYA A;  3GTK J;  1E2X A;  4HAM A;  1PP7 U;  2LTP A;  4GRI A;  4B4C A;  1BI3 A;  1YIO A;  4ZC3 A;  2WBM A;  3SZP A;  4PJJ A;  4ENM A;  3H3U A;  1OYY A;  1A5J A;  5K7Z A;  4GXO A;  4M74 A;  4IHV A;  1TQP A;  4IQJ A;  2QQ8 A;  2X0L A;  3RPQ A;  1F1Z A;  3QPH A;  4UNO A;  1LVA A;  2PJP A;  1P6R A;  5F0F A;  1UMQ A;  2DOE A;  3CCR I;  3WHB A;  4BDZ A;  3G1L A;  1XGN A;  5BPI A;  1T2K A;  2HPM A;  5LHH A;  2LSO A;  1K83 J;  2QKL B;  1X1D A;  3LA2 A;  4JOM A;  4AF5 A;  4IXA A;  5CVR A;  3VOE A;  3F6V A;  4DW6 A;  1O3R A;  2OA4 A;  1VND A;  3GTG J;  3KP5 A;  4F55 A;  4HLX A;  5KK1 A;  2MA3 A;  2ZCM A;  5M3M J;  2V7F A;  2XB0 X;  1MMN A;  3LNQ A;  4NEL A;  2XGC A;  1JXS A;  4XBF A;  2HXI A;  1OIS A;  2JA2 A;  4GCV A;  4YII A;  4ZYD A;  2B3W A;  3C2B A;  4TV7 A;  4WXD A;  2WA0 A;  3DV8 A;  2HXO A;  3OYL A;  2E71 A;  4G6D A;  1A36 A;  2GZW A;  3E7L A;  2VI6 A;  3HRS A;  2XPU A;  3FMR A;  4XRF A;  5HS7 A;  3RYP A;  4NUB A;  4RMN A;  2O0Y A;  2CUE A;  3A0H C;  4EGY A;  2IA2 A;  2HI3 A;  3K2Z A;  3W6J B;  4GGG A;  3QKX A;  4MK6 A;  2W48 A;  3ABL H;  4KNY A;  2PQ8 A;  1FMW A;  1IN8 A;  5FRO A;  5C4X J;  1BI0 A;  3L2W A;  1GVJ A;  3ABT A;  1JUS A;  2XSJ C;  3QQA A;  2XAG A;  3RKX A;  1XPX A;  3QU3 A;  4IOA F;  2ESN A;  3M8F A;  4BH9 A;  4CO8 A;  3DTE A;  1W4M A;  3HHH A;  4IF4 A;  4IJA A;  2G3B A;  2P5L C;  1T08 B;  3ZQC A;  3AG1 H;  3JAM K;  2LKP A;  3ZP5 A;  2JTV A;  1TW3 A;  3OIP A;  1QZZ A;  5EG0 A;  1VF9 A;  1OKR A;  1OR7 C;  4M6Y A;  4QWQ A;  3RKQ A;  5IOZ A;  3DTI A;  2H8W A;  5CVU A;  1YO5 C;  1XCV A;  3F8C A;  3KP2 A;  1SAN A;  2K3P A;  1MNE A;  4F3Q A;  2DMN A;  3GTL J;  3DXJ F;  3K4J A;  3FXJ A;  1H9G A;  1K4T A;  5E1Z B;  4ZJZ A;  2E1M B;  3FHZ A;  2HVQ A;  2Z3Y A;  4XQF A;  1HF0 A;  1JE8 A;  4O5V A;  1W5S A;  3E5Q A;  2EZL A;  3PNY A;  1SD5 A;  1MMS A;  1V54 H;  3HL2 A;  3KP7 A;  4PJN A;  3L2V A;  2PMU A;  1Z1D A;  4O6J A;  2HTS A;  2EJR A;  1R5I D;  3GTO J;  1K79 A;  1X3U A;  2Z33 A;  5HNH A;  4FT8 A;  2KL4 A;  3QOE A;  2DDA A;  1JJ8 C;  2EIM H;  2KQR A;  4HF2 A;  2WAE A;  3LQQ A;  4CCJ A;  2CUZ A;  4U0V A;  2E5Z A;  4Y33 A;  1TW2 A;  3D5L A;  1U8R A;  4BXU A;  5AQC A;  2LDU A;  2O9L A;  1Y0U A;  3HE0 A;  4HOB A;  3K8P C;  4EJV A;  4BJ5 C;  2CH0 A;  2R0Q C;  2E1C A;  3HC7 A;  1IUF A;  1MIJ A;  2MG4 A;  3EET A;  3P7N A;  5IOY A;  3J7Y J;  4EGZ A;  2CV2 A;  3BLY A;  3J7Z I;  4FHT A;  2LH9 A;  3BCG A;  5E8I A;  2VKV A;  4BNC A;  2VB6 A;  5IP7 J;  4XRS G;  3OYG A;  3VYS B;  1A31 A;  4U9N A;  2L3D A;  4CCO A;  4I2O A;  2G0E A;  2X6O A;  5GAG J;  2WAD A;  2LRE A;  4Y52 J;  4A2U A;  3IRQ A;  4JBA A;  2E5N A;  3SQN A;  5K1Y A;  1JKO C;  3BWG A;  1H88 C; 
#chains in the Genus database with same CATH homology
 2PMZ N;  3E7Q A;  4MLO A;  3CCY A;  4D5F A;  1WPK A;  5CXG A;  4DYC A;  2RHA A;  4KWA A;  1TWG J;  5IPA A;  3BR5 A;  3BG5 A;  5EYR A;  3O60 A;  1JKP C;  1X2N A;  2YS9 A;  4LOC A;  2R5Y B;  4DZJ A;  3IUV A;  2UXO A;  3K7A J;  3MVP A;  3VPR A;  3UKG A;  4BBR J;  2NVY J;  1ZGW A;  1RKT A;  3HOW J;  3S17 J;  5FKL A;  3TP0 A;  3ZQI A;  2HYJ A;  4AYB N;  4IHY A;  3OOU A;  2EZK A;  2L0K A;  5JLX A;  4GCT A;  4XID A;  4GFB A;  3VVX A;  4MO7 A;  4XRS A;  4JL3 A;  4A3D J;  3BTL A;  2KT0 A;  3ON2 A;  4BKX A;  2HOA A;  2ZCX A;  2XDN A;  1JTY A;  3PM1 A;  5CXI A;  2YVH A;  2L7M P;  3BJB A;  1QVU A;  1EF4 A;  5C44 J;  3ZQG A;  2R5Y A;  1YRN B;  2N8G A;  3G7R A;  3HTJ A;  1MH4 A;  3LSG A;  3VW2 A;  2NOG A;  1DU6 A;  5IP9 J;  1NTC A;  1VFC A;  3EUP A;  3G1O A;  3BR1 A;  4D7M A;  2DMU A;  3JSJ A;  5JLW A;  2AO9 A;  2M8G X;  2ID6 A;  1QVT A;  2KDZ A;  4GCL A;  2DA4 A;  1XS9 A;  1U9N A;  4XIC A;  2K9N A;  2LY9 A;  1BL0 A;  2JA5 J;  4MXM A;  4A3K J;  4CGR A;  3LSP A;  3BTC A;  1JKQ C;  3HOY J;  2DMP A;  1ZQ3 P;  3HTI A;  4I76 A;  2MW8 A;  1MBK A;  3D1N I;  1GVD A;  5J1Y A;  5E3M A;  2D5V A;  1YRN A;  1ZKG A;  4M3F A;  4BXX J;  5HBU A;  1AHD P;  3HB9 A;  3S2H J;  2OI8 A;  3HOV J;  1Q1V A;  4JX4 A;  2D6Y A;  1W0T A;  1IG7 A;  4JYK A;  1Z0X A;  4C3J J;  2Y0S N;  4FE7 A;  4XK4 A;  1JTX A;  3QPS A;  1E3O C;  4A3L J;  3KZ9 A;  3FK6 A;  2HDD A;  2Y9Z A;  4IHW A;  1GUU A;  1I50 J;  3BG9 A;  2G7S A;  2DN0 A;  5GPC A;  2NP5 A;  3G1M A;  2GFN A;  2AHQ A;  3S2D J;  3BR2 A;  1IJW C;  5EZG A;  5E3O A;  3S1R J;  1HOM A;  1LE8 B;  2QOP A;  4J19 A;  3ZOB A;  1CQT A;  2OF7 A;  4A3M J;  2ZOY A;  1SGM A;  3ON4 A;  3CMY A;  3A03 A;  3JRD A;  1G2H A;  3SDG A;  2UXU A;  2UXP A;  5H9T A;  2JA7 J;  5GPA A;  2LFB A;  1RKW A;  2FD5 A;  2QF7 A;  2PBX A;  1HCR A;  1ETX A;  3HDD A;  3RH2 A;  2XPW A;  4X6A J;  4GCK A;  3HEF A;  4M3E A;  3SJM A;  4UDS A;  1JUP A;  5F04 A;  4QTR A;  3VW1 A;  4FIS A;  1NK3 P;  1XG1 A;  1ETV A;  1IDZ A;  1K61 A;  1SFO J;  4UUS B;  2GLO A;  5FHP A;  3BG3 A;  3S14 J;  3NNR A;  1D5Y A;  3TP3 A;  1MNM C;  3T6N A;  2TCT A;  5E3L A;  5IYB J;  3OSF A;  1AU7 A;  1FTZ A;  1Y1V J;  1FIA A;  4V2G A;  5K7F A;  5EFY A;  1WGX A;  3I4N J;  2WB1 N;  3VP5 A;  3BNI A;  3IH4 A;  1IRZ A;  2R5Z B;  1I6H J;  1B72 B;  1NK2 P;  2VPR A;  2DA7 A;  3JRI A;  2HQ5 A;  5K7H A;  4ICH A;  3B6A A;  3B81 A;  1IV6 A;  2LR8 A;  2EH3 A;  1JJ6 C;  1ORK A;  3GBG A;  5EZH A;  5F1J A;  2H1K A;  3Q3S A;  4I6Z A;  1QRY A;  2JA6 J;  1IC8 A;  1JGG A;  2H8R A;  4A93 J;  1UI6 A;  2NVT J;  2QIB A;  3FIW A;  4NN1 A;  3DEW A;  3LOC A;  4A69 C;  4IHX A;  3NI7 A;  2R92 J;  3VOK A;  1WI3 A;  3L1P A;  3NAR A;  1UI5 A;  3A02 A;  3RQI A;  2B63 J;  3P9T A;  2XRL A;  2O7T A;  2DMT A;  4D7N A;  3NPI A;  2L9R A;  2REK A;  2JWT A;  3IH2 A;  3BTI A;  2OPT A;  2NP3 A;  1WCM J;  1WH7 A;  2CQQ A;  3GTQ J;  3AQS A;  2EZH A;  5FKK A;  2LD5 A;  2GEN A;  5F0C A;  3GZI A;  3LWJ A;  2QTQ A;  5BNG A;  1TC3 C;  3V6G A;  3BR6 A;  3C07 A;  2WV1 A;  4M3B A;  5K58 A;  2WUI A;  1OCT C;  2R7Z J;  1ZTR A;  3HGG A;  1F43 A;  2K40 A;  2ELK A;  3NAU A;  1GV2 A;  3MN2 A;  2DJN A;  2RAS A;  2DA5 A;  5EG0 B;  4UUT A;  2ZB9 A;  3HBL A;  1BJZ A;  3BRU A;  1JKR C;  2EBI A;  3HIM A;  2TRT A;  3S5R A;  1OFC X;  4A3B J;  1X58 A;  3DPJ A;  2HOT A;  2JJ7 A;  3I4M J;  5F08 A;  5D1R A;  2E2I J;  5C4Y A;  2LVS A;  4C3H J;  2ZOZ A;  3LJL A;  3MKL A;  4D5C A;  1B72 A;  3S16 J;  2DG7 A;  2IEK A;  1H89 C;  2OER A;  3O8G A;  4YZE A;  3HTH A;  1TWA J;  2ID3 A;  2ME0 A;  1BW6 A;  3HOZ J;  4B1R A;  1VI0 A;  3GEU A;  2LKX A;  1OCP A;  1RES A;  4MFD A;  4EEF G;  2XGE A;  3VUQ A;  3HOU J;  1RR7 A;  4A3I J;  1T33 A;  4BBS J;  2L7Z A;  2VKE A;  4UUS A;  4FCY A;  3Q0U A;  3VW0 A;  2ME6 A;  3ZQL A;  3QPL A;  1FEX A;  3AQT A;  4NDL A;  2YUS A;  2CRG A;  1HDD C;  2G7G A;  3Q0W A;  3M3Y J;  2JA8 J;  2Y30 A;  2E19 A;  4JNN A;  2FQ4 A;  3OIO A;  1UG2 A;  2QKO A;  3FIS A;  1AKH B;  4S0H B;  5IYC J;  3PO3 J;  3JRG A;  2P81 A;  1DU0 A;  2Y31 A;  5M3F J;  1RET A;  3RZD J;  1IDY A;  2NS8 A;  3WHC A;  1O4X A;  2DG8 A;  2CJJ A;  2CUF A;  2M34 A;  2E2J J;  1U8B A;  3LSJ A;  2XSD C;  1ETQ A;  1WH5 A;  1ZK8 A;  3JR9 A;  3S1Q J;  3IH3 A;  3HTA A;  4BY1 J;  4G12 A;  1FJL A;  4A3E J;  1U78 A;  1H8A C;  1GDT A;  3JRH A;  2Y9Y A;  1B8I B;  1APL C;  2HYT A;  4B3A A;  5F27 A;  9ANT A;  3F1B A;  2ZCN A;  3BQY A;  3COL A;  2DTZ A;  2V57 A;  3BT9 A;  4CYC B;  4AC6 A;  4JX5 A;  3PAS A;  2HKU A;  2DA1 A;  1ETO A;  1JT0 A;  5D18 A;  2QWT A;  2W53 A;  2GUH A;  1R9T J;  2RAE A;  4X1E A;  3CDL A;  5DTD A;  3PPB A;  3JRF A;  5FLV A;  4A3F J;  3TW6 A;  5J1U A;  4JKZ A;  4PXI A;  4M3D A;  3NRG A;  3GTM J;  1ZR4 A;  1QPI A;  2EZI A;  1AKH A;  3TW7 A;  3JRB A;  5EEA A;  4AC0 A;  1TWC J;  4AUX A;  3S15 J;  3V78 A;  3KKD A;  2XPV A;  4MIM A;  4W1U A;  1ZR2 A;  3GTK J;  2YVE A;  2LTP A;  1JUM A;  1POG A;  4B4C A;  3K2A A;  5FJ8 J;  3OSG A;  3Q0V A;  3HKZ N;  1I3Q J;  1GT0 C;  1ETK A;  1A5J A;  5IP6 A;  5K7Z A;  4IHV A;  3CRJ A;  3GTJ J;  5F0H A;  5DS9 A;  3G56 A;  3KKC A;  4GFK A;  2FBQ A;  5F0F A;  1UMQ A;  3TED A;  3WHB A;  2E1O A;  3G1L A;  1Z77 A;  4CYC A;  1XC5 A;  2XB5 A;  5M5X J;  2NVX J;  5FGL A;  2IAI A;  1K83 J;  1T56 A;  5HOD A;  3IV5 A;  5FKO A;  3HGY A;  5DAJ A;  3KNW A;  5EGO A;  4AF5 A;  4V2F A;  1B8I A;  1ITY A;  4DW6 A;  1U9O A;  3A01 B;  1VND A;  3GTG J;  2FJ1 A;  2ZCM A;  5M3M J;  2X9D A;  2XB0 X;  1TWF J;  5IYD J;  3LNQ A;  3VOX A;  4NEL A;  2XGC A;  2HXI A;  1LFB A;  1ETY A;  4A3J J;  1ENH A;  3C2B A;  5M5W J;  1X2M A;  1MBJ A;  4MFE A;  5J1R A;  3H0G J;  3NXC A;  2HXO A;  3VVZ A;  2ECB A;  4C2M J;  2IU5 A;  5FKN A;  2CQX A;  3LHQ A;  3S1M J;  3E7L A;  2VI6 A;  4M6V A;  2XPU A;  3ZQH A;  2I10 A;  5CW8 A;  2JK3 A;  2FX0 A;  3BTJ A;  2Y2Z A;  2CUE A;  1ETW A;  2HI3 A;  1HDP A;  3QKX A;  5HSZ A;  2LP0 A;  3HOX J;  3FK7 A;  4QIW N;  2EQR A;  4MK6 A;  2W48 A;  1TWH J;  2UXI A;  2O8K A;  1MBH A;  5C4X J;  3F0C A;  3BHQ A;  4RBO A;  1JUS A;  1PUF B;  3DCF A;  3B6C A;  3S1N J;  3QQA A;  2R93 J;  3M4O J;  2L7F P;  2PZ9 A;  2DA6 A;  3JRC A;  2K9S A;  1P7J A;  1FTT A;  1MBG A;  4JP0 A;  4HKU A;  2IBD A;  1GV5 A;  5EF6 A;  4FE4 A;  2COB A;  4L5E A;  5FLM J;  5D19 A;  3O8H A;  2O7O A;  2JMW A;  4W97 A;  5GP9 A;  1MSF C;  1LFU P;  3EGQ A;  2G3B A;  4QSH A;  1W0U A;  2NX4 A;  2M9H A;  2WAQ N;  3ZQC A;  1MBF A;  2WGB A;  1Y1W J;  5FMP A;  2CU7 A;  2UXH A;  3JRE A;  2NS7 A;  5HAW A;  5EG0 A;  1VF9 A;  4FTH A;  1PUF A;  3RKQ A;  4GFL A;  3JRA A;  2HOS A;  5IOZ A;  1MSE C;  4A3C J;  2XGD A;  5C4J J;  3GTP J;  1S7E A;  1BA5 A;  1SAN A;  4IEJ A;  4DZP A;  2DMN A;  4DYR A;  3GTL J;  2NVQ J;  2F07 A;  2YU9 J;  2X48 A;  3ZQF A;  3HM5 A;  1F36 A;  1UHS A;  1P7I A;  4XRM A;  1HF0 A;  3QBM A;  1BW5 A;  3MNL A;  1JT6 A;  4ME9 A;  3H3V K;  2EZL A;  3ANG A;  4DYQ A;  3BQZ A;  2G7L A;  2JN6 A;  4RDU A;  1OJL A;  2DA2 A;  5FKM A;  3SFI A;  3FKI J;  3GTO J;  2K9Q A;  3VIB A;  2LK2 A;  1FIP A;  2E2H J;  2QCO A;  3RD3 A;  3CQZ J;  2ECC A;  1JJ8 C;  3LSR A;  1LE8 A;  4HNV A;  3VVY A;  5AQC A;  2O9L A;  3A01 A;  3HE0 A;  1MBE A;  4ACI A;  4L62 A;  3CWR A;  5M5Y J;  2R5Z A;  5C3E J;  5EGO B;  2R0Q C;  2MSY A;  1IUF A;  2MG4 A;  5IOY A;  2MGQ A;  2M2E A;  2M0C A;  3PO2 J;  5J3L A;  1A6I A;  5E3N A;  4ABZ A;  2Q24 A;  2DA3 A;  2GBY A;  3BCG A;  2VKV A;  3BR0 A;  5EDN A;  5IP7 J;  3RZO J;  4XRS G;  2DMQ A;  4M3G A;  2GM4 A;  3FRQ A;  3BR3 A;  3CJD A;  2G0E A;  1RPW A;  4C3I J;  3ANP A;  2X6O A;  4A3G J;  1HLV A;  1MH3 A;  1IGN A;  4BY7 J;  3W6V A;  4Y52 J;  2LLK A;  1JKO C;  4Y7N J;  1H88 C;  4JX6 A;  2VUM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...