5F27A

Structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 2 at 1.68a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
187
Chain Sequence
b'DRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title A fragment merging approach towards the development of small molecule inhibitors of Mycobacterium tuberculosis EthR for use as ethionamide boosters.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 80
structure length 187
sequence length 191
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5f27A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5f27A02
1SGMA 5JLXA 1X2NA 2HYJA 3A03A 1Z0XA 4JX5A 2OI8A 3KKCA 3PASA 4KWAA 4Y7NJ 4GFKA 1TWGJ 2NS7A 3LOCA 1GT0C 3MVPA 4W97A 2XB5A 1H88C 4A3JJ 4A93J 5HODA 2WB1N 3WHBA 3HOUJ 4DZJA 4RBOA 2UXPA 4G12A 2M0CA 3NI7A 1HCRA 5M5XJ 4M3EA 1WH7A 2E19A 4D5CA 5IP6A 4DYRA 1UI5A 1ETWA 2O8KA 4S0HB 1K61A 1CQTA 2XGDA 3BR5A 1R9TJ 1S7EA 2DTZA 2W53A 2NP5A 1BW5A 5GPAA 2K9QA 3HTHA 1JJ8C 4UDSA 3FIWA 3IH2A 4EEFG 5CW8A 2ZOZA 3WHCA 2FD5A 1AHDP 4BY1J 2JJ7A 4GFLA 1TC3C 1JUSA 2HDDA 3MKLA 1TWFJ 1JKQC 2XDNA 4C2MJ 3QQAA 4LOCA 2H8RA 4ICHA 1RKTA 4J19A 4FE4A 1E3OC 1FJLA 4ME9A 2DA3A 1HDDC 4DYCA 1ITYA 2HOSA 2EZHA 2CJJA 4MO7A 3COLA 1LE8A 2P81A 1RETA 2LLKA 5M3MJ 2R5YB 1HOMA 2PZ9A 3GTPJ 1D5YA 1TWAJ 3JSJA 1U9NA 3VPRA 5FKMA 5FKNA 3LSPA 1ZQ3P 2PBXA 4JKZA 5FKOA 1Z77A 1MBFA 1LFBA 2IEKA 3HOVJ 3S2DJ 2R5ZB 2GUHA 3L1PA 1OJLA 2JA7J 3G7RA 2LTPA 4CYCB 4NN1A 2E2IJ 4M3GA 2M34A 1AKHB 3VVZA 2XSDC 1QVTA 3TEDA 4A3KJ 2ZCMA 3B6CA 5K7FA 2V57A 1T33A 5E3MA 1X2MA 5M3FJ 3KZ9A 5DS9A 3BTJA 5EGOA 3CMYA 3HB9A 4DZPA 2DA4A 3F1BA 3Q0WA 1WPKA 4MLOA 5JLWA 3LWJA 3RKQA 1IJWC 2HKUA 2M2EA 2X6OA 3Q3SA 2W48A 3H0GJ 3OSFA 3BCGA 3HOZJ 1JT0A 2DG7A 2K9SA 5EZHA 4AUXA 3V78A 5EEAA 3ZOBA 4B1RA 4IHYA 3FRQA 3SJMA 1OFCX 1JKOC 3ZQIA 5EGOB 2JMWA 2VKVA 4I76A 3JRBA 1BJZA 2REKA 3ZQFA 5GPCA 3FISA 2E2HJ 2X48A 2WAQN 1ZTRA 4QSHA 5IP9J 1HLVA 4IHXA 3G1LA 1DU6A 2EH3A 4DW6A 2NVTJ 4QTRA 2CUFA 5IOYA 3BTCA 3GTJJ 4GFBA 4C3JJ 3S16J 2XGEA 3IUVA 3BR1A 5M5WJ 2O9LA 4Y52J 3FKIJ 1XS9A 3VW2A 5IYDJ 2R7ZJ 1U9OA 2DMUA 3JRAA 2VUMJ 3NPIA 4A3GJ 1U78A 1P7IA 2FJ1A 2DMTA 2NOGA 2DA6A 3CDLA 5HSZA 5C4XJ 5E3NA 1UMQA 1GV5A 4XICA 1VNDA 1W0TA 4M3DA 2JA8J 3JRDA 4IHVA 5CXIA 3LSGA 2Y9YA 1I6HJ 4NELA 3W6VA 2L0KA 3BRUA 2PMZN 2KT0A 3BR3A 4GCKA 3S1RJ 1IC8A 5D19A 2XRLA 2TRTA 3HM5A 2WV1A 4UUSB 3S14J 1I50J 1BL0A 2UXIA 2G7GA 2EZIA 1JUMA 2GBYA 4FISA 2ME6A 3ON2A 2QCOA 3VUQA 4MK6A 4M3FA 4ACIA 1Y1WJ 2DMNA 1HDPA 1PUFB 1EF4A 1JT6A 2Y2ZA 3SDGA 3BNIA 2UXHA 5FMPA 1TWCJ 1A5JA 5E3LA 1P7JA 4X1EA 1IG7A 1GUUA 3FK7A 2HXOA 2O7OA 4C3HJ 1WH5A 2CUEA 5EG0A 2Y0SN 3CWRA 4JNNA 2DN0A 3BQYA 3TW6A 4M6VA 2Y31A 2WUIA 3HOWJ 1WGXA 2DA7A 2O7TA 4MFDA 2ZCNA 2Q24A 1JKPC 2LVSA 4FTHA 1DU0A 3HGYA 4DYQA 2AHQA 5J1YA 1LFUP 2ELKA 2ZB9A 1JKRC 3VW0A 5FLVA 1XC5A 3Q0VA 2LFBA 4JX4A 2G7SA 2HXIA 5FJ8J 2RHAA 4XRMA 2KDZA 1B72A 3GZIA 3KNWA 4MFEA 1RKWA 3K7AJ 3B6AA 3ZQLA 1O4XA 1ZR2A 2EZKA 3BR6A 5EDNA 3CQZJ 3KKDA 1F36A 5EFYA 3P9TA 3QBMA 2H1KA 2VPRA 1GVDA 2ZCXA 4A69C 1MBKA 1ZGWA 2L7ZA 3DCFA 2NX4A 3Q0UA 3BJBA 1ETKA 2JA5J 3JRIA 4B3AA 2NVYJ 2LKXA 1B72B 2R0QC 3JRFA 4JP0A 4C3IJ 1JTYA 1YRNA 2QKOA 5C4JJ 4MIMA 3ANGA 3A02A 3GTQJ 2K40A 2E2JJ 3S5RA 2G7LA 2R93J 2F07A 3HTAA 1LE8B 3BTLA 2DMQA 5F0FA 4GCTA 3G1MA 3NRGA 2COBA 5D18A 4I6ZA 2EQRA 3GTKJ 5HAWA 3CCYA 3IV5A 5FLMJ 4FCYA 5EZGA 3GEUA 3I4NJ 1ZKGA 3QPSA 1YRNB 4XIDA 2D5VA 2JA6J 2Y9ZA 2IU5A 5F08A 1VFCA 4BY7J 3RZOJ 2EBIA 1UHSA 3F0CA 2UXUA 3O8HA 4XK4A 3HTJA 3EUPA 2QOPA 5C3EJ 5IOZA 5J1RA 3VP5A 4BKXA 3VVYA 1MSEC 2CU7A 1QRYA 3LHQA 3ZQHA 1NK2P 2YU9J 3ON4A 5M5YJ 4XRSG 3HOXJ 2Y30A 2QTQA 1GV2A 3MN2A 2K9NA 5K58A 3BTIA 1B8IA 5E3OA 2R92J 3AQTA 1UI6A 4HKUA 2ECCA 5DAJA 5AQCA 5D1RA 2EZLA 3DEWA 1VI0A 2YS9A 3BR2A 1IDZA 3TP0A 4D7NA 3B81A 3LJLA 1XG1A 3PPBA 4B4CA 2G0EA 1H8AC 3MNLA 1A6IA 1K83J 3QPLA 2L7FP 2CQQA 3VOXA 4GCLA 4PXIA 1ORKA 5FKLA 3JR9A 3M4OJ 3NXCA 2LK2A 4D7MA 3M3YJ 1IDYA 1FIAA 2MGQA 1ZR4A 1GDTA 2YUSA 3NNRA 1JTXA 1ZK8A 2X9DA 2LY9A 1SANA 5F27A 1H89C 3S15J 2JK3A 4IHWA 2XPUA 1MBHA 2LR8A 3I4MJ 2CQXA 1FEXA 1QPIA 4BXXJ 2G3BA 3IH4A 3S1QJ 2RAEA 2YVEA 3T6NA 3K2AA 1Q1VA 2B63J 3G56A 1JUPA 3BG3A 3VOKA 2MSYA 1MH3A 2AO9A 4BBRJ 5IYBJ 4AC0A 3CRJA 2FBQA 3S1NJ 4AC6A 3BG5A 4RDUA 3E7LA 1ETQA 3JRCA 3DPJA 3D1NI 1WI3A 2GENA 4JL3A 5K7ZA 2CRGA 2GFNA 3C07A 4W1UA 1ETXA 1TWHJ 2RASA 1WCMJ 1FIPA 2ZOYA 3VIBA 4L62A 3OIOA 2GLOA 4A3FJ 4NDLA 3E7QA 2IBDA 5EYRA 3HGGA 3H3VK 2UXOA 3PM1A 3OOUA 3BG9A 1MSFC 1IV6A 4ABZA 5EG0B 4BBSJ 2L9RA 2QF7A 4V2GA 1AU7A 4A3CJ 1IGNA 2XPWA 2JWTA 3G1OA 4AYBN 1POGA 5F0HA 5C4YA 2R5YA 3OSGA 5HBUA 5H9TA 3A01A 3S2HJ 3S17J 1ETOA 3SFIA 3C2BA 2VI6A 3BQZA 4AF5A 4CGRA 3BR0A 4A3BJ 5GP9A 2WGBA 1VF9A 4JYKA 3ZQGA 2R5ZA 2HQ5A 5IP7J 1MBEA 5IYCJ 4CYCA 2NS8A 3O8GA 1Y1VJ 2M9HA 4V2FA 1AKHA 1W0UA 3BHQA 2M8GX 2TCTA 3RQIA 3A01B 2ME0A 5C44J 3HOYJ 2DG8A 4YZEA 4A3MJ 1JJ6C 3RH2A 4JX6A 5EF6A 2OPTA 4IEJA 1SFOJ 3BT9A 1NK3P 2NP3A 5FGLA 4A3EJ 3HIMA 2VKEA 3HDDA 1ENHA 5CXGA 5J1UA 2MG4A 3HKZN 2QWTA 1FTTA 3HTIA 3HE0A 1IUFA 2FQ4A 3CJDA 3ANPA 1MH4A 3VVXA 3LNQA 3GTGJ 1T56A 1NTCA 3ZQCA 2XB0X 3LSJA 5K7HA 1JGGA 3AQSA 3QKXA 1ETVA 1RPWA 2IAIA 1RESA 1RR7A 4X6AJ 3UKGA 3HEFA 1ETYA 3IH3A 5FKKA 3RZDJ 2DA1A 1MNMC 1F43A 4L5EA 1MBJA 2LP0A 1FTZA 2ECBA 5BNGA 2HOAA 2DMPA 1BA5A 2MW8A 2N8GA 3JRGA 3GTMJ 1IRZA 1G2HA 9ANTA 2E1OA 2XGCA 5J3LA 2ID3A 1U8BA 3LSRA 5IPAA 3FK6A 3NARA 1BW6A 4A3IJ 2DJNA 1OCPA 2ID6A 3HBLA 2I10A 2QIBA 1UG2A 1HF0A 3PO3J 2HI3A 3JREA 1APLC 4A3DJ 3RD3A 5FHPA 1B8IB 3TP3A 5DTDA 2LD5A 5F04A 2HYTA 1MBGA 3V6GA 4QIWN 2OF7A 2DA2A 3EGQA 4D5FA 4UUTA 2D6YA 4HNVA 2JN6A 4UUSA 2DA5A 3GTLJ 1OCTC 3GBGA 3JRHA 1I3QJ 4FE7A 2OERA 3O60A 3S1MJ 2FX0A 2L7MP 1PUFA 1X58A 2XPVA 1QVUA 4XRSA 2YVHA 3TW7A 2NVQJ 4M3BA 3NAUA 2NVXJ 3VW1A 3PO2J 4A3LJ 5F1JA 3GTOJ 2HOTA 5F0CA 2GM4A 4MXMA
chains in the Genus database with same CATH superfamily
5GAEJ 3WG9A 2IS2A 4E4HA 1X2NA 1Z0XA 2OI8A 1D1BA 4XR6A 5F64A 3HRTA 4GFKA 1G6NA 1H9GA 3S93A 3K4KA 4WK8F 3A0HC 4CICA 1XSVA 1FPQA 1UJ8A 2DYSH 2XVCA 3GEZA 4IO9F 1H88C 1SD6A 4FHTA 2GA1A 5HLIA 1SFKA 1OR7C 3WHBA 2F6CA 2OCCH 4BDZA 4G12A 4BXFA 2OZ6A 2R7WA 3OL3A 2V1DA 4AYBA 2ZJQF 1HCRA 4M3EA 1AOYA 2ZNYA 3P7NA 4D5CA 4DYRA 2XAFA 1UI5A 1UHWA 1ETWA 4BS9A 1K61A 1G3YA 4BEHA 2Z16A 3WU2C 1BW5A 2OA4A 1TZLA 4CHUA 5E17F 4CA0A 3HOTA 3HTHA 5TJJA 5LHIA 1OPCA 1FOKA 2EILH 3OYGA 4EEFG 5LEJA 4GFLA 3FXQA 2HDDA 3MKLA 3LAJA 3HG9A 1XGMA 4RAGA 1YITI 3QQAA 1YS7A 4LOCA 2H8RA 3GFJA 3TO9A 1YW8A 3CDIA 4N4OB 1O3QA 2FBHA 3WTYC 1HOMA 2LF7A 1R1TA 3CDHA 1VQNI 1PVEA 3NRVA 3Q9SA 4LMYA 2OD5A 2JA2A 1ZGJA 3HSEA 1F9NA 4HG2A 4RS8A 3IKTA 4G7HF 4RM2A 4BL0B 2R5ZB 2GUHA 1OJLA 1MMDA 4XKWA 4M6YA 1DDNA 2ZMEA 1ZELA 4DOZA 4KN4X 2XV4S 1ZLKA 1HSTA 3S3OA 4ZH4F 1XTAA 2M34A 3LSMA 4G6DA 1QVTA 2VBWA 2KKOA 2DK8A 2V57A 2HQRA 3O3KA 5DM6F 1X2MA 2FUG2 1D0YA 5DM7F 3F1BA 2FXAA 4XRFA 2ETHA 4KJZA 4PDKA 3W2VA 3WGIA 2BV6A 2M2EA 1BR2A 4BUPA 3R60A 2DFIA 3DBRB 1FMVA 3H0GJ 3KFWX 3H1CA 4BHCA 1FZPB 4KNYA 4EJWA 2P8TA 2K9SA 3WGHA 3OYMA 2EIKH 3K0LA 4EM0B 1Z3XA 1Y39A 4OINF 4HDVA 2LKSA 1BJZA 1T0FA 3OYHA 3ZQFA 3H9JA 1FOXA 3K10A 4BJ6C 1LB2A 1XMKA 3AL0B 1HLVA 3SQNA 1IRGA 2XGEA 2QSFX 3BR1A 5M5WJ 2LOOA 4DBRA 2VJJA 4Y52J 4HF1A 2CW8A 2K7LA 4LD5A 1MJBA 2VQLA 1MNDA 2ELJA 3M7GA 3JRAA 2VUMJ 1D8JA 2NOGA 3P9IA 3QOPA 3CDLA 3LSTA 4PZJA 1P4WA 5E3NA 3IRQA 1UMQA 2LKPA 4BQQA 1GV5A 5J4YA 4XICA 3X2QH 4RLFA 3JRDA 3S2WA 3VWBA 4IHVA 3LSGA 2Q2EA 1I6HJ 4NELA 3KZYA 3BRUA 2PMZN 2KLOA 2KT0A 3CMMA 4CCLA 4CUGA 1IC8A 4AIDA 3AG2H 3I56I 3CCRI 3J81K 1R4MB 3S14J 2PFVA 2EZIA 2K9LA 3FDYA 5HS7A 4O3MA 2OBPA 5DEQA 2A5YB 1R1UA 3K4MA 4HAMA 3V4GA 2DMNA 2RQQA 1HDPA 2WV0A 2X1EA 2Q2EB 3HUGA 5FMPA 1W7PD 3HRUA 4OMYA 3I54A 3TGNA 1IG7A 2CQNA 3IWZA 5D6EA 2O7OA 1I6XA 4C3HJ 2Y0SN 4NQWB 3TW6A 2WUIA 1SD7A 2DA7A 3PQJA 2Q24A 5BPIA 3KP6A 4DYQA 5D6FA 1EH7A 1QBJA 3EYYA 2WA0A 1D3YA 1HXDA 1T98A 2DQRA 3COAC 4O5VA 1UAAA 2R7VA 2CMPA 2J5OA 4XLEA 3Q0VA 1OMIA 1R22A 2LFBA 4JX4A 2RHAA 5FJ8J 1QGPA 2JRTA 4MFEA 1RKWA 2DDAA 1E0EA 3IWFA 5BMZA 2LY1A 2M8EA 1SC7A 2EZKA 3CJNA 3OS2A 4F52A 1IXCA 4ZJZA 1F36A 2BGCA 1KYZA 3K70D 2H1KA 5BPDA 2L54A 1OYWA 1V4RA 2L7ZA 3FXRA 4XKVA 4ZYAA 1VQ8I 4A12A 2YX4A 2CFXA 3K4BA 4X0GA 4B3AA 2IGMA 3JRIA 2QQBA 5H6QA 2HTJA 3BG7A 4N4NB 5HOOA 4JP0A 1OQYA 4C3IJ 4UB6C 3HRSA 4XLPF 3DTKA 3CCJI 2FJI1 2QKOA 1K7AA 3N4MA 1T8IA 2K40A 3G2BA 5E18F 2E2JJ 2DW4A 2G7LA 2F07A 5F0FA 2DMQA 5D8LB 4M74A 3G1MA 1LNWA 3LMMA 2DFHA 3HTUA 4XKCA 3PJRA 3GTKJ 3CCYA 1YX3A 2FNAA 1JGSA 2A5WA 4YIFA 1I39A 3RPUD 4DGWB 3IHUA 4LG0A 1K78A 2D5VA 1Z7UA 3EUAA 2Y9ZA 2JA6J 5F08A 3E1SA 1VFCA 5E1ZB 1FWZA 5HDKA 1UHSA 3F0CA 2UXUA 1X1BA 3HTJA 1LUJB 3F8MA 2DODA 3BWGA 2QOPA 3VP5A 4A2UA 1FMWA 3VVYA 1MSEC 2KIUA 4P1WA 2V79A 5FRMA 3ZQHA 3ON4A 1D0ZA 2A6HF 1X3ZB 4CDGA 1DPRA 1S7OA 4MEXF 1I27A 4AD9A 4KYWA 1GXQA 4BU2A 1O3SA 3AQTA 5LFAA 4HX7A 2CGPA 4UY8I 4IRGA 4FT8A 1E3HA 4ENJA 5DAJA 2EZLA 2VONA 1VI0A 2HVSA 3TP0A 3B81A 5ILSA 3LJLA 3KEOA 2LREA 2L9NA 1X3WB 1BR4A 3M1EA 3OL4A 5CQGA 2XC7A 3MNLA 4ZYGA 2CUZA 1KU2A 2WAEA 4OIPF 2VBZA 3TDUC 2LBFB 2QSHX 2KZVA 2MGQA 4HV5A 2K3PA 2UV1A 2IS1A 1ZK8A 2X9DA 4PGHA 1SANA 1H89C 2JK3A 1VQ9I 4HW0A 2QGUA 2RV8A 2CQXA 1P2FA 4MQVA 4YFXF 1E2XA 1O3RA 3VTIA 1R7JA 4LG3A 4DQ2A 3S1QJ 4IKFA 2YVEA 3T6NA 3K2AA 1Q1VA 2EWNA 1JUPA 2B0LA 3BG3A 1CGPA 3VOKA 1XB4A 1X1CA 1V5FA 5IYBJ 1HC8A 3CRJA 1SVOA 1WRJA 2WBMA 5HDNA 1LQ1A 3BG5A 3FXLA 2KL4A 2H1LA 1SAUA 2M0MA 3ZRGA 4XMYA 4R1HA 2LDUA 4BH9A 2GFNA 2MABA 1IAWA 5BOXA 1TWHJ 4L62A 1N75A 2X51A 4NDLA 4D1QA 3E7QA 2IBDA 5DV5A 5TRDA 1ON1A 3AG3H 3OOUA 3PM1A 2JUGA 2G7HA 4BBSJ 3BJ6A 3G1OA 3BDDA 4AYBN 2FA5A 3I3LA 5C4YA 1IXRC 3LQQA 5AONA 2HFHA 4ITVA 3C2BA 4LLLA 3SEQA 4BHPA 2V6CA 4AF5A 4CGRA 1WJBA 1G4DA 1U0JA 2H6BA 1V55H 2WGBA 2D45A 2LH9A 4WIBA 4UUVA 2EV5A 4J00A 2M4KA 5HDGA 1K4TA 4WXHA 5IP7J 1Y6IA 2DCEA 4CO8A 3G4SI 4BJTA 2VE8A 3C3WA 4CYCA 1Z91A 2NS8A 3E97A 4LGWA 1Y1VJ 3VSKA 1AKHA 1P9QC 5JVGF 2KISA 1SFUA 2F4OB 3R61A 1JJ6C 4JX6A 3DKXA 5EF6A 2W1OA 3BT9A 2DTRA 1PUEE 2A3SA 5JHUA 1YJNI 3AL0C 2NP3A 4G94A 5CVRA 1PYVA 4Y15A 5CXGA 2XRNA 2BBYA 2QWTA 1FTTA 4G7ZF 3HTIA 1HKSA 3HE0A 2QQAA 1K6OA 1BJAA 3T0YA 5DUKA 3LNQA 2V26A 2RNJA 2O3FA 1BOAA 1NTCA 2W24A 4L9NA 3ZQCA 2XB0X 3LSJA 4J01A 3F8BA 1TT5B 3O6BB 4FX0A 1ETVA 4QPQA 2PEXA 2VLAA 4IRIA 3HEFA 5FKKA 3GYHX 4HDUA 1MBJA 4L9VA 4KDPA 2HOAA 3ZMSA 2MW8A 2N8GA 1WI9A 2FEZA 3QPTA 2E7XA 5LGTA 2HVRA 3GTMJ 2PN6A 1G2HA 5HVQC 9ANTA 1X4OA 1MGTA 4BACA 2HDWA 1J59A 4F55A 3Q9VA 1IXSB 3OYJA 2DQLA 2FBIA 1HF0A 2HI3A 1HSJA 3JREA 1APLC 3E5UA 3O2PE 1RUOA 4UV9A 2K5CA 3TBIA 3VDXA 1I1GA 2M4GA 5D4SA 2HYTA 1W5TA 2FSWA 2F5FA 1Z6RA 1RZ4A 3OV8A 4UUTA 3V42A 1FX7A 1Z67A 4B09A 4P5OA 4IQ4A 5LRRA 1LJ9A 1VQKI 4PK4A 1OCTC 5DD8A 2STWA 1I3QJ 3ESWB 3HHHA 4RGRA 2E1NA 3B73A 5B3SH 2KDOA 3O60A 3EUHC 3WODF 2FX0A 2L7MP 1BR1A 2HKOA 5ILUA 5KCMA 2F4MB 4ESJA 2G7UA 2KJBA 2FOWA 3TW7A 1WVRA 3NAUA 2NVXJ 4YG2F 3PO2J 1WJDA 4MXMA 2PG4A 3ZN0A 4JX5A 3A03A 4G6QA 4HOBA 3KKCA 3PASA 4Y7NJ 1R5HA 2XASA 2NS7A 4W97A 1FBUA 2ZXIA 4L9JA 1IN6A 3F23A 4A93J 2R7TA 1WJCA 2XAUA 3SFZA 2WB1N 3HOUJ 2HOEA 4M6XA 3SHFA 2JUCA 2FNPA 4N9IA 2EA2A 3V8LA 2M0CA 4KMUX 3NI7A 3DEUA 2BY0A 1T2KA 1Y8RB 1KYWA 2OJED 4M9SA 2O8KA 4E7LA 1TLHB 2IJLA 4M71A 3K2ZA 4S0HB 3BR5A 2IGOA 1R9TJ 2DTZA 4L5IA 1R58A 2LG4A 3R4KA 5GPAA 3L2QA 3T8TA 3IH2A 3PNYA 5DCMB 3SWHA 2HQAA 2PX9A 3B02A 3WHCA 2JJ7A 5LGNA 1N77A 1VQ6I 1TC3C 1JUSA 1JKQC 4C30A 4ZZLA 4XONA 4C2MJ 4PJMA 1SVMA 4ICHA 3MKYB 4J19A 3LSKA 1YI2I 2C6YA 1E3OC 3PSIA 4ME9A 2P6SA 1OCRH 2YSRA 2DA3A 1HDDC 2VJIA 1ITYA 1QNTA 3R0AA 4L5JA 2HOSA 3DV8A 4MO7A 1LE8A 3COLA 2P81A 4V19K 1J7KA 2GXBA 5M3MJ 1VQLI 2MYSA 1D5YA 2ISYA 4G9YA 4BHBA 3JSJA 2HPIA 2X0LA 1YOVB 1KU7A 1U5TC 4JKZA 3C2GA 2QM3A 5IT3A 1ZQ3P 2PBXA 5FKOA 5KHDA 3K4CA 1A35A 3HOVJ 3I59B 1ODDA 4DIQA 3L1PA 3RJPA 4LLNA 2ACJA 1MW7A 3CF2A 4KA4A 1T38A 4E6KG 2LTPA 2B9SA 2XSDC 2E1MB 3DTIA 4M72A 3PNTA 3TEDA 4A3KJ 1T33A 2XUBA 5E3MA 3L2VA 2JVGA 2PFBA 3MMYB 4JOMA 3CMYA 3H5AA 4B8XA 2IXSA 4IF4A 2DA4A 2JRMA 3JTHA 3S8PA 2I8DA 4WCGA 4OD5A 3LWJA 5JLWA 3RPQA 1FC3A 2HYGD 1A36A 2XDVA 3Q3SA 4QLCU 1MZBA 3BCAA 3OR1C 3U1KA 4KFCA 3HOZJ 1IN5A 1JT0A 1MD0A 1WHUA 2L3DA 5EZHA 4AUXA 2OZUA 5EEAA 1IZ1A 2BVMA 3ABMH 3ZOBA 4B1RA 3FRQA 3SJMA 1OFCX 2QA4I 1B59A 4ESFA 2VKVA 4I76A 3WG7H 2MLKA 2IP2A 4H0EA 1IV8A 3FISA 2M87A 2X48A 2WAQN 1ZTRA 2VT2A 5GPCA 2E2HJ 4A0ZA 2OU2A 3G1LA 4IHXA 4DW6A 3QYEA 1OISA 2CUFA 3S16J 3GTJJ 4E7KA 4I7HA 4C3JJ 1LDJA 2O9LA 2OTJI 1ERDA 3K1NA 3DU5A 3EETA 2FJ1A 4Y3OA 2V7FA 3BOQA 3F9KA 5JR3A 4OAYA 2L9VA 1W0TA 3ISPA 1YG2A 2BHZA 3ASNH 4ENMA 2Y9YA 5FFZA 3AG1H 4RAFA 4ENKA 3W6VA 2L0KA 3I64A 4EM1A 3VB2A 3UR3C 3S1RJ 5D19A 1BI0A 2JTVA 3MZ8A 4RB1A 3HM5A 1SFEA 2WV1A 1JUMA 1EV7A 2P0WA 5L3FA 2HGCA 3H0DA 4FISA 2O03A 4C2MA 1W7PA 4HZFA 2QCOA 2ZO4A 2W7NA 2IPQX 1PUFB 3H9GA 2DLLA 2VBXA 5CLSA 5FB2A 1JT6A 1TWCJ 2L2OA 2KPMA 1HBXG 2CUJA 3FK7A 1QZYA 1JI8A 1TP4A 3LL7A 3GLLA 4RM3A 5E79C 1WWXA 1YHQI 1WH5A 5GTIC 5EG0A 1QPMA 5KNLA 4JNNA 2DN0A 3CZ6A 2O7TA 2UXNA 2ZCNA 1UZCA 3GFIA 2P6TA 3JTGA 5LD2C 2LF8A 3RKWA 1OCZH 4AIKA 4CH7A 1ZGAA 3AG4H 4II3A 1G8XA 1WKMA 2VKHA 1XC5A 3VFZA 2HXIA 4KT6A 4XRMA 2I5UA 1B72A 3OR2C 3CCQI 3ZQLA 1NG7A 1ZR2A 3BR6A 5EDNA 2DFEA 4CCJA 3CQZJ 4BEHB 3TMOA 3KKDA 5EFYA 3QBMA 2ZSIB 5D4RA 3PIOF 3F21A 4NUBA 4A69C 2NX4A 3Q0UA 3BJBA 1ETKA 2X1CA 3GO5A 3M8EA 2NVYJ 3GZ6A 4U9LA 3M9AA 2LKXA 4LK0F 1B72B 4NB5A 2R0QC 1YFHA 1YRNA 3RIRA 4F93B 3ANGA 3TQNA 2YPRA 2A05A 4XL9A 5J47A 3OYCA 3BTLA 4GCTA 2COBA 4E7SA 3CCMI 1WZ2A 3FZVA 3RPUA 3AKZA 4I6ZA 1MDMA 1LPQA 4Z2YA 4CSWA 4P96A 2ZSHB 5EZGA 4FCYA 2NNNA 3EUKL 4KISA 1ZKGA 1YRNB 3KZIC 5LEKA 2X6XA 4BY7J 3VSLA 4I2OA 2IS6A 2ZMEB 4ENNA 3O8HA 3PL8A 4XK4A 4I0BA 3TO7A 1P4AA 1HQCA 2LRDA 5IOZA 5C3EJ 1P6RA 4BKXA 3PQKA 2DDBA 1NK2P 5CVJA 4XRSG 2Y30A 3BG6A 2KP6A 1WJAA 5ICGA 1GV2A 3IKVA 3A2KA 2JT1A 2K9NA 5GAGJ 2R92J 5E3OA 3D5SC 3PSFA 5K5QA 3MEXA 4EJTA 1UI6A 5F1RA 3OYFA 4LB5A 4HV6A 4P55A 1Z1DA 1B1BA 5FGMA 3BR2A 2VC0A 4ZTJA 1XG1A 2RKHA 1A04A 2WADA 4AVZA 4IL6C 2G0EA 1K83J 1UELB 3QPLA 2CQQA 3VOXA 4PXIA 4IX7A 1ORKA 1P4XA 2EFOA 5FKLA 3JR9A 1RUNA 3NXCA 3CLOA 2LK2A 2NYXA 2VE9A 2R7DA 2YUSA 3NNRA 4U87A 2CV1A 2CO5A 2B1EA 2LY9A 4BGDA 3I53A 1SFXA 3DLLF 3LSHA 3DU6A 2XPUA 4ZDOA 3I4MJ 1HW5A 4Y17A 2MC4A 3PUFA 2G3BA 2QKMB 2JQ7A 3IH4A 1JHFA 1LDDA 2ZXWH 2L9SA 2CS3A 2MSYA 3G71I 4RA2A 4BBRJ 4E70A 4EQQA 1Z7LA 5LHHA 3S3NA 2FBQA 1D1AA 2IVMA 4AC6A 2QBYA 4RDUA 1ETQA 3BCBA 2AXLA 3H92A 1O3TA 1WI3A 3V8KA 4GDFA 5K7ZA 2ELHA 3C07A 4W1UA 2CV2A 3R0JA 1WCMJ 4CCNA 1FIPA 2VASA 3ZXSA 5D5XB 3OIOA 4MTDA 2RASA 3HUGB 3ABUA 3OYNA 4XOPA 4KUMA 2L01A 2TDXA 5EEHA 2BY2A 1MKMA 2R4GA 1MSFC 3C7JA 1S6LA 1L0OC 5CJ9A 2L9RA 3C1DA 1AU7A 4A3CJ 2OTLI 5FLXZ 5DYMA 4XLHA 1DGWY 1ZARA 3L9FA 4XLFA 2ZY9A 4BJ5C 1TQMA 2R5YA 2PJPA 3MWMA 1WJEA 5TGTA 1YJ9I 3S17J 3SFIA 2RREA 3BZKA 2XAJA 3FXKA 4BE2A 5ICFA 1RR8C 5GP9A 4ZDPA 3ZQGA 2NNYA 2OV7A 3CUQA 3ZMUA 5K5OA 1J2XA 4BAYA 3GZNB 2UZKA 2LY2A 5IYCJ 4OD4A 1X1DA 1B9MA 4C9YA 3DTEA 3O8GA 1TL8A 4YZEA 2TCTA 1S5LC 1S72I 2ME0A 5C44J 2MA3A 2BZTA 1RNLA 3CC4I 2JVHA 3RH2A 2A68F 2OPTA 4IEJA 3C2HA 5FGLA 3HIMA 2VKEA 4ZC3A 3HDDA 2LYCA 2RN7A 4RMNA 4A5NA 2MG4A 3Q5FA 3HKZN 3OWTA 1IUFA 2XGXA 3ZN1A 2KJCA 1MH4A 1IN8A 3ANPA 3KEQA 2ICWG 1CF7A 1JGGA 3ABKH 3AQSA 1RPWA 2IAIA 1RESA 2Z99A 3KP5A 5CYVA 1U5TA 4B48A 4G6TB 2XHKA 1M1EB 4IOCF 1XSDA 1K78B 1MNMC 3KLOA 4LG0B 4L5EA 1BI1A 1FTZA 1KQ9A 2M7BA 1HKQA 1ZG3A 2XKOA 2VOPA 1IRZA 3IRRA 3HOSA 4IVNA 2LNBA 1D1CA 1FOYA 2KMUA 2V9PA 1FSHA 1U8BA 2MD5A 2KZGA 2NAZA 3NARA 2EIMH 2ID6A 2VN2A 2MH2A 4A3DJ 1XGOA 2EV6A 2RDPA 1KA8A 3TP3A 2P7VB 5F04A 5B1BH 2GQQA 4QIWN 2OF7A 1LDKB 4HLXA 4D5FA 1TTYA 2D6YA 4PGGA 5CVUA 5FO5A 4N9HA 1YTYA 4UUSA 1Z3YA 4NC8A 4IQJA 2DA5A 1LVAA 2OCEA 2A07F 2DXIA 4GXOA 4IRVA 1LVKA 1LKXA 3E6CC 4NNJA 4CXFA 3A1YA 3OYBA 3QU3A 1X58A 2V1NA 2K4BA 2YVHA 3CMEI 2W84A 4A3LJ 2QVOA 5J4VA 1RRJA 6PAXA 1Z05A 2P5VA 2HYJA 4KWAA 1DP7P 1ZH5A 3BPVA 3ONQA 1IRXA 4E7ZA 3ZMTA 4B44A 3VYRB 3LOCA 4NC6A 3GFLA 2XB5A 1PDNC 4A3JJ 5HODA 1S9HA 2EK5A 4B43A 1MMAA 4XQFA 4U88A 4ZTFA 2BY1A 3ROUA 5ILVA 3RTRA 2O8XA 4Y13A 3QOEA 4RBOA 2UXXA 3WE2A 2R7UA 5M5XJ 5JVTA 1WH7A 3V7RA 2GWRA 3QAHA 3ABLH 2UWMA 3OYEA 4KT5C 4Y33A 2XGDA 2GIVA 4L0ZB 3H9QA 1S7EA 4A0YA 2WC2A 2X6YA 2YVXA 4UDSA 1TQPA 3SZTA 2FD5A 1AHDP 4BY1J 3FBIB 3GFMA 2ESHA 4I01A 1R71A 1SAXA 1TWFJ 2XDNA 3CP2A 1OR7A 4Q4ZF 1X19A 4DNCA 3D5RC 2CSOA 4EJOA 3GMEA 4AIJA 4DYCA 2EZHA 2CJJA 2K86A 3DPTA 3AFHA 3FMRA 3DXJF 3QYFA 3TOAA 1RETA 3WTWC 2LLKA 1PP8F 1Y0UA 2VOOA 2K4JA 4A5MA 2A6EF 3CESA 1TWAJ 2D1HA 2LSOA 1U9NA 3VYSB 3L2WA 1RIOH 2X4HA 3HPGA 5FKNA 3MAJA 2DT7B 3H5NA 3QODA 5L3GA 1E17A 1Y0NA 1MBFA 2R7FA 1LFBA 1FBQA 2EV0A 2IEKA 2VKDA 3S2DJ 4OMZA 1HA8A 4ETSA 2VQGA 2JA7J 1XD7A 2IS4A 1YE9A 3H36A 1NH3A 4CYCB 3U1DA 3E6MA 1S7AA 4M3GA 1KGSA 3DF8A 2MLGA 1YIJI 1ZG1A 3QYBA 1AKHB 1TNTA 3CJTB 5K7FA 4EJUA 3BZ6A 5M3FJ 3KZ9A 1T0FC 4FQGA 3BTJA 2X6WA 2W82A 3HB9A 3KE2A 2E1CA 5B5EC 4ZDLA 1WPKA 2ZFWA 3REOA 2NRAC 2B3WA 2F5EA 2IA2A 2MH9A 2NOJB 1IJWC 4YFKF 2HKUA 5KVRA 2X6OA 4RGSA 2RVCA 1U8RA 5HLTA 3OSFA 3BCGA 3QP6A 2HR3A 3SYTA 2HU9A 3TOBA 1W4MA 3FF5A 2DOFA 2BXZA 2ESNA 1R6RA 1SMYF 4XORA 1HW1A 4CCMA 2EA4A 5DUIA 3JRBA 3FMSA 4YELA 3DKWA 3BLYA 4ESBA 3GX4X 1F4KA 4QSHA 2UUZA 1V3FA 5IP9J 3OYIA 5IT9Z 1DU6A 2EH3A 3OIPA 3N05A 1XN7A 1J5YA 5IOYA 5FD5A 4KN7X 5A2QZ 2OQGA 3FKIJ 4LLGF 1XS9A 3VW2A 2W57A 4HLYA 1U9OA 5K1YA 4EMSA 1U78A 1P7IA 2MC3A 2DMTA 3I55I 2DA6A 2KHMA 2COMA 2NS0A 3LA2A 5HSZA 1Y8QB 1GXPA 4IHTA 1VNDA 2PMZA 3F3XA 5L3DA 5CXIA 3DEEA 2E71A 3CC7I 2AQEA 5FFXA 1C0WA 2JPCA 4ZYHA 1YQAA 2DBBA 3MD2A 2M45A 1REPC 5J8FA 1KU9A 4WWCA 5K5RA 2TRTA 4U7DA 4K2EA 3U21A 2QUFA 2BXYA 3IP4B 2D2WA 2GBYA 5F6FA 3KCCA 3OOPA 4BXUA 3VUQA 4OAZA 4ACIA 3LA7A 2P7CB 3SDGA 2ZKZA 1MMSA 5E3LA 1P7JA 2Y75A 1GUUA 2HXOA 4M9XA 3W2WA 1R00A 2LC2A 2CUEA 3CCUI 3FKJA 3HOWJ 5AIPA 3L2CA 3SZPA 4OIOF 1JKPC 2DOEA 4FTHA 4XOTA 1XX5A 3CC2I 3HGYA 2GAUA 1G3TA 1DUXC 4A6DA 2AHQA 3RKXA 4U7BA 2ZB9A 3VW0A 5FLVA 2VXZA 1STZA 4I09A 4OWRB 3T1BA 3JAMZ 5L3EA 3A0BC 2CQ7A 2W25A 3GZIA 2PLYA 3WTXC 3K7AJ 4GYGA 4MGRA 1O4XA 5CKTA 1XMXA 3VEPA 2K3FA 4UHTA 2IRFG 4MNUA 1F5TA 1SD4A 2XROA 1ZLJA 2Z5UA 3HSFA 4ON0A 4F92B 1MBKA 3MQ0A 4I99C 2CWEA 4L0YB 1T95A 1XCVA 1TBXA 1ZREA 2GOMA 4UXNA 4KIBA 1BC7C 3L7WA 1B6AA 3VODA 5L3CA 1W36C 2A61A 4ZYDA 5HLGA 3ZR8X 3A02A 2RGVA 4II2A 3ZGKA 3S5RA 2IGNA 3I9V2 1VQ4I 1LE8B 1WJ5A 1P92A 3HC7A 3NRGA 4F3QA 5B66C 1AA7A 3I4PA 3L09A 4BQAA 5D18A 3J7ZI 1LEBA 1BM9A 4R8HA 1VQPI 3I4NJ 3BY6A 2BE5F 3KYDB 3LSIA 3QPSA 4XIDA 1K4SA 4HNUA 2IU5A 1BIBA 3E5XA 2DJIA 3K4JA 3L2RA 1OYIA 3E0JB 4XKBA 4UB8C 2CH0A 3LWFA 4ZYEA 4HQEA 4E7JA 4LIUA 1D8KA 2CU7A 2H8WA 1QRYA 1W1WE 1A6QA 2F48A 3CUOA 2PJRA 3LHQA 5FRNA 1NHAA 5M5YJ 3HOXJ 3CJRB 4AM3A 1W5CC 2QTQA 2M5WA 3NWSA 5BQTA 1R49A 1I5ZA 2O0YA 1OCOH 4UVCA 3LFUA 3BTIA 5CQEA 1B8IA 1YLFA 4EJVA 1ZN2A 2ECCA 4BQNA 3KYLA 1XMAA 3DEWA 3J80Z 4B3XA 5ICCA 1VQOI 4Q5SF 1IDZA 3SDBA 2PJRB 4E7IA 2BW3A 2XIGA 2HZDA 3LA3A 1G3WA 3DWLE 3CTAA 2QQ8A 4B4CA 1H8AC 1A6IA 3ERED 2L7FP 2V1XA 2A2FX 1E3PA 3MZYA 4JQFA 1MNEA 4BNCA 2EPFA 3AAFA 3SXYA 3GUDA 4D7MA 1IDYA 2F4IA 4CCKA 3HTSB 1GDTA 1OCCH 1RI7A 3MZHA 1QA6A 4AIHA 1JTXA 4KITB 5JI6A 1FYLA 3S15J 1R4NB 3W3CA 4YRVA 2VXDA 2P4WA 1G3SA 1MBHA 2LR8A 2WWYA 3BJAA 4BXXJ 1ULYA 4M9ZA 5D5UB 3N97A 2LMDA 2RAEA 3ASOH 3U2RA 2ZJRF 3KIOA 3SEZA 1QO0D 3IAS2 3OS1A 1EJ9A 2X85A 2B63J 1J09A 1SVLA 1ZRDA 3R6SA 3HHGA 2AO9A 2DK5A 1K6YA 4PCQA 3S1NJ 2WTEA 4U9NA 2K02A 2CG4A 2H09A 2XAHA 3ELKA 4BQOA 4NC7A 2F2EA 4S04A 2GENA 2CRGA 1W7PB 2VPLA 3VOEA 3E6BA 4LITA 2RNGA 5DCFA 2GLOA 1KQ0A 4BDYA 3FXMA 5EYRA 2ZJPF 4P9FA 4BYYA 3H3VK 2UXOA 3BG9A 2K27A 3DP7A 3HXLA 3H5RA 4ABZA 5EG0B 3JSPA 2GXAA 2Z2SB 3K8PC 4PJ0C 4V2GA 5E20A 5CVIA 2Z33A 1IGNA 2XPWA 3CCEI 3E6DA 2JWTA 1TQIA 1PJRA 2RC4A 2M3AA 1POGA 5H2FC 3KP3A 5F0HA 3OSGA 1R1VA 5H9TA 3ABTA 2DT5A 4D9JA 3FWEA 1ETOA 1SD5A 3CP8A 3DLAA 4GO1A 3KZZA 3T5XA 2FOKA 2BY3A 3BR0A 4CCOA 4R79A 1FYMA 4JYKA 2ADUA 2OAZA 2R5ZA 1EA3A 4CZZA 4FETA 2HWVA 2R7QA 4PFOA 3KPHA 5H20A 4LJZF 2M9HA 4YEJA 3OYLA 4HA8A 3BZCA 1VZ0A 2E35A 2JZYA 3RQIA 2H27A 2CW7A 3NQOA 2GXGA 2A69F 1R23A 3A4CA 3WTTC 2AQFA 3QPHA 2FE3A 4ZZDA 2HDCA 4A3EJ 3CO7C 2FBKA 4JK1X 1I3AA 3VYUB 4XLNF 2M7AA 4U0VA 3K4LA 4OOIA 5J1UA 2WY7Q 2FQ4A 1Z6TA 1FT9A 3VVXA 1DQUA 1K79A 3S3MA 1T56A 2FMLA 3FXUA 4Z6YA 1USTA 1MDMB 5K7HA 3V7CA 2Q8KA 3QKXA 4XLAA 4X6AJ 1QHHD 3UKGA 3VIBA 2DA1A 2E36A 2LP0A 4PSWA 5HS8A 2MD0A 1BA5A 2DMPA 4I0AA 4HPQA 3DBHB 3P9KA 3K69A 3ZMZA 2KIFA 2E1OA 1SMTA 2XGCA 3H3UA 3ERMA 1BC8C 2KFDA 2Y69H 2E34A 3LSRA 3K9TA 4DBQA 4IOAF 3HYIA 1T6SA 1BW6A 4A3IJ 1FYKA 1U2WA 3J7YJ 1OCPA 2HZTA 3HBLA 3G6EI 2QIBA 2V9KA 1QHGA 3RD3A 5DTDA 3WGGA 4AWXB 2KQRA 2DA2A 4NHJA 3OYDA 2B7EA 2HYFA 4HNVA 2JN6A 3PUBA 2E5ZA 4UVBA 2XF7A 4HF2A 4IHSA 5GAHJ 4MEYF 1MJ9A 4HSTA 4D0PA 3WTVC 3GBGA 3JRHA 3EPZA 2D1VA 2OERA 3J81Z 2K9MA 3PIPF 3S1MJ 1IO2A 2XPVA 2YX7A 2NVQJ 3CCSI 1TT0A 2HS5A 4PFPA 3V7SA 4IXAA 3VW1A 2R7RA 5F1JA 3GTOJ 2GOXB 1XGSA 2Q1ZB 3IL2A 3HZJA 2GM4A 2QKLB 2Z3YA 2Y48A 4MTEA 2L7KA 3PFYA 1EKEA 5JLXA 1SGMA 1YW9A 4NQWA 2MFZA 3NEUA 1TWGJ 3DFGA 2BHYA 2WB1A 1GT0C 3MVPA 2V4JC 1V5EA 2Z1DA 3EUHA 3OS0A 4RB0A 5H6RA 1LFPA 2UXPA 3M07A 1Q1HA 3I5UA 3FXOA 3GF2A 4S05A 1IRFA 2STTA 2E19A 2QBYB 3EQLF 2E5NA 3GLXA 5IP6A 2IW5A 5CPRB 2PMHA 3RKYA 3LAPA 3U9GA 4GRIA 1CQTA 1EH8A 5GADJ 3ML6A 3GVAA 4PJLA 2E1MC 2Q0OA 3LQRA 1YS6A 5HLHA 2NP5A 2W53A 2K9QA 1JJ8C 4HSRA 2DO7A 3FIWA 3BROA 5JHFA 5CW8A 4XM3A 5EJCA 2ZOZA 4LK1F 1ZG5A 3M8FA 3ZP5A 1IW7F 4JBAA 4NBQA 5FLXK 2HPMA 1RKTA 3NS4A 4E7HA 1XDUA 1VQMI 4FE4A 1FJLA 4WXCA 1U6GA 4M73A 2PI0A 2KIQA 5LLQA 3F8CA 2AS5F 3HPHA 3RQ4A 4IPAA 1N78A 2R5YB 1FP2A 5FD6A 2PZ9A 1D0XA 3GTPJ 2P5KA 1KU3A 1IN4A 3VPRA 5FKMA 1A31A 3LSPA 3F22A 1Z77A 2P5LC 1BOBA 3I71A 3I58A 1VTNC 2QZ8A 1YYVA 3CUQB 3M1CA 4XN0A 4XSXF 3G7RA 2ISZA 2KIMA 3QU6A 1X4PA 3MKWB 4A0XA 1XPXA 4NN1A 2E2IJ 3JCUC 5D8KB 1IN7A 3VVZA 3QRFF 4RGUA 2ZCMA 3B6CA 5KAFC 3TL4X 5DS9A 2VODA 5EGOA 4I02A 2FF4A 2ZBKA 4IRHA 1HW2A 1BI2A 1MMGA 2VQHA 3FMQA 3GCMA 4LIVA 4DZPA 1W5SA 2W85A 2DPDA 2EJRA 3H3ZA 3Q0WA 4LFUA 4MLOA 3RKQA 3RI4A 2ZXJA 2K85A 3ZMVA 5CVVA 1B4AA 2W48A 1X3UA 2E7WA 3JW4A 1BI3A 4XSZF 2CV0A 2NVUB 5LGUA 2DG7A 2IA1A 1USSA 2IA0A 2L4MA 4KICA 3V78A 3CLQA 1CF7B 2YU3A 2IGKA 4IHYA 3H35A 2WAQA 1JKOC 1YIOA 3ZQIA 5EGOB 2JMWA 2EINH 2KRCA 1U5TB 2REKA 1AWCA 5TISC 3G73A 1Z21A 3K6GA 2GIZA 1L3LA 2NVTJ 2LBFA 4QTRA 3F8NA 4GFBA 3IUVA 1B9NA 3BTCA 2RQPA 1DGRM 3V8JA 2DPUA 3WU0A 4FASD 5IYDJ 2Y0MA 3ZMDA 2JSCA 2R7ZJ 2DMUA 3NPIA 3GZ5A 3KLNA 4A3GJ 5EEGA 2VB6A 3IC7A 5C4XJ 2OUMA 2HQNA 4M3DA 2JA8J 1T08B 3L2UA 3HL2A 2QLZA 2QEXI 2BOLA 4GYIA 2V6EA 3HIFA 1KONA 2EIJH 1FP1D 4QPOA 3BR3A 1XSXA 4GCKA 1GVJA 2XRLA 3S32A 2DOAA 4UUSB 2QSGX 3J7AY 2UXIA 1I50J 1BL0A 2G7GA 5D5VB 3FBNB 1X1PA 1JHHA 3ZCOA 4QWQA 4Q48A 2ME6A 5ERIA 3D5LA 4G7OF 3ON2A 5J8CA 2L02A 2IT0A 3BC8A 4MK6A 4M3FA 1Y1WJ 4PJJA 5GTHC 1EF4A 2Y2ZA 1MJAA 4HF0A 2UXHA 3BNIA 3FHZA 1A5JA 1MIJA 4YIIA 4X1EA 3K70C 1DP3A 3I0TA 5LHGA 4EVIA 3CWRA 4KIFA 3BQYA 4IZZA 3DPUA 3FXJA 4M6VA 2Y31A 5E8IA 5ICEA 1QU3A 4UVAA 3WTZA 1WGXA 4XLCA 4EM2A 4MFDA 2XSJC 1Z9CA 4HYEA 2LVSA 4FX4A 1X1AA 1JE8A 1DU0A 3HSRA 5KK1A 2VL8A 2MBFA 4U0YA 5J1YA 4RGXA 1LFUP 2ELKA 1JKRC 2EB7A 4HNTA 4B47A 1H9TA 4MHGA 2G7SA 2O61A 2KDZA 2G9WA 3KNWA 3OIQA 2VQCA 3B6AA 4CZCA 4MQ9F 2QYOA 2ZMEC 1RC9A 1WJFA 3CMAI 3DPLC 1VQ7I 1R5ID 3RCOA 1ZRCA 2L4AA 3MFKA 4GGGA 4KIGA 3P9TA 3KX2A 2F5DA 2VPRA 1N25A 1GVDA 2ZCXA 2DYRH 3DKYA 3GW2A 4HQMA 4WF2A 1YO5C 1OYYA 4ANJA 1ZGWA 3DCFA 2ZFUA 3MCZA 2JA5J 1D5VA 2ZCWA 3WU1B 1Y56A 1BIAA 4BE0A 3JRFA 1R36A 1JTYA 2WY8Q 2ZC2A 3FHNA 2Z9OA 5IY5H 3LFKA 1KZHA 4MIMA 5C4JJ 3DQVC 3GTQJ 2R93J 1O57A 3HTAA 2KRFA 1YW7A 2WAFA 1UB9A 3HRMA 4YFNF 4DVYP 3E3VA 3NWTA 4C2UA 2EQRA 1U3EM 1GLNA 2XAQA 3SZGA 2GZWA 3M8JA 5JFRA 5L3BA 5HAWA 1WQ2A 3IV5A 5FLMJ 1WSUA 3GEUA 2O6GE 2DAOA 3FM3A 1FNNA 4HX8A 3PFIA 2DI3A 5LRSA 1QQIA 3RZOJ 2EBIA 2JSPA 3KP2A 2HTSA 1WFXA 3W6KB 3F6VA 3EUPA 5J1RA 3F72A 4ASNA 1W36D 3K1PA 2YU9J 3W2AA 2HNHA 1TNSA 3WTUC 4BE1A 2HEOA 3WE3A 3MN2A 1I1SA 4EGYA 5ED4A 5K58A 4XBFA 3GWZA 4RAZA 2VJ5A 1FY7A 1XGNA 1BBYA 4HKUA 2DT6A 5AQCA 5D1RA 2BEOA 1IF1A 3FM5A 1J0RA 2YS9A 3D0SA 4G8XA 4GCVA 4EV0A 4D7NA 2CW0F 5IT9K 3PPBA 3TO6A 2R7XA 3CCVI 5E1WA 4PJNA 2VJ4A 5FROA 4RB2C 4GCLA 5A2QK 5E1XA 3KP7A 2VC1A 3P5JA 3M4OJ 2EFQA 1OLTA 3M3YJ 3TDZC 4IJAA 2HKXA 1FIAA 1ZR4A 4L18B 5HNFA 3C18A 3OMYA 2NXNB 4PSXA 4Y4RA 2AXTC 5F27A 3RDIA 3BPXA 4HRIA 4IHWA 1FEXA 4HBLA 2A6TA 1QPIA 1NG6A 1V54H 1ONVA 4WX9A 1UG0A 3G56A 4C2TA 1MH3A 2Y0SA 2CFOA 1FOWA 2CQKA 4AC0A 2PMUA 3DBLB 1F1ZA 3ZQQA 1XCBA 3JRCA 3E7LA 3CJQB 4H4KC 5J6XA 3DPJA 3RSNA 3D1NI 1GHCA 4JL3A 1ON2A 1YJWI 2OQRA 2QWWA 3ZQ7A 2FRHA 4AU7A 3JSOA 2V9VA 1J75A 1ETXA 5LBQA 2ZOYA 2H6CA 4A3FJ 3OYKA 5DCMA 1PP7U 1FBSA 2FQ3A 4HEA2 3CD6I 3HGGA 5KAIC 5HS9A 3OYAA 2HVQA 2JPBA 1FSEA 1IV6A 3CUQC 3UNGC 2O5RA 2FMYA 2QF7A 4AVPA 4CGZA 2ZNZA 2DU9A 3K4NA 4P9UA 2QQ9A 2XAGA 3JAMK 3F6OA 1DPUA 1XDSA 5HBUA 2XF5A 3A01A 3VYTB 3FX3A 3S2HJ 5AIQA 5DD4A 1QZZA 3KETA 1T39A 2ZJ2A 4A6EA 2KRHA 2VI6A 3T8RA 3BQZA 1O7FA 3CCLI 4XNFA 1S29A 1QZEA 2L5QA 2XF6A 4A3BJ 1VF9A 2OC6A 4KMFA 3I59A 2BYVE 2EFNA 2HQ5A 5HNHA 1MBEA 4UV8A 1FLIA 5BS6A 4F91B 4V2FA 3KEYA 1UCRA 3F8FA 3W6JB 3ULQB 1W0UA 4CYDA 2M8GX 3A01B 3HOYJ 2DG8A 3BHQA 3HJEA 1HKTA 4DJAA 4A3MJ 3OY9A 4UNOA 1JXSA 4EATA 5B1AH 1SFOJ 1VQ5I 3RYPA 4F7ZA 1NK3P 3HKZA 4I98B 2E60A 3PNVA 1BN5A 1UFMA 3WTSC 3KP4A 3QWLA 1ENHA 4YIRX 1IUYA 3QP5A 2R7SA 5J40A 4DZJA 1ZRFA 3CJDA 1UHMA 2W4SA 3ECHA 4PUSA 3GTGJ 2R3SA 1EH6A 3CF5F 4HX4A 2VBYA 1TW2A 2F5CA 2ZXHA 2R7OA 2VIXA 1KQ8A 1RR7A 3IH3A 1ETYA 3G3ZA 3RZDJ 2J5PA 1F43A 1MMNA 1V5GA 2M30A 2ECBA 3K1MA 5BNGA 2M1BA 2QENA 3JRGA 1G59A 4OU0A 5DDGA 3J7AO 1ZHFA 2EFPA 5J3LA 1R5GA 2ID3A 4OIRF 1OKRA 2F5VA 5IPAA 2PBIA 2BVLA 4N0BA 3BJOA 3FK6A 2W00A 2XKPA 2DJNA 1ZYRF 3MKZA 3CO6C 2I10A 4TV7A 1UG2A 1S8NA 2YR2A 3PO3J 2H94A 2VT3A 2V1UA 5FHPA 4U0WA 3J80K 1B8IB 2LD5A 3E5QA 4Q47A 4RAYA 3TKYA 1MBGA 3V6GA 4WXDA 1SEUA 1O7LA 4O6JA 4XN3A 1S3JA 3EGQA 2FU4A 5E8GA 4RLQA 3P9CA 3GXOA 2GA2A 1YX5A 2BW3B 2DFFA 3GTLJ 3KYCB 2CYYA 1TW3A 1ACIA 4LB6B 3EDPA 4FE7A 4EGZA 3L00A 3IAM2 2X1DA 1ZAOA 2PQ8A 4RB3C 3BP8A 1PUFA 1QVUA 4XRSA 2EFWA 1LEAA 3ZPLA 4L9TA 3ECOA 3IUOA 4M3BA 3RYRA 5D5WB 3EYIA 2HOTA 1J9IA 5F0CA 4OIQF 1H0MA
chains in the Genus database with same CATH topology
1SGMA 5JLXA 1X2NA 2HYJA 3A03A 1Z0XA 4JX5A 2OI8A 3KKCA 3PASA 4KWAA 4Y7NJ 4GFKA 1TWGJ 2NS7A 3LOCA 1GT0C 3MVPA 4W97A 2XB5A 1H88C 4A3JJ 4A93J 5HODA 2WB1N 3WHBA 3HOUJ 4DZJA 4RBOA 2UXPA 4G12A 2M0CA 3NI7A 1HCRA 5M5XJ 4M3EA 1WH7A 2E19A 4D5CA 5IP6A 4DYRA 1UI5A 1ETWA 2O8KA 4S0HB 1K61A 1CQTA 2XGDA 3BR5A 1R9TJ 1S7EA 2DTZA 2W53A 2NP5A 1BW5A 5GPAA 2K9QA 3HTHA 1JJ8C 4UDSA 3FIWA 3IH2A 4EEFG 5CW8A 2ZOZA 3WHCA 2FD5A 1AHDP 4BY1J 2JJ7A 4GFLA 1TC3C 1JUSA 2HDDA 3MKLA 1TWFJ 1JKQC 2XDNA 4C2MJ 3QQAA 4LOCA 2H8RA 4ICHA 1RKTA 4J19A 4FE4A 1E3OC 1FJLA 4ME9A 2DA3A 1HDDC 4DYCA 1ITYA 2HOSA 2EZHA 2CJJA 4MO7A 3COLA 1LE8A 2P81A 1RETA 2LLKA 5M3MJ 2R5YB 1HOMA 2PZ9A 3GTPJ 1D5YA 1TWAJ 3JSJA 1U9NA 3VPRA 5FKMA 5FKNA 3LSPA 1ZQ3P 2PBXA 4JKZA 5FKOA 1Z77A 1MBFA 1LFBA 2IEKA 3HOVJ 3S2DJ 2R5ZB 2GUHA 3L1PA 1OJLA 2JA7J 3G7RA 2LTPA 4CYCB 4NN1A 2E2IJ 4M3GA 2M34A 1AKHB 3VVZA 2XSDC 1QVTA 3TEDA 4A3KJ 2ZCMA 3B6CA 5K7FA 2V57A 1T33A 5E3MA 1X2MA 5M3FJ 3KZ9A 5DS9A 3BTJA 5EGOA 3CMYA 3HB9A 4DZPA 2DA4A 3F1BA 3Q0WA 1WPKA 4MLOA 5JLWA 3LWJA 3RKQA 1IJWC 2HKUA 2M2EA 2X6OA 3Q3SA 2W48A 3H0GJ 3OSFA 3BCGA 3HOZJ 1JT0A 2DG7A 2K9SA 5EZHA 4AUXA 3V78A 5EEAA 3ZOBA 4B1RA 4IHYA 3FRQA 3SJMA 1OFCX 1JKOC 3ZQIA 5EGOB 2JMWA 2VKVA 4I76A 3JRBA 1BJZA 2REKA 3ZQFA 5GPCA 3FISA 2E2HJ 2X48A 2WAQN 1ZTRA 4QSHA 5IP9J 1HLVA 4IHXA 3G1LA 1DU6A 2EH3A 4DW6A 2NVTJ 4QTRA 2CUFA 5IOYA 3BTCA 3GTJJ 4GFBA 4C3JJ 3S16J 2XGEA 3IUVA 3BR1A 5M5WJ 2O9LA 4Y52J 3FKIJ 1XS9A 3VW2A 5IYDJ 2R7ZJ 1U9OA 2DMUA 3JRAA 2VUMJ 3NPIA 4A3GJ 1U78A 1P7IA 2FJ1A 2DMTA 2NOGA 2DA6A 3CDLA 5HSZA 5C4XJ 5E3NA 1UMQA 1GV5A 4XICA 1VNDA 1W0TA 4M3DA 2JA8J 3JRDA 4IHVA 5CXIA 3LSGA 2Y9YA 1I6HJ 4NELA 3W6VA 2L0KA 3BRUA 2PMZN 2KT0A 3BR3A 4GCKA 3S1RJ 1IC8A 5D19A 2XRLA 2TRTA 3HM5A 2WV1A 4UUSB 3S14J 1I50J 1BL0A 2UXIA 2G7GA 2EZIA 1JUMA 2GBYA 4FISA 2ME6A 3ON2A 2QCOA 3VUQA 4MK6A 4M3FA 4ACIA 1Y1WJ 2DMNA 1HDPA 1PUFB 1EF4A 1JT6A 2Y2ZA 3SDGA 3BNIA 2UXHA 5FMPA 1TWCJ 1A5JA 5E3LA 1P7JA 4X1EA 1IG7A 1GUUA 3FK7A 2HXOA 2O7OA 4C3HJ 1WH5A 2CUEA 5EG0A 2Y0SN 3CWRA 4JNNA 2DN0A 3BQYA 3TW6A 4M6VA 2Y31A 2WUIA 3HOWJ 1WGXA 2DA7A 2O7TA 4MFDA 2ZCNA 2Q24A 1JKPC 2LVSA 4FTHA 1DU0A 3HGYA 4DYQA 2AHQA 5J1YA 1LFUP 2ELKA 2ZB9A 1JKRC 3VW0A 5FLVA 1XC5A 3Q0VA 2LFBA 4JX4A 2G7SA 2HXIA 5FJ8J 2RHAA 4XRMA 2KDZA 1B72A 3GZIA 3KNWA 4MFEA 1RKWA 3K7AJ 3B6AA 3ZQLA 1O4XA 1ZR2A 2EZKA 3BR6A 5EDNA 3CQZJ 3KKDA 1F36A 5EFYA 3P9TA 3QBMA 2H1KA 2VPRA 1GVDA 2ZCXA 4A69C 1MBKA 1ZGWA 2L7ZA 3DCFA 2NX4A 3Q0UA 3BJBA 1ETKA 2JA5J 3JRIA 4B3AA 2NVYJ 2LKXA 1B72B 2R0QC 3JRFA 4JP0A 4C3IJ 1JTYA 1YRNA 2QKOA 5C4JJ 4MIMA 3ANGA 3A02A 3GTQJ 2K40A 2E2JJ 3S5RA 2G7LA 2R93J 2F07A 3HTAA 1LE8B 3BTLA 2DMQA 5F0FA 4GCTA 3G1MA 3NRGA 2COBA 5D18A 4I6ZA 2EQRA 3GTKJ 5HAWA 3CCYA 3IV5A 5FLMJ 4FCYA 5EZGA 3GEUA 3I4NJ 1ZKGA 3QPSA 1YRNB 4XIDA 2D5VA 2JA6J 2Y9ZA 2IU5A 5F08A 1VFCA 4BY7J 3RZOJ 2EBIA 1UHSA 3F0CA 2UXUA 3O8HA 4XK4A 3HTJA 3EUPA 2QOPA 5C3EJ 5IOZA 5J1RA 3VP5A 4BKXA 3VVYA 1MSEC 2CU7A 1QRYA 3LHQA 3ZQHA 1NK2P 2YU9J 3ON4A 5M5YJ 4XRSG 3HOXJ 2Y30A 2QTQA 1GV2A 3MN2A 2K9NA 5K58A 3BTIA 1B8IA 5E3OA 2R92J 3AQTA 1UI6A 4HKUA 2ECCA 5DAJA 5AQCA 5D1RA 2EZLA 3DEWA 1VI0A 2YS9A 3BR2A 1IDZA 3TP0A 4D7NA 3B81A 3LJLA 1XG1A 3PPBA 4B4CA 2G0EA 1H8AC 3MNLA 1A6IA 1K83J 3QPLA 2L7FP 2CQQA 3VOXA 4GCLA 4PXIA 1ORKA 5FKLA 3JR9A 3M4OJ 3NXCA 2LK2A 4D7MA 3M3YJ 1IDYA 1FIAA 2MGQA 1ZR4A 1GDTA 2YUSA 3NNRA 1JTXA 1ZK8A 2X9DA 2LY9A 1SANA 5F27A 1H89C 3S15J 2JK3A 4IHWA 2XPUA 1MBHA 2LR8A 3I4MJ 2CQXA 1FEXA 1QPIA 4BXXJ 2G3BA 3IH4A 3S1QJ 2RAEA 2YVEA 3T6NA 3K2AA 1Q1VA 2B63J 3G56A 1JUPA 3BG3A 3VOKA 2MSYA 1MH3A 2AO9A 4BBRJ 5IYBJ 4AC0A 3CRJA 2FBQA 3S1NJ 4AC6A 3BG5A 4RDUA 3E7LA 1ETQA 3JRCA 3DPJA 3D1NI 1WI3A 2GENA 4JL3A 5K7ZA 2CRGA 2GFNA 3C07A 4W1UA 1ETXA 1TWHJ 2RASA 1WCMJ 1FIPA 2ZOYA 3VIBA 4L62A 3OIOA 2GLOA 4A3FJ 4NDLA 3E7QA 2IBDA 5EYRA 3HGGA 3H3VK 2UXOA 3PM1A 3OOUA 3BG9A 1MSFC 1IV6A 4ABZA 5EG0B 4BBSJ 2L9RA 2QF7A 4V2GA 1AU7A 4A3CJ 1IGNA 2XPWA 2JWTA 3G1OA 4AYBN 1POGA 5F0HA 5C4YA 2R5YA 3OSGA 5HBUA 5H9TA 3A01A 3S2HJ 3S17J 1ETOA 3SFIA 3C2BA 2VI6A 3BQZA 4AF5A 4CGRA 3BR0A 4A3BJ 5GP9A 2WGBA 1VF9A 4JYKA 3ZQGA 2R5ZA 2HQ5A 5IP7J 1MBEA 5IYCJ 4CYCA 2NS8A 3O8GA 1Y1VJ 2M9HA 4V2FA 1AKHA 1W0UA 3BHQA 2M8GX 2TCTA 3RQIA 3A01B 2ME0A 5C44J 3HOYJ 2DG8A 4YZEA 4A3MJ 1JJ6C 3RH2A 4JX6A 5EF6A 2OPTA 4IEJA 1SFOJ 3BT9A 1NK3P 2NP3A 5FGLA 4A3EJ 3HIMA 2VKEA 3HDDA 1ENHA 5CXGA 5J1UA 2MG4A 3HKZN 2QWTA 1FTTA 3HTIA 3HE0A 1IUFA 2FQ4A 3CJDA 3ANPA 1MH4A 3VVXA 3LNQA 3GTGJ 1T56A 1NTCA 3ZQCA 2XB0X 3LSJA 5K7HA 1JGGA 3AQSA 3QKXA 1ETVA 1RPWA 2IAIA 1RESA 1RR7A 4X6AJ 3UKGA 3HEFA 1ETYA 3IH3A 5FKKA 3RZDJ 2DA1A 1MNMC 1F43A 4L5EA 1MBJA 2LP0A 1FTZA 2ECBA 5BNGA 2HOAA 2DMPA 1BA5A 2MW8A 2N8GA 3JRGA 3GTMJ 1IRZA 1G2HA 9ANTA 2E1OA 2XGCA 5J3LA 2ID3A 1U8BA 3LSRA 5IPAA 3FK6A 3NARA 1BW6A 4A3IJ 2DJNA 1OCPA 2ID6A 3HBLA 2I10A 2QIBA 1UG2A 1HF0A 3PO3J 2HI3A 3JREA 1APLC 4A3DJ 3RD3A 5FHPA 1B8IB 3TP3A 5DTDA 2LD5A 5F04A 2HYTA 1MBGA 3V6GA 4QIWN 2OF7A 2DA2A 3EGQA 4D5FA 4UUTA 2D6YA 4HNVA 2JN6A 4UUSA 2DA5A 3GTLJ 1OCTC 3GBGA 3JRHA 1I3QJ 4FE7A 2OERA 3O60A 3S1MJ 2FX0A 2L7MP 1PUFA 1X58A 2XPVA 1QVUA 4XRSA 2YVHA 3TW7A 2NVQJ 4M3BA 3NAUA 2NVXJ 3VW1A 3PO2J 4A3LJ 5F1JA 3GTOJ 2HOTA 5F0CA 2GM4A 4MXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGM A;  5JLX A;  1X2N A;  2HYJ A;  3A03 A;  1Z0X A;  4JX5 A;  2OI8 A;  3KKC A;  3PAS A;  4KWA A;  4Y7N J;  4GFK A;  1TWG J;  2NS7 A;  3LOC A;  1GT0 C;  3MVP A;  4W97 A;  2XB5 A;  1H88 C;  4A3J J;  4A93 J;  5HOD A;  2WB1 N;  3WHB A;  3HOU J;  4DZJ A;  4RBO A;  2UXP A;  4G12 A;  2M0C A;  3NI7 A;  1HCR A;  5M5X J;  4M3E A;  1WH7 A;  2E19 A;  4D5C A;  5IP6 A;  4DYR A;  1UI5 A;  1ETW A;  2O8K A;  4S0H B;  1K61 A;  1CQT A;  2XGD A;  3BR5 A;  1R9T J;  1S7E A;  2DTZ A;  2W53 A;  2NP5 A;  1BW5 A;  5GPA A;  2K9Q A;  3HTH A;  1JJ8 C;  4UDS A;  3FIW A;  3IH2 A;  4EEF G;  5CW8 A;  2ZOZ A;  3WHC A;  2FD5 A;  1AHD P;  4BY1 J;  2JJ7 A;  4GFL A;  1TC3 C;  1JUS A;  2HDD A;  3MKL A;  1TWF J;  1JKQ C;  2XDN A;  4C2M J;  3QQA A;  4LOC A;  2H8R A;  4ICH A;  1RKT A;  4J19 A;  4FE4 A;  1E3O C;  1FJL A;  4ME9 A;  2DA3 A;  1HDD C;  4DYC A;  1ITY A;  2HOS A;  2EZH A;  2CJJ A;  4MO7 A;  3COL A;  1LE8 A;  2P81 A;  1RET A;  2LLK A;  5M3M J;  2R5Y B;  1HOM A;  2PZ9 A;  3GTP J;  1D5Y A;  1TWA J;  3JSJ A;  1U9N A;  3VPR A;  5FKM A;  5FKN A;  3LSP A;  1ZQ3 P;  2PBX A;  4JKZ A;  5FKO A;  1Z77 A;  1MBF A;  1LFB A;  2IEK A;  3HOV J;  3S2D J;  2R5Z B;  2GUH A;  3L1P A;  1OJL A;  2JA7 J;  3G7R A;  2LTP A;  4CYC B;  4NN1 A;  2E2I J;  4M3G A;  2M34 A;  1AKH B;  3VVZ A;  2XSD C;  1QVT A;  3TED A;  4A3K J;  2ZCM A;  3B6C A;  5K7F A;  2V57 A;  1T33 A;  5E3M A;  1X2M A;  5M3F J;  3KZ9 A;  5DS9 A;  3BTJ A;  5EGO A;  3CMY A;  3HB9 A;  4DZP A;  2DA4 A;  3F1B A;  3Q0W A;  1WPK A;  4MLO A;  5JLW A;  3LWJ A;  3RKQ A;  1IJW C;  2HKU A;  2M2E A;  2X6O A;  3Q3S A;  2W48 A;  3H0G J;  3OSF A;  3BCG A;  3HOZ J;  1JT0 A;  2DG7 A;  2K9S A;  5EZH A;  4AUX A;  3V78 A;  5EEA A;  3ZOB A;  4B1R A;  4IHY A;  3FRQ A;  3SJM A;  1OFC X;  1JKO C;  3ZQI A;  5EGO B;  2JMW A;  2VKV A;  4I76 A;  3JRB A;  1BJZ A;  2REK A;  3ZQF A;  5GPC A;  3FIS A;  2E2H J;  2X48 A;  2WAQ N;  1ZTR A;  4QSH A;  5IP9 J;  1HLV A;  4IHX A;  3G1L A;  1DU6 A;  2EH3 A;  4DW6 A;  2NVT J;  4QTR A;  2CUF A;  5IOY A;  3BTC A;  3GTJ J;  4GFB A;  4C3J J;  3S16 J;  2XGE A;  3IUV A;  3BR1 A;  5M5W J;  2O9L A;  4Y52 J;  3FKI J;  1XS9 A;  3VW2 A;  5IYD J;  2R7Z J;  1U9O A;  2DMU A;  3JRA A;  2VUM J;  3NPI A;  4A3G J;  1U78 A;  1P7I A;  2FJ1 A;  2DMT A;  2NOG A;  2DA6 A;  3CDL A;  5HSZ A;  5C4X J;  5E3N A;  1UMQ A;  1GV5 A;  4XIC A;  1VND A;  1W0T A;  4M3D A;  2JA8 J;  3JRD A;  4IHV A;  5CXI A;  3LSG A;  2Y9Y A;  1I6H J;  4NEL A;  3W6V A;  2L0K A;  3BRU A;  2PMZ N;  2KT0 A;  3BR3 A;  4GCK A;  3S1R J;  1IC8 A;  5D19 A;  2XRL A;  2TRT A;  3HM5 A;  2WV1 A;  4UUS B;  3S14 J;  1I50 J;  1BL0 A;  2UXI A;  2G7G A;  2EZI A;  1JUM A;  2GBY A;  4FIS A;  2ME6 A;  3ON2 A;  2QCO A;  3VUQ A;  4MK6 A;  4M3F A;  4ACI A;  1Y1W J;  2DMN A;  1HDP A;  1PUF B;  1EF4 A;  1JT6 A;  2Y2Z A;  3SDG A;  3BNI A;  2UXH A;  5FMP A;  1TWC J;  1A5J A;  5E3L A;  1P7J A;  4X1E A;  1IG7 A;  1GUU A;  3FK7 A;  2HXO A;  2O7O A;  4C3H J;  1WH5 A;  2CUE A;  5EG0 A;  2Y0S N;  3CWR A;  4JNN A;  2DN0 A;  3BQY A;  3TW6 A;  4M6V A;  2Y31 A;  2WUI A;  3HOW J;  1WGX A;  2DA7 A;  2O7T A;  4MFD A;  2ZCN A;  2Q24 A;  1JKP C;  2LVS A;  4FTH A;  1DU0 A;  3HGY A;  4DYQ A;  2AHQ A;  5J1Y A;  1LFU P;  2ELK A;  2ZB9 A;  1JKR C;  3VW0 A;  5FLV A;  1XC5 A;  3Q0V A;  2LFB A;  4JX4 A;  2G7S A;  2HXI A;  5FJ8 J;  2RHA A;  4XRM A;  2KDZ A;  1B72 A;  3GZI A;  3KNW A;  4MFE A;  1RKW A;  3K7A J;  3B6A A;  3ZQL A;  1O4X A;  1ZR2 A;  2EZK A;  3BR6 A;  5EDN A;  3CQZ J;  3KKD A;  1F36 A;  5EFY A;  3P9T A;  3QBM A;  2H1K A;  2VPR A;  1GVD A;  2ZCX A;  4A69 C;  1MBK A;  1ZGW A;  2L7Z A;  3DCF A;  2NX4 A;  3Q0U A;  3BJB A;  1ETK A;  2JA5 J;  3JRI A;  4B3A A;  2NVY J;  2LKX A;  1B72 B;  2R0Q C;  3JRF A;  4JP0 A;  4C3I J;  1JTY A;  1YRN A;  2QKO A;  5C4J J;  4MIM A;  3ANG A;  3A02 A;  3GTQ J;  2K40 A;  2E2J J;  3S5R A;  2G7L A;  2R93 J;  2F07 A;  3HTA A;  1LE8 B;  3BTL A;  2DMQ A;  5F0F A;  4GCT A;  3G1M A;  3NRG A;  2COB A;  5D18 A;  4I6Z A;  2EQR A;  3GTK J;  5HAW A;  3CCY A;  3IV5 A;  5FLM J;  4FCY A;  5EZG A;  3GEU A;  3I4N J;  1ZKG A;  3QPS A;  1YRN B;  4XID A;  2D5V A;  2JA6 J;  2Y9Z A;  2IU5 A;  5F08 A;  1VFC A;  4BY7 J;  3RZO J;  2EBI A;  1UHS A;  3F0C A;  2UXU A;  3O8H A;  4XK4 A;  3HTJ A;  3EUP A;  2QOP A;  5C3E J;  5IOZ A;  5J1R A;  3VP5 A;  4BKX A;  3VVY A;  1MSE C;  2CU7 A;  1QRY A;  3LHQ A;  3ZQH A;  1NK2 P;  2YU9 J;  3ON4 A;  5M5Y J;  4XRS G;  3HOX J;  2Y30 A;  2QTQ A;  1GV2 A;  3MN2 A;  2K9N A;  5K58 A;  3BTI A;  1B8I A;  5E3O A;  2R92 J;  3AQT A;  1UI6 A;  4HKU A;  2ECC A;  5DAJ A;  5AQC A;  5D1R A;  2EZL A;  3DEW A;  1VI0 A;  2YS9 A;  3BR2 A;  1IDZ A;  3TP0 A;  4D7N A;  3B81 A;  3LJL A;  1XG1 A;  3PPB A;  4B4C A;  2G0E A;  1H8A C;  3MNL A;  1A6I A;  1K83 J;  3QPL A;  2L7F P;  2CQQ A;  3VOX A;  4GCL A;  4PXI A;  1ORK A;  5FKL A;  3JR9 A;  3M4O J;  3NXC A;  2LK2 A;  4D7M A;  3M3Y J;  1IDY A;  1FIA A;  2MGQ A;  1ZR4 A;  1GDT A;  2YUS A;  3NNR A;  1JTX A;  1ZK8 A;  2X9D A;  2LY9 A;  1SAN A;  5F27 A;  1H89 C;  3S15 J;  2JK3 A;  4IHW A;  2XPU A;  1MBH A;  2LR8 A;  3I4M J;  2CQX A;  1FEX A;  1QPI A;  4BXX J;  2G3B A;  3IH4 A;  3S1Q J;  2RAE A;  2YVE A;  3T6N A;  3K2A A;  1Q1V A;  2B63 J;  3G56 A;  1JUP A;  3BG3 A;  3VOK A;  2MSY A;  1MH3 A;  2AO9 A;  4BBR J;  5IYB J;  4AC0 A;  3CRJ A;  2FBQ A;  3S1N J;  4AC6 A;  3BG5 A;  4RDU A;  3E7L A;  1ETQ A;  3JRC A;  3DPJ A;  3D1N I;  1WI3 A;  2GEN A;  4JL3 A;  5K7Z A;  2CRG A;  2GFN A;  3C07 A;  4W1U A;  1ETX A;  1TWH J;  2RAS A;  1WCM J;  1FIP A;  2ZOY A;  3VIB A;  4L62 A;  3OIO A;  2GLO A;  4A3F J;  4NDL A;  3E7Q A;  2IBD A;  5EYR A;  3HGG A;  3H3V K;  2UXO A;  3PM1 A;  3OOU A;  3BG9 A;  1MSF C;  1IV6 A;  4ABZ A;  5EG0 B;  4BBS J;  2L9R A;  2QF7 A;  4V2G A;  1AU7 A;  4A3C J;  1IGN A;  2XPW A;  2JWT A;  3G1O A;  4AYB N;  1POG A;  5F0H A;  5C4Y A;  2R5Y A;  3OSG A;  5HBU A;  5H9T A;  3A01 A;  3S2H J;  3S17 J;  1ETO A;  3SFI A;  3C2B A;  2VI6 A;  3BQZ A;  4AF5 A;  4CGR A;  3BR0 A;  4A3B J;  5GP9 A;  2WGB A;  1VF9 A;  4JYK A;  3ZQG A;  2R5Z A;  2HQ5 A;  5IP7 J;  1MBE A;  5IYC J;  4CYC A;  2NS8 A;  3O8G A;  1Y1V J;  2M9H A;  4V2F A;  1AKH A;  1W0U A;  3BHQ A;  2M8G X;  2TCT A;  3RQI A;  3A01 B;  2ME0 A;  5C44 J;  3HOY J;  2DG8 A;  4YZE A;  4A3M J;  1JJ6 C;  3RH2 A;  4JX6 A;  5EF6 A;  2OPT A;  4IEJ A;  1SFO J;  3BT9 A;  1NK3 P;  2NP3 A;  5FGL A;  4A3E J;  3HIM A;  2VKE A;  3HDD A;  1ENH A;  5CXG A;  5J1U A;  2MG4 A;  3HKZ N;  2QWT A;  1FTT A;  3HTI A;  3HE0 A;  1IUF A;  2FQ4 A;  3CJD A;  3ANP A;  1MH4 A;  3VVX A;  3LNQ A;  3GTG J;  1T56 A;  1NTC A;  3ZQC A;  2XB0 X;  3LSJ A;  5K7H A;  1JGG A;  3AQS A;  3QKX A;  1ETV A;  1RPW A;  2IAI A;  1RES A;  1RR7 A;  4X6A J;  3UKG A;  3HEF A;  1ETY A;  3IH3 A;  5FKK A;  3RZD J;  2DA1 A;  1MNM C;  1F43 A;  4L5E A;  1MBJ A;  2LP0 A;  1FTZ A;  2ECB A;  5BNG A;  2HOA A;  2DMP A;  1BA5 A;  2MW8 A;  2N8G A;  3JRG A;  3GTM J;  1IRZ A;  1G2H A;  9ANT A;  2E1O A;  2XGC A;  5J3L A;  2ID3 A;  1U8B A;  3LSR A;  5IPA A;  3FK6 A;  3NAR A;  1BW6 A;  4A3I J;  2DJN A;  1OCP A;  2ID6 A;  3HBL A;  2I10 A;  2QIB A;  1UG2 A;  1HF0 A;  3PO3 J;  2HI3 A;  3JRE A;  1APL C;  4A3D J;  3RD3 A;  5FHP A;  1B8I B;  3TP3 A;  5DTD A;  2LD5 A;  5F04 A;  2HYT A;  1MBG A;  3V6G A;  4QIW N;  2OF7 A;  2DA2 A;  3EGQ A;  4D5F A;  4UUT A;  2D6Y A;  4HNV A;  2JN6 A;  4UUS A;  2DA5 A;  3GTL J;  1OCT C;  3GBG A;  3JRH A;  1I3Q J;  4FE7 A;  2OER A;  3O60 A;  3S1M J;  2FX0 A;  2L7M P;  1PUF A;  1X58 A;  2XPV A;  1QVU A;  4XRS A;  2YVH A;  3TW7 A;  2NVQ J;  4M3B A;  3NAU A;  2NVX J;  3VW1 A;  3PO2 J;  4A3L J;  5F1J A;  3GTO J;  2HOT A;  5F0C A;  2GM4 A;  4MXM A; 
#chains in the Genus database with same CATH topology
 5GAE J;  3WG9 A;  2IS2 A;  4E4H A;  1X2N A;  1Z0X A;  2OI8 A;  1D1B A;  4XR6 A;  5F64 A;  3HRT A;  4GFK A;  1G6N A;  1H9G A;  3S93 A;  3K4K A;  4WK8 F;  3A0H C;  4CIC A;  1XSV A;  1FPQ A;  1UJ8 A;  2DYS H;  2XVC A;  3GEZ A;  4IO9 F;  1H88 C;  1SD6 A;  4FHT A;  2GA1 A;  5HLI A;  1SFK A;  1OR7 C;  3WHB A;  2F6C A;  2OCC H;  4BDZ A;  4G12 A;  4BXF A;  2OZ6 A;  2R7W A;  3OL3 A;  2V1D A;  4AYB A;  2ZJQ F;  1HCR A;  4M3E A;  1AOY A;  2ZNY A;  3P7N A;  4D5C A;  4DYR A;  2XAF A;  1UI5 A;  1UHW A;  1ETW A;  4BS9 A;  1K61 A;  1G3Y A;  4BEH A;  2Z16 A;  3WU2 C;  1BW5 A;  2OA4 A;  1TZL A;  4CHU A;  5E17 F;  4CA0 A;  3HOT A;  3HTH A;  5TJJ A;  5LHI A;  1OPC A;  1FOK A;  2EIL H;  3OYG A;  4EEF G;  5LEJ A;  4GFL A;  3FXQ A;  2HDD A;  3MKL A;  3LAJ A;  3HG9 A;  1XGM A;  4RAG A;  1YIT I;  3QQA A;  1YS7 A;  4LOC A;  2H8R A;  3GFJ A;  3TO9 A;  1YW8 A;  3CDI A;  4N4O B;  1O3Q A;  2FBH A;  3WTY C;  1HOM A;  2LF7 A;  1R1T A;  3CDH A;  1VQN I;  1PVE A;  3NRV A;  3Q9S A;  4LMY A;  2OD5 A;  2JA2 A;  1ZGJ A;  3HSE A;  1F9N A;  4HG2 A;  4RS8 A;  3IKT A;  4G7H F;  4RM2 A;  4BL0 B;  2R5Z B;  2GUH A;  1OJL A;  1MMD A;  4XKW A;  4M6Y A;  1DDN A;  2ZME A;  1ZEL A;  4DOZ A;  4KN4 X;  2XV4 S;  1ZLK A;  1HST A;  3S3O A;  4ZH4 F;  1XTA A;  2M34 A;  3LSM A;  4G6D A;  1QVT A;  2VBW A;  2KKO A;  2DK8 A;  2V57 A;  2HQR A;  3O3K A;  5DM6 F;  1X2M A;  2FUG 2;  1D0Y A;  5DM7 F;  3F1B A;  2FXA A;  4XRF A;  2ETH A;  4KJZ A;  4PDK A;  3W2V A;  3WGI A;  2BV6 A;  2M2E A;  1BR2 A;  4BUP A;  3R60 A;  2DFI A;  3DBR B;  1FMV A;  3H0G J;  3KFW X;  3H1C A;  4BHC A;  1FZP B;  4KNY A;  4EJW A;  2P8T A;  2K9S A;  3WGH A;  3OYM A;  2EIK H;  3K0L A;  4EM0 B;  1Z3X A;  1Y39 A;  4OIN F;  4HDV A;  2LKS A;  1BJZ A;  1T0F A;  3OYH A;  3ZQF A;  3H9J A;  1FOX A;  3K10 A;  4BJ6 C;  1LB2 A;  1XMK A;  3AL0 B;  1HLV A;  3SQN A;  1IRG A;  2XGE A;  2QSF X;  3BR1 A;  5M5W J;  2LOO A;  4DBR A;  2VJJ A;  4Y52 J;  4HF1 A;  2CW8 A;  2K7L A;  4LD5 A;  1MJB A;  2VQL A;  1MND A;  2ELJ A;  3M7G A;  3JRA A;  2VUM J;  1D8J A;  2NOG A;  3P9I A;  3QOP A;  3CDL A;  3LST A;  4PZJ A;  1P4W A;  5E3N A;  3IRQ A;  1UMQ A;  2LKP A;  4BQQ A;  1GV5 A;  5J4Y A;  4XIC A;  3X2Q H;  4RLF A;  3JRD A;  3S2W A;  3VWB A;  4IHV A;  3LSG A;  2Q2E A;  1I6H J;  4NEL A;  3KZY A;  3BRU A;  2PMZ N;  2KLO A;  2KT0 A;  3CMM A;  4CCL A;  4CUG A;  1IC8 A;  4AID A;  3AG2 H;  3I56 I;  3CCR I;  3J81 K;  1R4M B;  3S14 J;  2PFV A;  2EZI A;  2K9L A;  3FDY A;  5HS7 A;  4O3M A;  2OBP A;  5DEQ A;  2A5Y B;  1R1U A;  3K4M A;  4HAM A;  3V4G A;  2DMN A;  2RQQ A;  1HDP A;  2WV0 A;  2X1E A;  2Q2E B;  3HUG A;  5FMP A;  1W7P D;  3HRU A;  4OMY A;  3I54 A;  3TGN A;  1IG7 A;  2CQN A;  3IWZ A;  5D6E A;  2O7O A;  1I6X A;  4C3H J;  2Y0S N;  4NQW B;  3TW6 A;  2WUI A;  1SD7 A;  2DA7 A;  3PQJ A;  2Q24 A;  5BPI A;  3KP6 A;  4DYQ A;  5D6F A;  1EH7 A;  1QBJ A;  3EYY A;  2WA0 A;  1D3Y A;  1HXD A;  1T98 A;  2DQR A;  3COA C;  4O5V A;  1UAA A;  2R7V A;  2CMP A;  2J5O A;  4XLE A;  3Q0V A;  1OMI A;  1R22 A;  2LFB A;  4JX4 A;  2RHA A;  5FJ8 J;  1QGP A;  2JRT A;  4MFE A;  1RKW A;  2DDA A;  1E0E A;  3IWF A;  5BMZ A;  2LY1 A;  2M8E A;  1SC7 A;  2EZK A;  3CJN A;  3OS2 A;  4F52 A;  1IXC A;  4ZJZ A;  1F36 A;  2BGC A;  1KYZ A;  3K70 D;  2H1K A;  5BPD A;  2L54 A;  1OYW A;  1V4R A;  2L7Z A;  3FXR A;  4XKV A;  4ZYA A;  1VQ8 I;  4A12 A;  2YX4 A;  2CFX A;  3K4B A;  4X0G A;  4B3A A;  2IGM A;  3JRI A;  2QQB A;  5H6Q A;  2HTJ A;  3BG7 A;  4N4N B;  5HOO A;  4JP0 A;  1OQY A;  4C3I J;  4UB6 C;  3HRS A;  4XLP F;  3DTK A;  3CCJ I;  2FJI 1;  2QKO A;  1K7A A;  3N4M A;  1T8I A;  2K40 A;  3G2B A;  5E18 F;  2E2J J;  2DW4 A;  2G7L A;  2F07 A;  5F0F A;  2DMQ A;  5D8L B;  4M74 A;  3G1M A;  1LNW A;  3LMM A;  2DFH A;  3HTU A;  4XKC A;  3PJR A;  3GTK J;  3CCY A;  1YX3 A;  2FNA A;  1JGS A;  2A5W A;  4YIF A;  1I39 A;  3RPU D;  4DGW B;  3IHU A;  4LG0 A;  1K78 A;  2D5V A;  1Z7U A;  3EUA A;  2Y9Z A;  2JA6 J;  5F08 A;  3E1S A;  1VFC A;  5E1Z B;  1FWZ A;  5HDK A;  1UHS A;  3F0C A;  2UXU A;  1X1B A;  3HTJ A;  1LUJ B;  3F8M A;  2DOD A;  3BWG A;  2QOP A;  3VP5 A;  4A2U A;  1FMW A;  3VVY A;  1MSE C;  2KIU A;  4P1W A;  2V79 A;  5FRM A;  3ZQH A;  3ON4 A;  1D0Z A;  2A6H F;  1X3Z B;  4CDG A;  1DPR A;  1S7O A;  4MEX F;  1I27 A;  4AD9 A;  4KYW A;  1GXQ A;  4BU2 A;  1O3S A;  3AQT A;  5LFA A;  4HX7 A;  2CGP A;  4UY8 I;  4IRG A;  4FT8 A;  1E3H A;  4ENJ A;  5DAJ A;  2EZL A;  2VON A;  1VI0 A;  2HVS A;  3TP0 A;  3B81 A;  5ILS A;  3LJL A;  3KEO A;  2LRE A;  2L9N A;  1X3W B;  1BR4 A;  3M1E A;  3OL4 A;  5CQG A;  2XC7 A;  3MNL A;  4ZYG A;  2CUZ A;  1KU2 A;  2WAE A;  4OIP F;  2VBZ A;  3TDU C;  2LBF B;  2QSH X;  2KZV A;  2MGQ A;  4HV5 A;  2K3P A;  2UV1 A;  2IS1 A;  1ZK8 A;  2X9D A;  4PGH A;  1SAN A;  1H89 C;  2JK3 A;  1VQ9 I;  4HW0 A;  2QGU A;  2RV8 A;  2CQX A;  1P2F A;  4MQV A;  4YFX F;  1E2X A;  1O3R A;  3VTI A;  1R7J A;  4LG3 A;  4DQ2 A;  3S1Q J;  4IKF A;  2YVE A;  3T6N A;  3K2A A;  1Q1V A;  2EWN A;  1JUP A;  2B0L A;  3BG3 A;  1CGP A;  3VOK A;  1XB4 A;  1X1C A;  1V5F A;  5IYB J;  1HC8 A;  3CRJ A;  1SVO A;  1WRJ A;  2WBM A;  5HDN A;  1LQ1 A;  3BG5 A;  3FXL A;  2KL4 A;  2H1L A;  1SAU A;  2M0M A;  3ZRG A;  4XMY A;  4R1H A;  2LDU A;  4BH9 A;  2GFN A;  2MAB A;  1IAW A;  5BOX A;  1TWH J;  4L62 A;  1N75 A;  2X51 A;  4NDL A;  4D1Q A;  3E7Q A;  2IBD A;  5DV5 A;  5TRD A;  1ON1 A;  3AG3 H;  3OOU A;  3PM1 A;  2JUG A;  2G7H A;  4BBS J;  3BJ6 A;  3G1O A;  3BDD A;  4AYB N;  2FA5 A;  3I3L A;  5C4Y A;  1IXR C;  3LQQ A;  5AON A;  2HFH A;  4ITV A;  3C2B A;  4LLL A;  3SEQ A;  4BHP A;  2V6C A;  4AF5 A;  4CGR A;  1WJB A;  1G4D A;  1U0J A;  2H6B A;  1V55 H;  2WGB A;  2D45 A;  2LH9 A;  4WIB A;  4UUV A;  2EV5 A;  4J00 A;  2M4K A;  5HDG A;  1K4T A;  4WXH A;  5IP7 J;  1Y6I A;  2DCE A;  4CO8 A;  3G4S I;  4BJT A;  2VE8 A;  3C3W A;  4CYC A;  1Z91 A;  2NS8 A;  3E97 A;  4LGW A;  1Y1V J;  3VSK A;  1AKH A;  1P9Q C;  5JVG F;  2KIS A;  1SFU A;  2F4O B;  3R61 A;  1JJ6 C;  4JX6 A;  3DKX A;  5EF6 A;  2W1O A;  3BT9 A;  2DTR A;  1PUE E;  2A3S A;  5JHU A;  1YJN I;  3AL0 C;  2NP3 A;  4G94 A;  5CVR A;  1PYV A;  4Y15 A;  5CXG A;  2XRN A;  2BBY A;  2QWT A;  1FTT A;  4G7Z F;  3HTI A;  1HKS A;  3HE0 A;  2QQA A;  1K6O A;  1BJA A;  3T0Y A;  5DUK A;  3LNQ A;  2V26 A;  2RNJ A;  2O3F A;  1BOA A;  1NTC A;  2W24 A;  4L9N A;  3ZQC A;  2XB0 X;  3LSJ A;  4J01 A;  3F8B A;  1TT5 B;  3O6B B;  4FX0 A;  1ETV A;  4QPQ A;  2PEX A;  2VLA A;  4IRI A;  3HEF A;  5FKK A;  3GYH X;  4HDU A;  1MBJ A;  4L9V A;  4KDP A;  2HOA A;  3ZMS A;  2MW8 A;  2N8G A;  1WI9 A;  2FEZ A;  3QPT A;  2E7X A;  5LGT A;  2HVR A;  3GTM J;  2PN6 A;  1G2H A;  5HVQ C;  9ANT A;  1X4O A;  1MGT A;  4BAC A;  2HDW A;  1J59 A;  4F55 A;  3Q9V A;  1IXS B;  3OYJ A;  2DQL A;  2FBI A;  1HF0 A;  2HI3 A;  1HSJ A;  3JRE A;  1APL C;  3E5U A;  3O2P E;  1RUO A;  4UV9 A;  2K5C A;  3TBI A;  3VDX A;  1I1G A;  2M4G A;  5D4S A;  2HYT A;  1W5T A;  2FSW A;  2F5F A;  1Z6R A;  1RZ4 A;  3OV8 A;  4UUT A;  3V42 A;  1FX7 A;  1Z67 A;  4B09 A;  4P5O A;  4IQ4 A;  5LRR A;  1LJ9 A;  1VQK I;  4PK4 A;  1OCT C;  5DD8 A;  2STW A;  1I3Q J;  3ESW B;  3HHH A;  4RGR A;  2E1N A;  3B73 A;  5B3S H;  2KDO A;  3O60 A;  3EUH C;  3WOD F;  2FX0 A;  2L7M P;  1BR1 A;  2HKO A;  5ILU A;  5KCM A;  2F4M B;  4ESJ A;  2G7U A;  2KJB A;  2FOW A;  3TW7 A;  1WVR A;  3NAU A;  2NVX J;  4YG2 F;  3PO2 J;  1WJD A;  4MXM A;  2PG4 A;  3ZN0 A;  4JX5 A;  3A03 A;  4G6Q A;  4HOB A;  3KKC A;  3PAS A;  4Y7N J;  1R5H A;  2XAS A;  2NS7 A;  4W97 A;  1FBU A;  2ZXI A;  4L9J A;  1IN6 A;  3F23 A;  4A93 J;  2R7T A;  1WJC A;  2XAU A;  3SFZ A;  2WB1 N;  3HOU J;  2HOE A;  4M6X A;  3SHF A;  2JUC A;  2FNP A;  4N9I A;  2EA2 A;  3V8L A;  2M0C A;  4KMU X;  3NI7 A;  3DEU A;  2BY0 A;  1T2K A;  1Y8R B;  1KYW A;  2OJE D;  4M9S A;  2O8K A;  4E7L A;  1TLH B;  2IJL A;  4M71 A;  3K2Z A;  4S0H B;  3BR5 A;  2IGO A;  1R9T J;  2DTZ A;  4L5I A;  1R58 A;  2LG4 A;  3R4K A;  5GPA A;  3L2Q A;  3T8T A;  3IH2 A;  3PNY A;  5DCM B;  3SWH A;  2HQA A;  2PX9 A;  3B02 A;  3WHC A;  2JJ7 A;  5LGN A;  1N77 A;  1VQ6 I;  1TC3 C;  1JUS A;  1JKQ C;  4C30 A;  4ZZL A;  4XON A;  4C2M J;  4PJM A;  1SVM A;  4ICH A;  3MKY B;  4J19 A;  3LSK A;  1YI2 I;  2C6Y A;  1E3O C;  3PSI A;  4ME9 A;  2P6S A;  1OCR H;  2YSR A;  2DA3 A;  1HDD C;  2VJI A;  1ITY A;  1QNT A;  3R0A A;  4L5J A;  2HOS A;  3DV8 A;  4MO7 A;  1LE8 A;  3COL A;  2P81 A;  4V19 K;  1J7K A;  2GXB A;  5M3M J;  1VQL I;  2MYS A;  1D5Y A;  2ISY A;  4G9Y A;  4BHB A;  3JSJ A;  2HPI A;  2X0L A;  1YOV B;  1KU7 A;  1U5T C;  4JKZ A;  3C2G A;  2QM3 A;  5IT3 A;  1ZQ3 P;  2PBX A;  5FKO A;  5KHD A;  3K4C A;  1A35 A;  3HOV J;  3I59 B;  1ODD A;  4DIQ A;  3L1P A;  3RJP A;  4LLN A;  2ACJ A;  1MW7 A;  3CF2 A;  4KA4 A;  1T38 A;  4E6K G;  2LTP A;  2B9S A;  2XSD C;  2E1M B;  3DTI A;  4M72 A;  3PNT A;  3TED A;  4A3K J;  1T33 A;  2XUB A;  5E3M A;  3L2V A;  2JVG A;  2PFB A;  3MMY B;  4JOM A;  3CMY A;  3H5A A;  4B8X A;  2IXS A;  4IF4 A;  2DA4 A;  2JRM A;  3JTH A;  3S8P A;  2I8D A;  4WCG A;  4OD5 A;  3LWJ A;  5JLW A;  3RPQ A;  1FC3 A;  2HYG D;  1A36 A;  2XDV A;  3Q3S A;  4QLC U;  1MZB A;  3BCA A;  3OR1 C;  3U1K A;  4KFC A;  3HOZ J;  1IN5 A;  1JT0 A;  1MD0 A;  1WHU A;  2L3D A;  5EZH A;  4AUX A;  2OZU A;  5EEA A;  1IZ1 A;  2BVM A;  3ABM H;  3ZOB A;  4B1R A;  3FRQ A;  3SJM A;  1OFC X;  2QA4 I;  1B59 A;  4ESF A;  2VKV A;  4I76 A;  3WG7 H;  2MLK A;  2IP2 A;  4H0E A;  1IV8 A;  3FIS A;  2M87 A;  2X48 A;  2WAQ N;  1ZTR A;  2VT2 A;  5GPC A;  2E2H J;  4A0Z A;  2OU2 A;  3G1L A;  4IHX A;  4DW6 A;  3QYE A;  1OIS A;  2CUF A;  3S16 J;  3GTJ J;  4E7K A;  4I7H A;  4C3J J;  1LDJ A;  2O9L A;  2OTJ I;  1ERD A;  3K1N A;  3DU5 A;  3EET A;  2FJ1 A;  4Y3O A;  2V7F A;  3BOQ A;  3F9K A;  5JR3 A;  4OAY A;  2L9V A;  1W0T A;  3ISP A;  1YG2 A;  2BHZ A;  3ASN H;  4ENM A;  2Y9Y A;  5FFZ A;  3AG1 H;  4RAF A;  4ENK A;  3W6V A;  2L0K A;  3I64 A;  4EM1 A;  3VB2 A;  3UR3 C;  3S1R J;  5D19 A;  1BI0 A;  2JTV A;  3MZ8 A;  4RB1 A;  3HM5 A;  1SFE A;  2WV1 A;  1JUM A;  1EV7 A;  2P0W A;  5L3F A;  2HGC A;  3H0D A;  4FIS A;  2O03 A;  4C2M A;  1W7P A;  4HZF A;  2QCO A;  2ZO4 A;  2W7N A;  2IPQ X;  1PUF B;  3H9G A;  2DLL A;  2VBX A;  5CLS A;  5FB2 A;  1JT6 A;  1TWC J;  2L2O A;  2KPM A;  1HBX G;  2CUJ A;  3FK7 A;  1QZY A;  1JI8 A;  1TP4 A;  3LL7 A;  3GLL A;  4RM3 A;  5E79 C;  1WWX A;  1YHQ I;  1WH5 A;  5GTI C;  5EG0 A;  1QPM A;  5KNL A;  4JNN A;  2DN0 A;  3CZ6 A;  2O7T A;  2UXN A;  2ZCN A;  1UZC A;  3GFI A;  2P6T A;  3JTG A;  5LD2 C;  2LF8 A;  3RKW A;  1OCZ H;  4AIK A;  4CH7 A;  1ZGA A;  3AG4 H;  4II3 A;  1G8X A;  1WKM A;  2VKH A;  1XC5 A;  3VFZ A;  2HXI A;  4KT6 A;  4XRM A;  2I5U A;  1B72 A;  3OR2 C;  3CCQ I;  3ZQL A;  1NG7 A;  1ZR2 A;  3BR6 A;  5EDN A;  2DFE A;  4CCJ A;  3CQZ J;  4BEH B;  3TMO A;  3KKD A;  5EFY A;  3QBM A;  2ZSI B;  5D4R A;  3PIO F;  3F21 A;  4NUB A;  4A69 C;  2NX4 A;  3Q0U A;  3BJB A;  1ETK A;  2X1C A;  3GO5 A;  3M8E A;  2NVY J;  3GZ6 A;  4U9L A;  3M9A A;  2LKX A;  4LK0 F;  1B72 B;  4NB5 A;  2R0Q C;  1YFH A;  1YRN A;  3RIR A;  4F93 B;  3ANG A;  3TQN A;  2YPR A;  2A05 A;  4XL9 A;  5J47 A;  3OYC A;  3BTL A;  4GCT A;  2COB A;  4E7S A;  3CCM I;  1WZ2 A;  3FZV A;  3RPU A;  3AKZ A;  4I6Z A;  1MDM A;  1LPQ A;  4Z2Y A;  4CSW A;  4P96 A;  2ZSH B;  5EZG A;  4FCY A;  2NNN A;  3EUK L;  4KIS A;  1ZKG A;  1YRN B;  3KZI C;  5LEK A;  2X6X A;  4BY7 J;  3VSL A;  4I2O A;  2IS6 A;  2ZME B;  4ENN A;  3O8H A;  3PL8 A;  4XK4 A;  4I0B A;  3TO7 A;  1P4A A;  1HQC A;  2LRD A;  5IOZ A;  5C3E J;  1P6R A;  4BKX A;  3PQK A;  2DDB A;  1NK2 P;  5CVJ A;  4XRS G;  2Y30 A;  3BG6 A;  2KP6 A;  1WJA A;  5ICG A;  1GV2 A;  3IKV A;  3A2K A;  2JT1 A;  2K9N A;  5GAG J;  2R92 J;  5E3O A;  3D5S C;  3PSF A;  5K5Q A;  3MEX A;  4EJT A;  1UI6 A;  5F1R A;  3OYF A;  4LB5 A;  4HV6 A;  4P55 A;  1Z1D A;  1B1B A;  5FGM A;  3BR2 A;  2VC0 A;  4ZTJ A;  1XG1 A;  2RKH A;  1A04 A;  2WAD A;  4AVZ A;  4IL6 C;  2G0E A;  1K83 J;  1UEL B;  3QPL A;  2CQQ A;  3VOX A;  4PXI A;  4IX7 A;  1ORK A;  1P4X A;  2EFO A;  5FKL A;  3JR9 A;  1RUN A;  3NXC A;  3CLO A;  2LK2 A;  2NYX A;  2VE9 A;  2R7D A;  2YUS A;  3NNR A;  4U87 A;  2CV1 A;  2CO5 A;  2B1E A;  2LY9 A;  4BGD A;  3I53 A;  1SFX A;  3DLL F;  3LSH A;  3DU6 A;  2XPU A;  4ZDO A;  3I4M J;  1HW5 A;  4Y17 A;  2MC4 A;  3PUF A;  2G3B A;  2QKM B;  2JQ7 A;  3IH4 A;  1JHF A;  1LDD A;  2ZXW H;  2L9S A;  2CS3 A;  2MSY A;  3G71 I;  4RA2 A;  4BBR J;  4E70 A;  4EQQ A;  1Z7L A;  5LHH A;  3S3N A;  2FBQ A;  1D1A A;  2IVM A;  4AC6 A;  2QBY A;  4RDU A;  1ETQ A;  3BCB A;  2AXL A;  3H92 A;  1O3T A;  1WI3 A;  3V8K A;  4GDF A;  5K7Z A;  2ELH A;  3C07 A;  4W1U A;  2CV2 A;  3R0J A;  1WCM J;  4CCN A;  1FIP A;  2VAS A;  3ZXS A;  5D5X B;  3OIO A;  4MTD A;  2RAS A;  3HUG B;  3ABU A;  3OYN A;  4XOP A;  4KUM A;  2L01 A;  2TDX A;  5EEH A;  2BY2 A;  1MKM A;  2R4G A;  1MSF C;  3C7J A;  1S6L A;  1L0O C;  5CJ9 A;  2L9R A;  3C1D A;  1AU7 A;  4A3C J;  2OTL I;  5FLX Z;  5DYM A;  4XLH A;  1DGW Y;  1ZAR A;  3L9F A;  4XLF A;  2ZY9 A;  4BJ5 C;  1TQM A;  2R5Y A;  2PJP A;  3MWM A;  1WJE A;  5TGT A;  1YJ9 I;  3S17 J;  3SFI A;  2RRE A;  3BZK A;  2XAJ A;  3FXK A;  4BE2 A;  5ICF A;  1RR8 C;  5GP9 A;  4ZDP A;  3ZQG A;  2NNY A;  2OV7 A;  3CUQ A;  3ZMU A;  5K5O A;  1J2X A;  4BAY A;  3GZN B;  2UZK A;  2LY2 A;  5IYC J;  4OD4 A;  1X1D A;  1B9M A;  4C9Y A;  3DTE A;  3O8G A;  1TL8 A;  4YZE A;  2TCT A;  1S5L C;  1S72 I;  2ME0 A;  5C44 J;  2MA3 A;  2BZT A;  1RNL A;  3CC4 I;  2JVH A;  3RH2 A;  2A68 F;  2OPT A;  4IEJ A;  3C2H A;  5FGL A;  3HIM A;  2VKE A;  4ZC3 A;  3HDD A;  2LYC A;  2RN7 A;  4RMN A;  4A5N A;  2MG4 A;  3Q5F A;  3HKZ N;  3OWT A;  1IUF A;  2XGX A;  3ZN1 A;  2KJC A;  1MH4 A;  1IN8 A;  3ANP A;  3KEQ A;  2ICW G;  1CF7 A;  1JGG A;  3ABK H;  3AQS A;  1RPW A;  2IAI A;  1RES A;  2Z99 A;  3KP5 A;  5CYV A;  1U5T A;  4B48 A;  4G6T B;  2XHK A;  1M1E B;  4IOC F;  1XSD A;  1K78 B;  1MNM C;  3KLO A;  4LG0 B;  4L5E A;  1BI1 A;  1FTZ A;  1KQ9 A;  2M7B A;  1HKQ A;  1ZG3 A;  2XKO A;  2VOP A;  1IRZ A;  3IRR A;  3HOS A;  4IVN A;  2LNB A;  1D1C A;  1FOY A;  2KMU A;  2V9P A;  1FSH A;  1U8B A;  2MD5 A;  2KZG A;  2NAZ A;  3NAR A;  2EIM H;  2ID6 A;  2VN2 A;  2MH2 A;  4A3D J;  1XGO A;  2EV6 A;  2RDP A;  1KA8 A;  3TP3 A;  2P7V B;  5F04 A;  5B1B H;  2GQQ A;  4QIW N;  2OF7 A;  1LDK B;  4HLX A;  4D5F A;  1TTY A;  2D6Y A;  4PGG A;  5CVU A;  5FO5 A;  4N9H A;  1YTY A;  4UUS A;  1Z3Y A;  4NC8 A;  4IQJ A;  2DA5 A;  1LVA A;  2OCE A;  2A07 F;  2DXI A;  4GXO A;  4IRV A;  1LVK A;  1LKX A;  3E6C C;  4NNJ A;  4CXF A;  3A1Y A;  3OYB A;  3QU3 A;  1X58 A;  2V1N A;  2K4B A;  2YVH A;  3CME I;  2W84 A;  4A3L J;  2QVO A;  5J4V A;  1RRJ A;  6PAX A;  1Z05 A;  2P5V A;  2HYJ A;  4KWA A;  1DP7 P;  1ZH5 A;  3BPV A;  3ONQ A;  1IRX A;  4E7Z A;  3ZMT A;  4B44 A;  3VYR B;  3LOC A;  4NC6 A;  3GFL A;  2XB5 A;  1PDN C;  4A3J J;  5HOD A;  1S9H A;  2EK5 A;  4B43 A;  1MMA A;  4XQF A;  4U88 A;  4ZTF A;  2BY1 A;  3ROU A;  5ILV A;  3RTR A;  2O8X A;  4Y13 A;  3QOE A;  4RBO A;  2UXX A;  3WE2 A;  2R7U A;  5M5X J;  5JVT A;  1WH7 A;  3V7R A;  2GWR A;  3QAH A;  3ABL H;  2UWM A;  3OYE A;  4KT5 C;  4Y33 A;  2XGD A;  2GIV A;  4L0Z B;  3H9Q A;  1S7E A;  4A0Y A;  2WC2 A;  2X6Y A;  2YVX A;  4UDS A;  1TQP A;  3SZT A;  2FD5 A;  1AHD P;  4BY1 J;  3FBI B;  3GFM A;  2ESH A;  4I01 A;  1R71 A;  1SAX A;  1TWF J;  2XDN A;  3CP2 A;  1OR7 A;  4Q4Z F;  1X19 A;  4DNC A;  3D5R C;  2CSO A;  4EJO A;  3GME A;  4AIJ A;  4DYC A;  2EZH A;  2CJJ A;  2K86 A;  3DPT A;  3AFH A;  3FMR A;  3DXJ F;  3QYF A;  3TOA A;  1RET A;  3WTW C;  2LLK A;  1PP8 F;  1Y0U A;  2VOO A;  2K4J A;  4A5M A;  2A6E F;  3CES A;  1TWA J;  2D1H A;  2LSO A;  1U9N A;  3VYS B;  3L2W A;  1RIO H;  2X4H A;  3HPG A;  5FKN A;  3MAJ A;  2DT7 B;  3H5N A;  3QOD A;  5L3G A;  1E17 A;  1Y0N A;  1MBF A;  2R7F A;  1LFB A;  1FBQ A;  2EV0 A;  2IEK A;  2VKD A;  3S2D J;  4OMZ A;  1HA8 A;  4ETS A;  2VQG A;  2JA7 J;  1XD7 A;  2IS4 A;  1YE9 A;  3H36 A;  1NH3 A;  4CYC B;  3U1D A;  3E6M A;  1S7A A;  4M3G A;  1KGS A;  3DF8 A;  2MLG A;  1YIJ I;  1ZG1 A;  3QYB A;  1AKH B;  1TNT A;  3CJT B;  5K7F A;  4EJU A;  3BZ6 A;  5M3F J;  3KZ9 A;  1T0F C;  4FQG A;  3BTJ A;  2X6W A;  2W82 A;  3HB9 A;  3KE2 A;  2E1C A;  5B5E C;  4ZDL A;  1WPK A;  2ZFW A;  3REO A;  2NRA C;  2B3W A;  2F5E A;  2IA2 A;  2MH9 A;  2NOJ B;  1IJW C;  4YFK F;  2HKU A;  5KVR A;  2X6O A;  4RGS A;  2RVC A;  1U8R A;  5HLT A;  3OSF A;  3BCG A;  3QP6 A;  2HR3 A;  3SYT A;  2HU9 A;  3TOB A;  1W4M A;  3FF5 A;  2DOF A;  2BXZ A;  2ESN A;  1R6R A;  1SMY F;  4XOR A;  1HW1 A;  4CCM A;  2EA4 A;  5DUI A;  3JRB A;  3FMS A;  4YEL A;  3DKW A;  3BLY A;  4ESB A;  3GX4 X;  1F4K A;  4QSH A;  2UUZ A;  1V3F A;  5IP9 J;  3OYI A;  5IT9 Z;  1DU6 A;  2EH3 A;  3OIP A;  3N05 A;  1XN7 A;  1J5Y A;  5IOY A;  5FD5 A;  4KN7 X;  5A2Q Z;  2OQG A;  3FKI J;  4LLG F;  1XS9 A;  3VW2 A;  2W57 A;  4HLY A;  1U9O A;  5K1Y A;  4EMS A;  1U78 A;  1P7I A;  2MC3 A;  2DMT A;  3I55 I;  2DA6 A;  2KHM A;  2COM A;  2NS0 A;  3LA2 A;  5HSZ A;  1Y8Q B;  1GXP A;  4IHT A;  1VND A;  2PMZ A;  3F3X A;  5L3D A;  5CXI A;  3DEE A;  2E71 A;  3CC7 I;  2AQE A;  5FFX A;  1C0W A;  2JPC A;  4ZYH A;  1YQA A;  2DBB A;  3MD2 A;  2M45 A;  1REP C;  5J8F A;  1KU9 A;  4WWC A;  5K5R A;  2TRT A;  4U7D A;  4K2E A;  3U21 A;  2QUF A;  2BXY A;  3IP4 B;  2D2W A;  2GBY A;  5F6F A;  3KCC A;  3OOP A;  4BXU A;  3VUQ A;  4OAZ A;  4ACI A;  3LA7 A;  2P7C B;  3SDG A;  2ZKZ A;  1MMS A;  5E3L A;  1P7J A;  2Y75 A;  1GUU A;  2HXO A;  4M9X A;  3W2W A;  1R00 A;  2LC2 A;  2CUE A;  3CCU I;  3FKJ A;  3HOW J;  5AIP A;  3L2C A;  3SZP A;  4OIO F;  1JKP C;  2DOE A;  4FTH A;  4XOT A;  1XX5 A;  3CC2 I;  3HGY A;  2GAU A;  1G3T A;  1DUX C;  4A6D A;  2AHQ A;  3RKX A;  4U7B A;  2ZB9 A;  3VW0 A;  5FLV A;  2VXZ A;  1STZ A;  4I09 A;  4OWR B;  3T1B A;  3JAM Z;  5L3E A;  3A0B C;  2CQ7 A;  2W25 A;  3GZI A;  2PLY A;  3WTX C;  3K7A J;  4GYG A;  4MGR A;  1O4X A;  5CKT A;  1XMX A;  3VEP A;  2K3F A;  4UHT A;  2IRF G;  4MNU A;  1F5T A;  1SD4 A;  2XRO A;  1ZLJ A;  2Z5U A;  3HSF A;  4ON0 A;  4F92 B;  1MBK A;  3MQ0 A;  4I99 C;  2CWE A;  4L0Y B;  1T95 A;  1XCV A;  1TBX A;  1ZRE A;  2GOM A;  4UXN A;  4KIB A;  1BC7 C;  3L7W A;  1B6A A;  3VOD A;  5L3C A;  1W36 C;  2A61 A;  4ZYD A;  5HLG A;  3ZR8 X;  3A02 A;  2RGV A;  4II2 A;  3ZGK A;  3S5R A;  2IGN A;  3I9V 2;  1VQ4 I;  1LE8 B;  1WJ5 A;  1P92 A;  3HC7 A;  3NRG A;  4F3Q A;  5B66 C;  1AA7 A;  3I4P A;  3L09 A;  4BQA A;  5D18 A;  3J7Z I;  1LEB A;  1BM9 A;  4R8H A;  1VQP I;  3I4N J;  3BY6 A;  2BE5 F;  3KYD B;  3LSI A;  3QPS A;  4XID A;  1K4S A;  4HNU A;  2IU5 A;  1BIB A;  3E5X A;  2DJI A;  3K4J A;  3L2R A;  1OYI A;  3E0J B;  4XKB A;  4UB8 C;  2CH0 A;  3LWF A;  4ZYE A;  4HQE A;  4E7J A;  4LIU A;  1D8K A;  2CU7 A;  2H8W A;  1QRY A;  1W1W E;  1A6Q A;  2F48 A;  3CUO A;  2PJR A;  3LHQ A;  5FRN A;  1NHA A;  5M5Y J;  3HOX J;  3CJR B;  4AM3 A;  1W5C C;  2QTQ A;  2M5W A;  3NWS A;  5BQT A;  1R49 A;  1I5Z A;  2O0Y A;  1OCO H;  4UVC A;  3LFU A;  3BTI A;  5CQE A;  1B8I A;  1YLF A;  4EJV A;  1ZN2 A;  2ECC A;  4BQN A;  3KYL A;  1XMA A;  3DEW A;  3J80 Z;  4B3X A;  5ICC A;  1VQO I;  4Q5S F;  1IDZ A;  3SDB A;  2PJR B;  4E7I A;  2BW3 A;  2XIG A;  2HZD A;  3LA3 A;  1G3W A;  3DWL E;  3CTA A;  2QQ8 A;  4B4C A;  1H8A C;  1A6I A;  3ERE D;  2L7F P;  2V1X A;  2A2F X;  1E3P A;  3MZY A;  4JQF A;  1MNE A;  4BNC A;  2EPF A;  3AAF A;  3SXY A;  3GUD A;  4D7M A;  1IDY A;  2F4I A;  4CCK A;  3HTS B;  1GDT A;  1OCC H;  1RI7 A;  3MZH A;  1QA6 A;  4AIH A;  1JTX A;  4KIT B;  5JI6 A;  1FYL A;  3S15 J;  1R4N B;  3W3C A;  4YRV A;  2VXD A;  2P4W A;  1G3S A;  1MBH A;  2LR8 A;  2WWY A;  3BJA A;  4BXX J;  1ULY A;  4M9Z A;  5D5U B;  3N97 A;  2LMD A;  2RAE A;  3ASO H;  3U2R A;  2ZJR F;  3KIO A;  3SEZ A;  1QO0 D;  3IAS 2;  3OS1 A;  1EJ9 A;  2X85 A;  2B63 J;  1J09 A;  1SVL A;  1ZRD A;  3R6S A;  3HHG A;  2AO9 A;  2DK5 A;  1K6Y A;  4PCQ A;  3S1N J;  2WTE A;  4U9N A;  2K02 A;  2CG4 A;  2H09 A;  2XAH A;  3ELK A;  4BQO A;  4NC7 A;  2F2E A;  4S04 A;  2GEN A;  2CRG A;  1W7P B;  2VPL A;  3VOE A;  3E6B A;  4LIT A;  2RNG A;  5DCF A;  2GLO A;  1KQ0 A;  4BDY A;  3FXM A;  5EYR A;  2ZJP F;  4P9F A;  4BYY A;  3H3V K;  2UXO A;  3BG9 A;  2K27 A;  3DP7 A;  3HXL A;  3H5R A;  4ABZ A;  5EG0 B;  3JSP A;  2GXA A;  2Z2S B;  3K8P C;  4PJ0 C;  4V2G A;  5E20 A;  5CVI A;  2Z33 A;  1IGN A;  2XPW A;  3CCE I;  3E6D A;  2JWT A;  1TQI A;  1PJR A;  2RC4 A;  2M3A A;  1POG A;  5H2F C;  3KP3 A;  5F0H A;  3OSG A;  1R1V A;  5H9T A;  3ABT A;  2DT5 A;  4D9J A;  3FWE A;  1ETO A;  1SD5 A;  3CP8 A;  3DLA A;  4GO1 A;  3KZZ A;  3T5X A;  2FOK A;  2BY3 A;  3BR0 A;  4CCO A;  4R79 A;  1FYM A;  4JYK A;  2ADU A;  2OAZ A;  2R5Z A;  1EA3 A;  4CZZ A;  4FET A;  2HWV A;  2R7Q A;  4PFO A;  3KPH A;  5H20 A;  4LJZ F;  2M9H A;  4YEJ A;  3OYL A;  4HA8 A;  3BZC A;  1VZ0 A;  2E35 A;  2JZY A;  3RQI A;  2H27 A;  2CW7 A;  3NQO A;  2GXG A;  2A69 F;  1R23 A;  3A4C A;  3WTT C;  2AQF A;  3QPH A;  2FE3 A;  4ZZD A;  2HDC A;  4A3E J;  3CO7 C;  2FBK A;  4JK1 X;  1I3A A;  3VYU B;  4XLN F;  2M7A A;  4U0V A;  3K4L A;  4OOI A;  5J1U A;  2WY7 Q;  2FQ4 A;  1Z6T A;  1FT9 A;  3VVX A;  1DQU A;  1K79 A;  3S3M A;  1T56 A;  2FML A;  3FXU A;  4Z6Y A;  1UST A;  1MDM B;  5K7H A;  3V7C A;  2Q8K A;  3QKX A;  4XLA A;  4X6A J;  1QHH D;  3UKG A;  3VIB A;  2DA1 A;  2E36 A;  2LP0 A;  4PSW A;  5HS8 A;  2MD0 A;  1BA5 A;  2DMP A;  4I0A A;  4HPQ A;  3DBH B;  3P9K A;  3K69 A;  3ZMZ A;  2KIF A;  2E1O A;  1SMT A;  2XGC A;  3H3U A;  3ERM A;  1BC8 C;  2KFD A;  2Y69 H;  2E34 A;  3LSR A;  3K9T A;  4DBQ A;  4IOA F;  3HYI A;  1T6S A;  1BW6 A;  4A3I J;  1FYK A;  1U2W A;  3J7Y J;  1OCP A;  2HZT A;  3HBL A;  3G6E I;  2QIB A;  2V9K A;  1QHG A;  3RD3 A;  5DTD A;  3WGG A;  4AWX B;  2KQR A;  2DA2 A;  4NHJ A;  3OYD A;  2B7E A;  2HYF A;  4HNV A;  2JN6 A;  3PUB A;  2E5Z A;  4UVB A;  2XF7 A;  4HF2 A;  4IHS A;  5GAH J;  4MEY F;  1MJ9 A;  4HST A;  4D0P A;  3WTV C;  3GBG A;  3JRH A;  3EPZ A;  2D1V A;  2OER A;  3J81 Z;  2K9M A;  3PIP F;  3S1M J;  1IO2 A;  2XPV A;  2YX7 A;  2NVQ J;  3CCS I;  1TT0 A;  2HS5 A;  4PFP A;  3V7S A;  4IXA A;  3VW1 A;  2R7R A;  5F1J A;  3GTO J;  2GOX B;  1XGS A;  2Q1Z B;  3IL2 A;  3HZJ A;  2GM4 A;  2QKL B;  2Z3Y A;  2Y48 A;  4MTE A;  2L7K A;  3PFY A;  1EKE A;  5JLX A;  1SGM A;  1YW9 A;  4NQW A;  2MFZ A;  3NEU A;  1TWG J;  3DFG A;  2BHY A;  2WB1 A;  1GT0 C;  3MVP A;  2V4J C;  1V5E A;  2Z1D A;  3EUH A;  3OS0 A;  4RB0 A;  5H6R A;  1LFP A;  2UXP A;  3M07 A;  1Q1H A;  3I5U A;  3FXO A;  3GF2 A;  4S05 A;  1IRF A;  2STT A;  2E19 A;  2QBY B;  3EQL F;  2E5N A;  3GLX A;  5IP6 A;  2IW5 A;  5CPR B;  2PMH A;  3RKY A;  3LAP A;  3U9G A;  4GRI A;  1CQT A;  1EH8 A;  5GAD J;  3ML6 A;  3GVA A;  4PJL A;  2E1M C;  2Q0O A;  3LQR A;  1YS6 A;  5HLH A;  2NP5 A;  2W53 A;  2K9Q A;  1JJ8 C;  4HSR A;  2DO7 A;  3FIW A;  3BRO A;  5JHF A;  5CW8 A;  4XM3 A;  5EJC A;  2ZOZ A;  4LK1 F;  1ZG5 A;  3M8F A;  3ZP5 A;  1IW7 F;  4JBA A;  4NBQ A;  5FLX K;  2HPM A;  1RKT A;  3NS4 A;  4E7H A;  1XDU A;  1VQM I;  4FE4 A;  1FJL A;  4WXC A;  1U6G A;  4M73 A;  2PI0 A;  2KIQ A;  5LLQ A;  3F8C A;  2AS5 F;  3HPH A;  3RQ4 A;  4IPA A;  1N78 A;  2R5Y B;  1FP2 A;  5FD6 A;  2PZ9 A;  1D0X A;  3GTP J;  2P5K A;  1KU3 A;  1IN4 A;  3VPR A;  5FKM A;  1A31 A;  3LSP A;  3F22 A;  1Z77 A;  2P5L C;  1BOB A;  3I71 A;  3I58 A;  1VTN C;  2QZ8 A;  1YYV A;  3CUQ B;  3M1C A;  4XN0 A;  4XSX F;  3G7R A;  2ISZ A;  2KIM A;  3QU6 A;  1X4P A;  3MKW B;  4A0X A;  1XPX A;  4NN1 A;  2E2I J;  3JCU C;  5D8K B;  1IN7 A;  3VVZ A;  3QRF F;  4RGU A;  2ZCM A;  3B6C A;  5KAF C;  3TL4 X;  5DS9 A;  2VOD A;  5EGO A;  4I02 A;  2FF4 A;  2ZBK A;  4IRH A;  1HW2 A;  1BI2 A;  1MMG A;  2VQH A;  3FMQ A;  3GCM A;  4LIV A;  4DZP A;  1W5S A;  2W85 A;  2DPD A;  2EJR A;  3H3Z A;  3Q0W A;  4LFU A;  4MLO A;  3RKQ A;  3RI4 A;  2ZXJ A;  2K85 A;  3ZMV A;  5CVV A;  1B4A A;  2W48 A;  1X3U A;  2E7W A;  3JW4 A;  1BI3 A;  4XSZ F;  2CV0 A;  2NVU B;  5LGU A;  2DG7 A;  2IA1 A;  1USS A;  2IA0 A;  2L4M A;  4KIC A;  3V78 A;  3CLQ A;  1CF7 B;  2YU3 A;  2IGK A;  4IHY A;  3H35 A;  2WAQ A;  1JKO C;  1YIO A;  3ZQI A;  5EGO B;  2JMW A;  2EIN H;  2KRC A;  1U5T B;  2REK A;  1AWC A;  5TIS C;  3G73 A;  1Z21 A;  3K6G A;  2GIZ A;  1L3L A;  2NVT J;  2LBF A;  4QTR A;  3F8N A;  4GFB A;  3IUV A;  1B9N A;  3BTC A;  2RQP A;  1DGR M;  3V8J A;  2DPU A;  3WU0 A;  4FAS D;  5IYD J;  2Y0M A;  3ZMD A;  2JSC A;  2R7Z J;  2DMU A;  3NPI A;  3GZ5 A;  3KLN A;  4A3G J;  5EEG A;  2VB6 A;  3IC7 A;  5C4X J;  2OUM A;  2HQN A;  4M3D A;  2JA8 J;  1T08 B;  3L2U A;  3HL2 A;  2QLZ A;  2QEX I;  2BOL A;  4GYI A;  2V6E A;  3HIF A;  1KON A;  2EIJ H;  1FP1 D;  4QPO A;  3BR3 A;  1XSX A;  4GCK A;  1GVJ A;  2XRL A;  3S32 A;  2DOA A;  4UUS B;  2QSG X;  3J7A Y;  2UXI A;  1I50 J;  1BL0 A;  2G7G A;  5D5V B;  3FBN B;  1X1P A;  1JHH A;  3ZCO A;  4QWQ A;  4Q48 A;  2ME6 A;  5ERI A;  3D5L A;  4G7O F;  3ON2 A;  5J8C A;  2L02 A;  2IT0 A;  3BC8 A;  4MK6 A;  4M3F A;  1Y1W J;  4PJJ A;  5GTH C;  1EF4 A;  2Y2Z A;  1MJA A;  4HF0 A;  2UXH A;  3BNI A;  3FHZ A;  1A5J A;  1MIJ A;  4YII A;  4X1E A;  3K70 C;  1DP3 A;  3I0T A;  5LHG A;  4EVI A;  3CWR A;  4KIF A;  3BQY A;  4IZZ A;  3DPU A;  3FXJ A;  4M6V A;  2Y31 A;  5E8I A;  5ICE A;  1QU3 A;  4UVA A;  3WTZ A;  1WGX A;  4XLC A;  4EM2 A;  4MFD A;  2XSJ C;  1Z9C A;  4HYE A;  2LVS A;  4FX4 A;  1X1A A;  1JE8 A;  1DU0 A;  3HSR A;  5KK1 A;  2VL8 A;  2MBF A;  4U0Y A;  5J1Y A;  4RGX A;  1LFU P;  2ELK A;  1JKR C;  2EB7 A;  4HNT A;  4B47 A;  1H9T A;  4MHG A;  2G7S A;  2O61 A;  2KDZ A;  2G9W A;  3KNW A;  3OIQ A;  2VQC A;  3B6A A;  4CZC A;  4MQ9 F;  2QYO A;  2ZME C;  1RC9 A;  1WJF A;  3CMA I;  3DPL C;  1VQ7 I;  1R5I D;  3RCO A;  1ZRC A;  2L4A A;  3MFK A;  4GGG A;  4KIG A;  3P9T A;  3KX2 A;  2F5D A;  2VPR A;  1N25 A;  1GVD A;  2ZCX A;  2DYR H;  3DKY A;  3GW2 A;  4HQM A;  4WF2 A;  1YO5 C;  1OYY A;  4ANJ A;  1ZGW A;  3DCF A;  2ZFU A;  3MCZ A;  2JA5 J;  1D5V A;  2ZCW A;  3WU1 B;  1Y56 A;  1BIA A;  4BE0 A;  3JRF A;  1R36 A;  1JTY A;  2WY8 Q;  2ZC2 A;  3FHN A;  2Z9O A;  5IY5 H;  3LFK A;  1KZH A;  4MIM A;  5C4J J;  3DQV C;  3GTQ J;  2R93 J;  1O57 A;  3HTA A;  2KRF A;  1YW7 A;  2WAF A;  1UB9 A;  3HRM A;  4YFN F;  4DVY P;  3E3V A;  3NWT A;  4C2U A;  2EQR A;  1U3E M;  1GLN A;  2XAQ A;  3SZG A;  2GZW A;  3M8J A;  5JFR A;  5L3B A;  5HAW A;  1WQ2 A;  3IV5 A;  5FLM J;  1WSU A;  3GEU A;  2O6G E;  2DAO A;  3FM3 A;  1FNN A;  4HX8 A;  3PFI A;  2DI3 A;  5LRS A;  1QQI A;  3RZO J;  2EBI A;  2JSP A;  3KP2 A;  2HTS A;  1WFX A;  3W6K B;  3F6V A;  3EUP A;  5J1R A;  3F72 A;  4ASN A;  1W36 D;  3K1P A;  2YU9 J;  3W2A A;  2HNH A;  1TNS A;  3WTU C;  4BE1 A;  2HEO A;  3WE3 A;  3MN2 A;  1I1S A;  4EGY A;  5ED4 A;  5K58 A;  4XBF A;  3GWZ A;  4RAZ A;  2VJ5 A;  1FY7 A;  1XGN A;  1BBY A;  4HKU A;  2DT6 A;  5AQC A;  5D1R A;  2BEO A;  1IF1 A;  3FM5 A;  1J0R A;  2YS9 A;  3D0S A;  4G8X A;  4GCV A;  4EV0 A;  4D7N A;  2CW0 F;  5IT9 K;  3PPB A;  3TO6 A;  2R7X A;  3CCV I;  5E1W A;  4PJN A;  2VJ4 A;  5FRO A;  4RB2 C;  4GCL A;  5A2Q K;  5E1X A;  3KP7 A;  2VC1 A;  3P5J A;  3M4O J;  2EFQ A;  1OLT A;  3M3Y J;  3TDZ C;  4IJA A;  2HKX A;  1FIA A;  1ZR4 A;  4L18 B;  5HNF A;  3C18 A;  3OMY A;  2NXN B;  4PSX A;  4Y4R A;  2AXT C;  5F27 A;  3RDI A;  3BPX A;  4HRI A;  4IHW A;  1FEX A;  4HBL A;  2A6T A;  1QPI A;  1NG6 A;  1V54 H;  1ONV A;  4WX9 A;  1UG0 A;  3G56 A;  4C2T A;  1MH3 A;  2Y0S A;  2CFO A;  1FOW A;  2CQK A;  4AC0 A;  2PMU A;  3DBL B;  1F1Z A;  3ZQQ A;  1XCB A;  3JRC A;  3E7L A;  3CJQ B;  4H4K C;  5J6X A;  3DPJ A;  3RSN A;  3D1N I;  1GHC A;  4JL3 A;  1ON2 A;  1YJW I;  2OQR A;  2QWW A;  3ZQ7 A;  2FRH A;  4AU7 A;  3JSO A;  2V9V A;  1J75 A;  1ETX A;  5LBQ A;  2ZOY A;  2H6C A;  4A3F J;  3OYK A;  5DCM A;  1PP7 U;  1FBS A;  2FQ3 A;  4HEA 2;  3CD6 I;  3HGG A;  5KAI C;  5HS9 A;  3OYA A;  2HVQ A;  2JPB A;  1FSE A;  1IV6 A;  3CUQ C;  3UNG C;  2O5R A;  2FMY A;  2QF7 A;  4AVP A;  4CGZ A;  2ZNZ A;  2DU9 A;  3K4N A;  4P9U A;  2QQ9 A;  2XAG A;  3JAM K;  3F6O A;  1DPU A;  1XDS A;  5HBU A;  2XF5 A;  3A01 A;  3VYT B;  3FX3 A;  3S2H J;  5AIQ A;  5DD4 A;  1QZZ A;  3KET A;  1T39 A;  2ZJ2 A;  4A6E A;  2KRH A;  2VI6 A;  3T8R A;  3BQZ A;  1O7F A;  3CCL I;  4XNF A;  1S29 A;  1QZE A;  2L5Q A;  2XF6 A;  4A3B J;  1VF9 A;  2OC6 A;  4KMF A;  3I59 A;  2BYV E;  2EFN A;  2HQ5 A;  5HNH A;  1MBE A;  4UV8 A;  1FLI A;  5BS6 A;  4F91 B;  4V2F A;  3KEY A;  1UCR A;  3F8F A;  3W6J B;  3ULQ B;  1W0U A;  4CYD A;  2M8G X;  3A01 B;  3HOY J;  2DG8 A;  3BHQ A;  3HJE A;  1HKT A;  4DJA A;  4A3M J;  3OY9 A;  4UNO A;  1JXS A;  4EAT A;  5B1A H;  1SFO J;  1VQ5 I;  3RYP A;  4F7Z A;  1NK3 P;  3HKZ A;  4I98 B;  2E60 A;  3PNV A;  1BN5 A;  1UFM A;  3WTS C;  3KP4 A;  3QWL A;  1ENH A;  4YIR X;  1IUY A;  3QP5 A;  2R7S A;  5J40 A;  4DZJ A;  1ZRF A;  3CJD A;  1UHM A;  2W4S A;  3ECH A;  4PUS A;  3GTG J;  2R3S A;  1EH6 A;  3CF5 F;  4HX4 A;  2VBY A;  1TW2 A;  2F5C A;  2ZXH A;  2R7O A;  2VIX A;  1KQ8 A;  1RR7 A;  3IH3 A;  1ETY A;  3G3Z A;  3RZD J;  2J5P A;  1F43 A;  1MMN A;  1V5G A;  2M30 A;  2ECB A;  3K1M A;  5BNG A;  2M1B A;  2QEN A;  3JRG A;  1G59 A;  4OU0 A;  5DDG A;  3J7A O;  1ZHF A;  2EFP A;  5J3L A;  1R5G A;  2ID3 A;  4OIR F;  1OKR A;  2F5V A;  5IPA A;  2PBI A;  2BVL A;  4N0B A;  3BJO A;  3FK6 A;  2W00 A;  2XKP A;  2DJN A;  1ZYR F;  3MKZ A;  3CO6 C;  2I10 A;  4TV7 A;  1UG2 A;  1S8N A;  2YR2 A;  3PO3 J;  2H94 A;  2VT3 A;  2V1U A;  5FHP A;  4U0W A;  3J80 K;  1B8I B;  2LD5 A;  3E5Q A;  4Q47 A;  4RAY A;  3TKY A;  1MBG A;  3V6G A;  4WXD A;  1SEU A;  1O7L A;  4O6J A;  4XN3 A;  1S3J A;  3EGQ A;  2FU4 A;  5E8G A;  4RLQ A;  3P9C A;  3GXO A;  2GA2 A;  1YX5 A;  2BW3 B;  2DFF A;  3GTL J;  3KYC B;  2CYY A;  1TW3 A;  1ACI A;  4LB6 B;  3EDP A;  4FE7 A;  4EGZ A;  3L00 A;  3IAM 2;  2X1D A;  1ZAO A;  2PQ8 A;  4RB3 C;  3BP8 A;  1PUF A;  1QVU A;  4XRS A;  2EFW A;  1LEA A;  3ZPL A;  4L9T A;  3ECO A;  3IUO A;  4M3B A;  3RYR A;  5D5W B;  3EYI A;  2HOT A;  1J9I A;  5F0C A;  4OIQ F;  1H0M A; 
#chains in the Genus database with same CATH homology
 1SGM A;  5JLX A;  1X2N A;  2HYJ A;  3A03 A;  1Z0X A;  4JX5 A;  2OI8 A;  3KKC A;  3PAS A;  4KWA A;  4Y7N J;  4GFK A;  1TWG J;  2NS7 A;  3LOC A;  1GT0 C;  3MVP A;  4W97 A;  2XB5 A;  1H88 C;  4A3J J;  4A93 J;  5HOD A;  2WB1 N;  3WHB A;  3HOU J;  4DZJ A;  4RBO A;  2UXP A;  4G12 A;  2M0C A;  3NI7 A;  1HCR A;  5M5X J;  4M3E A;  1WH7 A;  2E19 A;  4D5C A;  5IP6 A;  4DYR A;  1UI5 A;  1ETW A;  2O8K A;  4S0H B;  1K61 A;  1CQT A;  2XGD A;  3BR5 A;  1R9T J;  1S7E A;  2DTZ A;  2W53 A;  2NP5 A;  1BW5 A;  5GPA A;  2K9Q A;  3HTH A;  1JJ8 C;  4UDS A;  3FIW A;  3IH2 A;  4EEF G;  5CW8 A;  2ZOZ A;  3WHC A;  2FD5 A;  1AHD P;  4BY1 J;  2JJ7 A;  4GFL A;  1TC3 C;  1JUS A;  2HDD A;  3MKL A;  1TWF J;  1JKQ C;  2XDN A;  4C2M J;  3QQA A;  4LOC A;  2H8R A;  4ICH A;  1RKT A;  4J19 A;  4FE4 A;  1E3O C;  1FJL A;  4ME9 A;  2DA3 A;  1HDD C;  4DYC A;  1ITY A;  2HOS A;  2EZH A;  2CJJ A;  4MO7 A;  3COL A;  1LE8 A;  2P81 A;  1RET A;  2LLK A;  5M3M J;  2R5Y B;  1HOM A;  2PZ9 A;  3GTP J;  1D5Y A;  1TWA J;  3JSJ A;  1U9N A;  3VPR A;  5FKM A;  5FKN A;  3LSP A;  1ZQ3 P;  2PBX A;  4JKZ A;  5FKO A;  1Z77 A;  1MBF A;  1LFB A;  2IEK A;  3HOV J;  3S2D J;  2R5Z B;  2GUH A;  3L1P A;  1OJL A;  2JA7 J;  3G7R A;  2LTP A;  4CYC B;  4NN1 A;  2E2I J;  4M3G A;  2M34 A;  1AKH B;  3VVZ A;  2XSD C;  1QVT A;  3TED A;  4A3K J;  2ZCM A;  3B6C A;  5K7F A;  2V57 A;  1T33 A;  5E3M A;  1X2M A;  5M3F J;  3KZ9 A;  5DS9 A;  3BTJ A;  5EGO A;  3CMY A;  3HB9 A;  4DZP A;  2DA4 A;  3F1B A;  3Q0W A;  1WPK A;  4MLO A;  5JLW A;  3LWJ A;  3RKQ A;  1IJW C;  2HKU A;  2M2E A;  2X6O A;  3Q3S A;  2W48 A;  3H0G J;  3OSF A;  3BCG A;  3HOZ J;  1JT0 A;  2DG7 A;  2K9S A;  5EZH A;  4AUX A;  3V78 A;  5EEA A;  3ZOB A;  4B1R A;  4IHY A;  3FRQ A;  3SJM A;  1OFC X;  1JKO C;  3ZQI A;  5EGO B;  2JMW A;  2VKV A;  4I76 A;  3JRB A;  1BJZ A;  2REK A;  3ZQF A;  5GPC A;  3FIS A;  2E2H J;  2X48 A;  2WAQ N;  1ZTR A;  4QSH A;  5IP9 J;  1HLV A;  4IHX A;  3G1L A;  1DU6 A;  2EH3 A;  4DW6 A;  2NVT J;  4QTR A;  2CUF A;  5IOY A;  3BTC A;  3GTJ J;  4GFB A;  4C3J J;  3S16 J;  2XGE A;  3IUV A;  3BR1 A;  5M5W J;  2O9L A;  4Y52 J;  3FKI J;  1XS9 A;  3VW2 A;  5IYD J;  2R7Z J;  1U9O A;  2DMU A;  3JRA A;  2VUM J;  3NPI A;  4A3G J;  1U78 A;  1P7I A;  2FJ1 A;  2DMT A;  2NOG A;  2DA6 A;  3CDL A;  5HSZ A;  5C4X J;  5E3N A;  1UMQ A;  1GV5 A;  4XIC A;  1VND A;  1W0T A;  4M3D A;  2JA8 J;  3JRD A;  4IHV A;  5CXI A;  3LSG A;  2Y9Y A;  1I6H J;  4NEL A;  3W6V A;  2L0K A;  3BRU A;  2PMZ N;  2KT0 A;  3BR3 A;  4GCK A;  3S1R J;  1IC8 A;  5D19 A;  2XRL A;  2TRT A;  3HM5 A;  2WV1 A;  4UUS B;  3S14 J;  1I50 J;  1BL0 A;  2UXI A;  2G7G A;  2EZI A;  1JUM A;  2GBY A;  4FIS A;  2ME6 A;  3ON2 A;  2QCO A;  3VUQ A;  4MK6 A;  4M3F A;  4ACI A;  1Y1W J;  2DMN A;  1HDP A;  1PUF B;  1EF4 A;  1JT6 A;  2Y2Z A;  3SDG A;  3BNI A;  2UXH A;  5FMP A;  1TWC J;  1A5J A;  5E3L A;  1P7J A;  4X1E A;  1IG7 A;  1GUU A;  3FK7 A;  2HXO A;  2O7O A;  4C3H J;  1WH5 A;  2CUE A;  5EG0 A;  2Y0S N;  3CWR A;  4JNN A;  2DN0 A;  3BQY A;  3TW6 A;  4M6V A;  2Y31 A;  2WUI A;  3HOW J;  1WGX A;  2DA7 A;  2O7T A;  4MFD A;  2ZCN A;  2Q24 A;  1JKP C;  2LVS A;  4FTH A;  1DU0 A;  3HGY A;  4DYQ A;  2AHQ A;  5J1Y A;  1LFU P;  2ELK A;  2ZB9 A;  1JKR C;  3VW0 A;  5FLV A;  1XC5 A;  3Q0V A;  2LFB A;  4JX4 A;  2G7S A;  2HXI A;  5FJ8 J;  2RHA A;  4XRM A;  2KDZ A;  1B72 A;  3GZI A;  3KNW A;  4MFE A;  1RKW A;  3K7A J;  3B6A A;  3ZQL A;  1O4X A;  1ZR2 A;  2EZK A;  3BR6 A;  5EDN A;  3CQZ J;  3KKD A;  1F36 A;  5EFY A;  3P9T A;  3QBM A;  2H1K A;  2VPR A;  1GVD A;  2ZCX A;  4A69 C;  1MBK A;  1ZGW A;  2L7Z A;  3DCF A;  2NX4 A;  3Q0U A;  3BJB A;  1ETK A;  2JA5 J;  3JRI A;  4B3A A;  2NVY J;  2LKX A;  1B72 B;  2R0Q C;  3JRF A;  4JP0 A;  4C3I J;  1JTY A;  1YRN A;  2QKO A;  5C4J J;  4MIM A;  3ANG A;  3A02 A;  3GTQ J;  2K40 A;  2E2J J;  3S5R A;  2G7L A;  2R93 J;  2F07 A;  3HTA A;  1LE8 B;  3BTL A;  2DMQ A;  5F0F A;  4GCT A;  3G1M A;  3NRG A;  2COB A;  5D18 A;  4I6Z A;  2EQR A;  3GTK J;  5HAW A;  3CCY A;  3IV5 A;  5FLM J;  4FCY A;  5EZG A;  3GEU A;  3I4N J;  1ZKG A;  3QPS A;  1YRN B;  4XID A;  2D5V A;  2JA6 J;  2Y9Z A;  2IU5 A;  5F08 A;  1VFC A;  4BY7 J;  3RZO J;  2EBI A;  1UHS A;  3F0C A;  2UXU A;  3O8H A;  4XK4 A;  3HTJ A;  3EUP A;  2QOP A;  5C3E J;  5IOZ A;  5J1R A;  3VP5 A;  4BKX A;  3VVY A;  1MSE C;  2CU7 A;  1QRY A;  3LHQ A;  3ZQH A;  1NK2 P;  2YU9 J;  3ON4 A;  5M5Y J;  4XRS G;  3HOX J;  2Y30 A;  2QTQ A;  1GV2 A;  3MN2 A;  2K9N A;  5K58 A;  3BTI A;  1B8I A;  5E3O A;  2R92 J;  3AQT A;  1UI6 A;  4HKU A;  2ECC A;  5DAJ A;  5AQC A;  5D1R A;  2EZL A;  3DEW A;  1VI0 A;  2YS9 A;  3BR2 A;  1IDZ A;  3TP0 A;  4D7N A;  3B81 A;  3LJL A;  1XG1 A;  3PPB A;  4B4C A;  2G0E A;  1H8A C;  3MNL A;  1A6I A;  1K83 J;  3QPL A;  2L7F P;  2CQQ A;  3VOX A;  4GCL A;  4PXI A;  1ORK A;  5FKL A;  3JR9 A;  3M4O J;  3NXC A;  2LK2 A;  4D7M A;  3M3Y J;  1IDY A;  1FIA A;  2MGQ A;  1ZR4 A;  1GDT A;  2YUS A;  3NNR A;  1JTX A;  1ZK8 A;  2X9D A;  2LY9 A;  1SAN A;  5F27 A;  1H89 C;  3S15 J;  2JK3 A;  4IHW A;  2XPU A;  1MBH A;  2LR8 A;  3I4M J;  2CQX A;  1FEX A;  1QPI A;  4BXX J;  2G3B A;  3IH4 A;  3S1Q J;  2RAE A;  2YVE A;  3T6N A;  3K2A A;  1Q1V A;  2B63 J;  3G56 A;  1JUP A;  3BG3 A;  3VOK A;  2MSY A;  1MH3 A;  2AO9 A;  4BBR J;  5IYB J;  4AC0 A;  3CRJ A;  2FBQ A;  3S1N J;  4AC6 A;  3BG5 A;  4RDU A;  3E7L A;  1ETQ A;  3JRC A;  3DPJ A;  3D1N I;  1WI3 A;  2GEN A;  4JL3 A;  5K7Z A;  2CRG A;  2GFN A;  3C07 A;  4W1U A;  1ETX A;  1TWH J;  2RAS A;  1WCM J;  1FIP A;  2ZOY A;  3VIB A;  4L62 A;  3OIO A;  2GLO A;  4A3F J;  4NDL A;  3E7Q A;  2IBD A;  5EYR A;  3HGG A;  3H3V K;  2UXO A;  3PM1 A;  3OOU A;  3BG9 A;  1MSF C;  1IV6 A;  4ABZ A;  5EG0 B;  4BBS J;  2L9R A;  2QF7 A;  4V2G A;  1AU7 A;  4A3C J;  1IGN A;  2XPW A;  2JWT A;  3G1O A;  4AYB N;  1POG A;  5F0H A;  5C4Y A;  2R5Y A;  3OSG A;  5HBU A;  5H9T A;  3A01 A;  3S2H J;  3S17 J;  1ETO A;  3SFI A;  3C2B A;  2VI6 A;  3BQZ A;  4AF5 A;  4CGR A;  3BR0 A;  4A3B J;  5GP9 A;  2WGB A;  1VF9 A;  4JYK A;  3ZQG A;  2R5Z A;  2HQ5 A;  5IP7 J;  1MBE A;  5IYC J;  4CYC A;  2NS8 A;  3O8G A;  1Y1V J;  2M9H A;  4V2F A;  1AKH A;  1W0U A;  3BHQ A;  2M8G X;  2TCT A;  3RQI A;  3A01 B;  2ME0 A;  5C44 J;  3HOY J;  2DG8 A;  4YZE A;  4A3M J;  1JJ6 C;  3RH2 A;  4JX6 A;  5EF6 A;  2OPT A;  4IEJ A;  1SFO J;  3BT9 A;  1NK3 P;  2NP3 A;  5FGL A;  4A3E J;  3HIM A;  2VKE A;  3HDD A;  1ENH A;  5CXG A;  5J1U A;  2MG4 A;  3HKZ N;  2QWT A;  1FTT A;  3HTI A;  3HE0 A;  1IUF A;  2FQ4 A;  3CJD A;  3ANP A;  1MH4 A;  3VVX A;  3LNQ A;  3GTG J;  1T56 A;  1NTC A;  3ZQC A;  2XB0 X;  3LSJ A;  5K7H A;  1JGG A;  3AQS A;  3QKX A;  1ETV A;  1RPW A;  2IAI A;  1RES A;  1RR7 A;  4X6A J;  3UKG A;  3HEF A;  1ETY A;  3IH3 A;  5FKK A;  3RZD J;  2DA1 A;  1MNM C;  1F43 A;  4L5E A;  1MBJ A;  2LP0 A;  1FTZ A;  2ECB A;  5BNG A;  2HOA A;  2DMP A;  1BA5 A;  2MW8 A;  2N8G A;  3JRG A;  3GTM J;  1IRZ A;  1G2H A;  9ANT A;  2E1O A;  2XGC A;  5J3L A;  2ID3 A;  1U8B A;  3LSR A;  5IPA A;  3FK6 A;  3NAR A;  1BW6 A;  4A3I J;  2DJN A;  1OCP A;  2ID6 A;  3HBL A;  2I10 A;  2QIB A;  1UG2 A;  1HF0 A;  3PO3 J;  2HI3 A;  3JRE A;  1APL C;  4A3D J;  3RD3 A;  5FHP A;  1B8I B;  3TP3 A;  5DTD A;  2LD5 A;  5F04 A;  2HYT A;  1MBG A;  3V6G A;  4QIW N;  2OF7 A;  2DA2 A;  3EGQ A;  4D5F A;  4UUT A;  2D6Y A;  4HNV A;  2JN6 A;  4UUS A;  2DA5 A;  3GTL J;  1OCT C;  3GBG A;  3JRH A;  1I3Q J;  4FE7 A;  2OER A;  3O60 A;  3S1M J;  2FX0 A;  2L7M P;  1PUF A;  1X58 A;  2XPV A;  1QVU A;  4XRS A;  2YVH A;  3TW7 A;  2NVQ J;  4M3B A;  3NAU A;  2NVX J;  3VW1 A;  3PO2 J;  4A3L J;  5F1J A;  3GTO J;  2HOT A;  5F0C A;  2GM4 A;  4MXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...