5F27A

Structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 2 at 1.68a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
187
Chain Sequence
DRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title A fragment merging approach towards the development of small molecule inhibitors of Mycobacterium tuberculosis EthR for use as ethionamide boosters.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 80
structure length 187
sequence length 191
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5f27A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5f27A02
1ZGWA 3QBMA 2E2JJ 3BHQA 1OCPA 3EGQA 1UI5A 1G2HA 2D6YA 4ABZA 2ECBA 5EG0A 2ID3A 2GENA 1B72B 1UI6A 4HNVA 3RKQA 3C07A 3Q0VA 2R5YA 2ME0A 3CMYA 2R92J 3ANPA 2WB1N 1LFUP 2OF7A 2FX0A 1IDYA 3HOUJ 4A3FJ 3LNQA 5IP7J 3IV5A 5M5WJ 5J1RA 1T33A 4FE7A 4A3GJ 5J3LA 1H8AC 3RH2A 4RDUA 4M6VA 5HBUA 4JP0A 3ZQGA 1VFCA 1B72A 2CU7A 3BR3A 1MSEC 4S0HB 2D5VA 3MKLA 3VVYA 3NNRA 4UDSA 2Y31A 1ITYA 3DPJA 2XRLA 3I4MJ 1POGA 4IHXA 3S16J 2DA1A 3OSFA 1JKRC 1WPKA 3FK7A 2YVHA 3FIWA 4I6ZA 1B8IA 2CRGA 1GUUA 4D5FA 3CJDA 4LOCA 3VIBA 4FE4A 1LE8B 4BXXJ 2R5ZB 2QWTA 1JT0A 3ANGA 4AYBN 2L0KA 2NVQJ 2YVEA 3VW2A 1BJZA 2XPUA 3IH2A 3D1NI 1WCMJ 3GZIA 2R93J 3ZOBA 2VUMJ 3LSPA 1EF4A 3GTLJ 3BG9A 3COLA 3VUQA 5EEAA 1X2NA 3HOVJ 1BW5A 2NX4A 2R5ZA 1JUSA 3VPRA 1FTTA 2IAIA 2NS7A 2VI6A 2Y0SN 5IPAA 5DAJA 1AU7A 3WHBA 2NVYJ 4XRSA 2XGCA 2ZOYA 3W6VA 4AC6A 1UG2A 1MBKA 1X2MA 4EEFG 1I3QJ 3A01A 4FTHA 2M8GX 2N8GA 3HTIA 5C3EJ 4NDLA 1FIAA 1GV2A 3L1PA 3QPSA 5F0CA 3E7QA 1XS9A 2HKUA 1JTYA 1JT6A 2K9NA 3ZQFA 4HKUA 2LFBA 1ETXA 1IG7A 3TEDA 1OCTC 3OSGA 5JLWA 3V6GA 2DA4A 4JKZA 2FQ4A 3Q0WA 4GCTA 3M4OJ 1Y1VJ 2G7LA 3EUPA 2QTQA 1QVUA 2PZ9A 2GFNA 2M9HA 3HTJA 4M3EA 3K7AJ 1XC5A 3G1MA 4MIMA 5FJ8J 3QQAA 2QOPA 3HTAA 5EGOB 3B6CA 4MFEA 4B3AA 2WGBA 3OOUA 4Y7NJ 3AQTA 4DZPA 2F07A 3QKXA 4C3HJ 4GCLA 5J1UA 1Y1WJ 4M3FA 2DG8A 2TRTA 2OI8A 3LWJA 3CCYA 4MXMA 1ETYA 5IYCJ 2XDNA 5K58A 5H9TA 1MBFA 4G12A 2ZCMA 3CRJA 1NK2P 4KWAA 4ME9A 2EH3A 3LSRA 2GBYA 2FBQA 3HTHA 3VOKA 3I4NJ 1IJWC 3HEFA 2YUSA 2REKA 3BRUA 2XPVA 5E3NA 5FHPA 2E2HJ 5EF6A 2GLOA 3LJLA 3HDDA 2O9LA 2RAEA 1TWGJ 2LD5A 1HF0A 1I6HJ 1U9OA 3VVZA 2NOGA 4A3KJ 5C4XJ 1JJ8C 2HYTA 3E7LA 4ACIA 3SDGA 4GFKA 5D18A 3BR0A 2LK2A 5DS9A 2XSDC 3JREA 5M5YJ 1X58A 3LSJA 4I76A 3IH4A 1A5JA 2R7ZJ 4MFDA 3NXCA 1E3OC 2DJNA 2WUIA 3JRDA 1TC3C 3S2HJ 2XGEA 3PPBA 3NRGA 4MLOA 3SJMA 2UXIA 5CXGA 4X1EA 2JWTA 4A3BJ 2W53A 1UHSA 2M34A 2DA6A 1MNMC 1FTZA 3BCGA 3HOXJ 4A3MJ 2OPTA 2DA3A 3LOCA 1H88C 1RETA 3GTJJ 3BQYA 4A3LJ 2O7OA 2G7GA 3RZOJ 3OIOA 2H1KA 2X9DA 2G3BA 2K40A 4AC0A 3S1QJ 4C3JJ 4DZJA 2DG7A 1MH3A 1QVTA 1B8IB 3RQIA 4A3IJ 4AUXA 2E2IJ 1D5YA 1ZQ3P 4A93J 5EZGA 5FKLA 5CXIA 3TW7A 1O4XA 1AKHA 5C4YA 3TP0A 3QPLA 2HYJA 3JRCA 3S14J 4NN1A 2NP3A 1K83J 2PBXA 3CWRA 1ORKA 3GEUA 3WHCA 2NVXJ 2MSYA 3M3YJ 2AO9A 2ME6A 2X48A 3MN2A 3ZQLA 3JRIA 3NARA 3B81A 5IP6A 2O8KA 3P9TA 1SGMA 2O7TA 3SFIA 3MNLA 1APLC 1W0UA 3RD3A 2XGDA 5FKMA 2KDZA 4L62A 1RESA 4V2GA 1TWHJ 5GPAA 2NVTJ 3A01B 1PUFB 3UKGA 3HIMA 4Y52J 3A02A 5GP9A 1Z0XA 4UUSA 2JK3A 1IUFA 3V78A 2UXPA 2HOTA 2EBIA 5EFYA 2CUEA 1JKQC 3BR6A 2E1OA 5HSZA 3O8HA 4A3JJ 4FCYA 2M2EA 3NPIA 2FD5A 3S5RA 1F43A 1JJ6C 5F1JA 1YRNA 5D19A 3BG5A 4M3DA 1PUFA 2ZCXA 2GM4A 4QIWN 1MSFC 1SFOJ 1GV5A 2Q24A 4GCKA 5F04A 2WAQN 1JGGA 2DTZA 5F27A 5M3MJ 1GVDA 1JUPA 2DMUA 1Z77A 2DMPA 3BTCA 4L5EA 2CQQA 1HDPA 3O8GA 4D7NA 4YZEA 2NP5A 3HOWJ 2GUHA 1UMQA 2XB0X 3H0GJ 1MH4A 1LFBA 1NK3P 1OJLA 3HGYA 1JKPC 5JLXA 4A3CJ 3JRBA 3VOXA 4JL3A 1GT0C 2COBA 2ECCA 2HDDA 4IHYA 4JX4A 5M5XJ 3BTIA 3HGGA 1U9NA 2CJJA 5HAWA 3PASA 4JX6A 2ZOZA 2PMZN 2JMWA 1IV6A 3S1RJ 1RKWA 2WV1A 3O60A 4V2FA 3VVXA 1I50J 1QPIA 1FEXA 1R9TJ 2K9SA 2HXOA 3BTLA 1FIPA 1XG1A 1TWAJ 3FKIJ 5FKKA 3TW6A 3HB9A 4DYQA 1JTXA 1T56A 5FLVA 3BJBA 3S17J 2LKXA 1FJLA 3JR9A 2B63J 2L7FP 1DU0A 2XB5A 3F1BA 5F0HA 4IHVA 3VW1A 4M3BA 2OERA 1RR7A 5EYRA 1HOMA 3ON2A 3GTGJ 4DYCA 3B6AA 2VKEA 4XRSG 4X6AJ 2K9QA 2YU9J 2HXIA 3GTOJ 2EZKA 2ZB9A 1IC8A 2MG4A 3Q0UA 2ELKA 2L7MP 5FKOA 2JA7J 3HM5A 1P7IA 2LY9A 3T6NA 5F0FA 3IH3A 3HOZJ 3G56A 5K7HA 5GPCA 3JRAA 1ZR4A 1JUMA 4CYCA 2LVSA 1GDTA 5HODA 3DEWA 2R0QC 4A69C 2JA6J 2JA8J 5FGLA 4JYKA 1HCRA 1K61A 1RPWA 2LLKA 3G1OA 1AKHB 2UXOA 2QCOA 2X6OA 1HLVA 2L7ZA 4IEJA 1ZKGA 1VF9A 4D7MA 4ICHA 2DA2A 1MBGA 3S1MJ 3BNIA 4IHWA 2CQXA 4A3EJ 2L9RA 2M0CA 5K7ZA 1VNDA 1AHDP 2Y30A 4BBSJ 4C3IJ 2HQ5A 2VKVA 1HDDC 3JRHA 2QIBA 4JNNA 3S2DJ 1S7EA 4C2MJ 3IUVA 3KKCA 2DMQA 4FISA 5IYBJ 3JRFA 2E19A 4XICA 1P7JA 1TWFJ 4RBOA 1H89C 4W97A 1CQTA 3K2AA 5M3FJ 2EQRA 3BT9A 4UUSB 1W0TA 1ETOA 3VP5A 1U78A 2MGQA 3LSGA 2IBDA 2NS8A 3GTMJ 5IOYA 2QKOA 1MBHA 1YRNB 3GTQJ 2Y9ZA 4BKXA 2AHQA 4DYRA 1WH7A 3PO2J 5IP9J 5K7FA 9ANTA 1IDZA 3G7RA 5FMPA 1RKTA 3AQSA 1Q1VA 4QTRA 5C4JJ 2QF7A 5E3MA 2HOAA 4NELA 1ETVA 1ZTRA 1JKOC 4BY7J 5E3OA 5C44J 3GTPJ 3BR1A 2I10A 2EZHA 1A6IA 3LHQA 2TCTA 3JSJA 3BR5A 1MBEA 2DA5A 4PXIA 2XPWA 3G1LA 3CQZJ 4BBRJ 5EDNA 3PO3J 2KT0A 3BR2A 1LE8A 1F36A 2G0EA 5J1YA 2DMTA 2W48A 1IGNA 4XK4A 5FKNA 3Q3SA 3FISA 3S15J 1ETKA 1WH5A 2P81A 3HKZN 4MK6A 1SANA 2EZLA 3ZQHA 3S1NJ 3BG3A 5IOZA 2LTPA 3CDLA 2JJ7A 3C2BA 4B4CA 3BQZA 2Y2ZA 1ETQA 2DA7A 3KZ9A 1OFCX 5CW8A 4CGRA 2IU5A 1ENHA 1ZR2A 3DCFA 2Y9YA 2UXUA 3BTJA 2H8RA 2HOSA 3FK6A 1BW6A 2DMNA 2LP0A 2RASA 4GFBA 2G7SA 2CUFA 3RZDJ 4D5CA 3HBLA 2DN0A 2YS9A 1BA5A 5EZHA 5E3LA 2V57A 2JN6A 3H3VK 3NAUA 1WI3A 4DW6A 4QSHA 4XRMA 4CYCB 2IEKA 1QRYA 2VPRA 2MW8A 1ETWA 5IYDJ 4W1UA 5F08A 1ZK8A 5FLMJ 2LR8A 1BL0A 5D1RA 5EGOA 3KKDA 5BNGA 2RHAA 1IRZA 3PM1A 4JX5A 3ZQIA 3A03A 1DU6A 3FRQA 1U8BA 3HE0A 2UXHA 3ON4A 3VW0A 4MO7A 5AQCA 4J19A 4XIDA 4GFLA 3F0CA 3GTKJ 1VI0A 2FJ1A 3GBGA 3ZQCA 1MBJA 4UUTA 4B1RA 1WGXA 2ID6A 3MVPA 4BY1J 5EG0B 2JA5J 3HOYJ 3JRGA 3KNWA 3TP3A 2EZIA 2ZCNA 2R5YB 4AF5A 4M3GA 3NI7A 4A3DJ 5DTDA 1NTCA 1TWCJ 2HI3A
chains in the Genus database with same CATH superfamily
3BDDA 1FMWA 1OCPA 3EGQA 2L7KA 2M3AA 4PK4A 4BUPA 2GQQA 3FXKA 2KRCA 3CC7I 2R7XA 3I0TA 5J47A 2G7HA 4ABZA 2ECBA 4E4HA 5E18F 1N77A 1LB2A 1LKXA 1B72B 4HA8A 3Q0VA 1YITI 2DOFA 3HOUJ 1IDYA 1FPQA 1STZA 1T95A 1BI2A 2V1XA 1T33A 3PNYA 2K3FA 1ZHFA 3KPHA 3M8JA 5B66C 1R5GA 3F21A 1B72A 2CU7A 3BR3A 1FYKA 2BXYA 4S0HB 4BAYA 2D5VA 5H20A 4M9SA 4UDSA 1HSJA 2Y31A 2RREA 3K4CA 4MEYF 2DPDA 1ULYA 1L3LA 2WC2A 3C3WA 3S16J 3K70C 3DP7A 5BPIA 5DCFA 3M9AA 1Y39A 1B8IA 4BXUA 4XLPF 2QENA 1B9NA 1EKEA 1FSEA 1BIAA 2EB7A 4LOCA 4Y3OA 3H36A 5B3SH 1LE8B 2QWTA 4C2TA 4LITA 5HDNA 1J9IA 5EEGA 2DPUA 3ANGA 3QYFA 2NVQJ 1G6NA 2GIVA 2MC4A 3ZQQA 3PIPF 1BN5A 1RNLA 3ZMUA 1YIOA 2XF5A 2KRFA 2OV7A 3ZOBA 2VUMJ 3F3XA 1EF4A 2XV4S 5FFZA 1O57A 1X2NA 1BW5A 1X1CA 2L9SA 4EM1A 4M9XA 2VJIA 4BACA 1VQMI 2NVYJ 2OQRA 3HXLA 1UG2A 1MBKA 3QPHA 4GGGA 1KQ0A 3LSKA 2PMUA 3DBHB 3I54A 3H0DA 3J7AO 2FSWA 2GZWA 4LG0B 1W4MA 2DOAA 3PSIA 5DCMA 5TRDA 4M72A 1SMTA 3P7NA 2GOXB 2CQKA 2DBBA 1FP1D 2ZMEB 1ETXA 5FFXA 1X3UA 4BQQA 3OSGA 5JLWA 1BOAA 4EJTA 2JRMA 2X6XA 3LSTA 3Q0WA 3M4OJ 3ELKA 3J7ZI 4YFKF 1WJCA 1QVUA 2PZ9A 2F4IA 2M9HA 1W1WE 2PMHA 2FQ3A 3K7AJ 3F8FA 4MIMA 4XN3A 3QQAA 3WE3A 3CF5F 5EGOB 2ZMEA 4MFEA 2V1UA 1FBUA 2MABA 3MZ8A 4U0YA 3BJOA 4N9HA 1SC7A 3H9QA 1KQ8A 3CCLI 3ASNH 4M3FA 2L02A 1ETYA 1U5TC 3EYYA 4HQEA 2ZCMA 3D5SC 3BZCA 3S2WA 3CRJA 3AG2H 1J0RA 1IXSB 3ECHA 4Y4RA 5DDGA 3LSRA 1Y56A 4KNYA 3HEFA 1TT5B 2REKA 2E2HJ 1WWXA 3E5XA 2Z33A 3KLOA 3LJLA 1NHAA 3FXJA 2IXSA 4HSTA 3CUQB 1I6HJ 5D6FA 3D5RC 3VVZA 2NOGA 3WG9A 3DLLF 4E6KG 1CGPA 3QP6A 4YFNF 1JJ8C 2RN7A 4ACIA 1WI9A 1KU3A 3DBLB 3SDGA 5D18A 2XSDC 5FGMA 3JREA 1GXQA 3LWFA 1SFUA 2R7ZJ 4HX8A 1OCZH 1QGPA 4RGXA 3JRDA 3OYDA 1MZBA 2HQNA 1TC3C 3HTSB 4CDGA 3CUQA 1QZEA 3KFWX 2MD0A 1T0FA 1T8IA 2Z3YA 2UXIA 2HGCA 5F1RA 4BQNA 2W53A 1UHSA 2M34A 4KT6A 4KIFA 2OQGA 2VKDA 1ON1A 3PSFA 2WB1A 2DJIA 3LOCA 2ZNYA 3BQYA 2G7GA 4QPQA 3Q5FA 3RZOJ 4ZYHA 4RAGA 2XUBA 2G3BA 2BE5F 1MH3A 2LSOA 2IT0A 3WTSC 2CW0F 2DYSH 4A3IJ 4CZCA 4KA4A 2EV5A 2V9VA 1ZQ3P 5FO5A 5IY5H 5CXIA 1UHMA 3S3MA 3PNVA 5C4YA 1DP7P 2V4JC 1O7FA 1VQ7I 2VIXA 4OD4A 1K83J 4OOIA 3L2QA 3U1DA 1P9QC 1PP8F 1QO0D 1ORKA 4XN0A 3WHCA 2NVXJ 4RB0A 3MZYA 3QRFF 3H5RA 1IXRC 3JSOA 4OIPF 1ZLKA 4E7JA 2O8KA 3R61A 3ZMDA 3SFIA 2HTJA 2IP2A 2W1OA 1APLC 1W0UA 3RD3A 4CHUA 5FKMA 1Z7LA 2LKPA 2P6SA 2H27A 4V2GA 5GPAA 1FLIA 1PUFB 3UKGA 4Y52J 2FBHA 4HDUA 2JK3A 3P9IA 2VBWA 3DPUA 2Z9OA 2EBIA 1TZLA 2CUEA 1JKQC 3HKZA 4XMYA 4OMYA 2AQEA 2FD5A 3T8RA 5D4RA 3OYIA 5CJ9A 2GWRA 3O6BB 5D19A 1PUFA 4IPAA 3H5NA 4L9JA 4QIWN 3WGIA 2IGOA 2P4WA 1MSFC 4EJWA 1SFOJ 1IO2A 3FBIB 3CCVI 1SFKA 1KU9A 1R22A 5LHGA 1JGGA 2YR2A 2MH2A 3GFMA 2ESNA 5M3MJ 1Z77A 3V8KA 4CA0A 4LMYA 4BU2A 2KJBA 3BTCA 1V55H 4CCJA 4ZC3A 3O8GA 1YI2I 4BE0A 2K9MA 3RIRA 4MNUA 1MMNA 4OIQF 2G7UA 2R7QA 3J7YJ 1LFBA 2V9PA 5JLXA 4A3CJ 3JRBA 4RB2C 1GT0C 2COBA 2XF6A 3PUFA 5HS7A 3TKYA 3BTIA 3U9GA 1U9NA 4ZTJA 1XTAA 2OZ6A 3DWLE 2DAOA 3IUOA 3ABUA 4MQ9F 4N9IA 2JPCA 1YOVB 3V7SA 3IWFA 3SQNA 2OU2A 3GMEA 2K86A 2EWNA 4Q5SF 1I50J 4G6DA 4LLGF 3OS0A 1FEXA 1R9TJ 2BVLA 2K9SA 3BTLA 3V7CA 1FIPA 3IL2A 3TO9A 2BXZA 4DYQA 3A2KA 2KHMA 3ZMZA 4AU7A 1R36A 1SFEA 5E1ZB 3VW1A 2EFPA 1U5TB 2QKMB 3IAM2 4NBQA 1SVOA 1XDSA 4BNCA 5HLHA 2K9QA 1RI7A 3GTOJ 3R60A 4BJ6C 2CV1A 2MG4A 3DKYA 2DT7B 4NC8A 4ZYDA 2ELKA 2IRFG 1IN8A 3R4KA 1O3QA 2ELJA 2E36A 2DI3A 3IH3A 5F0FA 1TBXA 5JHFA 3LAJA 5GPCA 1NH3A 1X1PA 2LVSA 4A69C 2JA6J 2JA8J 2Z2SB 4U0VA 1RPWA 3LQRA 2LLKA 3G1OA 4AM3A 3W3CA 1G4DA 2XDVA 3MAJA 2K5CA 1S8NA 3A4CA 3H3ZA 3N4MA 3KP4A 1QPMA 3BROA 3HSFA 2KZGA 2DA2A 2AS5F 1XSXA 2LDUA 4UV9A 2CW8A 3S1MJ 1D8KA 4AIJA 3RQ4A 1UELB 3OYFA 1VNDA 4XR6A 4C3IJ 3BG7A 3JRHA 2QIBA 2FXAA 2HS5A 3KKCA 3IUVA 4FISA 5IYBJ 5J4VA 2FF4A 2LBFA 2E19A 3OY9A 3MZHA 3BP8A 3CZ6A 4RBOA 3DEUA 4U88A 1CQTA 3E3VA 1X4PA 3FF5A 3BT9A 3DF8A 2UXXA 5E1WA 3OYJA 4P96A 2H1LA 1U78A 2VBXA 1KQ9A 3FXUA 3KP2A 4XLAA 1VQ4I 2QKOA 3DTKA 1XSVA 1T6SA 1HXDA 1E3HA 2DT6A 2VBYA 2AHQA 1BM9A 5ICCA 5DM7F 1BJAA 5K7FA 1FMVA 4IF4A 9ANTA 3FHNA 1XMXA 3CCJI 2DDBA 5AONA 4QTRA 2OD5A 5C4JJ 2FBIA 5E3MA 3GW2A 4NELA 1PYVA 2KIFA 4PGHA 5CVJA 1Z7UA 2VT2A 4KN4X 3EUKL 5CQGA 4ASNA 4IJAA 5E17F 2XC7A 3KYDB 2OBPA 2BZTA 2ISYA 2OCCH 3B02A 3G1LA 2E1NA 4JK1X 5L3GA 4FASD 3PO3J 2KT0A 1F36A 4LFUA 2IGNA 1B1BA 2W48A 4UNOA 3CJQB 4ON0A 5FKNA 1VQ5I 3LL7A 1TQPA 3OS1A 2GXAA 2P81A 3HKZN 2QVOA 2QUFA 3BG3A 1X1BA 3U1KA 4J00A 3RKYA 4B4CA 3C2BA 1QBJA 3BQZA 2Y2ZA 3H9GA 3LFUA 4XNFA 1DPRA 1OFCX 2QYOA 2WWYA 3KZ9A 1I39A 1SD5A 4JBAA 4CGRA 4B43A 5CVVA 3WTWC 4XBFA 5FRMA 2L4AA 3DCFA 3HYIA 3QOPA 2Y9YA 2QM3A 2ZXWH 4QWQA 1JI8A 2MYSA 2NRAC 3BTJA 2OCEA 2H8RA 3O2PE 3VWBA 4ZZLA 1U0JA 1BW6A 4A12A 2L54A 2VJ5A 2G7SA 4C9YA 5K5QA 3ZR8X 3CESA 3RZDJ 3HBLA 1W36D 4UB8C 1I27A 2D1HA 4FT8A 4O3MA 5GAEJ 2QLZA 5CVRA 1R6RA 4M6XA 1HKQA 4YEJA 2YX4A 4BJ5C 1WI3A 2FE3A 1LJ9A 4CYCB 2J5OA 3KZYA 4D9JA 1ETWA 1WJ5A 1X1AA 4W1UA 2ZXHA 5F08A 2LR8A 2FA5A 1BL0A 5D1RA 1X1DA 3SWHA 2MA3A 2RQPA 5BNGA 2QKLB 2RHAA 1IRZA 4OMZA 2R7WA 4U0WA 2DLLA 3DTEA 1EA3A 1D1CA 3G3ZA 3FHZA 4MO7A 1JE8A 4J19A 3RTRA 3F0CA 3AKZA 1VI0A 1S72I 1IV8A 2FJ1A 2V7FA 1YW8A 4QPOA 5AIQA 4B1RA 1OYWA 4BEHB 2A3SA 2JA5J 1BI1A 3HOYJ 4M73A 3KNWA 3TP3A 2BOLA 2EZIA 3CC4I 3VODA 3EDPA 4ETSA 4BHPA 3J81Z 4XKVA 3JAMK 1R00A 3W2VA 3QBMA 3AG4H 3CMAI 3BHQA 4M71A 2JPBA 2W82A 3ZGKA 2D6YA 2ETHA 2GENA 4AIHA 2FOKA 1O3SA 3RYPA 4HQMA 1XCBA 2XAUA 3CMYA 2VL8A 5E20A 1VQ9I 1LFUP 2OF7A 5HVQC 1J2XA 4A0XA 2HVRA 3LNQA 3WTTC 3I56I 2PEXA 5M5WJ 3HTUA 5J3LA 1KONA 5JFRA 2LREA 1IUYA 4JP0A 4DBQA 3ZQGA 1TL8A 2OTLI 1BC7C 2F5VA 3F8BA 3KYCB 5JVTA 3BC8A 3EQLF 5GAHJ 2P7VB 3E0JB 3VVYA 5LBQA 1W7PB 4BL0B 2WV0A 3DPJA 2DTRA 1V54H 5DUKA 4IHXA 3F8MA 3KZZA 3WGHA 3OSFA 3CCSI 1WPKA 3FK7A 4KIGA 3SHFA 4HOBA 2LKSA 3OYGA 4HSRA 4RMNA 4XL9A 2CMPA 1MDMB 2G9WA 3G73A 3O3KA 1JXSA 2UWMA 3OL3A 3FZVA 3A0HC 1YO5C 4AYBN 1GLNA 1LEBA 2L0KA 2EFQA 2CO5A 2YVEA 3VW2A 1BJZA 2WAQA 2M4GA 5KK1A 1WCMJ 3P9KA 5BMZA 2R93J 1HW2A 1JHHA 1MDMA 5L3FA 1RUOA 3HOVJ 2VASA 2ZMEC 4OAZA 1PP7U 3I55I 2WTEA 2DQRA 5DAJA 3CCEI 3QP5A 3WHBA 3S8PA 3WTZA 2BW3B 3SFZA 4AWXB 3A01A 1YTYA 2K3PA 3L00A 2O0YA 2VJ4A 1OLTA 4NDLA 1GV2A 3EYIA 3L1PA 2HKUA 2GA1A 2Z5UA 4YIIA 3G71I 2PLYA 2YVXA 4X0GA 1OCTC 1NG6A 2DA4A 2VBZA 2Z16A 2A5YB 2FQ4A 1XD7A 2BW3A 1PUEE 4GCTA 4IX7A 3BJ6A 3KCCA 1LVKA 4E7ZA 2EA2A 3HTJA 2ZFWA 4AIDA 2Y48A 3HTAA 3I53A 1QQIA 4BGDA 3B6CA 5D4SA 4B3AA 2F5EA 3GLLA 3OOUA 4Y7NJ 3MKYB 2F07A 3L7WA 3CUQC 5J1UA 4ZDPA 4IRVA 4GCLA 1T0FC 4I98B 3OYNA 1FP2A 2V79A 2DG8A 4BXFA 2OI8A 2XAFA 3LWJA 3CCYA 2LOOA 3BPVA 4G12A 1BBYA 4Y13A 1NK2P 4WXCA 1P4XA 1A36A 2EFOA 1LDDA 4PSWA 4B8XA 2FBQA 5GTHC 1TQMA 4KUMA 1IJWC 4RAFA 2QQ8A 2VXDA 5HLGA 5EF6A 4BYYA 2GLOA 1Z1DA 2X1DA 4FHTA 1F4KA 3HDDA 2A2FX 2O3FA 2HDWA 5C4XJ 2HYTA 3E7LA 2JUGA 2QBYB 3HHGA 3IAS2 2K9LA 3SZTA 3LSJA 4EJUA 3IH4A 3KETA 2VC0A 2HPMA 2WUIA 5D6EA 3S2HJ 2XGEA 1HSTA 3SJMA 4NHJA 2XSJC 2IGMA 4P5OA 2UV1A 3K4KA 4X1EA 4A3BJ 2QBYA 2L5QA 5ILSA 4I7HA 1MMSA 4OAYA 2DA3A 4U9NA 3IKVA 3L9FA 3GTJJ 3FM3A 2O7OA 1DUXC 1FOXA 2HOEA 1MJ9A 2H1KA 5FROA 4RM2A 1DGWY 3K4MA 1LDKB 2P5KA 2HYGD 4E7SA 4YIRX 4FX4A 1WQ2A 1IN6A 2O6GE 1IRFA 4DZJA 3NRVA 2HVSA 1QVTA 1B8IB 2A6HF 4AUXA 2B7EA 4A93J 1D0YA 5EZGA 4WXHA 3E5QA 1O4XA 4ZYAA 1YIJI 5B5EC 3TP0A 3QPLA 2HYJA 2DFIA 4NN1A 2NP3A 2RC4A 2PBXA 1K6YA 2ME6A 3MN2A 4A5MA 2ACJA 3HSEA 3JRIA 3B81A 2WADA 3HZJA 1A31A 2W24A 1WKMA 1SGMA 2OJED 4G7ZF 2ZSHB 1SVMA 2L2OA 3K6GA 1YHQI 2KDZA 4L62A 1RESA 2DQLA 2NVTJ 5GP9A 5E8GA 4UUSA 1Z6TA 1UCRA 2Q2EB 5DCMB 3J81K 2UXPA 2A61A 1WJAA 3WTYC 3F22A 1JGSA 4PJ0C 3OYAA 5FD6A 4ENMA 1HA8A 4IOCF 4FCYA 1R71A 2BY2A 3NPIA 2NVUB 2IS1A 2NAZA 2DFEA 4M3DA 4NQWA 2ZCXA 2BV6A 5IT3A 2WBMA 2VE8A 1QU3A 2Q2EA 2R7OA 3AG3H 3M8FA 4LK1F 1GV5A 2WAEA 2Q24A 4IQJA 1UZCA 2WAQN 3FM5A 1YS6A 3C2GA 3HG9A 3I64A 3WU0A 3QOEA 2LY2A 4GYIA 2ZXIA 5L3DA 2CV0A 3JTHA 4M9ZA 5HS8A 2NP5A 1XX5A 2UZKA 3RCOA 4RGUA 3DTIA 5LLQA 3HOWJ 2K7LA 2GUHA 1D0XA 2K4BA 1G3WA 4F3QA 1NK3P 1OJLA 4JL3A 2PFBA 3GLXA 4Q48A 5M5XJ 3HGGA 4A0ZA 3HHHA 3K1NA 4UVAA 4PDKA 3OS2A 4CUGA 2H6BA 2PMZN 2JMWA 4ZTFA 1Z6RA 2EFWA 3ZP5A 3O60A 1R1TA 3CCMI 5DEQA 4UY8I 2DCEA 1USTA 3LQQA 4UV8A 5FKKA 1XG1A 4CCOA 4ZZDA 1IRGA 2PX9A 3QPTA 1FJLA 3JR9A 3WTUC 2E71A 3BOQA 1B6AA 1REPC 4RB1A 1K4SA 4G6QA 2EIMH 4UVCA 4M74A 3B6AA 2R7SA 4X6AJ 3RKWA 4PGGA 3M7GA 4NNJA 2ZB9A 1BC8C 5FKOA 1KYWA 1R7JA 4HYEA 2LY9A 4EM0B 2X0LA 1VQNI 2Q8KA 3T6NA 4G7OF 4BDYA 3E6BA 2W84A 1ZR4A 1JUMA 3A1YA 3TOBA 3MKZA 2DK8A 2W57A 2DFHA 4JYKA 4LIVA 1HCRA 1V5GA 4EM2A 4F92B 2P0WA 1S5LC 3PFYA 1R4MB 2V9KA 1HW5A 3FWEA 4Y15A 5J4YA 4IEJA 1ZKGA 1YJ9I 5ICFA 1N78A 2KRHA 1MBGA 4KMUX 4RLQA 4PFOA 2KMUA 2M87A 3CMEI 1YJWI 1QHHD 2CQXA 4A3EJ 1IAWA 2TDXA 4IHWA 3VYRB 1QHGA 2RV8A 2Y30A 4BBSJ 4C2MA 3VB2A 1M1EB 5IT9Z 1HDDC 2IS2A 1RRJA 1E0EA 3S2DJ 5LEJA 3BPXA 3JW4A 4R79A 1HBXG 4EQQA 4C2MJ 3GFJA 3S3OA 3HJEA 1P7JA 1H89C 2RDPA 1ZGJA 1ZG1A 1EH6A 4A6DA 2WAFA 4F91B 3OYHA 4IZZA 1MD0A 4ITVA 4RGRA 1PDNC 4KN7X 2MGQA 3ERED 1Q1HA 2NS8A 2L9VA 3JCUC 5IOYA 1R1VA 1W5CC 1HKSA 4O5VA 2MD5A 5JVGF 2Y0SA 2E60A 2H94A 1LUJB 3LSMA 1J09A 3TL4X 5FMPA 1HKTA 2EILH 1OCOH 1RKTA 1Q1VA 1MMDA 2LF8A 2KPMA 4LJZF 2VQGA 5FRNA 3QYEA 4IXAA 3DEEA 1Y8RB 3OYEA 3KIOA 4N0BA 4XKBA 1A6IA 2KFDA 2A07F 4RB3C 3B73A 3MWMA 2TCTA 3K70D 3BR5A 2DA5A 5DV5A 3MCZA 2X1EA 4ZDOA 5GADJ 2X85A 1FBQA 2X1CA 4MHGA 4EGZA 2Q1ZB 2R4GA 5TJJA 3FISA 3HRUA 1E17A 5H6RA 3Q9SA 1ETKA 1WH5A 3S15J 2KDOA 4WXDA 3QODA 1SANA 1S3JA 3FMSA 2Q0OA 5IOZA 2LTPA 4PCQA 5LFAA 3OMYA 2A5WA 3DU6A 2ZJQF 2PI0A 4FETA 3L2WA 3V4GA 3IWZA 5CW8A 3F6VA 2IU5A 2E7XA 1ZARA 2UXUA 4BJTA 3CCRI 4PJNA 2L9NA 4WF2A 2HKOA 4B44A 2HOSA 3FK6A 3UR3C 2RASA 4KFCA 2M5WA 1WFXA 4IO9F 1YFHA 4E7LA 2DN0A 4F7ZA 2YS9A 3L2CA 1UFMA 2VPLA 2VOPA 5CVIA 5J40A 3VYTB 2KIQA 2ISZA 4OU0A 4QSHA 1O7LA 1LQ1A 3BLYA 1OQYA 3R0JA 3E6MA 1I6XA 1X19A 2MW8A 1FZPB 4JQFA 4LIUA 4HNTA 5IYDJ 2LYCA 2QZ8A 3ZMVA 1J7KA 3ML6A 3MFKA 2HQAA 5CVUA 2XVCA 1YQAA 1HC8A 3ZQIA 3A03A 2R7TA 2F2EA 2ELHA 1Y8QB 2FU4A 4DBRA 2ADUA 3E6DA 3F72A 4EGYA 4UUTA 5D8KB 1WGXA 3MVPA 3WGGA 4BY1J 3E6CC 3JRGA 2AXTC 3HRTA 2ZCNA 3DKXA 3NI7A 1ZG3A 2IA1A 3BZKA 3LSIA 3ONQA 5DTDA 4DGWB 1NTCA 4A3DJ 2LBFB 4ENNA 1ZGWA 5AIPA 2KIMA 2E2JJ 1VQ6I 3DXJF 4NUBA 5LGTA 4WIBA 4XSZF 4XRFA 2I8DA 1H0MA 2DDAA 3I3LA 2L01A 4HNVA 2F48A 2YPRA 3HOSA 2V6EA 4XLHA 1YS7A 2WA0A 1FYLA 2R92J 2JT1A 2WB1N 5HDGA 1P92A 2FX0A 3A0BC 4HPQA 4EJOA 4A3FJ 2Z1DA 1KU2A 1Z91A 3U2RA 4ZH4F 5IP7J 4Q47A 5J1RA 4FX0A 4A3GJ 3FKJA 1H8AC 3RH2A 3HUGA 4RDUA 4M6VA 1U8RA 5HBUA 4R1HA 1MSEC 2XIGA 3E1SA 1JHFA 1VZ0A 2M30A 1LVAA 2HNHA 1HW1A 1ITYA 2XRLA 3DQVC 5BOXA 2VN2A 2E7WA 4L0YB 4IOAF 2DA1A 1JKRC 1P4WA 2YVHA 2JSPA 4L9VA 1I5ZA 4CCKA 2BGCA 5JI6A 4I6ZA 2D45A 2I5UA 1GUUA 2M45A 3CJDA 4ANJA 3ABKH 3FX3A 2W00A 3VIBA 4FE4A 1VQLI 1V5EA 2EA4A 2RQQA 3HOTA 3ULQB 3DPTA 4HV5A 3VDXA 2R7VA 4KT5C 2NNNA 2XPUA 3IH2A 4CGZA 3D1NI 1USSA 2QEXI 2ZJ2A 3ISPA 3GZIA 1IW7F 3IRRA 3LSPA 3BG9A 2CFXA 4I0AA 2EIKH 2NX4A 1K78A 1JUSA 3VPRA 1SD7A 3QU3A 4LB6B 1DQUA 2Y0SN 1XMAA 3TQNA 1FSHA 3K8PC 5KVRA 3IRQA 1AU7A 2ZOYA 3HC7A 2LC2A 2XGCA 4CZZA 4S04A 4AC6A 2L4MA 2JRTA 1XGOA 1I3QJ 1LNWA 1SFXA 5IT9K 2N8GA 2XROA 1T2KA 3HTIA 5C3EJ 1FIAA 2DK5A 1ZGAA 3QPSA 3SXYA 5L3BA 1JTYA 1JT6A 1OR7A 4HKUA 4OINF 2LFBA 1IG7A 3C1DA 3VSLA 3TEDA 1AWCA 3V6GA 3I58A 1WJEA 2O03A 3V7RA 2MLGA 2V1NA 3ZCOA 1Y1VJ 2G7LA 1XPXA 2CYYA 3QYBA 3OWTA 4M3EA 5FJ8J 4E7IA 4XSXF 3QWLA 2WGBA 1Y0NA 2HQRA 3I9V2 3AQTA 3D0SA 1P2FA 2CQ7A 3TBIA 4C3HJ 3H1CA 2IS6A 4PUSA 3MQ0A 3FXRA 1XDUA 1T39A 1DP3A 4XQFA 1S29A 5IYCJ 2XDNA 1ON2A 5H9TA 4KWAA 4ME9A 3VOKA 4GCVA 2GBYA 2F6CA 1XN7A 2YUSA 4B48A 5E3NA 1ACIA 1WVRA 2UXNA 5ICEA 1O3RA 2CS3A 2LD5A 1TWGJ 3FMRA 1UHWA 1U9OA 3N05A 5GTIC 4A3KJ 2EV0A 2XHKA 2NYXA 1ERDA 5CQEA 3H5AA 4GFKA 3BR0A 3W6JB 2LG4A 3L09A 1D1AA 4MFDA 1E3OC 2JA2A 3PPBA 4NC7A 5L3CA 5BPDA 2GOMA 4IHTA 1DPUA 5CXGA 1SD4A 4KIBA 1H9TA 2DA6A 1TT0A 5BS6A 3BCGA 2E1CA 5K5OA 1LPQA 3OYBA 3PQJA 2R7UA 4MEXF 1RETA 3BY6A 5CKTA 1F9NA 3ECOA 2W85A 3OIOA 3RYRA 2EIJH 3OR2C 5K1YA 4BE1A 4AC0A 3IHUA 1YW9A 4Z2YA 4D0PA 3RQIA 3TW7A 3W2AA 1AKHA 2IJLA 3T8TA 2K4JA 3LFKA 3RI4A 3H9JA 2JTVA 3S14J 2R7DA 4DJAA 1BOBA 4HDVA 2JUCA 1WJBA 1ZG5A 1RR8C 2RKHA 4PJMA 3NQOA 3M3YJ 2AO9A 2F5DA 3BCBA 4ESJA 1RUNA 4B3XA 4HLXA 2RNGA 4HLYA 1BIBA 3NARA 2STWA 2O7TA 1A6QA 5J8FA 4WK8F 1X3WB 1R49A 3GUDA 2E35A 4ESBA 1OISA 3M1EA 3A01B 3HIMA 2Y0MA 3A02A 1Z0XA 1IUFA 1TNTA 1KA8A 2M4KA 5CLSA 4MQVA 3RPQA 3BR6A 5HSZA 4A3JJ 1UJ8A 4H0EA 4GYGA 4HZFA 2M2EA 2RGVA 3ZQ7A 2FMLA 1F43A 1JJ6C 3S5RA 1YRNA 5F6FA 1WZ2A 3BG5A 2CV2A 5KCMA 4GRIA 2GM4A 2FNAA 1P4AA 4KDPA 3KYLA 4ENKA 2XF7A 2PQ8A 3E97A 3REOA 5F04A 4XORA 3M8EA 1FOYA 2DTZA 4PSXA 1N25A 5F27A 1GXPA 3OIQA 4HRIA 1SEUA 1V5FA 1X3ZB 2DMPA 4II2A 4P1WA 1BR1A 1E2XA 1MNEA 2CQQA 4D7NA 4G7HF 5B1BH 2COMA 2XB0X 3H0GJ 1XGMA 2AXLA 2BY3A 1I1SA 1ONVA 1YYVA 2DODA 1MH4A 4AVPA 4OD5A 2GA2A 3HGYA 4IRHA 2CWEA 4M6YA 2ECCA 2HDDA 5DM6F 1D5VA 3AG1H 5HAWA 3PASA 3QU6A 2D1VA 2ZJPF 2ZOZA 1ZN2A 5ICGA 3KEOA 5D5UB 5E8IA 1TP4A 3ROUA 2WV1A 2IA2A 4JOMA 1VTNC 3VVXA 1PJRA 1KZHA 1KU7A 3ERMA 2HXOA 2M7BA 2HEOA 3FKIJ 4XOTA 3TW6A 4LLNA 3HB9A 5FLVA 1WSUA 2LKXA 2B63J 1ODDA 3F1BA 1DU0A 2XB5A 3FDYA 5F0HA 4U7BA 4IHVA 4M3BA 1RR7A 2PJPA 3COAC 4I0BA 3M07A 4DYCA 4XRSG 2VKEA 2EK5A 3CDHA 2W7NA 1IN4A 2YSRA 2QA4I 1D8JA 1IC8A 3EUAA 1MJBA 2KIUA 2L7MP 4G8XA 2JA7J 5JHUA 3HM5A 1P7IA 2ZCWA 3HOZJ 2KZVA 3G56A 1YW7A 5K7HA 3JRAA 1FYMA 1MNDA 3KP3A 1CF7A 1GDTA 5HODA 2OC6A 5FGLA 3L2UA 3CLQA 1K61A 1R5ID 2OUMA 1ZH5A 1EV7A 3K9TA 2QCOA 2X6OA 3FMQA 3T1BA 3IKTA 1HLVA 4NC6A 1OCCH 1MMAA 3KX2A 4IKFA 2IVMA 4D7MA 1C0WA 4ICHA 2IPQX 5CYVA 4CCNA 2PJRA 3BNIA 3F8CA 5D5XB 2H6CA 3J80Z 3V42A 5KAIC 2RVCA 4KJZA 1AHDP 1WJDA 4YG2F 4BHBA 5KHDA 4PJJA 2HQ5A 2VKVA 4JNNA 3VSKA 5KNLA 3KEQA 1AOYA 2DMQA 3JRFA 3F23A 1XGSA 4XICA 1IF1A 3EUHA 1TWFJ 3DLAA 5CPRB 3VYSB 4W97A 1IRXA 3LA7A 3ZRGA 2A69F 3K2AA 1L0OC 1R23A 4UUSB 3EETA 3I71A 4YRVA 4LD5A 1ETOA 5ILUA 3VYUB 3MKWB 2B9SA 1Z05A 2L3DA 2P6TA 2IBDA 3BJAA 4CYDA 1UAAA 2LMDA 1MBHA 1S7OA 3GTQJ 2LH9A 1QZYA 4NQWB 4KITB 1W5SA 1F5TA 4DYRA 4AD9A 4A2UA 1IDZA 3HPGA 3G7RA 3T0YA 2V6CA 2GXGA 3GF2A 2CH0A 5ED4A 2QF7A 1AA7A 4CCLA 2HOAA 1PVEA 4E7KA 1XSDA 1UB9A 2FUG2 3NEUA 4BY7J 5E3OA 2IW5A 2I10A 1S6LA 2EZHA 3JSJA 2KJCA 5LRSA 4PXIA 3PIOF 3CJNA 2QSFX 3CQZJ 4GDFA 4EMSA 1J59A 2XKPA 3BR2A 3DBRB 3M1CA 1LE8A 2Y75A 5HLIA 2G0EA 2HPIA 4ZDLA 2B3WA 3CO7C 4RLFA 1QZZA 2HDCA 3Q3SA 2OTJI 2DYRH 2E1MB 4RA2A 2EINH 1A35A 3CMMA 3ZMTA 3S3NA 4MK6A 3W2WA 1XB4A 4FQGA 5DUIA 2EZLA 3S1NJ 3F6OA 2MBFA 1LEAA 1ETQA 4U7DA 4N4OB 2E34A 2O5RA 2XASA 3CP2A 4XOPA 1N75A 1FX7A 2QSGX 2CUZA 4KICA 1FOWA 2K02A 2HWVA 2CFOA 2DMNA 4LG0A 2C6YA 3MMYB 4I02A 4XKCA 2XAQA 5BQTA 1ZRFA 3G4SI 3K10A 2XAJA 1DDNA 4G9YA 3VEPA 2B0LA 4HX4A 4EVIA 1BA5A 1B59A 1R1UA 2JN6A 4Y17A 1BR2A 4DW6A 1S7AA 3P5JA 2VPRA 5DD4A 5E79C 2P5VA 1WHUA 4DIQA 2PG4A 1FT9A 5EGOA 3KKDA 4BH9A 2HZDA 3PJRA 4HF2A 4YFXF 3EPZA 3I59B 3TOAA 1Y0UA 1T38A 3FRQA 3HE0A 2UXHA 3ON4A 1G3YA 5AQCA 4XIDA 2CGPA 3RDIA 4GFLA 4F93B 2LNBA 1DGRM 5F64A 1SAUA 2XAGA 3GBGA 3CUOA 3GX4X 3VOEA 3ZQCA 3GZ5A 5TISC 1QNTA 5ILVA 2ID6A 4I2OA 5EG0B 4BQAA 2IS4A 3SZGA 3I59A 4MTEA 4AF5A 5D5VB 2R5YB 5GAGJ 4A0YA 1V4RA 3OL4A 2HTSA 1B4AA 1TWCJ 1GHCA 4RGSA 2HI3A 1UI5A 3ZN1A 4ZYGA 1G2HA 2PN6A 5EG0A 1EH8A 2ID3A 2JVGA 2QWWA 2KP6A 3GZ6A 2MH9A 3WE2A 3RKQA 2O8XA 1UI6A 4IVNA 3C07A 2R5YA 2ME0A 2BY0A 3ANPA 4P9UA 2A68F 4IRGA 3IV5A 3C2HA 4ENJA 4FE7A 2BHZA 1RIOH 1SMYF 1VFCA 2PBIA 3SYTA 3V8LA 4UHTA 3FXLA 3OYMA 2V1DA 3MKLA 4RM3A 5EEHA 3NNRA 3BCAA 3QAHA 4H4KC 4L9NA 1K7AA 3I4MJ 3IC7A 2Z99A 1POGA 1J5YA 4AVZA 3FIWA 3PNTA 4RS8A 2CRGA 4D5FA 1U2WA 4HV6A 2BVMA 3V8JA 4G6TB 4BXXJ 2LY1A 3I4PA 1OR7C 2R5ZB 1JT0A 4I01A 1VQPI 1I1GA 5LD2C 1TQIA 2FEZA 2DT5A 3DU5A 4BQOA 1D0ZA 4AIKA 1U6GA 3GTLJ 3COLA 2GXBA 3VUQA 5EEAA 2R5ZA 2LRDA 1K6OA 1FTTA 2IAIA 3H92A 2NS7A 1BI0A 2VI6A 5FD5A 5IPAA 3K4NA 4XRSA 3W6VA 3J80K 2XKOA 3OYLA 2X6WA 1TW2A 1X2MA 4EEFG 3FXQA 3H3UA 1W36C 4FTHA 2M8GX 3K0LA 3LAPA 4B09A 2M7AA 2CG4A 3CDIA 5F0CA 3E7QA 1XS9A 4KISA 2K9NA 3ZQFA 2M0MA 1FBSA 1G3TA 2A05A 2ZC2A 4MTDA 3L2VA 4JKZA 2X51A 2OZUA 3NS4A 1OYYA 3I5UA 5E1XA 2JVHA 2QTQA 3EUPA 4QLCU 1O3TA 5K5RA 2V26A 3CTAA 2GFNA 2NXNB 5LHIA 2JSCA 1XC5A 3G1MA 1U3EM 2ZXJA 2QOPA 3WG7H 2IA0A 3JAMZ 2XRNA 5HNFA 3KP7A 2DO7A 5JR3A 1T98A 4DZPA 3QKXA 3FBNB 4BDZA 3G6EI 2ZNZA 1Y1WJ 2STTA 2HFHA 3C18A 3TGNA 2W4SA 5LGNA 3GO5A 4DOZA 2F4MB 2TRTA 4I09A 3U21A 4MXMA 5K58A 1MBFA 1IXCA 4UVBA 2A6TA 2EH3A 3CC2I 4HAMA 3HTHA 1TLHB 2M8EA 2VKHA 2QQ9A 3I4NJ 3BRUA 5FHPA 2XPVA 4Y33A 2OA4A 4D1QA 2O9LA 4PFPA 2H09A 3TO6A 2RAEA 1HF0A 4N4NB 2CUJA 2XAHA 3SZPA 3K1PA 2ZY9A 3ZPLA 3Q9VA 2LK2A 5DS9A 1FY7A 2KKOA 2QGUA 1X58A 2AQFA 4E70A 2NS0A 4I76A 5M5YJ 3NXCA 1A5JA 2DJNA 2DOEA 2EV6A 3IP4B 3MEXA 4XLFA 4Z6YA 1YX5A 4XLCA 3NRGA 3AL0C 4MLOA 1Z9CA 2E5NA 4BHCA 3WTVC 3CF2A 4KMFA 3RSNA 3LA3A 3CO6C 2JWTA 5H6QA 3C7JA 1U5TA 1MNMC 1FTZA 2VC1A 3HUGB 4G94A 4O6JA 3HOXJ 2BBYA 4A3MJ 2OPTA 5LGUA 2KL4A 1H88C 1OKRA 3E5UA 2FBKA 4A3LJ 3GCMA 4WCGA 2ZJRF 4HX7A 4II3A 1K79A 1Z3YA 4XKWA 2X9DA 2K40A 3S1QJ 4C3JJ 2DG7A 1D5YA 1BI3A 5FKLA 3WODF 3JRCA 2VE9A 1SVLA 1TTYA 3MD2A 2MLKA 3OYCA 3CWRA 3WU2C 3GEUA 3OV8A 2MSYA 4S05A 3ABLH 3ASOH 2KQRA 2UUZA 2X48A 1EH7A 3ZQLA 2VB6A 3CP8A 4GXOA 4EV0A 2ICWG 4AYBA 5IP6A 5L3EA 3P9TA 1K78B 3NWSA 2MC3A 3KP6A 1HQCA 2CQNA 3MNLA 6PAXA 4R8HA 5D5WB 3DV8A 3HIFA 2XGDA 5HS9A 3TDUC 3WTXC 1TWHJ 2CW7A 2DW4A 1MIJA 2ZFUA 4IHSA 3V78A 3AAFA 2HOTA 1ZELA 2P5LC 1VQ8I 5EFYA 1R58A 2BEOA 2E1OA 2E5ZA 3O8HA 3W6KB 2QQAA 3SDBA 3TMOA 5F1JA 5TGTA 4XLEA 5FLXZ 1Z67A 1R5HA 2LF7A 3ABMH 4HEA2 2YU3A 3K1MA 3KP5A 4EATA 4A5NA 2RNJA 4HG2A 4OIRF 4OWRB 1IZ1A 2FNPA 2DFFA 4CXFA 4DVYP 4GCKA 3PQKA 4XLNF 2F4OB 3K4BA 3F9KA 1S9HA 1GVDA 1JUPA 2DMUA 2Y69H 4WX9A 2QSHX 1ZRCA 1G59A 4P9FA 3PFIA 5A2QZ 4L5EA 1HDPA 4YZEA 5D8LB 4A6EA 3R0AA 2EFNA 1FC3A 1Z21A 1UMQA 2R7RA 1IN5A 1OCRH 1Y6IA 4C30A 1X4OA 1F1ZA 3CJRB 3VOXA 3ESWB 1A04A 1JKPC 4CCMA 4IHYA 4JX4A 2WY8Q 3TO7A 2FOWA 3K2ZA 3GVAA 2CJJA 2WY7Q 3ZMSA 4I99C 3SEQA 2CSOA 2W25A 1B9MA 3GEZA 3ZXSA 4JX6A 1IV6A 3S1RJ 2D2WA 2P7CB 1YE9A 2VT3A 2X4HA 2GAUA 1RKWA 3WU1B 1ZYRF 4V2FA 3GFIA 3HRMA 4L5IA 1QPIA 3PL8A 1TWAJ 4J01A 3AFHA 4UB6C 4U9LA 1H9GA 1JTXA 1T56A 2M1BA 4UXNA 3FXMA 3S17J 3BJBA 3NWTA 4IL6C 4F52A 2L7FP 3BZ6A 4CSWA 1T08B 1UG0A 2P8TA 3JSPA 2OERA 5EYRA 4WWCA 1HOMA 3ON2A 3GTGJ 1FOKA 1OMIA 5LRRA 1G3SA 2EPFA 2YU9J 2HXIA 2EZKA 1W5TA 3GXOA 2VLAA 2F5CA 3Q0UA 2HU9A 4CO8A 3N97A 4LB5A 1WRJA 2B1EA 1GVJA 5LHHA 2HVQA 1MMGA 1TW3A 1FWZA 4CYCA 2BHYA 3DEWA 3EUHC 2R0QC 2HYFA 4PZJA 1YG2A 1MJAA 2DU9A 3S93A 1OYIA 4LGWA 3CD6I 4IRIA 3HL2A 1MGTA 1XGNA 4HW0A 1AKHB 3L2RA 2UXOA 4GO1A 4TV7A 3TDZC 3AL0B 2L7ZA 2KLOA 5J6XA 3HRSA 1RZ4A 4B47A 2BY1A 1VF9A 5HDKA 2VOOA 4CH7A 3ZN0A 2X6YA 3G2BA 2L9RA 4LK0F 4BEHA 1XCVA 2M0CA 5K7ZA 4L18B 1ZLJA 4Q4ZF 3CCQI 4YELA 3DFGA 3VTIA 3CLOA 3LA2A 1YLFA 4MGRA 3OR1C 1I3AA 1S7EA 1QA6A 2VXZA 1EJ9A 4V19K 5HOOA 5ERIA 5M3FJ 2EQRA 1W0TA 2F5FA 4IQ4A 2OAZA 2XGXA 4C2UA 5KAFC 3K4LA 4KYWA 3RPUD 1E3PA 2NNYA 3VP5A 4E7HA 3LSGA 4YIFA 4ZJZA 2IGKA 4K2EA 4NB5A 2KISA 3GTMJ 1FNNA 1Z3XA 2A6EF 4LLLA 1YRNB 1W7PD 2Y9ZA 4HF1A 4BKXA 3T5XA 1WH7A 3RPUA 3PO2J 3VFZA 5J8CA 5IP9J 3GWZA 3JTGA 3AQSA 5DD8A 3HPHA 2FMYA 3PUBA 1R4NB 1W7PA 2R3SA 1ETVA 1ZTRA 1JKOC 3OOPA 2BYVE 4HBLA 5C44J 3GTPJ 3FXOA 3BR1A 2E1MC 4ESFA 3KLNA 2VODA 5HNHA 3LHQA 1YX3A 3J7AY 4BS9A 2VQCA 2VJJA 1MBEA 3LSHA 1TNSA 2H8WA 4CICA 4XM3A 4DQ2A 1KYZA 2XPWA 3D5LA 3RKXA 2MFZA 4BBRJ 5EDNA 5DYMA 5J1YA 2DMTA 2ZSIB 1IGNA 1K4TA 4XK4A 3GYHX 2EJRA 3H35A 3K4JA 4BE2A 2FRHA 2K85A 3ZQHA 1NG7A 4OIOF 3CDLA 2JJ7A 2VONA 2FJI1 1D3YA 1SD6A 1G8XA 2DA7A 1OPCA 1V3FA 1ENHA 1ZR2A 2ZBKA 3DPLC 3GFLA 3OIPA 2PMZA 2J5PA 1ZRDA 1P6RA 1ZREA 2QQBA 2HKXA 4HF0A 3BG6A 2JZYA 2YX7A 4RAYA 2LP0A 2VQHA 4GFBA 3KE2A 1MKMA 2CUFA 2JQ7A 4D5CA 4EJVA 2ESHA 3KEYA 1KGSA 1VQKI 3ABTA 2K27A 3S32A 3R6SA 3F8NA 2NOJB 5EJCA 5EZHA 5E3LA 2V57A 3H3VK 3NAUA 3DKWA 2DXIA 2HR3A 2ZO4A 3GZNB 4DNCA 5LEKA 3X2QH 1ZAOA 1BR4A 4U87A 4XRMA 1CF7B 2IEKA 1QRYA 1XMKA 4L9TA 1ZK8A 5FLMJ 2R7FA 3CCUI 2VQLA 2HZTA 4P55A 5FLXK 1LFPA 3HSRA 3PM1A 3RJPA 4JX5A 1WJFA 1IN7A 4LG3A 3SEZA 4UUVA 1DU6A 3VW0A 4L5JA 1U8BA 3BWGA 3LMMA 1MW7A 3KZIC 1RC9A 1YJNI 4HNUA 1D1BA 3GTKJ 3OYKA 1J75A 2PJRB 3P9CA 4ZYEA 1SAXA 2PFVA 2O61A 1MBJA 4RAZA 5B1AH 2ZKZA 4PJLA 5A2QK 5FB2A 3K69A 2GIZA 3CJTB 1LDJA 4L0ZB 5HLTA 4M3GA 4F55A 4XONA 5H2FC 3UNGC 1VQOI 2E2IJ
chains in the Genus database with same CATH topology
1ZGWA 3QBMA 2E2JJ 3BHQA 1OCPA 3EGQA 1UI5A 1G2HA 2D6YA 4ABZA 2ECBA 5EG0A 2ID3A 2GENA 1B72B 1UI6A 4HNVA 3RKQA 3C07A 3Q0VA 2R5YA 2ME0A 3CMYA 2R92J 3ANPA 2WB1N 1LFUP 2OF7A 2FX0A 1IDYA 3HOUJ 4A3FJ 3LNQA 5IP7J 3IV5A 5M5WJ 5J1RA 1T33A 4FE7A 4A3GJ 5J3LA 1H8AC 3RH2A 4RDUA 4M6VA 5HBUA 4JP0A 3ZQGA 1VFCA 1B72A 2CU7A 3BR3A 1MSEC 4S0HB 2D5VA 3MKLA 3VVYA 3NNRA 4UDSA 2Y31A 1ITYA 3DPJA 2XRLA 3I4MJ 1POGA 4IHXA 3S16J 2DA1A 3OSFA 1JKRC 1WPKA 3FK7A 2YVHA 3FIWA 4I6ZA 1B8IA 2CRGA 1GUUA 4D5FA 3CJDA 4LOCA 3VIBA 4FE4A 1LE8B 4BXXJ 2R5ZB 2QWTA 1JT0A 3ANGA 4AYBN 2L0KA 2NVQJ 2YVEA 3VW2A 1BJZA 2XPUA 3IH2A 3D1NI 1WCMJ 3GZIA 2R93J 3ZOBA 2VUMJ 3LSPA 1EF4A 3GTLJ 3BG9A 3COLA 3VUQA 5EEAA 1X2NA 3HOVJ 1BW5A 2NX4A 2R5ZA 1JUSA 3VPRA 1FTTA 2IAIA 2NS7A 2VI6A 2Y0SN 5IPAA 5DAJA 1AU7A 3WHBA 2NVYJ 4XRSA 2XGCA 2ZOYA 3W6VA 4AC6A 1UG2A 1MBKA 1X2MA 4EEFG 1I3QJ 3A01A 4FTHA 2M8GX 2N8GA 3HTIA 5C3EJ 4NDLA 1FIAA 1GV2A 3L1PA 3QPSA 5F0CA 3E7QA 1XS9A 2HKUA 1JTYA 1JT6A 2K9NA 3ZQFA 4HKUA 2LFBA 1ETXA 1IG7A 3TEDA 1OCTC 3OSGA 5JLWA 3V6GA 2DA4A 4JKZA 2FQ4A 3Q0WA 4GCTA 3M4OJ 1Y1VJ 2G7LA 3EUPA 2QTQA 1QVUA 2PZ9A 2GFNA 2M9HA 3HTJA 4M3EA 3K7AJ 1XC5A 3G1MA 4MIMA 5FJ8J 3QQAA 2QOPA 3HTAA 5EGOB 3B6CA 4MFEA 4B3AA 2WGBA 3OOUA 4Y7NJ 3AQTA 4DZPA 2F07A 3QKXA 4C3HJ 4GCLA 5J1UA 1Y1WJ 4M3FA 2DG8A 2TRTA 2OI8A 3LWJA 3CCYA 4MXMA 1ETYA 5IYCJ 2XDNA 5K58A 5H9TA 1MBFA 4G12A 2ZCMA 3CRJA 1NK2P 4KWAA 4ME9A 2EH3A 3LSRA 2GBYA 2FBQA 3HTHA 3VOKA 3I4NJ 1IJWC 3HEFA 2YUSA 2REKA 3BRUA 2XPVA 5E3NA 5FHPA 2E2HJ 5EF6A 2GLOA 3LJLA 3HDDA 2O9LA 2RAEA 1TWGJ 2LD5A 1HF0A 1I6HJ 1U9OA 3VVZA 2NOGA 4A3KJ 5C4XJ 1JJ8C 2HYTA 3E7LA 4ACIA 3SDGA 4GFKA 5D18A 3BR0A 2LK2A 5DS9A 2XSDC 3JREA 5M5YJ 1X58A 3LSJA 4I76A 3IH4A 1A5JA 2R7ZJ 4MFDA 3NXCA 1E3OC 2DJNA 2WUIA 3JRDA 1TC3C 3S2HJ 2XGEA 3PPBA 3NRGA 4MLOA 3SJMA 2UXIA 5CXGA 4X1EA 2JWTA 4A3BJ 2W53A 1UHSA 2M34A 2DA6A 1MNMC 1FTZA 3BCGA 3HOXJ 4A3MJ 2OPTA 2DA3A 3LOCA 1H88C 1RETA 3GTJJ 3BQYA 4A3LJ 2O7OA 2G7GA 3RZOJ 3OIOA 2H1KA 2X9DA 2G3BA 2K40A 4AC0A 3S1QJ 4C3JJ 4DZJA 2DG7A 1MH3A 1QVTA 1B8IB 3RQIA 4A3IJ 4AUXA 2E2IJ 1D5YA 1ZQ3P 4A93J 5EZGA 5FKLA 5CXIA 3TW7A 1O4XA 1AKHA 5C4YA 3TP0A 3QPLA 2HYJA 3JRCA 3S14J 4NN1A 2NP3A 1K83J 2PBXA 3CWRA 1ORKA 3GEUA 3WHCA 2NVXJ 2MSYA 3M3YJ 2AO9A 2ME6A 2X48A 3MN2A 3ZQLA 3JRIA 3NARA 3B81A 5IP6A 2O8KA 3P9TA 1SGMA 2O7TA 3SFIA 3MNLA 1APLC 1W0UA 3RD3A 2XGDA 5FKMA 2KDZA 4L62A 1RESA 4V2GA 1TWHJ 5GPAA 2NVTJ 3A01B 1PUFB 3UKGA 3HIMA 4Y52J 3A02A 5GP9A 1Z0XA 4UUSA 2JK3A 1IUFA 3V78A 2UXPA 2HOTA 2EBIA 5EFYA 2CUEA 1JKQC 3BR6A 2E1OA 5HSZA 3O8HA 4A3JJ 4FCYA 2M2EA 3NPIA 2FD5A 3S5RA 1F43A 1JJ6C 5F1JA 1YRNA 5D19A 3BG5A 4M3DA 1PUFA 2ZCXA 2GM4A 4QIWN 1MSFC 1SFOJ 1GV5A 2Q24A 4GCKA 5F04A 2WAQN 1JGGA 2DTZA 5F27A 5M3MJ 1GVDA 1JUPA 2DMUA 1Z77A 2DMPA 3BTCA 4L5EA 2CQQA 1HDPA 3O8GA 4D7NA 4YZEA 2NP5A 3HOWJ 2GUHA 1UMQA 2XB0X 3H0GJ 1MH4A 1LFBA 1NK3P 1OJLA 3HGYA 1JKPC 5JLXA 4A3CJ 3JRBA 3VOXA 4JL3A 1GT0C 2COBA 2ECCA 2HDDA 4IHYA 4JX4A 5M5XJ 3BTIA 3HGGA 1U9NA 2CJJA 5HAWA 3PASA 4JX6A 2ZOZA 2PMZN 2JMWA 1IV6A 3S1RJ 1RKWA 2WV1A 3O60A 4V2FA 3VVXA 1I50J 1QPIA 1FEXA 1R9TJ 2K9SA 2HXOA 3BTLA 1FIPA 1XG1A 1TWAJ 3FKIJ 5FKKA 3TW6A 3HB9A 4DYQA 1JTXA 1T56A 5FLVA 3BJBA 3S17J 2LKXA 1FJLA 3JR9A 2B63J 2L7FP 1DU0A 2XB5A 3F1BA 5F0HA 4IHVA 3VW1A 4M3BA 2OERA 1RR7A 5EYRA 1HOMA 3ON2A 3GTGJ 4DYCA 3B6AA 2VKEA 4XRSG 4X6AJ 2K9QA 2YU9J 2HXIA 3GTOJ 2EZKA 2ZB9A 1IC8A 2MG4A 3Q0UA 2ELKA 2L7MP 5FKOA 2JA7J 3HM5A 1P7IA 2LY9A 3T6NA 5F0FA 3IH3A 3HOZJ 3G56A 5K7HA 5GPCA 3JRAA 1ZR4A 1JUMA 4CYCA 2LVSA 1GDTA 5HODA 3DEWA 2R0QC 4A69C 2JA6J 2JA8J 5FGLA 4JYKA 1HCRA 1K61A 1RPWA 2LLKA 3G1OA 1AKHB 2UXOA 2QCOA 2X6OA 1HLVA 2L7ZA 4IEJA 1ZKGA 1VF9A 4D7MA 4ICHA 2DA2A 1MBGA 3S1MJ 3BNIA 4IHWA 2CQXA 4A3EJ 2L9RA 2M0CA 5K7ZA 1VNDA 1AHDP 2Y30A 4BBSJ 4C3IJ 2HQ5A 2VKVA 1HDDC 3JRHA 2QIBA 4JNNA 3S2DJ 1S7EA 4C2MJ 3IUVA 3KKCA 2DMQA 4FISA 5IYBJ 3JRFA 2E19A 4XICA 1P7JA 1TWFJ 4RBOA 1H89C 4W97A 1CQTA 3K2AA 5M3FJ 2EQRA 3BT9A 4UUSB 1W0TA 1ETOA 3VP5A 1U78A 2MGQA 3LSGA 2IBDA 2NS8A 3GTMJ 5IOYA 2QKOA 1MBHA 1YRNB 3GTQJ 2Y9ZA 4BKXA 2AHQA 4DYRA 1WH7A 3PO2J 5IP9J 5K7FA 9ANTA 1IDZA 3G7RA 5FMPA 1RKTA 3AQSA 1Q1VA 4QTRA 5C4JJ 2QF7A 5E3MA 2HOAA 4NELA 1ETVA 1ZTRA 1JKOC 4BY7J 5E3OA 5C44J 3GTPJ 3BR1A 2I10A 2EZHA 1A6IA 3LHQA 2TCTA 3JSJA 3BR5A 1MBEA 2DA5A 4PXIA 2XPWA 3G1LA 3CQZJ 4BBRJ 5EDNA 3PO3J 2KT0A 3BR2A 1LE8A 1F36A 2G0EA 5J1YA 2DMTA 2W48A 1IGNA 4XK4A 5FKNA 3Q3SA 3FISA 3S15J 1ETKA 1WH5A 2P81A 3HKZN 4MK6A 1SANA 2EZLA 3ZQHA 3S1NJ 3BG3A 5IOZA 2LTPA 3CDLA 2JJ7A 3C2BA 4B4CA 3BQZA 2Y2ZA 1ETQA 2DA7A 3KZ9A 1OFCX 5CW8A 4CGRA 2IU5A 1ENHA 1ZR2A 3DCFA 2Y9YA 2UXUA 3BTJA 2H8RA 2HOSA 3FK6A 1BW6A 2DMNA 2LP0A 2RASA 4GFBA 2G7SA 2CUFA 3RZDJ 4D5CA 3HBLA 2DN0A 2YS9A 1BA5A 5EZHA 5E3LA 2V57A 2JN6A 3H3VK 3NAUA 1WI3A 4DW6A 4QSHA 4XRMA 4CYCB 2IEKA 1QRYA 2VPRA 2MW8A 1ETWA 5IYDJ 4W1UA 5F08A 1ZK8A 5FLMJ 2LR8A 1BL0A 5D1RA 5EGOA 3KKDA 5BNGA 2RHAA 1IRZA 3PM1A 4JX5A 3ZQIA 3A03A 1DU6A 3FRQA 1U8BA 3HE0A 2UXHA 3ON4A 3VW0A 4MO7A 5AQCA 4J19A 4XIDA 4GFLA 3F0CA 3GTKJ 1VI0A 2FJ1A 3GBGA 3ZQCA 1MBJA 4UUTA 4B1RA 1WGXA 2ID6A 3MVPA 4BY1J 5EG0B 2JA5J 3HOYJ 3JRGA 3KNWA 3TP3A 2EZIA 2ZCNA 2R5YB 4AF5A 4M3GA 3NI7A 4A3DJ 5DTDA 1NTCA 1TWCJ 2HI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGW A;  3QBM A;  2E2J J;  3BHQ A;  1OCP A;  3EGQ A;  1UI5 A;  1G2H A;  2D6Y A;  4ABZ A;  2ECB A;  5EG0 A;  2ID3 A;  2GEN A;  1B72 B;  1UI6 A;  4HNV A;  3RKQ A;  3C07 A;  3Q0V A;  2R5Y A;  2ME0 A;  3CMY A;  2R92 J;  3ANP A;  2WB1 N;  1LFU P;  2OF7 A;  2FX0 A;  1IDY A;  3HOU J;  4A3F J;  3LNQ A;  5IP7 J;  3IV5 A;  5M5W J;  5J1R A;  1T33 A;  4FE7 A;  4A3G J;  5J3L A;  1H8A C;  3RH2 A;  4RDU A;  4M6V A;  5HBU A;  4JP0 A;  3ZQG A;  1VFC A;  1B72 A;  2CU7 A;  3BR3 A;  1MSE C;  4S0H B;  2D5V A;  3MKL A;  3VVY A;  3NNR A;  4UDS A;  2Y31 A;  1ITY A;  3DPJ A;  2XRL A;  3I4M J;  1POG A;  4IHX A;  3S16 J;  2DA1 A;  3OSF A;  1JKR C;  1WPK A;  3FK7 A;  2YVH A;  3FIW A;  4I6Z A;  1B8I A;  2CRG A;  1GUU A;  4D5F A;  3CJD A;  4LOC A;  3VIB A;  4FE4 A;  1LE8 B;  4BXX J;  2R5Z B;  2QWT A;  1JT0 A;  3ANG A;  4AYB N;  2L0K A;  2NVQ J;  2YVE A;  3VW2 A;  1BJZ A;  2XPU A;  3IH2 A;  3D1N I;  1WCM J;  3GZI A;  2R93 J;  3ZOB A;  2VUM J;  3LSP A;  1EF4 A;  3GTL J;  3BG9 A;  3COL A;  3VUQ A;  5EEA A;  1X2N A;  3HOV J;  1BW5 A;  2NX4 A;  2R5Z A;  1JUS A;  3VPR A;  1FTT A;  2IAI A;  2NS7 A;  2VI6 A;  2Y0S N;  5IPA A;  5DAJ A;  1AU7 A;  3WHB A;  2NVY J;  4XRS A;  2XGC A;  2ZOY A;  3W6V A;  4AC6 A;  1UG2 A;  1MBK A;  1X2M A;  4EEF G;  1I3Q J;  3A01 A;  4FTH A;  2M8G X;  2N8G A;  3HTI A;  5C3E J;  4NDL A;  1FIA A;  1GV2 A;  3L1P A;  3QPS A;  5F0C A;  3E7Q A;  1XS9 A;  2HKU A;  1JTY A;  1JT6 A;  2K9N A;  3ZQF A;  4HKU A;  2LFB A;  1ETX A;  1IG7 A;  3TED A;  1OCT C;  3OSG A;  5JLW A;  3V6G A;  2DA4 A;  4JKZ A;  2FQ4 A;  3Q0W A;  4GCT A;  3M4O J;  1Y1V J;  2G7L A;  3EUP A;  2QTQ A;  1QVU A;  2PZ9 A;  2GFN A;  2M9H A;  3HTJ A;  4M3E A;  3K7A J;  1XC5 A;  3G1M A;  4MIM A;  5FJ8 J;  3QQA A;  2QOP A;  3HTA A;  5EGO B;  3B6C A;  4MFE A;  4B3A A;  2WGB A;  3OOU A;  4Y7N J;  3AQT A;  4DZP A;  2F07 A;  3QKX A;  4C3H J;  4GCL A;  5J1U A;  1Y1W J;  4M3F A;  2DG8 A;  2TRT A;  2OI8 A;  3LWJ A;  3CCY A;  4MXM A;  1ETY A;  5IYC J;  2XDN A;  5K58 A;  5H9T A;  1MBF A;  4G12 A;  2ZCM A;  3CRJ A;  1NK2 P;  4KWA A;  4ME9 A;  2EH3 A;  3LSR A;  2GBY A;  2FBQ A;  3HTH A;  3VOK A;  3I4N J;  1IJW C;  3HEF A;  2YUS A;  2REK A;  3BRU A;  2XPV A;  5E3N A;  5FHP A;  2E2H J;  5EF6 A;  2GLO A;  3LJL A;  3HDD A;  2O9L A;  2RAE A;  1TWG J;  2LD5 A;  1HF0 A;  1I6H J;  1U9O A;  3VVZ A;  2NOG A;  4A3K J;  5C4X J;  1JJ8 C;  2HYT A;  3E7L A;  4ACI A;  3SDG A;  4GFK A;  5D18 A;  3BR0 A;  2LK2 A;  5DS9 A;  2XSD C;  3JRE A;  5M5Y J;  1X58 A;  3LSJ A;  4I76 A;  3IH4 A;  1A5J A;  2R7Z J;  4MFD A;  3NXC A;  1E3O C;  2DJN A;  2WUI A;  3JRD A;  1TC3 C;  3S2H J;  2XGE A;  3PPB A;  3NRG A;  4MLO A;  3SJM A;  2UXI A;  5CXG A;  4X1E A;  2JWT A;  4A3B J;  2W53 A;  1UHS A;  2M34 A;  2DA6 A;  1MNM C;  1FTZ A;  3BCG A;  3HOX J;  4A3M J;  2OPT A;  2DA3 A;  3LOC A;  1H88 C;  1RET A;  3GTJ J;  3BQY A;  4A3L J;  2O7O A;  2G7G A;  3RZO J;  3OIO A;  2H1K A;  2X9D A;  2G3B A;  2K40 A;  4AC0 A;  3S1Q J;  4C3J J;  4DZJ A;  2DG7 A;  1MH3 A;  1QVT A;  1B8I B;  3RQI A;  4A3I J;  4AUX A;  2E2I J;  1D5Y A;  1ZQ3 P;  4A93 J;  5EZG A;  5FKL A;  5CXI A;  3TW7 A;  1O4X A;  1AKH A;  5C4Y A;  3TP0 A;  3QPL A;  2HYJ A;  3JRC A;  3S14 J;  4NN1 A;  2NP3 A;  1K83 J;  2PBX A;  3CWR A;  1ORK A;  3GEU A;  3WHC A;  2NVX J;  2MSY A;  3M3Y J;  2AO9 A;  2ME6 A;  2X48 A;  3MN2 A;  3ZQL A;  3JRI A;  3NAR A;  3B81 A;  5IP6 A;  2O8K A;  3P9T A;  1SGM A;  2O7T A;  3SFI A;  3MNL A;  1APL C;  1W0U A;  3RD3 A;  2XGD A;  5FKM A;  2KDZ A;  4L62 A;  1RES A;  4V2G A;  1TWH J;  5GPA A;  2NVT J;  3A01 B;  1PUF B;  3UKG A;  3HIM A;  4Y52 J;  3A02 A;  5GP9 A;  1Z0X A;  4UUS A;  2JK3 A;  1IUF A;  3V78 A;  2UXP A;  2HOT A;  2EBI A;  5EFY A;  2CUE A;  1JKQ C;  3BR6 A;  2E1O A;  5HSZ A;  3O8H A;  4A3J J;  4FCY A;  2M2E A;  3NPI A;  2FD5 A;  3S5R A;  1F43 A;  1JJ6 C;  5F1J A;  1YRN A;  5D19 A;  3BG5 A;  4M3D A;  1PUF A;  2ZCX A;  2GM4 A;  4QIW N;  1MSF C;  1SFO J;  1GV5 A;  2Q24 A;  4GCK A;  5F04 A;  2WAQ N;  1JGG A;  2DTZ A;  5F27 A;  5M3M J;  1GVD A;  1JUP A;  2DMU A;  1Z77 A;  2DMP A;  3BTC A;  4L5E A;  2CQQ A;  1HDP A;  3O8G A;  4D7N A;  4YZE A;  2NP5 A;  3HOW J;  2GUH A;  1UMQ A;  2XB0 X;  3H0G J;  1MH4 A;  1LFB A;  1NK3 P;  1OJL A;  3HGY A;  1JKP C;  5JLX A;  4A3C J;  3JRB A;  3VOX A;  4JL3 A;  1GT0 C;  2COB A;  2ECC A;  2HDD A;  4IHY A;  4JX4 A;  5M5X J;  3BTI A;  3HGG A;  1U9N A;  2CJJ A;  5HAW A;  3PAS A;  4JX6 A;  2ZOZ A;  2PMZ N;  2JMW A;  1IV6 A;  3S1R J;  1RKW A;  2WV1 A;  3O60 A;  4V2F A;  3VVX A;  1I50 J;  1QPI A;  1FEX A;  1R9T J;  2K9S A;  2HXO A;  3BTL A;  1FIP A;  1XG1 A;  1TWA J;  3FKI J;  5FKK A;  3TW6 A;  3HB9 A;  4DYQ A;  1JTX A;  1T56 A;  5FLV A;  3BJB A;  3S17 J;  2LKX A;  1FJL A;  3JR9 A;  2B63 J;  2L7F P;  1DU0 A;  2XB5 A;  3F1B A;  5F0H A;  4IHV A;  3VW1 A;  4M3B A;  2OER A;  1RR7 A;  5EYR A;  1HOM A;  3ON2 A;  3GTG J;  4DYC A;  3B6A A;  2VKE A;  4XRS G;  4X6A J;  2K9Q A;  2YU9 J;  2HXI A;  3GTO J;  2EZK A;  2ZB9 A;  1IC8 A;  2MG4 A;  3Q0U A;  2ELK A;  2L7M P;  5FKO A;  2JA7 J;  3HM5 A;  1P7I A;  2LY9 A;  3T6N A;  5F0F A;  3IH3 A;  3HOZ J;  3G56 A;  5K7H A;  5GPC A;  3JRA A;  1ZR4 A;  1JUM A;  4CYC A;  2LVS A;  1GDT A;  5HOD A;  3DEW A;  2R0Q C;  4A69 C;  2JA6 J;  2JA8 J;  5FGL A;  4JYK A;  1HCR A;  1K61 A;  1RPW A;  2LLK A;  3G1O A;  1AKH B;  2UXO A;  2QCO A;  2X6O A;  1HLV A;  2L7Z A;  4IEJ A;  1ZKG A;  1VF9 A;  4D7M A;  4ICH A;  2DA2 A;  1MBG A;  3S1M J;  3BNI A;  4IHW A;  2CQX A;  4A3E J;  2L9R A;  2M0C A;  5K7Z A;  1VND A;  1AHD P;  2Y30 A;  4BBS J;  4C3I J;  2HQ5 A;  2VKV A;  1HDD C;  3JRH A;  2QIB A;  4JNN A;  3S2D J;  1S7E A;  4C2M J;  3IUV A;  3KKC A;  2DMQ A;  4FIS A;  5IYB J;  3JRF A;  2E19 A;  4XIC A;  1P7J A;  1TWF J;  4RBO A;  1H89 C;  4W97 A;  1CQT A;  3K2A A;  5M3F J;  2EQR A;  3BT9 A;  4UUS B;  1W0T A;  1ETO A;  3VP5 A;  1U78 A;  2MGQ A;  3LSG A;  2IBD A;  2NS8 A;  3GTM J;  5IOY A;  2QKO A;  1MBH A;  1YRN B;  3GTQ J;  2Y9Z A;  4BKX A;  2AHQ A;  4DYR A;  1WH7 A;  3PO2 J;  5IP9 J;  5K7F A;  9ANT A;  1IDZ A;  3G7R A;  5FMP A;  1RKT A;  3AQS A;  1Q1V A;  4QTR A;  5C4J J;  2QF7 A;  5E3M A;  2HOA A;  4NEL A;  1ETV A;  1ZTR A;  1JKO C;  4BY7 J;  5E3O A;  5C44 J;  3GTP J;  3BR1 A;  2I10 A;  2EZH A;  1A6I A;  3LHQ A;  2TCT A;  3JSJ A;  3BR5 A;  1MBE A;  2DA5 A;  4PXI A;  2XPW A;  3G1L A;  3CQZ J;  4BBR J;  5EDN A;  3PO3 J;  2KT0 A;  3BR2 A;  1LE8 A;  1F36 A;  2G0E A;  5J1Y A;  2DMT A;  2W48 A;  1IGN A;  4XK4 A;  5FKN A;  3Q3S A;  3FIS A;  3S15 J;  1ETK A;  1WH5 A;  2P81 A;  3HKZ N;  4MK6 A;  1SAN A;  2EZL A;  3ZQH A;  3S1N J;  3BG3 A;  5IOZ A;  2LTP A;  3CDL A;  2JJ7 A;  3C2B A;  4B4C A;  3BQZ A;  2Y2Z A;  1ETQ A;  2DA7 A;  3KZ9 A;  1OFC X;  5CW8 A;  4CGR A;  2IU5 A;  1ENH A;  1ZR2 A;  3DCF A;  2Y9Y A;  2UXU A;  3BTJ A;  2H8R A;  2HOS A;  3FK6 A;  1BW6 A;  2DMN A;  2LP0 A;  2RAS A;  4GFB A;  2G7S A;  2CUF A;  3RZD J;  4D5C A;  3HBL A;  2DN0 A;  2YS9 A;  1BA5 A;  5EZH A;  5E3L A;  2V57 A;  2JN6 A;  3H3V K;  3NAU A;  1WI3 A;  4DW6 A;  4QSH A;  4XRM A;  4CYC B;  2IEK A;  1QRY A;  2VPR A;  2MW8 A;  1ETW A;  5IYD J;  4W1U A;  5F08 A;  1ZK8 A;  5FLM J;  2LR8 A;  1BL0 A;  5D1R A;  5EGO A;  3KKD A;  5BNG A;  2RHA A;  1IRZ A;  3PM1 A;  4JX5 A;  3ZQI A;  3A03 A;  1DU6 A;  3FRQ A;  1U8B A;  3HE0 A;  2UXH A;  3ON4 A;  3VW0 A;  4MO7 A;  5AQC A;  4J19 A;  4XID A;  4GFL A;  3F0C A;  3GTK J;  1VI0 A;  2FJ1 A;  3GBG A;  3ZQC A;  1MBJ A;  4UUT A;  4B1R A;  1WGX A;  2ID6 A;  3MVP A;  4BY1 J;  5EG0 B;  2JA5 J;  3HOY J;  3JRG A;  3KNW A;  3TP3 A;  2EZI A;  2ZCN A;  2R5Y B;  4AF5 A;  4M3G A;  3NI7 A;  4A3D J;  5DTD A;  1NTC A;  1TWC J;  2HI3 A; 
#chains in the Genus database with same CATH topology
 3BDD A;  1FMW A;  1OCP A;  3EGQ A;  2L7K A;  2M3A A;  4PK4 A;  4BUP A;  2GQQ A;  3FXK A;  2KRC A;  3CC7 I;  2R7X A;  3I0T A;  5J47 A;  2G7H A;  4ABZ A;  2ECB A;  4E4H A;  5E18 F;  1N77 A;  1LB2 A;  1LKX A;  1B72 B;  4HA8 A;  3Q0V A;  1YIT I;  2DOF A;  3HOU J;  1IDY A;  1FPQ A;  1STZ A;  1T95 A;  1BI2 A;  2V1X A;  1T33 A;  3PNY A;  2K3F A;  1ZHF A;  3KPH A;  3M8J A;  5B66 C;  1R5G A;  3F21 A;  1B72 A;  2CU7 A;  3BR3 A;  1FYK A;  2BXY A;  4S0H B;  4BAY A;  2D5V A;  5H20 A;  4M9S A;  4UDS A;  1HSJ A;  2Y31 A;  2RRE A;  3K4C A;  4MEY F;  2DPD A;  1ULY A;  1L3L A;  2WC2 A;  3C3W A;  3S16 J;  3K70 C;  3DP7 A;  5BPI A;  5DCF A;  3M9A A;  1Y39 A;  1B8I A;  4BXU A;  4XLP F;  2QEN A;  1B9N A;  1EKE A;  1FSE A;  1BIA A;  2EB7 A;  4LOC A;  4Y3O A;  3H36 A;  5B3S H;  1LE8 B;  2QWT A;  4C2T A;  4LIT A;  5HDN A;  1J9I A;  5EEG A;  2DPU A;  3ANG A;  3QYF A;  2NVQ J;  1G6N A;  2GIV A;  2MC4 A;  3ZQQ A;  3PIP F;  1BN5 A;  1RNL A;  3ZMU A;  1YIO A;  2XF5 A;  2KRF A;  2OV7 A;  3ZOB A;  2VUM J;  3F3X A;  1EF4 A;  2XV4 S;  5FFZ A;  1O57 A;  1X2N A;  1BW5 A;  1X1C A;  2L9S A;  4EM1 A;  4M9X A;  2VJI A;  4BAC A;  1VQM I;  2NVY J;  2OQR A;  3HXL A;  1UG2 A;  1MBK A;  3QPH A;  4GGG A;  1KQ0 A;  3LSK A;  2PMU A;  3DBH B;  3I54 A;  3H0D A;  3J7A O;  2FSW A;  2GZW A;  4LG0 B;  1W4M A;  2DOA A;  3PSI A;  5DCM A;  5TRD A;  4M72 A;  1SMT A;  3P7N A;  2GOX B;  2CQK A;  2DBB A;  1FP1 D;  2ZME B;  1ETX A;  5FFX A;  1X3U A;  4BQQ A;  3OSG A;  5JLW A;  1BOA A;  4EJT A;  2JRM A;  2X6X A;  3LST A;  3Q0W A;  3M4O J;  3ELK A;  3J7Z I;  4YFK F;  1WJC A;  1QVU A;  2PZ9 A;  2F4I A;  2M9H A;  1W1W E;  2PMH A;  2FQ3 A;  3K7A J;  3F8F A;  4MIM A;  4XN3 A;  3QQA A;  3WE3 A;  3CF5 F;  5EGO B;  2ZME A;  4MFE A;  2V1U A;  1FBU A;  2MAB A;  3MZ8 A;  4U0Y A;  3BJO A;  4N9H A;  1SC7 A;  3H9Q A;  1KQ8 A;  3CCL I;  3ASN H;  4M3F A;  2L02 A;  1ETY A;  1U5T C;  3EYY A;  4HQE A;  2ZCM A;  3D5S C;  3BZC A;  3S2W A;  3CRJ A;  3AG2 H;  1J0R A;  1IXS B;  3ECH A;  4Y4R A;  5DDG A;  3LSR A;  1Y56 A;  4KNY A;  3HEF A;  1TT5 B;  2REK A;  2E2H J;  1WWX A;  3E5X A;  2Z33 A;  3KLO A;  3LJL A;  1NHA A;  3FXJ A;  2IXS A;  4HST A;  3CUQ B;  1I6H J;  5D6F A;  3D5R C;  3VVZ A;  2NOG A;  3WG9 A;  3DLL F;  4E6K G;  1CGP A;  3QP6 A;  4YFN F;  1JJ8 C;  2RN7 A;  4ACI A;  1WI9 A;  1KU3 A;  3DBL B;  3SDG A;  5D18 A;  2XSD C;  5FGM A;  3JRE A;  1GXQ A;  3LWF A;  1SFU A;  2R7Z J;  4HX8 A;  1OCZ H;  1QGP A;  4RGX A;  3JRD A;  3OYD A;  1MZB A;  2HQN A;  1TC3 C;  3HTS B;  4CDG A;  3CUQ A;  1QZE A;  3KFW X;  2MD0 A;  1T0F A;  1T8I A;  2Z3Y A;  2UXI A;  2HGC A;  5F1R A;  4BQN A;  2W53 A;  1UHS A;  2M34 A;  4KT6 A;  4KIF A;  2OQG A;  2VKD A;  1ON1 A;  3PSF A;  2WB1 A;  2DJI A;  3LOC A;  2ZNY A;  3BQY A;  2G7G A;  4QPQ A;  3Q5F A;  3RZO J;  4ZYH A;  4RAG A;  2XUB A;  2G3B A;  2BE5 F;  1MH3 A;  2LSO A;  2IT0 A;  3WTS C;  2CW0 F;  2DYS H;  4A3I J;  4CZC A;  4KA4 A;  2EV5 A;  2V9V A;  1ZQ3 P;  5FO5 A;  5IY5 H;  5CXI A;  1UHM A;  3S3M A;  3PNV A;  5C4Y A;  1DP7 P;  2V4J C;  1O7F A;  1VQ7 I;  2VIX A;  4OD4 A;  1K83 J;  4OOI A;  3L2Q A;  3U1D A;  1P9Q C;  1PP8 F;  1QO0 D;  1ORK A;  4XN0 A;  3WHC A;  2NVX J;  4RB0 A;  3MZY A;  3QRF F;  3H5R A;  1IXR C;  3JSO A;  4OIP F;  1ZLK A;  4E7J A;  2O8K A;  3R61 A;  3ZMD A;  3SFI A;  2HTJ A;  2IP2 A;  2W1O A;  1APL C;  1W0U A;  3RD3 A;  4CHU A;  5FKM A;  1Z7L A;  2LKP A;  2P6S A;  2H27 A;  4V2G A;  5GPA A;  1FLI A;  1PUF B;  3UKG A;  4Y52 J;  2FBH A;  4HDU A;  2JK3 A;  3P9I A;  2VBW A;  3DPU A;  2Z9O A;  2EBI A;  1TZL A;  2CUE A;  1JKQ C;  3HKZ A;  4XMY A;  4OMY A;  2AQE A;  2FD5 A;  3T8R A;  5D4R A;  3OYI A;  5CJ9 A;  2GWR A;  3O6B B;  5D19 A;  1PUF A;  4IPA A;  3H5N A;  4L9J A;  4QIW N;  3WGI A;  2IGO A;  2P4W A;  1MSF C;  4EJW A;  1SFO J;  1IO2 A;  3FBI B;  3CCV I;  1SFK A;  1KU9 A;  1R22 A;  5LHG A;  1JGG A;  2YR2 A;  2MH2 A;  3GFM A;  2ESN A;  5M3M J;  1Z77 A;  3V8K A;  4CA0 A;  4LMY A;  4BU2 A;  2KJB A;  3BTC A;  1V55 H;  4CCJ A;  4ZC3 A;  3O8G A;  1YI2 I;  4BE0 A;  2K9M A;  3RIR A;  4MNU A;  1MMN A;  4OIQ F;  2G7U A;  2R7Q A;  3J7Y J;  1LFB A;  2V9P A;  5JLX A;  4A3C J;  3JRB A;  4RB2 C;  1GT0 C;  2COB A;  2XF6 A;  3PUF A;  5HS7 A;  3TKY A;  3BTI A;  3U9G A;  1U9N A;  4ZTJ A;  1XTA A;  2OZ6 A;  3DWL E;  2DAO A;  3IUO A;  3ABU A;  4MQ9 F;  4N9I A;  2JPC A;  1YOV B;  3V7S A;  3IWF A;  3SQN A;  2OU2 A;  3GME A;  2K86 A;  2EWN A;  4Q5S F;  1I50 J;  4G6D A;  4LLG F;  3OS0 A;  1FEX A;  1R9T J;  2BVL A;  2K9S A;  3BTL A;  3V7C A;  1FIP A;  3IL2 A;  3TO9 A;  2BXZ A;  4DYQ A;  3A2K A;  2KHM A;  3ZMZ A;  4AU7 A;  1R36 A;  1SFE A;  5E1Z B;  3VW1 A;  2EFP A;  1U5T B;  2QKM B;  3IAM 2;  4NBQ A;  1SVO A;  1XDS A;  4BNC A;  5HLH A;  2K9Q A;  1RI7 A;  3GTO J;  3R60 A;  4BJ6 C;  2CV1 A;  2MG4 A;  3DKY A;  2DT7 B;  4NC8 A;  4ZYD A;  2ELK A;  2IRF G;  1IN8 A;  3R4K A;  1O3Q A;  2ELJ A;  2E36 A;  2DI3 A;  3IH3 A;  5F0F A;  1TBX A;  5JHF A;  3LAJ A;  5GPC A;  1NH3 A;  1X1P A;  2LVS A;  4A69 C;  2JA6 J;  2JA8 J;  2Z2S B;  4U0V A;  1RPW A;  3LQR A;  2LLK A;  3G1O A;  4AM3 A;  3W3C A;  1G4D A;  2XDV A;  3MAJ A;  2K5C A;  1S8N A;  3A4C A;  3H3Z A;  3N4M A;  3KP4 A;  1QPM A;  3BRO A;  3HSF A;  2KZG A;  2DA2 A;  2AS5 F;  1XSX A;  2LDU A;  4UV9 A;  2CW8 A;  3S1M J;  1D8K A;  4AIJ A;  3RQ4 A;  1UEL B;  3OYF A;  1VND A;  4XR6 A;  4C3I J;  3BG7 A;  3JRH A;  2QIB A;  2FXA A;  2HS5 A;  3KKC A;  3IUV A;  4FIS A;  5IYB J;  5J4V A;  2FF4 A;  2LBF A;  2E19 A;  3OY9 A;  3MZH A;  3BP8 A;  3CZ6 A;  4RBO A;  3DEU A;  4U88 A;  1CQT A;  3E3V A;  1X4P A;  3FF5 A;  3BT9 A;  3DF8 A;  2UXX A;  5E1W A;  3OYJ A;  4P96 A;  2H1L A;  1U78 A;  2VBX A;  1KQ9 A;  3FXU A;  3KP2 A;  4XLA A;  1VQ4 I;  2QKO A;  3DTK A;  1XSV A;  1T6S A;  1HXD A;  1E3H A;  2DT6 A;  2VBY A;  2AHQ A;  1BM9 A;  5ICC A;  5DM7 F;  1BJA A;  5K7F A;  1FMV A;  4IF4 A;  9ANT A;  3FHN A;  1XMX A;  3CCJ I;  2DDB A;  5AON A;  4QTR A;  2OD5 A;  5C4J J;  2FBI A;  5E3M A;  3GW2 A;  4NEL A;  1PYV A;  2KIF A;  4PGH A;  5CVJ A;  1Z7U A;  2VT2 A;  4KN4 X;  3EUK L;  5CQG A;  4ASN A;  4IJA A;  5E17 F;  2XC7 A;  3KYD B;  2OBP A;  2BZT A;  2ISY A;  2OCC H;  3B02 A;  3G1L A;  2E1N A;  4JK1 X;  5L3G A;  4FAS D;  3PO3 J;  2KT0 A;  1F36 A;  4LFU A;  2IGN A;  1B1B A;  2W48 A;  4UNO A;  3CJQ B;  4ON0 A;  5FKN A;  1VQ5 I;  3LL7 A;  1TQP A;  3OS1 A;  2GXA A;  2P81 A;  3HKZ N;  2QVO A;  2QUF A;  3BG3 A;  1X1B A;  3U1K A;  4J00 A;  3RKY A;  4B4C A;  3C2B A;  1QBJ A;  3BQZ A;  2Y2Z A;  3H9G A;  3LFU A;  4XNF A;  1DPR A;  1OFC X;  2QYO A;  2WWY A;  3KZ9 A;  1I39 A;  1SD5 A;  4JBA A;  4CGR A;  4B43 A;  5CVV A;  3WTW C;  4XBF A;  5FRM A;  2L4A A;  3DCF A;  3HYI A;  3QOP A;  2Y9Y A;  2QM3 A;  2ZXW H;  4QWQ A;  1JI8 A;  2MYS A;  2NRA C;  3BTJ A;  2OCE A;  2H8R A;  3O2P E;  3VWB A;  4ZZL A;  1U0J A;  1BW6 A;  4A12 A;  2L54 A;  2VJ5 A;  2G7S A;  4C9Y A;  5K5Q A;  3ZR8 X;  3CES A;  3RZD J;  3HBL A;  1W36 D;  4UB8 C;  1I27 A;  2D1H A;  4FT8 A;  4O3M A;  5GAE J;  2QLZ A;  5CVR A;  1R6R A;  4M6X A;  1HKQ A;  4YEJ A;  2YX4 A;  4BJ5 C;  1WI3 A;  2FE3 A;  1LJ9 A;  4CYC B;  2J5O A;  3KZY A;  4D9J A;  1ETW A;  1WJ5 A;  1X1A A;  4W1U A;  2ZXH A;  5F08 A;  2LR8 A;  2FA5 A;  1BL0 A;  5D1R A;  1X1D A;  3SWH A;  2MA3 A;  2RQP A;  5BNG A;  2QKL B;  2RHA A;  1IRZ A;  4OMZ A;  2R7W A;  4U0W A;  2DLL A;  3DTE A;  1EA3 A;  1D1C A;  3G3Z A;  3FHZ A;  4MO7 A;  1JE8 A;  4J19 A;  3RTR A;  3F0C A;  3AKZ A;  1VI0 A;  1S72 I;  1IV8 A;  2FJ1 A;  2V7F A;  1YW8 A;  4QPO A;  5AIQ A;  4B1R A;  1OYW A;  4BEH B;  2A3S A;  2JA5 J;  1BI1 A;  3HOY J;  4M73 A;  3KNW A;  3TP3 A;  2BOL A;  2EZI A;  3CC4 I;  3VOD A;  3EDP A;  4ETS A;  4BHP A;  3J81 Z;  4XKV A;  3JAM K;  1R00 A;  3W2V A;  3QBM A;  3AG4 H;  3CMA I;  3BHQ A;  4M71 A;  2JPB A;  2W82 A;  3ZGK A;  2D6Y A;  2ETH A;  2GEN A;  4AIH A;  2FOK A;  1O3S A;  3RYP A;  4HQM A;  1XCB A;  2XAU A;  3CMY A;  2VL8 A;  5E20 A;  1VQ9 I;  1LFU P;  2OF7 A;  5HVQ C;  1J2X A;  4A0X A;  2HVR A;  3LNQ A;  3WTT C;  3I56 I;  2PEX A;  5M5W J;  3HTU A;  5J3L A;  1KON A;  5JFR A;  2LRE A;  1IUY A;  4JP0 A;  4DBQ A;  3ZQG A;  1TL8 A;  2OTL I;  1BC7 C;  2F5V A;  3F8B A;  3KYC B;  5JVT A;  3BC8 A;  3EQL F;  5GAH J;  2P7V B;  3E0J B;  3VVY A;  5LBQ A;  1W7P B;  4BL0 B;  2WV0 A;  3DPJ A;  2DTR A;  1V54 H;  5DUK A;  4IHX A;  3F8M A;  3KZZ A;  3WGH A;  3OSF A;  3CCS I;  1WPK A;  3FK7 A;  4KIG A;  3SHF A;  4HOB A;  2LKS A;  3OYG A;  4HSR A;  4RMN A;  4XL9 A;  2CMP A;  1MDM B;  2G9W A;  3G73 A;  3O3K A;  1JXS A;  2UWM A;  3OL3 A;  3FZV A;  3A0H C;  1YO5 C;  4AYB N;  1GLN A;  1LEB A;  2L0K A;  2EFQ A;  2CO5 A;  2YVE A;  3VW2 A;  1BJZ A;  2WAQ A;  2M4G A;  5KK1 A;  1WCM J;  3P9K A;  5BMZ A;  2R93 J;  1HW2 A;  1JHH A;  1MDM A;  5L3F A;  1RUO A;  3HOV J;  2VAS A;  2ZME C;  4OAZ A;  1PP7 U;  3I55 I;  2WTE A;  2DQR A;  5DAJ A;  3CCE I;  3QP5 A;  3WHB A;  3S8P A;  3WTZ A;  2BW3 B;  3SFZ A;  4AWX B;  3A01 A;  1YTY A;  2K3P A;  3L00 A;  2O0Y A;  2VJ4 A;  1OLT A;  4NDL A;  1GV2 A;  3EYI A;  3L1P A;  2HKU A;  2GA1 A;  2Z5U A;  4YII A;  3G71 I;  2PLY A;  2YVX A;  4X0G A;  1OCT C;  1NG6 A;  2DA4 A;  2VBZ A;  2Z16 A;  2A5Y B;  2FQ4 A;  1XD7 A;  2BW3 A;  1PUE E;  4GCT A;  4IX7 A;  3BJ6 A;  3KCC A;  1LVK A;  4E7Z A;  2EA2 A;  3HTJ A;  2ZFW A;  4AID A;  2Y48 A;  3HTA A;  3I53 A;  1QQI A;  4BGD A;  3B6C A;  5D4S A;  4B3A A;  2F5E A;  3GLL A;  3OOU A;  4Y7N J;  3MKY B;  2F07 A;  3L7W A;  3CUQ C;  5J1U A;  4ZDP A;  4IRV A;  4GCL A;  1T0F C;  4I98 B;  3OYN A;  1FP2 A;  2V79 A;  2DG8 A;  4BXF A;  2OI8 A;  2XAF A;  3LWJ A;  3CCY A;  2LOO A;  3BPV A;  4G12 A;  1BBY A;  4Y13 A;  1NK2 P;  4WXC A;  1P4X A;  1A36 A;  2EFO A;  1LDD A;  4PSW A;  4B8X A;  2FBQ A;  5GTH C;  1TQM A;  4KUM A;  1IJW C;  4RAF A;  2QQ8 A;  2VXD A;  5HLG A;  5EF6 A;  4BYY A;  2GLO A;  1Z1D A;  2X1D A;  4FHT A;  1F4K A;  3HDD A;  2A2F X;  2O3F A;  2HDW A;  5C4X J;  2HYT A;  3E7L A;  2JUG A;  2QBY B;  3HHG A;  3IAS 2;  2K9L A;  3SZT A;  3LSJ A;  4EJU A;  3IH4 A;  3KET A;  2VC0 A;  2HPM A;  2WUI A;  5D6E A;  3S2H J;  2XGE A;  1HST A;  3SJM A;  4NHJ A;  2XSJ C;  2IGM A;  4P5O A;  2UV1 A;  3K4K A;  4X1E A;  4A3B J;  2QBY A;  2L5Q A;  5ILS A;  4I7H A;  1MMS A;  4OAY A;  2DA3 A;  4U9N A;  3IKV A;  3L9F A;  3GTJ J;  3FM3 A;  2O7O A;  1DUX C;  1FOX A;  2HOE A;  1MJ9 A;  2H1K A;  5FRO A;  4RM2 A;  1DGW Y;  3K4M A;  1LDK B;  2P5K A;  2HYG D;  4E7S A;  4YIR X;  4FX4 A;  1WQ2 A;  1IN6 A;  2O6G E;  1IRF A;  4DZJ A;  3NRV A;  2HVS A;  1QVT A;  1B8I B;  2A6H F;  4AUX A;  2B7E A;  4A93 J;  1D0Y A;  5EZG A;  4WXH A;  3E5Q A;  1O4X A;  4ZYA A;  1YIJ I;  5B5E C;  3TP0 A;  3QPL A;  2HYJ A;  2DFI A;  4NN1 A;  2NP3 A;  2RC4 A;  2PBX A;  1K6Y A;  2ME6 A;  3MN2 A;  4A5M A;  2ACJ A;  3HSE A;  3JRI A;  3B81 A;  2WAD A;  3HZJ A;  1A31 A;  2W24 A;  1WKM A;  1SGM A;  2OJE D;  4G7Z F;  2ZSH B;  1SVM A;  2L2O A;  3K6G A;  1YHQ I;  2KDZ A;  4L62 A;  1RES A;  2DQL A;  2NVT J;  5GP9 A;  5E8G A;  4UUS A;  1Z6T A;  1UCR A;  2Q2E B;  5DCM B;  3J81 K;  2UXP A;  2A61 A;  1WJA A;  3WTY C;  3F22 A;  1JGS A;  4PJ0 C;  3OYA A;  5FD6 A;  4ENM A;  1HA8 A;  4IOC F;  4FCY A;  1R71 A;  2BY2 A;  3NPI A;  2NVU B;  2IS1 A;  2NAZ A;  2DFE A;  4M3D A;  4NQW A;  2ZCX A;  2BV6 A;  5IT3 A;  2WBM A;  2VE8 A;  1QU3 A;  2Q2E A;  2R7O A;  3AG3 H;  3M8F A;  4LK1 F;  1GV5 A;  2WAE A;  2Q24 A;  4IQJ A;  1UZC A;  2WAQ N;  3FM5 A;  1YS6 A;  3C2G A;  3HG9 A;  3I64 A;  3WU0 A;  3QOE A;  2LY2 A;  4GYI A;  2ZXI A;  5L3D A;  2CV0 A;  3JTH A;  4M9Z A;  5HS8 A;  2NP5 A;  1XX5 A;  2UZK A;  3RCO A;  4RGU A;  3DTI A;  5LLQ A;  3HOW J;  2K7L A;  2GUH A;  1D0X A;  2K4B A;  1G3W A;  4F3Q A;  1NK3 P;  1OJL A;  4JL3 A;  2PFB A;  3GLX A;  4Q48 A;  5M5X J;  3HGG A;  4A0Z A;  3HHH A;  3K1N A;  4UVA A;  4PDK A;  3OS2 A;  4CUG A;  2H6B A;  2PMZ N;  2JMW A;  4ZTF A;  1Z6R A;  2EFW A;  3ZP5 A;  3O60 A;  1R1T A;  3CCM I;  5DEQ A;  4UY8 I;  2DCE A;  1UST A;  3LQQ A;  4UV8 A;  5FKK A;  1XG1 A;  4CCO A;  4ZZD A;  1IRG A;  2PX9 A;  3QPT A;  1FJL A;  3JR9 A;  3WTU C;  2E71 A;  3BOQ A;  1B6A A;  1REP C;  4RB1 A;  1K4S A;  4G6Q A;  2EIM H;  4UVC A;  4M74 A;  3B6A A;  2R7S A;  4X6A J;  3RKW A;  4PGG A;  3M7G A;  4NNJ A;  2ZB9 A;  1BC8 C;  5FKO A;  1KYW A;  1R7J A;  4HYE A;  2LY9 A;  4EM0 B;  2X0L A;  1VQN I;  2Q8K A;  3T6N A;  4G7O F;  4BDY A;  3E6B A;  2W84 A;  1ZR4 A;  1JUM A;  3A1Y A;  3TOB A;  3MKZ A;  2DK8 A;  2W57 A;  2DFH A;  4JYK A;  4LIV A;  1HCR A;  1V5G A;  4EM2 A;  4F92 B;  2P0W A;  1S5L C;  3PFY A;  1R4M B;  2V9K A;  1HW5 A;  3FWE A;  4Y15 A;  5J4Y A;  4IEJ A;  1ZKG A;  1YJ9 I;  5ICF A;  1N78 A;  2KRH A;  1MBG A;  4KMU X;  4RLQ A;  4PFO A;  2KMU A;  2M87 A;  3CME I;  1YJW I;  1QHH D;  2CQX A;  4A3E J;  1IAW A;  2TDX A;  4IHW A;  3VYR B;  1QHG A;  2RV8 A;  2Y30 A;  4BBS J;  4C2M A;  3VB2 A;  1M1E B;  5IT9 Z;  1HDD C;  2IS2 A;  1RRJ A;  1E0E A;  3S2D J;  5LEJ A;  3BPX A;  3JW4 A;  4R79 A;  1HBX G;  4EQQ A;  4C2M J;  3GFJ A;  3S3O A;  3HJE A;  1P7J A;  1H89 C;  2RDP A;  1ZGJ A;  1ZG1 A;  1EH6 A;  4A6D A;  2WAF A;  4F91 B;  3OYH A;  4IZZ A;  1MD0 A;  4ITV A;  4RGR A;  1PDN C;  4KN7 X;  2MGQ A;  3ERE D;  1Q1H A;  2NS8 A;  2L9V A;  3JCU C;  5IOY A;  1R1V A;  1W5C C;  1HKS A;  4O5V A;  2MD5 A;  5JVG F;  2Y0S A;  2E60 A;  2H94 A;  1LUJ B;  3LSM A;  1J09 A;  3TL4 X;  5FMP A;  1HKT A;  2EIL H;  1OCO H;  1RKT A;  1Q1V A;  1MMD A;  2LF8 A;  2KPM A;  4LJZ F;  2VQG A;  5FRN A;  3QYE A;  4IXA A;  3DEE A;  1Y8R B;  3OYE A;  3KIO A;  4N0B A;  4XKB A;  1A6I A;  2KFD A;  2A07 F;  4RB3 C;  3B73 A;  3MWM A;  2TCT A;  3K70 D;  3BR5 A;  2DA5 A;  5DV5 A;  3MCZ A;  2X1E A;  4ZDO A;  5GAD J;  2X85 A;  1FBQ A;  2X1C A;  4MHG A;  4EGZ A;  2Q1Z B;  2R4G A;  5TJJ A;  3FIS A;  3HRU A;  1E17 A;  5H6R A;  3Q9S A;  1ETK A;  1WH5 A;  3S15 J;  2KDO A;  4WXD A;  3QOD A;  1SAN A;  1S3J A;  3FMS A;  2Q0O A;  5IOZ A;  2LTP A;  4PCQ A;  5LFA A;  3OMY A;  2A5W A;  3DU6 A;  2ZJQ F;  2PI0 A;  4FET A;  3L2W A;  3V4G A;  3IWZ A;  5CW8 A;  3F6V A;  2IU5 A;  2E7X A;  1ZAR A;  2UXU A;  4BJT A;  3CCR I;  4PJN A;  2L9N A;  4WF2 A;  2HKO A;  4B44 A;  2HOS A;  3FK6 A;  3UR3 C;  2RAS A;  4KFC A;  2M5W A;  1WFX A;  4IO9 F;  1YFH A;  4E7L A;  2DN0 A;  4F7Z A;  2YS9 A;  3L2C A;  1UFM A;  2VPL A;  2VOP A;  5CVI A;  5J40 A;  3VYT B;  2KIQ A;  2ISZ A;  4OU0 A;  4QSH A;  1O7L A;  1LQ1 A;  3BLY A;  1OQY A;  3R0J A;  3E6M A;  1I6X A;  1X19 A;  2MW8 A;  1FZP B;  4JQF A;  4LIU A;  4HNT A;  5IYD J;  2LYC A;  2QZ8 A;  3ZMV A;  1J7K A;  3ML6 A;  3MFK A;  2HQA A;  5CVU A;  2XVC A;  1YQA A;  1HC8 A;  3ZQI A;  3A03 A;  2R7T A;  2F2E A;  2ELH A;  1Y8Q B;  2FU4 A;  4DBR A;  2ADU A;  3E6D A;  3F72 A;  4EGY A;  4UUT A;  5D8K B;  1WGX A;  3MVP A;  3WGG A;  4BY1 J;  3E6C C;  3JRG A;  2AXT C;  3HRT A;  2ZCN A;  3DKX A;  3NI7 A;  1ZG3 A;  2IA1 A;  3BZK A;  3LSI A;  3ONQ A;  5DTD A;  4DGW B;  1NTC A;  4A3D J;  2LBF B;  4ENN A;  1ZGW A;  5AIP A;  2KIM A;  2E2J J;  1VQ6 I;  3DXJ F;  4NUB A;  5LGT A;  4WIB A;  4XSZ F;  4XRF A;  2I8D A;  1H0M A;  2DDA A;  3I3L A;  2L01 A;  4HNV A;  2F48 A;  2YPR A;  3HOS A;  2V6E A;  4XLH A;  1YS7 A;  2WA0 A;  1FYL A;  2R92 J;  2JT1 A;  2WB1 N;  5HDG A;  1P92 A;  2FX0 A;  3A0B C;  4HPQ A;  4EJO A;  4A3F J;  2Z1D A;  1KU2 A;  1Z91 A;  3U2R A;  4ZH4 F;  5IP7 J;  4Q47 A;  5J1R A;  4FX0 A;  4A3G J;  3FKJ A;  1H8A C;  3RH2 A;  3HUG A;  4RDU A;  4M6V A;  1U8R A;  5HBU A;  4R1H A;  1MSE C;  2XIG A;  3E1S A;  1JHF A;  1VZ0 A;  2M30 A;  1LVA A;  2HNH A;  1HW1 A;  1ITY A;  2XRL A;  3DQV C;  5BOX A;  2VN2 A;  2E7W A;  4L0Y B;  4IOA F;  2DA1 A;  1JKR C;  1P4W A;  2YVH A;  2JSP A;  4L9V A;  1I5Z A;  4CCK A;  2BGC A;  5JI6 A;  4I6Z A;  2D45 A;  2I5U A;  1GUU A;  2M45 A;  3CJD A;  4ANJ A;  3ABK H;  3FX3 A;  2W00 A;  3VIB A;  4FE4 A;  1VQL I;  1V5E A;  2EA4 A;  2RQQ A;  3HOT A;  3ULQ B;  3DPT A;  4HV5 A;  3VDX A;  2R7V A;  4KT5 C;  2NNN A;  2XPU A;  3IH2 A;  4CGZ A;  3D1N I;  1USS A;  2QEX I;  2ZJ2 A;  3ISP A;  3GZI A;  1IW7 F;  3IRR A;  3LSP A;  3BG9 A;  2CFX A;  4I0A A;  2EIK H;  2NX4 A;  1K78 A;  1JUS A;  3VPR A;  1SD7 A;  3QU3 A;  4LB6 B;  1DQU A;  2Y0S N;  1XMA A;  3TQN A;  1FSH A;  3K8P C;  5KVR A;  3IRQ A;  1AU7 A;  2ZOY A;  3HC7 A;  2LC2 A;  2XGC A;  4CZZ A;  4S04 A;  4AC6 A;  2L4M A;  2JRT A;  1XGO A;  1I3Q J;  1LNW A;  1SFX A;  5IT9 K;  2N8G A;  2XRO A;  1T2K A;  3HTI A;  5C3E J;  1FIA A;  2DK5 A;  1ZGA A;  3QPS A;  3SXY A;  5L3B A;  1JTY A;  1JT6 A;  1OR7 A;  4HKU A;  4OIN F;  2LFB A;  1IG7 A;  3C1D A;  3VSL A;  3TED A;  1AWC A;  3V6G A;  3I58 A;  1WJE A;  2O03 A;  3V7R A;  2MLG A;  2V1N A;  3ZCO A;  1Y1V J;  2G7L A;  1XPX A;  2CYY A;  3QYB A;  3OWT A;  4M3E A;  5FJ8 J;  4E7I A;  4XSX F;  3QWL A;  2WGB A;  1Y0N A;  2HQR A;  3I9V 2;  3AQT A;  3D0S A;  1P2F A;  2CQ7 A;  3TBI A;  4C3H J;  3H1C A;  2IS6 A;  4PUS A;  3MQ0 A;  3FXR A;  1XDU A;  1T39 A;  1DP3 A;  4XQF A;  1S29 A;  5IYC J;  2XDN A;  1ON2 A;  5H9T A;  4KWA A;  4ME9 A;  3VOK A;  4GCV A;  2GBY A;  2F6C A;  1XN7 A;  2YUS A;  4B48 A;  5E3N A;  1ACI A;  1WVR A;  2UXN A;  5ICE A;  1O3R A;  2CS3 A;  2LD5 A;  1TWG J;  3FMR A;  1UHW A;  1U9O A;  3N05 A;  5GTI C;  4A3K J;  2EV0 A;  2XHK A;  2NYX A;  1ERD A;  5CQE A;  3H5A A;  4GFK A;  3BR0 A;  3W6J B;  2LG4 A;  3L09 A;  1D1A A;  4MFD A;  1E3O C;  2JA2 A;  3PPB A;  4NC7 A;  5L3C A;  5BPD A;  2GOM A;  4IHT A;  1DPU A;  5CXG A;  1SD4 A;  4KIB A;  1H9T A;  2DA6 A;  1TT0 A;  5BS6 A;  3BCG A;  2E1C A;  5K5O A;  1LPQ A;  3OYB A;  3PQJ A;  2R7U A;  4MEX F;  1RET A;  3BY6 A;  5CKT A;  1F9N A;  3ECO A;  2W85 A;  3OIO A;  3RYR A;  2EIJ H;  3OR2 C;  5K1Y A;  4BE1 A;  4AC0 A;  3IHU A;  1YW9 A;  4Z2Y A;  4D0P A;  3RQI A;  3TW7 A;  3W2A A;  1AKH A;  2IJL A;  3T8T A;  2K4J A;  3LFK A;  3RI4 A;  3H9J A;  2JTV A;  3S14 J;  2R7D A;  4DJA A;  1BOB A;  4HDV A;  2JUC A;  1WJB A;  1ZG5 A;  1RR8 C;  2RKH A;  4PJM A;  3NQO A;  3M3Y J;  2AO9 A;  2F5D A;  3BCB A;  4ESJ A;  1RUN A;  4B3X A;  4HLX A;  2RNG A;  4HLY A;  1BIB A;  3NAR A;  2STW A;  2O7T A;  1A6Q A;  5J8F A;  4WK8 F;  1X3W B;  1R49 A;  3GUD A;  2E35 A;  4ESB A;  1OIS A;  3M1E A;  3A01 B;  3HIM A;  2Y0M A;  3A02 A;  1Z0X A;  1IUF A;  1TNT A;  1KA8 A;  2M4K A;  5CLS A;  4MQV A;  3RPQ A;  3BR6 A;  5HSZ A;  4A3J J;  1UJ8 A;  4H0E A;  4GYG A;  4HZF A;  2M2E A;  2RGV A;  3ZQ7 A;  2FML A;  1F43 A;  1JJ6 C;  3S5R A;  1YRN A;  5F6F A;  1WZ2 A;  3BG5 A;  2CV2 A;  5KCM A;  4GRI A;  2GM4 A;  2FNA A;  1P4A A;  4KDP A;  3KYL A;  4ENK A;  2XF7 A;  2PQ8 A;  3E97 A;  3REO A;  5F04 A;  4XOR A;  3M8E A;  1FOY A;  2DTZ A;  4PSX A;  1N25 A;  5F27 A;  1GXP A;  3OIQ A;  4HRI A;  1SEU A;  1V5F A;  1X3Z B;  2DMP A;  4II2 A;  4P1W A;  1BR1 A;  1E2X A;  1MNE A;  2CQQ A;  4D7N A;  4G7H F;  5B1B H;  2COM A;  2XB0 X;  3H0G J;  1XGM A;  2AXL A;  2BY3 A;  1I1S A;  1ONV A;  1YYV A;  2DOD A;  1MH4 A;  4AVP A;  4OD5 A;  2GA2 A;  3HGY A;  4IRH A;  2CWE A;  4M6Y A;  2ECC A;  2HDD A;  5DM6 F;  1D5V A;  3AG1 H;  5HAW A;  3PAS A;  3QU6 A;  2D1V A;  2ZJP F;  2ZOZ A;  1ZN2 A;  5ICG A;  3KEO A;  5D5U B;  5E8I A;  1TP4 A;  3ROU A;  2WV1 A;  2IA2 A;  4JOM A;  1VTN C;  3VVX A;  1PJR A;  1KZH A;  1KU7 A;  3ERM A;  2HXO A;  2M7B A;  2HEO A;  3FKI J;  4XOT A;  3TW6 A;  4LLN A;  3HB9 A;  5FLV A;  1WSU A;  2LKX A;  2B63 J;  1ODD A;  3F1B A;  1DU0 A;  2XB5 A;  3FDY A;  5F0H A;  4U7B A;  4IHV A;  4M3B A;  1RR7 A;  2PJP A;  3COA C;  4I0B A;  3M07 A;  4DYC A;  4XRS G;  2VKE A;  2EK5 A;  3CDH A;  2W7N A;  1IN4 A;  2YSR A;  2QA4 I;  1D8J A;  1IC8 A;  3EUA A;  1MJB A;  2KIU A;  2L7M P;  4G8X A;  2JA7 J;  5JHU A;  3HM5 A;  1P7I A;  2ZCW A;  3HOZ J;  2KZV A;  3G56 A;  1YW7 A;  5K7H A;  3JRA A;  1FYM A;  1MND A;  3KP3 A;  1CF7 A;  1GDT A;  5HOD A;  2OC6 A;  5FGL A;  3L2U A;  3CLQ A;  1K61 A;  1R5I D;  2OUM A;  1ZH5 A;  1EV7 A;  3K9T A;  2QCO A;  2X6O A;  3FMQ A;  3T1B A;  3IKT A;  1HLV A;  4NC6 A;  1OCC H;  1MMA A;  3KX2 A;  4IKF A;  2IVM A;  4D7M A;  1C0W A;  4ICH A;  2IPQ X;  5CYV A;  4CCN A;  2PJR A;  3BNI A;  3F8C A;  5D5X B;  2H6C A;  3J80 Z;  3V42 A;  5KAI C;  2RVC A;  4KJZ A;  1AHD P;  1WJD A;  4YG2 F;  4BHB A;  5KHD A;  4PJJ A;  2HQ5 A;  2VKV A;  4JNN A;  3VSK A;  5KNL A;  3KEQ A;  1AOY A;  2DMQ A;  3JRF A;  3F23 A;  1XGS A;  4XIC A;  1IF1 A;  3EUH A;  1TWF J;  3DLA A;  5CPR B;  3VYS B;  4W97 A;  1IRX A;  3LA7 A;  3ZRG A;  2A69 F;  3K2A A;  1L0O C;  1R23 A;  4UUS B;  3EET A;  3I71 A;  4YRV A;  4LD5 A;  1ETO A;  5ILU A;  3VYU B;  3MKW B;  2B9S A;  1Z05 A;  2L3D A;  2P6T A;  2IBD A;  3BJA A;  4CYD A;  1UAA A;  2LMD A;  1MBH A;  1S7O A;  3GTQ J;  2LH9 A;  1QZY A;  4NQW B;  4KIT B;  1W5S A;  1F5T A;  4DYR A;  4AD9 A;  4A2U A;  1IDZ A;  3HPG A;  3G7R A;  3T0Y A;  2V6C A;  2GXG A;  3GF2 A;  2CH0 A;  5ED4 A;  2QF7 A;  1AA7 A;  4CCL A;  2HOA A;  1PVE A;  4E7K A;  1XSD A;  1UB9 A;  2FUG 2;  3NEU A;  4BY7 J;  5E3O A;  2IW5 A;  2I10 A;  1S6L A;  2EZH A;  3JSJ A;  2KJC A;  5LRS A;  4PXI A;  3PIO F;  3CJN A;  2QSF X;  3CQZ J;  4GDF A;  4EMS A;  1J59 A;  2XKP A;  3BR2 A;  3DBR B;  3M1C A;  1LE8 A;  2Y75 A;  5HLI A;  2G0E A;  2HPI A;  4ZDL A;  2B3W A;  3CO7 C;  4RLF A;  1QZZ A;  2HDC A;  3Q3S A;  2OTJ I;  2DYR H;  2E1M B;  4RA2 A;  2EIN H;  1A35 A;  3CMM A;  3ZMT A;  3S3N A;  4MK6 A;  3W2W A;  1XB4 A;  4FQG A;  5DUI A;  2EZL A;  3S1N J;  3F6O A;  2MBF A;  1LEA A;  1ETQ A;  4U7D A;  4N4O B;  2E34 A;  2O5R A;  2XAS A;  3CP2 A;  4XOP A;  1N75 A;  1FX7 A;  2QSG X;  2CUZ A;  4KIC A;  1FOW A;  2K02 A;  2HWV A;  2CFO A;  2DMN A;  4LG0 A;  2C6Y A;  3MMY B;  4I02 A;  4XKC A;  2XAQ A;  5BQT A;  1ZRF A;  3G4S I;  3K10 A;  2XAJ A;  1DDN A;  4G9Y A;  3VEP A;  2B0L A;  4HX4 A;  4EVI A;  1BA5 A;  1B59 A;  1R1U A;  2JN6 A;  4Y17 A;  1BR2 A;  4DW6 A;  1S7A A;  3P5J A;  2VPR A;  5DD4 A;  5E79 C;  2P5V A;  1WHU A;  4DIQ A;  2PG4 A;  1FT9 A;  5EGO A;  3KKD A;  4BH9 A;  2HZD A;  3PJR A;  4HF2 A;  4YFX F;  3EPZ A;  3I59 B;  3TOA A;  1Y0U A;  1T38 A;  3FRQ A;  3HE0 A;  2UXH A;  3ON4 A;  1G3Y A;  5AQC A;  4XID A;  2CGP A;  3RDI A;  4GFL A;  4F93 B;  2LNB A;  1DGR M;  5F64 A;  1SAU A;  2XAG A;  3GBG A;  3CUO A;  3GX4 X;  3VOE A;  3ZQC A;  3GZ5 A;  5TIS C;  1QNT A;  5ILV A;  2ID6 A;  4I2O A;  5EG0 B;  4BQA A;  2IS4 A;  3SZG A;  3I59 A;  4MTE A;  4AF5 A;  5D5V B;  2R5Y B;  5GAG J;  4A0Y A;  1V4R A;  3OL4 A;  2HTS A;  1B4A A;  1TWC J;  1GHC A;  4RGS A;  2HI3 A;  1UI5 A;  3ZN1 A;  4ZYG A;  1G2H A;  2PN6 A;  5EG0 A;  1EH8 A;  2ID3 A;  2JVG A;  2QWW A;  2KP6 A;  3GZ6 A;  2MH9 A;  3WE2 A;  3RKQ A;  2O8X A;  1UI6 A;  4IVN A;  3C07 A;  2R5Y A;  2ME0 A;  2BY0 A;  3ANP A;  4P9U A;  2A68 F;  4IRG A;  3IV5 A;  3C2H A;  4ENJ A;  4FE7 A;  2BHZ A;  1RIO H;  1SMY F;  1VFC A;  2PBI A;  3SYT A;  3V8L A;  4UHT A;  3FXL A;  3OYM A;  2V1D A;  3MKL A;  4RM3 A;  5EEH A;  3NNR A;  3BCA A;  3QAH A;  4H4K C;  4L9N A;  1K7A A;  3I4M J;  3IC7 A;  2Z99 A;  1POG A;  1J5Y A;  4AVZ A;  3FIW A;  3PNT A;  4RS8 A;  2CRG A;  4D5F A;  1U2W A;  4HV6 A;  2BVM A;  3V8J A;  4G6T B;  4BXX J;  2LY1 A;  3I4P A;  1OR7 C;  2R5Z B;  1JT0 A;  4I01 A;  1VQP I;  1I1G A;  5LD2 C;  1TQI A;  2FEZ A;  2DT5 A;  3DU5 A;  4BQO A;  1D0Z A;  4AIK A;  1U6G A;  3GTL J;  3COL A;  2GXB A;  3VUQ A;  5EEA A;  2R5Z A;  2LRD A;  1K6O A;  1FTT A;  2IAI A;  3H92 A;  2NS7 A;  1BI0 A;  2VI6 A;  5FD5 A;  5IPA A;  3K4N A;  4XRS A;  3W6V A;  3J80 K;  2XKO A;  3OYL A;  2X6W A;  1TW2 A;  1X2M A;  4EEF G;  3FXQ A;  3H3U A;  1W36 C;  4FTH A;  2M8G X;  3K0L A;  3LAP A;  4B09 A;  2M7A A;  2CG4 A;  3CDI A;  5F0C A;  3E7Q A;  1XS9 A;  4KIS A;  2K9N A;  3ZQF A;  2M0M A;  1FBS A;  1G3T A;  2A05 A;  2ZC2 A;  4MTD A;  3L2V A;  4JKZ A;  2X51 A;  2OZU A;  3NS4 A;  1OYY A;  3I5U A;  5E1X A;  2JVH A;  2QTQ A;  3EUP A;  4QLC U;  1O3T A;  5K5R A;  2V26 A;  3CTA A;  2GFN A;  2NXN B;  5LHI A;  2JSC A;  1XC5 A;  3G1M A;  1U3E M;  2ZXJ A;  2QOP A;  3WG7 H;  2IA0 A;  3JAM Z;  2XRN A;  5HNF A;  3KP7 A;  2DO7 A;  5JR3 A;  1T98 A;  4DZP A;  3QKX A;  3FBN B;  4BDZ A;  3G6E I;  2ZNZ A;  1Y1W J;  2STT A;  2HFH A;  3C18 A;  3TGN A;  2W4S A;  5LGN A;  3GO5 A;  4DOZ A;  2F4M B;  2TRT A;  4I09 A;  3U21 A;  4MXM A;  5K58 A;  1MBF A;  1IXC A;  4UVB A;  2A6T A;  2EH3 A;  3CC2 I;  4HAM A;  3HTH A;  1TLH B;  2M8E A;  2VKH A;  2QQ9 A;  3I4N J;  3BRU A;  5FHP A;  2XPV A;  4Y33 A;  2OA4 A;  4D1Q A;  2O9L A;  4PFP A;  2H09 A;  3TO6 A;  2RAE A;  1HF0 A;  4N4N B;  2CUJ A;  2XAH A;  3SZP A;  3K1P A;  2ZY9 A;  3ZPL A;  3Q9V A;  2LK2 A;  5DS9 A;  1FY7 A;  2KKO A;  2QGU A;  1X58 A;  2AQF A;  4E70 A;  2NS0 A;  4I76 A;  5M5Y J;  3NXC A;  1A5J A;  2DJN A;  2DOE A;  2EV6 A;  3IP4 B;  3MEX A;  4XLF A;  4Z6Y A;  1YX5 A;  4XLC A;  3NRG A;  3AL0 C;  4MLO A;  1Z9C A;  2E5N A;  4BHC A;  3WTV C;  3CF2 A;  4KMF A;  3RSN A;  3LA3 A;  3CO6 C;  2JWT A;  5H6Q A;  3C7J A;  1U5T A;  1MNM C;  1FTZ A;  2VC1 A;  3HUG B;  4G94 A;  4O6J A;  3HOX J;  2BBY A;  4A3M J;  2OPT A;  5LGU A;  2KL4 A;  1H88 C;  1OKR A;  3E5U A;  2FBK A;  4A3L J;  3GCM A;  4WCG A;  2ZJR F;  4HX7 A;  4II3 A;  1K79 A;  1Z3Y A;  4XKW A;  2X9D A;  2K40 A;  3S1Q J;  4C3J J;  2DG7 A;  1D5Y A;  1BI3 A;  5FKL A;  3WOD F;  3JRC A;  2VE9 A;  1SVL A;  1TTY A;  3MD2 A;  2MLK A;  3OYC A;  3CWR A;  3WU2 C;  3GEU A;  3OV8 A;  2MSY A;  4S05 A;  3ABL H;  3ASO H;  2KQR A;  2UUZ A;  2X48 A;  1EH7 A;  3ZQL A;  2VB6 A;  3CP8 A;  4GXO A;  4EV0 A;  2ICW G;  4AYB A;  5IP6 A;  5L3E A;  3P9T A;  1K78 B;  3NWS A;  2MC3 A;  3KP6 A;  1HQC A;  2CQN A;  3MNL A;  6PAX A;  4R8H A;  5D5W B;  3DV8 A;  3HIF A;  2XGD A;  5HS9 A;  3TDU C;  3WTX C;  1TWH J;  2CW7 A;  2DW4 A;  1MIJ A;  2ZFU A;  4IHS A;  3V78 A;  3AAF A;  2HOT A;  1ZEL A;  2P5L C;  1VQ8 I;  5EFY A;  1R58 A;  2BEO A;  2E1O A;  2E5Z A;  3O8H A;  3W6K B;  2QQA A;  3SDB A;  3TMO A;  5F1J A;  5TGT A;  4XLE A;  5FLX Z;  1Z67 A;  1R5H A;  2LF7 A;  3ABM H;  4HEA 2;  2YU3 A;  3K1M A;  3KP5 A;  4EAT A;  4A5N A;  2RNJ A;  4HG2 A;  4OIR F;  4OWR B;  1IZ1 A;  2FNP A;  2DFF A;  4CXF A;  4DVY P;  4GCK A;  3PQK A;  4XLN F;  2F4O B;  3K4B A;  3F9K A;  1S9H A;  1GVD A;  1JUP A;  2DMU A;  2Y69 H;  4WX9 A;  2QSH X;  1ZRC A;  1G59 A;  4P9F A;  3PFI A;  5A2Q Z;  4L5E A;  1HDP A;  4YZE A;  5D8L B;  4A6E A;  3R0A A;  2EFN A;  1FC3 A;  1Z21 A;  1UMQ A;  2R7R A;  1IN5 A;  1OCR H;  1Y6I A;  4C30 A;  1X4O A;  1F1Z A;  3CJR B;  3VOX A;  3ESW B;  1A04 A;  1JKP C;  4CCM A;  4IHY A;  4JX4 A;  2WY8 Q;  3TO7 A;  2FOW A;  3K2Z A;  3GVA A;  2CJJ A;  2WY7 Q;  3ZMS A;  4I99 C;  3SEQ A;  2CSO A;  2W25 A;  1B9M A;  3GEZ A;  3ZXS A;  4JX6 A;  1IV6 A;  3S1R J;  2D2W A;  2P7C B;  1YE9 A;  2VT3 A;  2X4H A;  2GAU A;  1RKW A;  3WU1 B;  1ZYR F;  4V2F A;  3GFI A;  3HRM A;  4L5I A;  1QPI A;  3PL8 A;  1TWA J;  4J01 A;  3AFH A;  4UB6 C;  4U9L A;  1H9G A;  1JTX A;  1T56 A;  2M1B A;  4UXN A;  3FXM A;  3S17 J;  3BJB A;  3NWT A;  4IL6 C;  4F52 A;  2L7F P;  3BZ6 A;  4CSW A;  1T08 B;  1UG0 A;  2P8T A;  3JSP A;  2OER A;  5EYR A;  4WWC A;  1HOM A;  3ON2 A;  3GTG J;  1FOK A;  1OMI A;  5LRR A;  1G3S A;  2EPF A;  2YU9 J;  2HXI A;  2EZK A;  1W5T A;  3GXO A;  2VLA A;  2F5C A;  3Q0U A;  2HU9 A;  4CO8 A;  3N97 A;  4LB5 A;  1WRJ A;  2B1E A;  1GVJ A;  5LHH A;  2HVQ A;  1MMG A;  1TW3 A;  1FWZ A;  4CYC A;  2BHY A;  3DEW A;  3EUH C;  2R0Q C;  2HYF A;  4PZJ A;  1YG2 A;  1MJA A;  2DU9 A;  3S93 A;  1OYI A;  4LGW A;  3CD6 I;  4IRI A;  3HL2 A;  1MGT A;  1XGN A;  4HW0 A;  1AKH B;  3L2R A;  2UXO A;  4GO1 A;  4TV7 A;  3TDZ C;  3AL0 B;  2L7Z A;  2KLO A;  5J6X A;  3HRS A;  1RZ4 A;  4B47 A;  2BY1 A;  1VF9 A;  5HDK A;  2VOO A;  4CH7 A;  3ZN0 A;  2X6Y A;  3G2B A;  2L9R A;  4LK0 F;  4BEH A;  1XCV A;  2M0C A;  5K7Z A;  4L18 B;  1ZLJ A;  4Q4Z F;  3CCQ I;  4YEL A;  3DFG A;  3VTI A;  3CLO A;  3LA2 A;  1YLF A;  4MGR A;  3OR1 C;  1I3A A;  1S7E A;  1QA6 A;  2VXZ A;  1EJ9 A;  4V19 K;  5HOO A;  5ERI A;  5M3F J;  2EQR A;  1W0T A;  2F5F A;  4IQ4 A;  2OAZ A;  2XGX A;  4C2U A;  5KAF C;  3K4L A;  4KYW A;  3RPU D;  1E3P A;  2NNY A;  3VP5 A;  4E7H A;  3LSG A;  4YIF A;  4ZJZ A;  2IGK A;  4K2E A;  4NB5 A;  2KIS A;  3GTM J;  1FNN A;  1Z3X A;  2A6E F;  4LLL A;  1YRN B;  1W7P D;  2Y9Z A;  4HF1 A;  4BKX A;  3T5X A;  1WH7 A;  3RPU A;  3PO2 J;  3VFZ A;  5J8C A;  5IP9 J;  3GWZ A;  3JTG A;  3AQS A;  5DD8 A;  3HPH A;  2FMY A;  3PUB A;  1R4N B;  1W7P A;  2R3S A;  1ETV A;  1ZTR A;  1JKO C;  3OOP A;  2BYV E;  4HBL A;  5C44 J;  3GTP J;  3FXO A;  3BR1 A;  2E1M C;  4ESF A;  3KLN A;  2VOD A;  5HNH A;  3LHQ A;  1YX3 A;  3J7A Y;  4BS9 A;  2VQC A;  2VJJ A;  1MBE A;  3LSH A;  1TNS A;  2H8W A;  4CIC A;  4XM3 A;  4DQ2 A;  1KYZ A;  2XPW A;  3D5L A;  3RKX A;  2MFZ A;  4BBR J;  5EDN A;  5DYM A;  5J1Y A;  2DMT A;  2ZSI B;  1IGN A;  1K4T A;  4XK4 A;  3GYH X;  2EJR A;  3H35 A;  3K4J A;  4BE2 A;  2FRH A;  2K85 A;  3ZQH A;  1NG7 A;  4OIO F;  3CDL A;  2JJ7 A;  2VON A;  2FJI 1;  1D3Y A;  1SD6 A;  1G8X A;  2DA7 A;  1OPC A;  1V3F A;  1ENH A;  1ZR2 A;  2ZBK A;  3DPL C;  3GFL A;  3OIP A;  2PMZ A;  2J5P A;  1ZRD A;  1P6R A;  1ZRE A;  2QQB A;  2HKX A;  4HF0 A;  3BG6 A;  2JZY A;  2YX7 A;  4RAY A;  2LP0 A;  2VQH A;  4GFB A;  3KE2 A;  1MKM A;  2CUF A;  2JQ7 A;  4D5C A;  4EJV A;  2ESH A;  3KEY A;  1KGS A;  1VQK I;  3ABT A;  2K27 A;  3S32 A;  3R6S A;  3F8N A;  2NOJ B;  5EJC A;  5EZH A;  5E3L A;  2V57 A;  3H3V K;  3NAU A;  3DKW A;  2DXI A;  2HR3 A;  2ZO4 A;  3GZN B;  4DNC A;  5LEK A;  3X2Q H;  1ZAO A;  1BR4 A;  4U87 A;  4XRM A;  1CF7 B;  2IEK A;  1QRY A;  1XMK A;  4L9T A;  1ZK8 A;  5FLM J;  2R7F A;  3CCU I;  2VQL A;  2HZT A;  4P55 A;  5FLX K;  1LFP A;  3HSR A;  3PM1 A;  3RJP A;  4JX5 A;  1WJF A;  1IN7 A;  4LG3 A;  3SEZ A;  4UUV A;  1DU6 A;  3VW0 A;  4L5J A;  1U8B A;  3BWG A;  3LMM A;  1MW7 A;  3KZI C;  1RC9 A;  1YJN I;  4HNU A;  1D1B A;  3GTK J;  3OYK A;  1J75 A;  2PJR B;  3P9C A;  4ZYE A;  1SAX A;  2PFV A;  2O61 A;  1MBJ A;  4RAZ A;  5B1A H;  2ZKZ A;  4PJL A;  5A2Q K;  5FB2 A;  3K69 A;  2GIZ A;  3CJT B;  1LDJ A;  4L0Z B;  5HLT A;  4M3G A;  4F55 A;  4XON A;  5H2F C;  3UNG C;  1VQO I;  2E2I J; 
#chains in the Genus database with same CATH homology
 1ZGW A;  3QBM A;  2E2J J;  3BHQ A;  1OCP A;  3EGQ A;  1UI5 A;  1G2H A;  2D6Y A;  4ABZ A;  2ECB A;  5EG0 A;  2ID3 A;  2GEN A;  1B72 B;  1UI6 A;  4HNV A;  3RKQ A;  3C07 A;  3Q0V A;  2R5Y A;  2ME0 A;  3CMY A;  2R92 J;  3ANP A;  2WB1 N;  1LFU P;  2OF7 A;  2FX0 A;  1IDY A;  3HOU J;  4A3F J;  3LNQ A;  5IP7 J;  3IV5 A;  5M5W J;  5J1R A;  1T33 A;  4FE7 A;  4A3G J;  5J3L A;  1H8A C;  3RH2 A;  4RDU A;  4M6V A;  5HBU A;  4JP0 A;  3ZQG A;  1VFC A;  1B72 A;  2CU7 A;  3BR3 A;  1MSE C;  4S0H B;  2D5V A;  3MKL A;  3VVY A;  3NNR A;  4UDS A;  2Y31 A;  1ITY A;  3DPJ A;  2XRL A;  3I4M J;  1POG A;  4IHX A;  3S16 J;  2DA1 A;  3OSF A;  1JKR C;  1WPK A;  3FK7 A;  2YVH A;  3FIW A;  4I6Z A;  1B8I A;  2CRG A;  1GUU A;  4D5F A;  3CJD A;  4LOC A;  3VIB A;  4FE4 A;  1LE8 B;  4BXX J;  2R5Z B;  2QWT A;  1JT0 A;  3ANG A;  4AYB N;  2L0K A;  2NVQ J;  2YVE A;  3VW2 A;  1BJZ A;  2XPU A;  3IH2 A;  3D1N I;  1WCM J;  3GZI A;  2R93 J;  3ZOB A;  2VUM J;  3LSP A;  1EF4 A;  3GTL J;  3BG9 A;  3COL A;  3VUQ A;  5EEA A;  1X2N A;  3HOV J;  1BW5 A;  2NX4 A;  2R5Z A;  1JUS A;  3VPR A;  1FTT A;  2IAI A;  2NS7 A;  2VI6 A;  2Y0S N;  5IPA A;  5DAJ A;  1AU7 A;  3WHB A;  2NVY J;  4XRS A;  2XGC A;  2ZOY A;  3W6V A;  4AC6 A;  1UG2 A;  1MBK A;  1X2M A;  4EEF G;  1I3Q J;  3A01 A;  4FTH A;  2M8G X;  2N8G A;  3HTI A;  5C3E J;  4NDL A;  1FIA A;  1GV2 A;  3L1P A;  3QPS A;  5F0C A;  3E7Q A;  1XS9 A;  2HKU A;  1JTY A;  1JT6 A;  2K9N A;  3ZQF A;  4HKU A;  2LFB A;  1ETX A;  1IG7 A;  3TED A;  1OCT C;  3OSG A;  5JLW A;  3V6G A;  2DA4 A;  4JKZ A;  2FQ4 A;  3Q0W A;  4GCT A;  3M4O J;  1Y1V J;  2G7L A;  3EUP A;  2QTQ A;  1QVU A;  2PZ9 A;  2GFN A;  2M9H A;  3HTJ A;  4M3E A;  3K7A J;  1XC5 A;  3G1M A;  4MIM A;  5FJ8 J;  3QQA A;  2QOP A;  3HTA A;  5EGO B;  3B6C A;  4MFE A;  4B3A A;  2WGB A;  3OOU A;  4Y7N J;  3AQT A;  4DZP A;  2F07 A;  3QKX A;  4C3H J;  4GCL A;  5J1U A;  1Y1W J;  4M3F A;  2DG8 A;  2TRT A;  2OI8 A;  3LWJ A;  3CCY A;  4MXM A;  1ETY A;  5IYC J;  2XDN A;  5K58 A;  5H9T A;  1MBF A;  4G12 A;  2ZCM A;  3CRJ A;  1NK2 P;  4KWA A;  4ME9 A;  2EH3 A;  3LSR A;  2GBY A;  2FBQ A;  3HTH A;  3VOK A;  3I4N J;  1IJW C;  3HEF A;  2YUS A;  2REK A;  3BRU A;  2XPV A;  5E3N A;  5FHP A;  2E2H J;  5EF6 A;  2GLO A;  3LJL A;  3HDD A;  2O9L A;  2RAE A;  1TWG J;  2LD5 A;  1HF0 A;  1I6H J;  1U9O A;  3VVZ A;  2NOG A;  4A3K J;  5C4X J;  1JJ8 C;  2HYT A;  3E7L A;  4ACI A;  3SDG A;  4GFK A;  5D18 A;  3BR0 A;  2LK2 A;  5DS9 A;  2XSD C;  3JRE A;  5M5Y J;  1X58 A;  3LSJ A;  4I76 A;  3IH4 A;  1A5J A;  2R7Z J;  4MFD A;  3NXC A;  1E3O C;  2DJN A;  2WUI A;  3JRD A;  1TC3 C;  3S2H J;  2XGE A;  3PPB A;  3NRG A;  4MLO A;  3SJM A;  2UXI A;  5CXG A;  4X1E A;  2JWT A;  4A3B J;  2W53 A;  1UHS A;  2M34 A;  2DA6 A;  1MNM C;  1FTZ A;  3BCG A;  3HOX J;  4A3M J;  2OPT A;  2DA3 A;  3LOC A;  1H88 C;  1RET A;  3GTJ J;  3BQY A;  4A3L J;  2O7O A;  2G7G A;  3RZO J;  3OIO A;  2H1K A;  2X9D A;  2G3B A;  2K40 A;  4AC0 A;  3S1Q J;  4C3J J;  4DZJ A;  2DG7 A;  1MH3 A;  1QVT A;  1B8I B;  3RQI A;  4A3I J;  4AUX A;  2E2I J;  1D5Y A;  1ZQ3 P;  4A93 J;  5EZG A;  5FKL A;  5CXI A;  3TW7 A;  1O4X A;  1AKH A;  5C4Y A;  3TP0 A;  3QPL A;  2HYJ A;  3JRC A;  3S14 J;  4NN1 A;  2NP3 A;  1K83 J;  2PBX A;  3CWR A;  1ORK A;  3GEU A;  3WHC A;  2NVX J;  2MSY A;  3M3Y J;  2AO9 A;  2ME6 A;  2X48 A;  3MN2 A;  3ZQL A;  3JRI A;  3NAR A;  3B81 A;  5IP6 A;  2O8K A;  3P9T A;  1SGM A;  2O7T A;  3SFI A;  3MNL A;  1APL C;  1W0U A;  3RD3 A;  2XGD A;  5FKM A;  2KDZ A;  4L62 A;  1RES A;  4V2G A;  1TWH J;  5GPA A;  2NVT J;  3A01 B;  1PUF B;  3UKG A;  3HIM A;  4Y52 J;  3A02 A;  5GP9 A;  1Z0X A;  4UUS A;  2JK3 A;  1IUF A;  3V78 A;  2UXP A;  2HOT A;  2EBI A;  5EFY A;  2CUE A;  1JKQ C;  3BR6 A;  2E1O A;  5HSZ A;  3O8H A;  4A3J J;  4FCY A;  2M2E A;  3NPI A;  2FD5 A;  3S5R A;  1F43 A;  1JJ6 C;  5F1J A;  1YRN A;  5D19 A;  3BG5 A;  4M3D A;  1PUF A;  2ZCX A;  2GM4 A;  4QIW N;  1MSF C;  1SFO J;  1GV5 A;  2Q24 A;  4GCK A;  5F04 A;  2WAQ N;  1JGG A;  2DTZ A;  5F27 A;  5M3M J;  1GVD A;  1JUP A;  2DMU A;  1Z77 A;  2DMP A;  3BTC A;  4L5E A;  2CQQ A;  1HDP A;  3O8G A;  4D7N A;  4YZE A;  2NP5 A;  3HOW J;  2GUH A;  1UMQ A;  2XB0 X;  3H0G J;  1MH4 A;  1LFB A;  1NK3 P;  1OJL A;  3HGY A;  1JKP C;  5JLX A;  4A3C J;  3JRB A;  3VOX A;  4JL3 A;  1GT0 C;  2COB A;  2ECC A;  2HDD A;  4IHY A;  4JX4 A;  5M5X J;  3BTI A;  3HGG A;  1U9N A;  2CJJ A;  5HAW A;  3PAS A;  4JX6 A;  2ZOZ A;  2PMZ N;  2JMW A;  1IV6 A;  3S1R J;  1RKW A;  2WV1 A;  3O60 A;  4V2F A;  3VVX A;  1I50 J;  1QPI A;  1FEX A;  1R9T J;  2K9S A;  2HXO A;  3BTL A;  1FIP A;  1XG1 A;  1TWA J;  3FKI J;  5FKK A;  3TW6 A;  3HB9 A;  4DYQ A;  1JTX A;  1T56 A;  5FLV A;  3BJB A;  3S17 J;  2LKX A;  1FJL A;  3JR9 A;  2B63 J;  2L7F P;  1DU0 A;  2XB5 A;  3F1B A;  5F0H A;  4IHV A;  3VW1 A;  4M3B A;  2OER A;  1RR7 A;  5EYR A;  1HOM A;  3ON2 A;  3GTG J;  4DYC A;  3B6A A;  2VKE A;  4XRS G;  4X6A J;  2K9Q A;  2YU9 J;  2HXI A;  3GTO J;  2EZK A;  2ZB9 A;  1IC8 A;  2MG4 A;  3Q0U A;  2ELK A;  2L7M P;  5FKO A;  2JA7 J;  3HM5 A;  1P7I A;  2LY9 A;  3T6N A;  5F0F A;  3IH3 A;  3HOZ J;  3G56 A;  5K7H A;  5GPC A;  3JRA A;  1ZR4 A;  1JUM A;  4CYC A;  2LVS A;  1GDT A;  5HOD A;  3DEW A;  2R0Q C;  4A69 C;  2JA6 J;  2JA8 J;  5FGL A;  4JYK A;  1HCR A;  1K61 A;  1RPW A;  2LLK A;  3G1O A;  1AKH B;  2UXO A;  2QCO A;  2X6O A;  1HLV A;  2L7Z A;  4IEJ A;  1ZKG A;  1VF9 A;  4D7M A;  4ICH A;  2DA2 A;  1MBG A;  3S1M J;  3BNI A;  4IHW A;  2CQX A;  4A3E J;  2L9R A;  2M0C A;  5K7Z A;  1VND A;  1AHD P;  2Y30 A;  4BBS J;  4C3I J;  2HQ5 A;  2VKV A;  1HDD C;  3JRH A;  2QIB A;  4JNN A;  3S2D J;  1S7E A;  4C2M J;  3IUV A;  3KKC A;  2DMQ A;  4FIS A;  5IYB J;  3JRF A;  2E19 A;  4XIC A;  1P7J A;  1TWF J;  4RBO A;  1H89 C;  4W97 A;  1CQT A;  3K2A A;  5M3F J;  2EQR A;  3BT9 A;  4UUS B;  1W0T A;  1ETO A;  3VP5 A;  1U78 A;  2MGQ A;  3LSG A;  2IBD A;  2NS8 A;  3GTM J;  5IOY A;  2QKO A;  1MBH A;  1YRN B;  3GTQ J;  2Y9Z A;  4BKX A;  2AHQ A;  4DYR A;  1WH7 A;  3PO2 J;  5IP9 J;  5K7F A;  9ANT A;  1IDZ A;  3G7R A;  5FMP A;  1RKT A;  3AQS A;  1Q1V A;  4QTR A;  5C4J J;  2QF7 A;  5E3M A;  2HOA A;  4NEL A;  1ETV A;  1ZTR A;  1JKO C;  4BY7 J;  5E3O A;  5C44 J;  3GTP J;  3BR1 A;  2I10 A;  2EZH A;  1A6I A;  3LHQ A;  2TCT A;  3JSJ A;  3BR5 A;  1MBE A;  2DA5 A;  4PXI A;  2XPW A;  3G1L A;  3CQZ J;  4BBR J;  5EDN A;  3PO3 J;  2KT0 A;  3BR2 A;  1LE8 A;  1F36 A;  2G0E A;  5J1Y A;  2DMT A;  2W48 A;  1IGN A;  4XK4 A;  5FKN A;  3Q3S A;  3FIS A;  3S15 J;  1ETK A;  1WH5 A;  2P81 A;  3HKZ N;  4MK6 A;  1SAN A;  2EZL A;  3ZQH A;  3S1N J;  3BG3 A;  5IOZ A;  2LTP A;  3CDL A;  2JJ7 A;  3C2B A;  4B4C A;  3BQZ A;  2Y2Z A;  1ETQ A;  2DA7 A;  3KZ9 A;  1OFC X;  5CW8 A;  4CGR A;  2IU5 A;  1ENH A;  1ZR2 A;  3DCF A;  2Y9Y A;  2UXU A;  3BTJ A;  2H8R A;  2HOS A;  3FK6 A;  1BW6 A;  2DMN A;  2LP0 A;  2RAS A;  4GFB A;  2G7S A;  2CUF A;  3RZD J;  4D5C A;  3HBL A;  2DN0 A;  2YS9 A;  1BA5 A;  5EZH A;  5E3L A;  2V57 A;  2JN6 A;  3H3V K;  3NAU A;  1WI3 A;  4DW6 A;  4QSH A;  4XRM A;  4CYC B;  2IEK A;  1QRY A;  2VPR A;  2MW8 A;  1ETW A;  5IYD J;  4W1U A;  5F08 A;  1ZK8 A;  5FLM J;  2LR8 A;  1BL0 A;  5D1R A;  5EGO A;  3KKD A;  5BNG A;  2RHA A;  1IRZ A;  3PM1 A;  4JX5 A;  3ZQI A;  3A03 A;  1DU6 A;  3FRQ A;  1U8B A;  3HE0 A;  2UXH A;  3ON4 A;  3VW0 A;  4MO7 A;  5AQC A;  4J19 A;  4XID A;  4GFL A;  3F0C A;  3GTK J;  1VI0 A;  2FJ1 A;  3GBG A;  3ZQC A;  1MBJ A;  4UUT A;  4B1R A;  1WGX A;  2ID6 A;  3MVP A;  4BY1 J;  5EG0 B;  2JA5 J;  3HOY J;  3JRG A;  3KNW A;  3TP3 A;  2EZI A;  2ZCN A;  2R5Y B;  4AF5 A;  4M3G A;  3NI7 A;  4A3D J;  5DTD A;  1NTC A;  1TWC J;  2HI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...