5F27A

Structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 2 at 1.68a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
187
Chain Sequence
DRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title A fragment merging approach towards the development of small molecule inhibitors of Mycobacterium tuberculosis EthR for use as ethionamide boosters.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 80
structure length 187
sequence length 191
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5f27A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5f27A02
3HOYJ 3CQZJ 1AHDP 1Z0XA 2L0KA 1WI3A 2EZHA 1Q1VA 4A69C 5C4XJ 1ZR4A 1NK3P 1BJZA 1I3QJ 1POGA 4W1UA 4JX5A 4JKZA 2DA6A 5E3OA 4FTHA 2REKA 4HNVA 3JRDA 2UXIA 2AHQA 4BKXA 3HGGA 3BJBA 1X2MA 3IH4A 5EYRA 4JNNA 2GENA 1AKHB 2LFBA 3BCGA 2H8RA 1DU6A 1WH7A 2NS7A 1MNMC 1ETVA 2FJ1A 4DW6A 3GZIA 1AKHA 4V2FA 2EH3A 3GEUA 4C3IJ 1HDPA 4A3GJ 4XICA 3ZQIA 1T56A 3G1MA 3LNQA 1R9TJ 3GTLJ 5D1RA 4JX6A 2XGEA 2CU7A 2R5YB 4B3AA 4B4CA 3S2DJ 1SGMA 2NP5A 2ZCMA 3T6NA 2AO9A 1RESA 2P81A 2H1KA 2NP3A 1RPWA 2R5YA 3G1LA 5M5YJ 2LKXA 5FKKA 1XG1A 2YVEA 1FIAA 3DPJA 2DA5A 2DMPA 3W6VA 1UG2A 4JX4A 1JUMA 2IBDA 3UKGA 4A3JJ 3C2BA 1MBGA 5IOYA 2QWTA 2COBA 2B63J 3DEWA 3VW2A 4BY1J 3S1NJ 3WHCA 1P7IA 4AC0A 2LVSA 4EEFG 2R0QC 2EZKA 5IP7J 3JRAA 5F1JA 1IGNA 3S16J 4UUSB 4A3LJ 2TCTA 3HOVJ 2UXUA 2I10A 3E7QA 3S17J 3ZQCA 4UUSA 2FQ4A 3ON2A 3HKZN 3ZOBA 1TWCJ 2QIBA 1GT0C 4UDSA 2XPVA 2E2JJ 2KT0A 5J3LA 1TWHJ 2MG4A 4A3DJ 4MFDA 5C4JJ 3BR0A 3BG9A 1LFBA 2YUSA 2V57A 2ZCNA 3FK6A 3ON4A 3TEDA 2VKEA 1JTYA 5FJ8J 4AC6A 2XPWA 1ETXA 5F27A 3S1QJ 2NVTJ 2QKOA 1U78A 3WHBA 3HOXJ 3DCFA 3HB9A 2JA6J 2E19A 4NDLA 2X9DA 4A3KJ 2YVHA 3ANGA 5J1YA 5FHPA 3KZ9A 2UXHA 1F36A 3H3VK 1APLC 1HDDC 4CGRA 4DYCA 3LWJA 2ID3A 3IH2A 2O7OA 4M3DA 4C3JJ 1H88C 2OI8A 1ETKA 2MW8A 1JKPC 2ZB9A 5EF6A 3HOZJ 3LSRA 3B6AA 4JP0A 1MBJA 3MKLA 1XC5A 5FLMJ 5C4YA 3ANPA 1Z77A 5F08A 5FMPA 2PZ9A 5JLXA 2ME6A 2DA3A 2WUIA 3VVXA 5F0FA 2NVXJ 2OERA 2LP0A 3TP3A 2GBYA 3SJMA 4IHYA 3HOWJ 4B1RA 3MNLA 2XPUA 2DG7A 1IV6A 1K61A 1GV2A 4ABZA 2EBIA 3MN2A 3E7LA 1HF0A 3VP5A 1YRNB 5C44J 2R93J 4GFLA 3Q0UA 2FX0A 4X1EA 4Y7NJ 1MBKA 1JKOC 1JUPA 3AQTA 2HOSA 4M6VA 5K7HA 2CQQA 2L9RA 4W97A 3GTKJ 1E3OC 4NN1A 1MSFC 3B81A 3HTAA 3JRBA 2DMUA 2LTPA 3S1MJ 4GFKA 3BHQA 3A01B 3RKQA 3IV5A 1SFOJ 5M5XJ 3COLA 5FGLA 1I50J 3A01A 4PXIA 2W53A 2M8GX 1JGGA 1U9OA 1Y1VJ 3JRCA 4MLOA 3P9TA 1JKRC 2XSDC 4IHWA 3BTJA 2R5ZA 1LFUP 1NTCA 2FBQA 2JA7J 2DJNA 2RASA 1ETQA 1IUFA 2G3BA 5IYDJ 4MXMA 1VF9A 1BW6A 2LY9A 3BG5A 4M3GA 1TWAJ 4V2GA 2K9NA 5K58A 2NOGA 3CJDA 4YZEA 3SDGA 2PBXA 4XRMA 2HXOA 4XK4A 2G0EA 2VKVA 1FTTA 2VPRA 3CDLA 3PO2J 3VOXA 2CJJA 2M0CA 1PUFB 1ITYA 2JJ7A 5M5WJ 4DYQA 3NPIA 2YS9A 2CUEA 3LSJA 1PUFA 2GM4A 1WH5A 3M3YJ 5D19A 3JRIA 1ZQ3P 5HBUA 4M3EA 1TWFJ 2KDZA 2CRGA 3HOUJ 1ORKA 2LLKA 5HAWA 1LE8B 4AUXA 3H0GJ 1NK2P 3G1OA 3O8HA 3HDDA 1LE8A 1IC8A 3IH3A 5DTDA 4MO7A 3G7RA 1CQTA 3GTOJ 2HKUA 3KNWA 2JMWA 2XB5A 3V78A 2ME0A 3VW0A 1XS9A 1H8AC 4BBSJ 3LSPA 2JWTA 4RDUA 1BL0A 3HE0A 2PMZN 5EG0A 2LD5A 4D7NA 1IJWC 2CUFA 4IHVA 3GTMJ 3HIMA 4MFEA 1G2HA 2E2HJ 3V6GA 4UUTA 3PO3J 3VVZA 5IYBJ 4XRSA 2ZOYA 3KKCA 1P7JA 2ECCA 2FD5A 3JRFA 1A5JA 1FEXA 4JL3A 1ZK8A 4M3BA 2IU5A 5EZHA 3K2AA 4A3MJ 4GCKA 5GPAA 3I4MJ 1U9NA 1HLVA 3HTJA 2QCOA 1QPIA 1IG7A 3LHQA 3NNRA 3BR2A 1RR7A 3GTQJ 4A93J 2UXPA 3BRUA 2WB1N 2JA5J 5EFYA 2ID6A 1GDTA 2QTQA 4C2MJ 3QQAA 1OJLA 1JT6A 3O8GA 1K83J 2G7GA 1F43A 3I4NJ 3NAUA 3TP0A 3SFIA 5GP9A 2Y2ZA 1VFCA 1ZTRA 1B8IA 5EDNA 1IRZA 5EGOA 1MBEA 1OFCX 5EEAA 4ICHA 3RQIA 2DN0A 5C3EJ 3VOKA 4MIMA 4A3BJ 1RETA 4A3FJ 3VUQA 2HYJA 3BTIA 5F04A 3S14J 1DU0A 1JJ8C 2X6OA 3O60A 3RD3A 3ZQFA 5E3LA 1ZR2A 3KKDA 5HSZA 1JT0A 2L7FP 2HYTA 3BT9A 3FISA 5DS9A 1JUSA 1JTXA 2IEKA 5IOZA 4D5FA 3QPLA 4CYCA 1WGXA 2JN6A 2JA8J 4GCTA 1B72A 3BR1A 3HBLA 1Y1WJ 2RHAA 5FKOA 3FIWA 5F0HA 1W0UA 3HGYA 2CQXA 3LJLA 2DA7A 3NARA 2XRLA 2ELKA 1MSEC 2EQRA 3RZDJ 4A3CJ 3VPRA 2R5ZB 1MH3A 4S0HB 4D7MA 1FJLA 1S7EA 3NRGA 2DG8A 3OIOA 2Y9ZA 3TW7A 4FE4A 3JREA 3Q0VA 1WPKA 2DA4A 2WV1A 3Q3SA 4QTRA 3F0CA 2XGCA 4M3FA 4GCLA 2NVQJ 3AQSA 3S1RJ 4G12A 1RKTA 2UXOA 2XGDA 5BNGA 4ACIA 1ZGWA 2E2IJ 5HODA 2R92J 1T33A 1SANA 1JJ6C 2NS8A 2JK3A 2K9QA 5IPAA 1TC3C 2R7ZJ 5IP6A 3CWRA 3TW6A 4X6AJ 3C07A 3Q0WA 1U8BA 4DYRA 1QVTA 2DMQA 2HOAA 4LOCA 5FKNA 2M9HA 5K7FA 2O7TA 1H89C 3D1NI 3S2HJ 1W0TA 1WCMJ 1HOMA 3BR5A 2NVYJ 5IP9J 1ENHA 3MVPA 4ME9A 4KWAA 4L62A 2DTZA 3GBGA 3IUVA 2HDDA 3QPSA 2X48A 2O9LA 5FKMA 4BXXJ 2ZCXA 2F07A 5GPCA 5CXIA 4Y52J 2NX4A 2VI6A 3VVYA 2WAQN 3CRJA 1FTZA 2HQ5A 2G7LA 4HKUA 5FKLA 3GTPJ 3CCYA 2D6YA 3PPBA 1ETOA 5AQCA 4L5EA 4DZJA 5EG0B 3HTIA 1QRYA 3PASA 5K7ZA 4FCYA 1D5YA 4I76A 9ANTA 2MSYA 1ETYA 3HTHA 4AYBN 3JRHA 3NI7A 5IYCJ 1HCRA 3JR9A 3OSFA 4A3IJ 2XB0X 1JKQC 3GTGJ 3FK7A 4BY7J 3BTLA 2M34A 4I6ZA 3OSGA 2EZIA 1GV5A 2ECBA 1UI5A 5CW8A 3VIBA 2MGQA 3HEFA 4FE7A 2G7SA 2Y9YA 2XDNA 4MK6A 2L7MP 3LOCA 3OOUA 1ZKGA 3BR6A 1IDYA 1MBHA 2K40A 2WGBA 2EZLA 3G56A 2ZOZA 2TRTA 2W48A 5J1RA 2GLOA 3BNIA 3ZQLA 1IDZA 5M3MJ 1UHSA 2LK2A 3ZQHA 3NXCA 2L7ZA 2O8KA 2QF7A 3S15J 3PM1A 1RKWA 4A3EJ 3HM5A 2K9SA 1O4XA 2M2EA 4D5CA 3A02A 1B8IB 5EGOB 1X58A 1QVUA 2OPTA 1VI0A 4JYKA 2HXIA 5H9TA 5EZGA 3CMYA 4C3HJ 1EF4A 2QOPA 5D18A 2HI3A 1AU7A 3F1BA 1VNDA 2LR8A 3JRGA 3EGQA 3B6CA 3VW1A 1ETWA 4XIDA 1MBFA 1FIPA 3LSGA 4IEJA 2D5VA 3QBMA 5E3NA 2Y30A 2DA1A 2GFNA 4AF5A 5J1UA 3GTJJ 3S5RA 1UI6A 4DZPA 2RAEA 3BQZA 4GFBA 4IHXA 3EUPA 4CYCB 4QIWN 1A6IA 1BA5A 2IAIA 4J19A 5DAJA 3RZOJ 2HOTA 1B72B 1GUUA 2Y0SN 2N8GA 3L1PA 1MH4A 2OF7A 2Y31A 3BG3A 4RBOA 2YU9J 1GVDA 1TWGJ 5F0CA 2DA2A 1I6HJ 3QKXA 1X2NA 3BTCA 3BR3A 5E3MA 3JSJA 5CXGA 2DMNA 4FISA 4QSHA 1BW5A 4NELA 3RH2A 3A03A 1OCPA 1OCTC 3K7AJ 1UMQA 5JLWA 2Q24A 3FKIJ 4XRSG 4BBRJ 5M3FJ 1YRNA 2GUHA 2DMTA 3ZQGA 5FLVA 2E1OA 3BQYA 3FRQA 3M4OJ 2VUMJ
chains in the Genus database with same CATH superfamily
3HOYJ 3WTTC 5F64A 5LEKA 5C4XJ 3QOEA 3CZ6A 1BJZA 1I3QJ 3RCOA 1MJBA 2B7EA 1BR2A 1J2XA 4PSWA 1WVRA 1FMVA 3ZQ7A 4FTHA 3HHGA 1UHMA 3Q9SA 4BKXA 1BC7C 1MNDA 3FDYA 2FBIA 3HRSA 2LDUA 2PN6A 4UVBA 2JVHA 4ZTJA 1DU6A 1MNMC 3GZIA 4L9TA 1LFPA 3PUBA 1AKHA 4DVYP 2CW7A 2R7FA 3E5QA 4V2FA 4EM0B 3CCJI 3GEUA 4A3GJ 1MKMA 3OIPA 3R60A 4F91B 3CCMI 3IHUA 3RPQA 1R9TJ 2HGCA 2QM3A 4M9SA 1HC8A 3GWZA 1O57A 2NP5A 5D1RA 4B3AA 1SGMA 1Y8RB 2CQKA 5J8FA 2OA4A 1MIJA 2AO9A 2NP3A 1J5YA 2R5YA 2EV5A 2QQ9A 3G1LA 3TKYA 3JW4A 2X85A 4ZYAA 1O3TA 3MKZA 3HRMA 2YVEA 5DYMA 1MZBA 3JAMK 2KIUA 2DA5A 3L2RA 3W6VA 2AXLA 4JX4A 3C18A 2HYFA 2GXBA 1JUMA 2Q2EB 2HVRA 5KAIC 2DYRH 2F4IA 2COBA 2IVMA 2EA4A 3WTSC 2X51A 4EEFG 1D5VA 2LY1A 3ASNH 4AIJA 3F3XA 4CH7A 4JK1X 4M71A 3E6CC 4A3LJ 1PP8F 2HU9A 4RGUA 2W82A 2I10A 1DPRA 4I0AA 5AIPA 4FX4A 3ZQCA 4ENJA 2BY1A 3ZOBA 4A5MA 5D5WB 2VONA 2XPVA 5B1BH 4UDSA 5EJCA 2HZDA 2MG4A 4A3DJ 2IA0A 5C4JJ 3DTEA 2HKXA 2PJPA 1OCOH 3ZXSA 2V57A 4OOIA 3V7CA 2JUGA 4MQVA 4ENKA 3TEDA 2KP6A 3CCVI 2HQAA 4UB8C 3EYIA 1NG6A 1ZRFA 2XPWA 4BUPA 3JSOA 1ETXA 2BXYA 5F27A 5JVGF 1ZG1A 1UFMA 2NVTJ 3S1QJ 1DP3A 5JI6A 1N75A 1RUNA 3DCFA 4HX7A 2QQ8A 4A2UA 5DDGA 2W85A 2E19A 1U6GA 2JPBA 3WE2A 2YVHA 4XL9A 1SFKA 3ANGA 5ILSA 5FHPA 2MD5A 4GGGA 2Z5UA 1HDDC 2F5CA 2LYCA 4DYCA 2FNAA 2ID3A 1R00A 1ZRCA 4J01A 4N4OB 2OI8A 2FEZA 1BM9A 1IXSB 3ERMA 1JKPC 2ZB9A 3MZHA 5EF6A 4Y4RA 4PGGA 1BR1A 2X6XA 1MBJA 4JP0A 2MH9A 1XC5A 4HDVA 2LMDA 4M9ZA 2PZ9A 2KISA 5L3GA 2WUIA 5CYVA 2NVXJ 1JE8A 4BHCA 4IHYA 3SJMA 1Z6TA 4DNCA 2DDBA 4HQMA 1IV6A 4ABZA 3PNYA 3IKVA 3MN2A 4BJ5C 3NWTA 3S8PA 4OIPF 3VP5A 1YRNB 5C44J 3MFKA 4GFLA 2LKSA 3R0JA 4A12A 1MJAA 2KZVA 1YJ9I 4X1EA 5D5UB 1Z7UA 3LAJA 1SFXA 3H9QA 2HOSA 2XDVA 2CQQA 3FM3A 2Y0SA 1FYMA 2ZO4A 4I99C 2CFXA 5FGMA 1QU3A 1Y6IA 2DMUA 3N4MA 3D0SA 3E5UA 3O3KA 2GXGA 1SFOJ 3HRUA 3A0HC 1TTYA 3AKZA 2V79A 2QBYA 1YITI 1V5EA 3A01A 3H3ZA 1Y1VJ 1CF7B 2A5WA 1FY7A 2PLYA 5FFXA 1BR4A 2XSDC 3OYGA 3ERED 3PQJA 2ZXIA 1NTCA 4RM3A 2JA7J 2ZSHB 5H20A 2DDAA 3FKJA 5DCMB 4OIOF 2IS1A 5IYDJ 4V2GA 2Z2SB 4XNFA 5LRRA 2EB7A 2HZTA 3EYYA 3ZQQA 4Z6YA 4H4KC 5GAGJ 3I53A 3TGNA 3CJDA 2MD0A 1G3TA 2M1BA 3IRQA 3J81Z 1WJFA 1BIAA 2VPRA 3PO2J 2ISYA 1BBYA 4KJZA 4P55A 3TO7A 4UVAA 4HW0A 2G7HA 3M07A 4IVNA 2YS9A 3RKYA 4PUSA 4KT5C 5F1RA 2V7FA 4M3EA 2R7VA 3HOUJ 4BYYA 1W7PD 1C0WA 1FOKA 1ZG3A 4KA4A 2DLLA 1XCBA 2FMLA 3BJ6A 3PSIA 3G4SI 1LE8A 2E71A 5HLGA 3IH3A 4RM2A 1IC8A 3ZMTA 1CQTA 3GTOJ 2XB5A 3E5XA 4NC7A 1LQ1A 1U2WA 2F48A 2BY3A 3KP7A 4AWXB 3LSPA 2JWTA 1MGTA 1ONVA 3DEEA 2QEXI 4D7NA 4KICA 1Z9CA 4II2A 5HDKA 4G9YA 3OYKA 4M73A 1DGWY 2KIQA 4R1HA 5LGTA 2RC4A 2R7WA 3KKCA 3JRFA 1A5JA 1ZN2A 1USSA 4EVIA 4M3BA 4OIQF 3HPGA 2PBIA 3K2AA 2XAQA 1P92A 3CCQI 3ZCOA 1HLVA 1JI8A 3OS0A 1PJRA 1QPIA 2PG4A 4BXUA 1IF1A 3NNRA 3BRUA 3PFYA 1D8JA 5EFYA 1MDMA 2ID6A 2Q1ZB 3H5NA 3LA2A 4NUBA 4C2MJ 4CA0A 3QQAA 3O8GA 1F43A 3F23A 4LLLA 3BLYA 3D5LA 3EDPA 2E1MC 2K3FA 2Y2ZA 1VFCA 1B8IA 5EGOA 1BI1A 1OFCX 3DU6A 3W2VA 4ICHA 3GYHX 4B09A 4MIMA 4IQJA 4A3BJ 3IRRA 3BROA 3OL3A 3BTIA 3S14J 1ZGJA 5KHDA 2OTLI 3O60A 3ZQFA 5E3LA 1ZG5A 3OOPA 4EJTA 1D0XA 2R7OA 4A6EA 3FISA 1H9GA 3HRTA 3R0AA 5HDNA 4RAZA 2ETHA 2VC0A 3BDDA 3HSEA 3I3LA 4CYCA 2CQ7A 2JN6A 3VDXA 3REOA 3BR1A 3HBLA 4D9JA 4IRIA 2HNHA 1MW7A 5F0HA 1ZELA 5AIQA 3HGYA 2QBYB 2CQXA 4OMZA 3NARA 3DWLE 2ELKA 2Z3YA 3KZYA 4XORA 1MSEC 2E5NA 4BU2A 3VPRA 3VYUB 1MH3A 4S0HB 1S7EA 2KKOA 2IT0A 3HYIA 3GZNB 2EFPA 3M8EA 3K70C 3OIOA 2DG8A 4U0YA 1KU7A 1Q1HA 5JHUA 3KP3A 1SD7A 2BV6A 1WPKA 3GXOA 3LFUA 1O3QA 2H8WA 3FXQA 2WV1A 2ZFUA 3RIRA 3F0CA 3F8CA 4U0VA 3FZVA 5FLXZ 4G12A 4FHTA 3VSLA 2FXAA 4IJAA 1VTNC 1FPQA 2XGDA 4XN3A 3QPHA 5HODA 3VSKA 4YEJA 2NS8A 2K9QA 3LFKA 1XD7A 4Y33A 3Q0WA 4BH9A 4CSWA 1WWXA 2M9HA 2QWWA 3OIQA 2K3PA 2WBMA 4E4HA 1H89C 1K4SA 4L18B 1NH3A 1W0TA 1WCMJ 1HOMA 2JUCA 4OAZA 2XGXA 4ME9A 3MVPA 1UG0A 3EUHC 4HRIA 2DTZA 3VWBA 3IUVA 3F21A 2W4SA 4RAGA 3IL2A 4DIQA 2E35A 4ZH4F 1FSEA 1FYLA 3S32A 2A61A 1LDDA 2B1EA 2DPUA 3VVYA 1SC7A 3PQKA 1B9MA 2HQ5A 2VOPA 4HKUA 3ZR8X 1ETOA 2Z99A 5TISC 3VEPA 1VQ9I 2BHYA 4KUMA 4H0EA 3LQRA 3DV8A 3CLOA 2H94A 2ZY9A 5AONA 1TLHB 2HYGD 5KAFC 4AYBN 3R6SA 3ECHA 1ZARA 3OSFA 4A3IJ 4EJVA 2KFDA 4Q4ZF 2UV1A 4C2MA 5CW8A 3VIBA 1W5SA 4M72A 4AIHA 3HEFA 2G7SA 2UUZA 1FT9A 4Q47A 2H09A 4OIRF 4MK6A 3LOCA 1ZKGA 5LBQA 1MBHA 2BZTA 2WGBA 2E1MB 2KRCA 2EZLA 3G56A 2V6EA 5CPRB 2W48A 1MDMB 2PMZA 1ZLKA 1XGOA 4RLFA 3ZQHA 4O3MA 2QF7A 2ZMEA 2TDXA 3RYPA 2VODA 3P9IA 4YRVA 2A6HF 1S5LC 1B8IB 5EGOB 1X58A 1QVUA 3GFJA 3CMYA 5H2FC 1EF4A 5DV5A 5D18A 2ZMEC 3QWLA 2IJLA 2ZJRF 1XSDA 1AU7A 2VIXA 2ZFWA 4IKFA 3B6CA 3L7WA 1V55H 1P6RA 4EMSA 3V4GA 4KITB 1FIPA 3LSGA 2KRFA 3SHFA 5LFAA 4IEJA 1S7AA 3I64A 2BE5F 4AF5A 3H9JA 2O3FA 2UXXA 1NHAA 4C9YA 2OAZA 4AIDA 4GFBA 3K2ZA 3ABUA 1LVAA 2BVLA 1AA7A 2F4MB 2KHMA 3K4BA 4CYCB 5BPDA 4J19A 5DAJA 2HOTA 1GXQA 3L1PA 1GVDA 4PCQA 4KDPA 3BTCA 1OPCA 1GHCA 1S7OA 2QUFA 1OQYA 1S6LA 3K7AJ 2Q24A 1Z3YA 5D5VB 2Y69H 5HS8A 1TL8A 2WA0A 2P4WA 1SD6A 1YOVB 1N25A 3LWFA 3M4OJ 2REKA 5DUKA 4CCNA 1Z0XA 5KCMA 1Q1VA 1W5TA 2BY0A 3EETA 1ZR4A 1NK3P 4W1UA 1G4DA 4JKZA 3BCAA 3CJRB 3FMQA 4CCLA 2RVCA 3HOTA 1RR8C 1MMGA 4HNVA 3CO6C 3JRDA 2C6YA 2FUG2 4XOTA 1O7LA 3G6EI 3HGGA 3DTIA 3NQOA 3H5AA 3DLAA 3CMAI 1X1AA 1MMAA 5EYRA 1IAWA 1GXPA 2NS7A 2FJ1A 1XSXA 2VASA 4KNYA 2FA5A 2EH3A 4XKVA 4XICA 3ZQIA 2X1CA 4NBQA 3G1MA 3LNQA 1ULYA 5D6EA 5CVVA 4IRHA 1D0ZA 3T6NA 3L09A 2BEOA 5J4YA 5CLSA 1KQ9A 1RPWA 1X3ZB 3J7AO 2LKXA 3CCRI 1X1DA 3HIFA 4XSXF 4EV0A 4A0ZA 1R5HA 2O5RA 3E0JB 4UVCA 1OCRH 2STWA 2DMPA 1R5ID 4XOPA 4XLCA 4DGWB 3M9AA 2XV4S 4HA8A 4B3XA 3WTWC 1MMNA 5IT9K 3BOQA 3PNVA 3SWHA 1Z1DA 1ODDA 2GA1A 3M1EA 3C2BA 3PSFA 5IOYA 2B63J 3LA3A 5D8LB 3S1NJ 1P7IA 2L7KA 3GZ5A 3NWSA 3KEYA 1FNNA 2EZKA 5IP7J 1R4MB 1PYVA 2IP2A 2DQLA 3KLOA 4CICA 2E60A 2FOWA 4KMUX 3C3WA 4UUSB 3HOVJ 2UXUA 3J80Z 1KYZA 3ON2A 2DJIA 4RB1A 1Z91A 2Y0MA 4Q48A 1J0RA 1R71A 4XKBA 4F7ZA 4IRVA 1X3WB 1W7PA 2E2JJ 4BHPA 1R22A 4YG2F 4G94A 3CP8A 1BI3A 2OV7A 3GZ6A 5GADJ 1M1EB 2W25A 3BR0A 2YUSA 1I5ZA 5FJ8J 1IN5A 2NOJB 3E3VA 4XKWA 2QKOA 1B9NA 3WHBA 4P9UA 1VQ7I 3HOXJ 3HB9A 1UJ8A 3ZMSA 3S3MA 1P4AA 4ZC3A 2Y48A 3MWMA 3BPXA 3I5UA 2L9VA 4C30A 5J1YA 2E7WA 1A31A 2CSOA 5JFRA 4ZTFA 3LWJA 4CGRA 3BJOA 1BOBA 3RYRA 2FRHA 4XLHA 2WB1A 4MGRA 3HOZJ 4GDFA 2M4GA 3B6AA 3H3UA 1BC8C 1WI9A 1TNSA 1V5FA 3MKLA 5C4YA 1Z77A 5DEQA 2AQEA 4CUGA 3MD2A 2ME6A 2DA3A 2EJRA 2IGMA 3VVXA 2KL4A 3HSRA 2VT2A 3WTUC 2CS3A 4HF0A 1K61A 1GV2A 3AG2H 2EBIA 1J09A 2DBBA 3LAPA 1E0EA 2VJ4A 1R4NB 1HF0A 4M6XA 2EILH 3BCBA 1YX5A 4F52A 2XKPA 2OU2A 1WFXA 2KRHA 2ISZA 1MBKA 1QQIA 2DW4A 1N77A 4EJUA 4M6VA 4LMYA 2DPDA 5K7HA 1VQOI 4L5JA 3GTKJ 4UNOA 1QO0D 3KYCB 4NN1A 1I1SA 1TZLA 1SFUA 4LLNA 3S1MJ 4RGSA 4GFKA 1WSUA 4RMNA 2CFOA 2HTSA 1TNTA 5FGLA 3GO5A 3OYMA 1I50J 2CUJA 2A5YB 4PXIA 2M8GX 1QNTA 3K4JA 1JGGA 4L9JA 3BG6A 3L2UA 4G8XA 4G6TB 4G6DA 1LFUP 3PIPF 1YJWI 1S29A 1X1BA 1CF7A 3F8NA 4EJOA 4IF4A 5DM6F 1XMKA 1ETQA 1IUFA 2CMPA 1EH8A 3PUFA 4A5NA 3BG5A 4M3GA 5DCMA 2F4OB 2VBXA 2E36A 2ZJQF 4QPQA 4PFOA 2NOGA 2AQFA 4YZEA 4CCOA 2JVGA 1VQ8I 1BI2A 4RB0A 2B0LA 1B59A 2CW0F 4E6KG 5FD6A 3GFMA 3VOXA 2CJJA 4AIKA 4KFCA 1V3FA 4P9FA 4XONA 1ITYA 5M5WJ 1T98A 3GLXA 3NPIA 1U5TA 1ZLJA 2DFHA 3QP6A 4UHTA 2XAHA 1RC9A 2CUEA 3LSJA 3FXUA 1LUJB 3N05A 1BI0A 2MC3A 4PGHA 1YHQI 1W4MA 2KDZA 2CRGA 2HPMA 1XN7A 1RUOA 1ORKA 1QHHD 4ESBA 3H0GJ 1RZ4A 1O7FA 4BAYA 4HZFA 3K4MA 1NK2P 2O61A 3DLLF 1IN7A 2EV6A 1U5TC 5E79C 2WAQA 4HF1A 3KCCA 1F5TA 3G7RA 4BNCA 4XQFA 3K4LA 1JGSA 4XM3A 1W7PB 2HKUA 3V78A 1YQAA 3VW0A 3ABTA 4E7IA 3OMYA 4BBSJ 4ZDPA 1IV8A 3MMYB 2Z9OA 1BN5A 4O6JA 3S2WA 5EG0A 3ELKA 4ZYEA 4IHVA 1G2HA 2ELHA 2VB6A 4D0PA 5E17F 3PO3J 2PFBA 5F6FA 3F22A 3PFIA 3DF8A 3RQ4A 3T8TA 3VVZA 1LPQA 5ED4A 2ZOYA 1FSHA 2ECCA 4XLEA 1RI7A 3UNGC 3NS4A 1R1VA 3OYNA 4GCKA 3CLQA 1UZCA 1G3YA 2ESNA 4I09A 4IX7A 1EV7A 4OU0A 2DK5A 2XRNA 3HJEA 1RR7A 4I7HA 3CF5F 3A2KA 3GTQJ 4A93J 2UXPA 2WB1N 3EPZA 1YX3A 3H36A 4WXDA 2O8XA 5CVIA 2CW8A 3ZN1A 1OJLA 4BQNA 3GF2A 1KU3A 4EM2A 4RAFA 2CGPA 3HL2A 1OYWA 5GP9A 1ZTRA 1TW3A 3D5SC 1MBEA 2IRFG 4ESFA 3RQIA 4LGWA 4BEHA 2AS5F 4KT6A 5C3EJ 1KZHA 1OKRA 2XAGA 2A2FX 1ZRDA 2X6YA 2F6CA 4A3FJ 3VFZA 2HYJA 1X4OA 2I5UA 2DTRA 3L2VA 3RD3A 3KKDA 1LKXA 2JPCA 3VOEA 4E7LA 3F9KA 1YS7A 3B73A 1B1BA 2EFOA 1JTXA 1IRFA 6PAXA 2JA8J 4LD5A 1Y1WJ 2RHAA 4U0WA 3I58A 2XRLA 2R7QA 2EQRA 3RZDJ 5D5XB 3FXRA 1HKTA 1MD0A 1S72I 4MNUA 1VQ5I 3QYBA 3TW7A 2XAJA 2A68F 3OYFA 1D1BA 3W3CA 4KN7X 3OS2A 1I27A 2XGCA 3ZN0A 2VBZA 2OQRA 2NVQJ 3S1RJ 5B66C 1IO2A 4QPOA 3FM5A 4IL6C 4ACIA 2P0WA 4G6QA 2NRAC 5E1WA 4DQ2A 4J00A 2P5VA 1SANA 1JJ6C 3M8JA 2JK3A 4HNUA 2VPLA 3CUQB 4GYIA 4KIGA 3TW6A 5D8KB 1DDNA 1YIJI 2HOAA 1X1CA 1U5TB 5FKNA 2O7TA 1QZEA 1W1WE 3AG3H 1XGNA 3WTVC 3D1NI 3TQNA 2K9LA 3BR5A 2NVYJ 3LMMA 4KWAA 4L62A 3GBGA 2VL8A 2ZCXA 2X48A 3QPTA 2VOOA 5GPCA 4CHUA 5CXIA 4Y52J 2NX4A 2RQQA 5DD4A 4R79A 2WAQN 5KK1A 3CRJA 2IS2A 2PQ8A 2K5CA 3DFGA 3PJRA 1ZGAA 5AQCA 2LKPA 5H6RA 1KQ8A 5EG0B 1QRYA 2VLAA 4FETA 3QYEA 1D5YA 4I76A 3CTAA 9ANTA 2MSYA 2DFEA 3HTHA 1HCRA 3U2RA 1T2KA 1DPUA 2WAFA 3RTRA 1JKQC 3PIOF 2OCEA 3FK7A 3BTLA 4I6ZA 3AG4H 2EZIA 2KMUA 3HTUA 3JTGA 1IZ1A 1I3AA 4KIBA 4OAYA 3FHZA 2XUBA 2IXSA 2XDNA 4B44A 3CC7I 2ZOZA 3BY6A 2J5PA 2TRTA 3K1MA 5J1RA 1JHFA 4HF2A 2YX4A 1IDZA 5M3MJ 2M5WA 1WJ5A 2LK2A 3WU2C 2MLGA 1VQPI 4FT8A 2GIZA 3LQQA 3S15J 3H0DA 3PM1A 2PI0A 4S05A 1VQ6I 4G7OF 3KEQA 2ICWG 2CG4A 2K9SA 3GFLA 2M2EA 1U0JA 2L02A 4BEHB 2P6SA 3SZGA 2D1HA 4PZJA 3CMEI 2HEOA 2QOPA 2FE3A 2HI3A 3IP4B 3EUKL 1G59A 2XHKA 3F1BA 2LR8A 1K79A 3EGQA 2F2EA 2VKDA 1MBFA 2FBHA 2W00A 5E3NA 2DA1A 5HNFA 4NB5A 3O6BB 2DI3A 3FBNB 4YIRX 2XSJC 3EUAA 2GWRA 1J7KA 3CMMA 2OQGA 4WXCA 2Y0SN 2KPMA 2OF7A 2HFHA 2ZCWA 3LSTA 1IRGA 4FQGA 1I6HJ 2IPQX 3BR3A 1MMSA 5D4RA 4E70A 5CXGA 4FISA 4QSHA 3LA7A 1BW5A 2BVMA 1MNEA 2LG4A 4WX9A 4QWQA 1OCTC 1UMQA 5B5EC 5JLWA 3KP5A 3KZIC 4L9VA 4BS9A 3I9V2 3ZQGA 2R7UA 4WCGA 4ETSA 2L0KA 1R5GA 2A69F 2EZHA 1FBUA 4A69C 2UXNA 3TDUC 1POGA 1FOWA 4HSRA 4JQFA 4PFPA 4N4NB 3WE3A 1LEAA 5E3OA 4BQAA 1D3YA 4I01A 3C7JA 2J5OA 2UXIA 1ZYRF 1N78A 3H5RA 1X2MA 5HLTA 3COAC 3EUHA 1AWCA 2GENA 2FNPA 2LFBA 4HDUA 1YTYA 1A35A 1WH7A 3K69A 3IAS2 3U1KA 3KEOA 2L4AA 4DW6A 4N9IA 3ABLH 1HDPA 3L00A 2V6CA 3Q5FA 1T56A 4BJTA 4F92B 4HX4A 4JX6A 2XGEA 1B6AA 1XDUA 2FF4A 4XLNF 4B4CA 1SMYF 4AU7A 3S2DJ 1W36D 3J7AY 1RESA 2P81A 5EEGA 2H1KA 2VBWA 4ENMA 5FKKA 4XMYA 3R61A 1XG1A 3FXMA 4EM1A 2PX9A 4GYGA 1V5GA 3P7NA 3U9GA 2EIKH 3MQ0A 3K6GA 3M1CA 4NNJA 4EJWA 1RRJA 3UKGA 4A3JJ 5ICCA 1E17A 5TJJA 4CZCA 2QWTA 3BZKA 1V4RA 3DEWA 3VW2A 2DOFA 3WHCA 3OYCA 4AC0A 4CO8A 1Z21A 1EKEA 1DQUA 4YFNF 1IGNA 1IXCA 3TO9A 2DT7B 2GA2A 2BW3A 2TCTA 5K1YA 2G7UA 4IQ4A 5HLHA 3E7QA 3S17J 4A6DA 4UUSA 2V1UA 1SVMA 3CJNA 3QODA 4NQWA 2MA3A 2GOMA 4CDGA 2OJED 5CKTA 3K4CA 1V54H 5J3LA 5ICGA 1TWHJ 2A3SA 2O03A 3OY9A 2Q0OA 1P4XA 1HBXG 2FMYA 3BG9A 1LFBA 3NEUA 4ITVA 3ZGKA 1PP7U 3FK6A 3K10A 2K7LA 2DAOA 2VKEA 4AC6A 3H1CA 3QRFF 3E97A 3L2QA 5L3DA 2EK5A 3J81K 1UELB 4A3KJ 1GVJA 2EIMH 2ZJ2A 1T8IA 1F36A 3OR1C 2ZSIB 3O2PE 3VYRB 4LK1F 3IH2A 4HG2A 3ZRGA 2MABA 4JBAA 1ETKA 1BJAA 1QZYA 1P2FA 2MW8A 5LD2C 3HC7A 5BMZA 2I8DA 4Y13A 2ELJA 2M7BA 5KNLA 3ANPA 5F08A 5FMPA 2WC2A 1T38A 1D8KA 5JLXA 5ICFA 2WAEA 2G9WA 4HLXA 4WXHA 2LP0A 2WV0A 3HOWJ 2XPUA 2DG7A 4UXNA 1Y0UA 2XVCA 4ENNA 3E7LA 4ON0A 3W2AA 2KZGA 1L3LA 2F5DA 2R3SA 4PK4A 3WGHA 1AOYA 2QZ8A 3BJAA 1Z3XA 3JAMZ 2MH2A 2DFIA 5HS7A 3DKXA 4ZYGA 5ILVA 1OLTA 4CZZA 1FWZA 1Z67A 3IWZA 1JUPA 3AQTA 3F72A 1HQCA 2L9RA 4W97A 2ZXHA 1FYKA 2JZYA 2CYYA 2R7RA 1XPXA 1MSFC 3HTAA 2VQCA 2YX7A 3PL8A 1Z05A 5D4SA 2FJI1 4RB2C 5D6FA 5LRSA 4UY8I 3F8MA 3COLA 2FOKA 3KETA 5J4VA 3CJTB 1Z7LA 1P4WA 1QPMA 1NG7A 4MLOA 3T1BA 1JKRC 3BTJA 2R5ZA 1WZ2A 3UR3C 2FBQA 4RS8A 2XC7A 2BOLA 2V26A 1TP4A 3FMSA 3JTHA 4YFXF 1YE9A 2B9SA 3WTXC 3ML6A 2CQNA 4S04A 3MKYB 2V4JC 4HOBA 1XDSA 2YR2A 3FWEA 1VF9A 2LY9A 1IW7F 3DBHB 4I2OA 3RPUD 1HKSA 4U7DA 4U9LA 5K58A 5K5QA 4NHJA 4LK0F 3SDGA 3A1YA 2PBXA 4UUVA 2DODA 2HTJA 2HXOA 3V8LA 2YSRA 2HPIA 2L2OA 2G0EA 1KQ0A 2XAFA 4XKCA 1LB2A 2DOAA 5KVRA 2M0CA 1PUFB 2JJ7A 2L5QA 4DYQA 2Y75A 3E6DA 2R7TA 4G7ZF 4PJNA 2GM4A 1WH5A 5D19A 4QLCU 3JRIA 1ZQ3P 1TWFJ 4NC8A 5CVRA 1REPC 1IN8A 5B1AH 1G3SA 3QU3A 3GUDA 2LLKA 5HAWA 2BW3B 1XTAA 2EWNA 2X6WA 3G1OA 5E18F 3O8HA 3HDDA 3V7RA 3CCLI 2ZNZA 3EQLF 2M8EA 4OMYA 1PUEE 3KX2A 1EH6A 2E7XA 4MO7A 3ZP5A 4NQWB 3GCMA 3KNWA 2QYOA 2ME0A 3A0BC 5E8IA 1H8AC 3WU0A 1BL0A 2E5ZA 2MFZA 3K1PA 2PMZN 5FLXK 4A0XA 2CUFA 5CQGA 3FXOA 3GTMJ 3HIMA 1FC3A 4MFEA 3L2CA 2E2HJ 2CV1A 1Y56A 5HOOA 3V6GA 4HLYA 4GRIA 5IYBJ 2XASA 1VQKI 1X1PA 3CP2A 1P7JA 4Y15A 1K4TA 4JL3A 3K9TA 4OD5A 3OYEA 5EZHA 1KYWA 1H9TA 5GPAA 4LB6B 5HDGA 3C2GA 1U9NA 4IPAA 3HG9A 5J8CA 4RGXA 3LHQA 1SD5A 4F55A 4IOAF 1MJ9A 2NYXA 3OV8A 1RNLA 4ZZLA 2F5FA 3BG7A 2JA5J 2NNNA 3ZMZA 1GDTA 2QTQA 1ZH5A 5L3CA 2VC1A 3IWFA 1JT6A 3RKWA 2G7GA 3I4NJ 3E6BA 5FRMA 3TP0A 5B3SH 2STTA 2EFWA 2VE8A 2F5VA 3ULQB 2X1DA 1IRZA 4HEA2 5EDNA 2NS0A 3F8BA 2PMHA 5A2QZ 2DN0A 1UAAA 3VOKA 3WU1B 3QP5A 3X2QH 2KIFA 2VJ5A 3VYSB 1RETA 2H27A 1W5CC 3VUQA 1DU0A 1JHHA 3HTSB 2GZWA 2CO5A 5ERIA 5GAHJ 3H35A 3NRVA 5HSZA 1JT0A 3BT9A 3DBLB 2HWVA 1BOAA 3LSKA 4XLAA 2IEKA 3L2WA 3SEZA 1QZZA 3CCEI 1WGXA 2L3DA 1VQLI 4ZDOA 4AVPA 2HQNA 5FKOA 3T0YA 3WODF 2VXZA 1EJ9A 1YYVA 3LJLA 4MEXF 4U7BA 1TQIA 3SZTA 3CESA 4A3CJ 1YO5C 2HOEA 5GAEJ 3CC2I 2R5ZB 3BZCA 4HAMA 4JOMA 4IZZA 5FB2A 2Y9ZA 1GLNA 2QQAA 1SFEA 3I54A 1SVOA 3I59A 1B4AA 3JREA 3VTIA 1LJ9A 2VJJA 5E1ZB 3Q3SA 2BHZA 2CWEA 2F5EA 5L3BA 4FASD 4M3FA 4CXFA 5ILUA 4GCLA 4P5OA 3AQSA 4M9XA 3ZPLA 1RKTA 1YW9A 4LB5A 2CH0A 3TL4X 2M7AA 3RI4A 5BNGA 2LSOA 2R92J 1T33A 1WRJA 4A0YA 2R7ZJ 5IP6A 4LJZF 4X6AJ 4XRFA 5IT3A 1QVTA 2DMQA 1S3JA 4LOCA 5K7FA 3CDHA 3CUQA 4BHBA 4MTDA 5DUIA 1YI2I 2R4GA 3S2HJ 4I0BA 2D45A 1OYIA 2YPRA 3HUGB 5BQTA 1F4KA 2HDDA 5K5RA 4BXXJ 2O9LA 5FKMA 5E8GA 5FO5A 2VJIA 2F07A 3CUQC 4LIUA 3J7ZI 5HNHA 3T5XA 2VI6A 1FTZA 4M74A 3ISPA 2M87A 4WIBA 5FKLA 3GTPJ 3CCYA 3PPBA 3P5JA 3B02A 3ESWB 4L5EA 1Y8QB 4Y17A 5E20A 2P5KA 3GLLA 3VODA 4DZJA 2VE9A 5K7ZA 1YLFA 4FCYA 1HSTA 4P96A 5EEHA 2KIMA 4II3A 2LBFB 3I0TA 3ROUA 1TW2A 3JRHA 3NI7A 5GTHC 3KP2A 2XB0X 1SEUA 3IUOA 1W36C 3OSGA 1GV5A 2ECBA 2GAUA 2RN7A 4WF2A 3E6MA 1UI5A 2MGQA 2RV8A 5HLIA 4BXFA 5K5OA 3WGIA 2HVQA 3ABMH 4FE7A 1T39A 2LF8A 4LIVA 4G7HF 4N9HA 3GEZA 3HKZA 3OOUA 3BR6A 3E1SA 2K40A 2VBYA 2L54A 5H6QA 1XGSA 1WJAA 1FZPB 1UHSA 2RDPA 5LHIA 2AXTC 2L7ZA 2OD5A 3OL4A 4IOCF 2JSPA 1RKWA 2WY8Q 3HM5A 4A3EJ 2LOOA 3WG7H 4D5CA 3A02A 5LEJA 1DUXC 3WG9A 1XMXA 1FBQA 2M30A 3LSMA 5HVQC 1VI0A 1YIOA 1TQPA 1XGMA 4TV7A 4HNTA 4BL0B 2W24A 3K1NA 1VNDA 3JRGA 1RIOH 3VW1A 2EA2A 2YU3A 4XIDA 3KYDB 2ZBKA 3KPHA 1K7AA 3GFIA 2D5VA 3QBMA 3J7YJ 2RREA 1TQMA 2RNJA 5J1UA 2MLKA 1E3HA 4AD9A 3IC7A 5L3EA 4DZPA 4IHXA 3BQZA 1E2XA 4GO1A 2DOEA 5DD8A 1R49A 3DPLC 1A6IA 4NC6A 4EGZA 2IAIA 5DM7F 3RZOJ 1GUUA 2PFVA 2N8GA 1MH4A 4RBOA 3ASOH 3BG3A 3S93A 3J80K 4EGYA 2DA2A 1X2NA 2QVOA 3H9GA 3RDIA 4LLGF 5E3MA 3I55I 3KYLA 1J75A 5LGUA 2DMNA 1OMIA 3D5RC 4E7HA 2ZNYA 4NELA 3WGGA 3A03A 4AM3A 5CVUA 3Q9VA 2BY2A 3FKIJ 4XRSG 3F6VA 3OS1A 2GUHA 5E1XA 2OBPA 3DXJF 5LLQA 3I59B 1K6OA 5FLVA 2IGKA 1YW7A 2E1OA 3BQYA 4F3QA 2VUMJ 4OD4A 3DEUA 3CQZJ 1AHDP 2O0YA 3JSPA 3DTKA 1WI3A 1F9NA 1HA8A 2DQRA 1ZAOA 4CYDA 4JX5A 1FLIA 3LSHA 4L9NA 2VQGA 2DA6A 3TOAA 1SMTA 3BZ6A 2K9MA 2AHQA 1K6YA 4XSZF 5FFZA 3BJBA 1J59A 3N97A 3IH4A 3BC8A 4JNNA 1G6NA 1AKHB 3BCGA 3W6JB 3HOSA 2H8RA 1IN6A 1XSVA 1QA6A 1T08B 1ETVA 5J6XA 2GQQA 4BE1A 4C3IJ 5JHFA 3LSIA 2O6GE 1G3WA 3GTLJ 2R5YB 1XB4A 2CU7A 2ZCMA 3DPUA 5A2QK 4XR6A 5CVJA 1UHWA 1Y39A 2KQRA 5IY5H 5M5YJ 4C2TA 2BYVE 2FSWA 3W2WA 2K86A 3DPTA 3DPJA 1FIAA 2H1LA 2LC2A 1EA3A 1G8XA 3MKWB 3DQVC 1UG2A 1F1ZA 1FX7A 3V7SA 1WQ2A 2X4HA 2IBDA 4E7ZA 1MBGA 3RPUA 4YIFA 2MC4A 5CJ9A 4BY1J 4UB6C 2V1XA 4KYWA 2LVSA 2R0QC 1Z6RA 3SQNA 4CCKA 1ERDA 3JRAA 5F1JA 2ESHA 3ZMDA 3IAM2 3S16J 4PJJA 4BDZA 4Q5SF 2KDOA 1D1AA 1X4PA 5L3FA 2L9SA 2FQ4A 4C2UA 4K2EA 1R23A 3IKTA 2HQRA 3G73A 3HKZN 4OINF 4YELA 1TWCJ 2QIBA 1GT0C 3AFHA 1K78A 2KT0A 3HHHA 2XKOA 4IHTA 4GXOA 3AG1H 3K4KA 3GVAA 4MFDA 2PEXA 4ZDLA 4U88A 1WJDA 1ON1A 3SZPA 4AYBA 2ZCNA 2ACJA 4HX8A 3ON4A 2KLOA 3C2HA 2BGCA 2LF7A 3LL7A 1JTYA 3F8FA 3M8FA 2OTJI 1U78A 3GW2A 1I6XA 2GOXB 4U9NA 1I1GA 3RSNA 2JA6J 4NDLA 2X9DA 4E7SA 3KLNA 3KZ9A 3KP6A 2UXHA 3H3VK 1APLC 1R58A 4O5VA 2ZC2A 2O7OA 4M3DA 2H6CA 2NVUB 3SEQA 4C3JJ 1H88C 3P9KA 3R4KA 4HSTA 2WTEA 3LSRA 1A04A 3U21A 5FLMJ 4D1QA 4L0ZB 5BS6A 1YS6A 3FX3A 2Z1DA 3U1DA 3OYDA 4WK8F 1JXSA 3GMEA 5F0FA 3KFWX 4ZJZA 4L5IA 5J47A 2OERA 3TP3A 1X19A 2GBYA 3DBRB 3TOBA 4B1RA 3MNLA 2JT1A 1WJBA 4BACA 1IXRC 4N0BA 2D1VA 4EATA 2RQPA 2OUMA 2DT5A 2BXZA 1KU9A 3MZYA 2R93J 2EFNA 3CF2A 3Q0UA 2FX0A 5FRNA 1P9QC 1D1CA 2QQBA 3H92A 1YJNI 4Y7NJ 4B48A 2ADUA 1VQNI 1JKOC 5IT9Z 2W1OA 2IGNA 2V1DA 2RNGA 3S3NA 1TT5B 4LG0A 5JR3A 4PJMA 2XF6A 1E3OC 1T0FA 1VQ4I 2OC6A 1XCVA 2VN2A 2GXAA 1X3UA 3B81A 3A4CA 2EIJH 3JRBA 5BOXA 1I39A 2LTPA 5J40A 3V8KA 2P6TA 3A01B 1A36A 3RKQA 2M0MA 3BHQA 2WADA 3IV5A 2XROA 5M5XJ 3FXJA 1MMDA 2W53A 2VT3A 4XBFA 1SVLA 1T0FC 1U9OA 2A6EF 4DJAA 4HPQA 3JRCA 2HVSA 3P9TA 2IGOA 4IHWA 3QOPA 2KJCA 3T8RA 4CCJA 2A05A 2IS4A 2LY2A 2QKLB 2VQLA 1DP7P 1ZREA 2DJNA 2RASA 2EV0A 1TT0A 2G3BA 4ANJA 4MXMA 1BW6A 2ZXWH 1TWAJ 1WKMA 2KJBA 2OZUA 3OWTA 3PNTA 2K9NA 4HYEA 3OYJA 2JA2A 4PDKA 4GCVA 3DP7A 4XRMA 2H6BA 2COMA 4XK4A 3WTYC 3CJQB 2QENA 2ZKZA 2VKVA 1FTTA 2K4JA 2PMUA 2X0LA 2YVXA 3CDLA 1LDJA 2D2WA 3BPVA 1IUYA 4HQEA 3DKYA 3OYLA 2E34A 1PUFA 4ASNA 3M3YJ 3M7GA 4KIFA 4ZYHA 5HBUA 4BE2A 1HKQA 5GTIC 1VQMI 2QSFX 2VXDA 2WY7Q 1U3EM 1LE8B 4AUXA 3HPHA 1IN4A 5LHHA 3TDZC 3SYTA 5FD5A 1HW1A 2W57A 2UWMA 5CQEA 2EPFA 1KGSA 5DTDA 3QU6A 3RJPA 3GX4X 1R7JA 2NAZA 3VYTB 1K78B 2BBYA 1QHGA 2JMWA 2P8TA 1UCRA 1SD4A 2OCCH 1XS9A 4YIIA 2L4MA 1QBJA 4RDUA 3HE0A 2LD5A 1E3PA 1R1UA 1IJWC 2QSHX 3CO7C 2IW5A 1HW5A 2CV0A 2V1NA 1R36A 4UUTA 3JCUC 3OYAA 2PJRA 2DFFA 2V9PA 2M3AA 4XRSA 2B3WA 2FD5A 2QSGX 2XF7A 4WWCA 1HW2A 1FEXA 1ZK8A 3VB2A 4UV8A 3I4PA 4UV9A 4FX0A 1LDKB 2IU5A 4BQQA 2FU4A 4A3MJ 3HSFA 2JQ7A 1ZHFA 3I4MJ 3KE2A 3I56I 1OCCH 2QCOA 3HTJA 1A6QA 1IG7A 2XIGA 3BR2A 3CD6I 1XMAA 2E1CA 4BJ6C 3CCSI 3G2BA 2Z33A 3HXLA 3TO6A 4F93B 4HV5A 3AL0C 5TRDA 2R7SA 1K83J 2L01A 5HS9A 1R1TA 2RKHA 3FHNA 3NAUA 2K02A 1EH7A 3SFIA 5EEAA 4Z2YA 1T6SA 3KP4A 1H0MA 4IXAA 1ON2A 2DO7A 3CDIA 2W7NA 1YG2A 1D0YA 2JRMA 3QYFA 3BP8A 4E7JA 5F04A 1OCZH 2A07F 1JJ8C 2X6OA 4XN0A 3OYIA 2EINH 1ZR2A 2QLZA 4LG3A 2HYTA 2L7FP 2ZXJA 3RKXA 4LG0B 2Q8KA 5DS9A 4MTEA 2P5LC 2JSCA 2CUZA 2UZKA 4KISA 1JUSA 1QGPA 5IOZA 4M6YA 4D5FA 3QPLA 2Z16A 4RGRA 4GCTA 1B72A 2XAUA 2HDWA 2QGUA 3ABKH 1WJCA 3FIWA 5DCFA 1W0UA 4XLPF 5LGNA 3W6KB 2DA7A 2LREA 2K27A 1FJLA 2NNYA 4D7MA 4BDYA 1OISA 1KONA 4B8XA 3NRGA 4KMFA 5FROA 4CCMA 1YW8A 4FE4A 2QA4I 3Q0VA 4B43A 4RAYA 1T95A 2DA4A 4QTRA 1LVKA 1O3SA 4IHSA 3ZMVA 2IA1A 4HBLA 4I98B 1R6RA 2UXOA 4XLFA 3ONQA 4ZYDA 4ESJA 2DCEA 4MHGA 1ZGWA 2E2IJ 4U87A 5IPAA 1TC3C 1VZ0A 4B47A 3ECOA 4OWRB 3CWRA 5BPIA 3C07A 1U8BA 4DYRA 2IA2A 4I02A 4PJ0C 2OZ6A 1PVEA 1FOYA 3V42A 5ICEA 1UB9A 2NXNB 2EFQA 3FMRA 2VQHA 3FXLA 3OR2C 5IP9J 1ENHA 1ACIA 1HXDA 2DU9A 3KIOA 4LITA 3FF5A 3QPSA 2FQ3A 3MEXA 2FBKA 3MCZA 3TMOA 1YFHA 2DYSH 3HUGA 3MAJA 4E7KA 1KA8A 1CGPA 2IS6A 3G3ZA 4IRGA 2MBFA 4YFKF 2G7LA 3OYHA 2D6YA 4RLQA 2V9KA 2LNBA 3HTIA 3PASA 4X0GA 3SDBA 2Q2EA 3SXYA 2P7CB 1LEBA 2QKMB 1ETYA 2PJRB 3ZMUA 5IYCJ 3P9CA 1SAUA 1OR7A 3JR9A 2K4BA 2LBFA 1PDNC 3GTGJ 1HSJA 2MYSA 3DU5A 4BY7J 2M34A 1STZA 3AAFA 1FMWA 1FOXA 2HKOA 2ZJPF 4DBRA 1KU2A 3DKWA 3AL0B 2Y9YA 2GIVA 2VKHA 4DBQA 1U8RA 3TBIA 1OR7C 2L7MP 4PSXA 2WWYA 4BE0A 3FBIB 3WTZA 4CGZA 1IDYA 2RGVA 4L0YB 4DOZA 2ZMEB 3CCUI 2GLOA 3BNIA 1FP1D 1S8NA 2DT6A 2JTVA 3ZQLA 2L9NA 3NXCA 2O8KA 1USTA 2X1EA 1S9HA 3OYBA 1SAXA 1FP2A 2LH9A 4PJLA 3S3OA 5LHGA 2HR3A 2R7DA 1O4XA 3C1DA 3CC4I 3K8PC 4RA2A 2LRDA 2OPTA 4JYKA 2DXIA 2HXIA 5H9TA 1LNWA 5TGTA 5EZGA 2E1NA 4MEYF 4C3HJ 1XX5A 4R8HA 3CUOA 1IRXA 2CV2A 2HS5A 1ETWA 4LFUA 4KN4X 5JVTA 4ZZDA 3K70D 1DGRM 4MQ9F 2W84A 1FBSA 2M4KA 2Y30A 3MZ8A 4V19K 2GFNA 2V9VA 3FXKA 3HZJA 1WHUA 3F6OA 1WJEA 3I71A 3K4NA 4BQOA 2RAEA 4EQQA 3GTJJ 1UI6A 3EUPA 3S5RA 4BGDA 4RB3C 2A6TA 1O3RA 4QIWN 2JRTA 1BA5A 2K85A 1B72B 2R7XA 4P1WA 4HV6A 2Y31A 2YU9J 1TWGJ 5F0CA 2M45A 3KZZA 3SFZA 3QKXA 4IO9F 4AVZA 3JSJA 1L0OC 3L9FA 1OYYA 1Y0NA 3V8JA 1TBXA 3BWGA 3RH2A 4Y3OA 1OCPA 2DK8A 4BBRJ 5M3FJ 1YRNA 1J9IA 1BIBA 2DMTA 2XF5A 2HDCA 3G71I 3K0LA 2P7VB 3FRQA 3QAHA
chains in the Genus database with same CATH topology
3HOYJ 3CQZJ 1AHDP 1Z0XA 2L0KA 1WI3A 2EZHA 1Q1VA 4A69C 5C4XJ 1ZR4A 1NK3P 1BJZA 1I3QJ 1POGA 4W1UA 4JX5A 4JKZA 2DA6A 5E3OA 4FTHA 2REKA 4HNVA 3JRDA 2UXIA 2AHQA 4BKXA 3HGGA 3BJBA 1X2MA 3IH4A 5EYRA 4JNNA 2GENA 1AKHB 2LFBA 3BCGA 2H8RA 1DU6A 1WH7A 2NS7A 1MNMC 1ETVA 2FJ1A 4DW6A 3GZIA 1AKHA 4V2FA 2EH3A 3GEUA 4C3IJ 1HDPA 4A3GJ 4XICA 3ZQIA 1T56A 3G1MA 3LNQA 1R9TJ 3GTLJ 5D1RA 4JX6A 2XGEA 2CU7A 2R5YB 4B3AA 4B4CA 3S2DJ 1SGMA 2NP5A 2ZCMA 3T6NA 2AO9A 1RESA 2P81A 2H1KA 2NP3A 1RPWA 2R5YA 3G1LA 5M5YJ 2LKXA 5FKKA 1XG1A 2YVEA 1FIAA 3DPJA 2DA5A 2DMPA 3W6VA 1UG2A 4JX4A 1JUMA 2IBDA 3UKGA 4A3JJ 3C2BA 1MBGA 5IOYA 2QWTA 2COBA 2B63J 3DEWA 3VW2A 4BY1J 3S1NJ 3WHCA 1P7IA 4AC0A 2LVSA 4EEFG 2R0QC 2EZKA 5IP7J 3JRAA 5F1JA 1IGNA 3S16J 4UUSB 4A3LJ 2TCTA 3HOVJ 2UXUA 2I10A 3E7QA 3S17J 3ZQCA 4UUSA 2FQ4A 3ON2A 3HKZN 3ZOBA 1TWCJ 2QIBA 1GT0C 4UDSA 2XPVA 2E2JJ 2KT0A 5J3LA 1TWHJ 2MG4A 4A3DJ 4MFDA 5C4JJ 3BR0A 3BG9A 1LFBA 2YUSA 2V57A 2ZCNA 3FK6A 3ON4A 3TEDA 2VKEA 1JTYA 5FJ8J 4AC6A 2XPWA 1ETXA 5F27A 3S1QJ 2NVTJ 2QKOA 1U78A 3WHBA 3HOXJ 3DCFA 3HB9A 2JA6J 2E19A 4NDLA 2X9DA 4A3KJ 2YVHA 3ANGA 5J1YA 5FHPA 3KZ9A 2UXHA 1F36A 3H3VK 1APLC 1HDDC 4CGRA 4DYCA 3LWJA 2ID3A 3IH2A 2O7OA 4M3DA 4C3JJ 1H88C 2OI8A 1ETKA 2MW8A 1JKPC 2ZB9A 5EF6A 3HOZJ 3LSRA 3B6AA 4JP0A 1MBJA 3MKLA 1XC5A 5FLMJ 5C4YA 3ANPA 1Z77A 5F08A 5FMPA 2PZ9A 5JLXA 2ME6A 2DA3A 2WUIA 3VVXA 5F0FA 2NVXJ 2OERA 2LP0A 3TP3A 2GBYA 3SJMA 4IHYA 3HOWJ 4B1RA 3MNLA 2XPUA 2DG7A 1IV6A 1K61A 1GV2A 4ABZA 2EBIA 3MN2A 3E7LA 1HF0A 3VP5A 1YRNB 5C44J 2R93J 4GFLA 3Q0UA 2FX0A 4X1EA 4Y7NJ 1MBKA 1JKOC 1JUPA 3AQTA 2HOSA 4M6VA 5K7HA 2CQQA 2L9RA 4W97A 3GTKJ 1E3OC 4NN1A 1MSFC 3B81A 3HTAA 3JRBA 2DMUA 2LTPA 3S1MJ 4GFKA 3BHQA 3A01B 3RKQA 3IV5A 1SFOJ 5M5XJ 3COLA 5FGLA 1I50J 3A01A 4PXIA 2W53A 2M8GX 1JGGA 1U9OA 1Y1VJ 3JRCA 4MLOA 3P9TA 1JKRC 2XSDC 4IHWA 3BTJA 2R5ZA 1LFUP 1NTCA 2FBQA 2JA7J 2DJNA 2RASA 1ETQA 1IUFA 2G3BA 5IYDJ 4MXMA 1VF9A 1BW6A 2LY9A 3BG5A 4M3GA 1TWAJ 4V2GA 2K9NA 5K58A 2NOGA 3CJDA 4YZEA 3SDGA 2PBXA 4XRMA 2HXOA 4XK4A 2G0EA 2VKVA 1FTTA 2VPRA 3CDLA 3PO2J 3VOXA 2CJJA 2M0CA 1PUFB 1ITYA 2JJ7A 5M5WJ 4DYQA 3NPIA 2YS9A 2CUEA 3LSJA 1PUFA 2GM4A 1WH5A 3M3YJ 5D19A 3JRIA 1ZQ3P 5HBUA 4M3EA 1TWFJ 2KDZA 2CRGA 3HOUJ 1ORKA 2LLKA 5HAWA 1LE8B 4AUXA 3H0GJ 1NK2P 3G1OA 3O8HA 3HDDA 1LE8A 1IC8A 3IH3A 5DTDA 4MO7A 3G7RA 1CQTA 3GTOJ 2HKUA 3KNWA 2JMWA 2XB5A 3V78A 2ME0A 3VW0A 1XS9A 1H8AC 4BBSJ 3LSPA 2JWTA 4RDUA 1BL0A 3HE0A 2PMZN 5EG0A 2LD5A 4D7NA 1IJWC 2CUFA 4IHVA 3GTMJ 3HIMA 4MFEA 1G2HA 2E2HJ 3V6GA 4UUTA 3PO3J 3VVZA 5IYBJ 4XRSA 2ZOYA 3KKCA 1P7JA 2ECCA 2FD5A 3JRFA 1A5JA 1FEXA 4JL3A 1ZK8A 4M3BA 2IU5A 5EZHA 3K2AA 4A3MJ 4GCKA 5GPAA 3I4MJ 1U9NA 1HLVA 3HTJA 2QCOA 1QPIA 1IG7A 3LHQA 3NNRA 3BR2A 1RR7A 3GTQJ 4A93J 2UXPA 3BRUA 2WB1N 2JA5J 5EFYA 2ID6A 1GDTA 2QTQA 4C2MJ 3QQAA 1OJLA 1JT6A 3O8GA 1K83J 2G7GA 1F43A 3I4NJ 3NAUA 3TP0A 3SFIA 5GP9A 2Y2ZA 1VFCA 1ZTRA 1B8IA 5EDNA 1IRZA 5EGOA 1MBEA 1OFCX 5EEAA 4ICHA 3RQIA 2DN0A 5C3EJ 3VOKA 4MIMA 4A3BJ 1RETA 4A3FJ 3VUQA 2HYJA 3BTIA 5F04A 3S14J 1DU0A 1JJ8C 2X6OA 3O60A 3RD3A 3ZQFA 5E3LA 1ZR2A 3KKDA 5HSZA 1JT0A 2L7FP 2HYTA 3BT9A 3FISA 5DS9A 1JUSA 1JTXA 2IEKA 5IOZA 4D5FA 3QPLA 4CYCA 1WGXA 2JN6A 2JA8J 4GCTA 1B72A 3BR1A 3HBLA 1Y1WJ 2RHAA 5FKOA 3FIWA 5F0HA 1W0UA 3HGYA 2CQXA 3LJLA 2DA7A 3NARA 2XRLA 2ELKA 1MSEC 2EQRA 3RZDJ 4A3CJ 3VPRA 2R5ZB 1MH3A 4S0HB 4D7MA 1FJLA 1S7EA 3NRGA 2DG8A 3OIOA 2Y9ZA 3TW7A 4FE4A 3JREA 3Q0VA 1WPKA 2DA4A 2WV1A 3Q3SA 4QTRA 3F0CA 2XGCA 4M3FA 4GCLA 2NVQJ 3AQSA 3S1RJ 4G12A 1RKTA 2UXOA 2XGDA 5BNGA 4ACIA 1ZGWA 2E2IJ 5HODA 2R92J 1T33A 1SANA 1JJ6C 2NS8A 2JK3A 2K9QA 5IPAA 1TC3C 2R7ZJ 5IP6A 3CWRA 3TW6A 4X6AJ 3C07A 3Q0WA 1U8BA 4DYRA 1QVTA 2DMQA 2HOAA 4LOCA 5FKNA 2M9HA 5K7FA 2O7TA 1H89C 3D1NI 3S2HJ 1W0TA 1WCMJ 1HOMA 3BR5A 2NVYJ 5IP9J 1ENHA 3MVPA 4ME9A 4KWAA 4L62A 2DTZA 3GBGA 3IUVA 2HDDA 3QPSA 2X48A 2O9LA 5FKMA 4BXXJ 2ZCXA 2F07A 5GPCA 5CXIA 4Y52J 2NX4A 2VI6A 3VVYA 2WAQN 3CRJA 1FTZA 2HQ5A 2G7LA 4HKUA 5FKLA 3GTPJ 3CCYA 2D6YA 3PPBA 1ETOA 5AQCA 4L5EA 4DZJA 5EG0B 3HTIA 1QRYA 3PASA 5K7ZA 4FCYA 1D5YA 4I76A 9ANTA 2MSYA 1ETYA 3HTHA 4AYBN 3JRHA 3NI7A 5IYCJ 1HCRA 3JR9A 3OSFA 4A3IJ 2XB0X 1JKQC 3GTGJ 3FK7A 4BY7J 3BTLA 2M34A 4I6ZA 3OSGA 2EZIA 1GV5A 2ECBA 1UI5A 5CW8A 3VIBA 2MGQA 3HEFA 4FE7A 2G7SA 2Y9YA 2XDNA 4MK6A 2L7MP 3LOCA 3OOUA 1ZKGA 3BR6A 1IDYA 1MBHA 2K40A 2WGBA 2EZLA 3G56A 2ZOZA 2TRTA 2W48A 5J1RA 2GLOA 3BNIA 3ZQLA 1IDZA 5M3MJ 1UHSA 2LK2A 3ZQHA 3NXCA 2L7ZA 2O8KA 2QF7A 3S15J 3PM1A 1RKWA 4A3EJ 3HM5A 2K9SA 1O4XA 2M2EA 4D5CA 3A02A 1B8IB 5EGOB 1X58A 1QVUA 2OPTA 1VI0A 4JYKA 2HXIA 5H9TA 5EZGA 3CMYA 4C3HJ 1EF4A 2QOPA 5D18A 2HI3A 1AU7A 3F1BA 1VNDA 2LR8A 3JRGA 3EGQA 3B6CA 3VW1A 1ETWA 4XIDA 1MBFA 1FIPA 3LSGA 4IEJA 2D5VA 3QBMA 5E3NA 2Y30A 2DA1A 2GFNA 4AF5A 5J1UA 3GTJJ 3S5RA 1UI6A 4DZPA 2RAEA 3BQZA 4GFBA 4IHXA 3EUPA 4CYCB 4QIWN 1A6IA 1BA5A 2IAIA 4J19A 5DAJA 3RZOJ 2HOTA 1B72B 1GUUA 2Y0SN 2N8GA 3L1PA 1MH4A 2OF7A 2Y31A 3BG3A 4RBOA 2YU9J 1GVDA 1TWGJ 5F0CA 2DA2A 1I6HJ 3QKXA 1X2NA 3BTCA 3BR3A 5E3MA 3JSJA 5CXGA 2DMNA 4FISA 4QSHA 1BW5A 4NELA 3RH2A 3A03A 1OCPA 1OCTC 3K7AJ 1UMQA 5JLWA 2Q24A 3FKIJ 4XRSG 4BBRJ 5M3FJ 1YRNA 2GUHA 2DMTA 3ZQGA 5FLVA 2E1OA 3BQYA 3FRQA 3M4OJ 2VUMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY J;  3CQZ J;  1AHD P;  1Z0X A;  2L0K A;  1WI3 A;  2EZH A;  1Q1V A;  4A69 C;  5C4X J;  1ZR4 A;  1NK3 P;  1BJZ A;  1I3Q J;  1POG A;  4W1U A;  4JX5 A;  4JKZ A;  2DA6 A;  5E3O A;  4FTH A;  2REK A;  4HNV A;  3JRD A;  2UXI A;  2AHQ A;  4BKX A;  3HGG A;  3BJB A;  1X2M A;  3IH4 A;  5EYR A;  4JNN A;  2GEN A;  1AKH B;  2LFB A;  3BCG A;  2H8R A;  1DU6 A;  1WH7 A;  2NS7 A;  1MNM C;  1ETV A;  2FJ1 A;  4DW6 A;  3GZI A;  1AKH A;  4V2F A;  2EH3 A;  3GEU A;  4C3I J;  1HDP A;  4A3G J;  4XIC A;  3ZQI A;  1T56 A;  3G1M A;  3LNQ A;  1R9T J;  3GTL J;  5D1R A;  4JX6 A;  2XGE A;  2CU7 A;  2R5Y B;  4B3A A;  4B4C A;  3S2D J;  1SGM A;  2NP5 A;  2ZCM A;  3T6N A;  2AO9 A;  1RES A;  2P81 A;  2H1K A;  2NP3 A;  1RPW A;  2R5Y A;  3G1L A;  5M5Y J;  2LKX A;  5FKK A;  1XG1 A;  2YVE A;  1FIA A;  3DPJ A;  2DA5 A;  2DMP A;  3W6V A;  1UG2 A;  4JX4 A;  1JUM A;  2IBD A;  3UKG A;  4A3J J;  3C2B A;  1MBG A;  5IOY A;  2QWT A;  2COB A;  2B63 J;  3DEW A;  3VW2 A;  4BY1 J;  3S1N J;  3WHC A;  1P7I A;  4AC0 A;  2LVS A;  4EEF G;  2R0Q C;  2EZK A;  5IP7 J;  3JRA A;  5F1J A;  1IGN A;  3S16 J;  4UUS B;  4A3L J;  2TCT A;  3HOV J;  2UXU A;  2I10 A;  3E7Q A;  3S17 J;  3ZQC A;  4UUS A;  2FQ4 A;  3ON2 A;  3HKZ N;  3ZOB A;  1TWC J;  2QIB A;  1GT0 C;  4UDS A;  2XPV A;  2E2J J;  2KT0 A;  5J3L A;  1TWH J;  2MG4 A;  4A3D J;  4MFD A;  5C4J J;  3BR0 A;  3BG9 A;  1LFB A;  2YUS A;  2V57 A;  2ZCN A;  3FK6 A;  3ON4 A;  3TED A;  2VKE A;  1JTY A;  5FJ8 J;  4AC6 A;  2XPW A;  1ETX A;  5F27 A;  3S1Q J;  2NVT J;  2QKO A;  1U78 A;  3WHB A;  3HOX J;  3DCF A;  3HB9 A;  2JA6 J;  2E19 A;  4NDL A;  2X9D A;  4A3K J;  2YVH A;  3ANG A;  5J1Y A;  5FHP A;  3KZ9 A;  2UXH A;  1F36 A;  3H3V K;  1APL C;  1HDD C;  4CGR A;  4DYC A;  3LWJ A;  2ID3 A;  3IH2 A;  2O7O A;  4M3D A;  4C3J J;  1H88 C;  2OI8 A;  1ETK A;  2MW8 A;  1JKP C;  2ZB9 A;  5EF6 A;  3HOZ J;  3LSR A;  3B6A A;  4JP0 A;  1MBJ A;  3MKL A;  1XC5 A;  5FLM J;  5C4Y A;  3ANP A;  1Z77 A;  5F08 A;  5FMP A;  2PZ9 A;  5JLX A;  2ME6 A;  2DA3 A;  2WUI A;  3VVX A;  5F0F A;  2NVX J;  2OER A;  2LP0 A;  3TP3 A;  2GBY A;  3SJM A;  4IHY A;  3HOW J;  4B1R A;  3MNL A;  2XPU A;  2DG7 A;  1IV6 A;  1K61 A;  1GV2 A;  4ABZ A;  2EBI A;  3MN2 A;  3E7L A;  1HF0 A;  3VP5 A;  1YRN B;  5C44 J;  2R93 J;  4GFL A;  3Q0U A;  2FX0 A;  4X1E A;  4Y7N J;  1MBK A;  1JKO C;  1JUP A;  3AQT A;  2HOS A;  4M6V A;  5K7H A;  2CQQ A;  2L9R A;  4W97 A;  3GTK J;  1E3O C;  4NN1 A;  1MSF C;  3B81 A;  3HTA A;  3JRB A;  2DMU A;  2LTP A;  3S1M J;  4GFK A;  3BHQ A;  3A01 B;  3RKQ A;  3IV5 A;  1SFO J;  5M5X J;  3COL A;  5FGL A;  1I50 J;  3A01 A;  4PXI A;  2W53 A;  2M8G X;  1JGG A;  1U9O A;  1Y1V J;  3JRC A;  4MLO A;  3P9T A;  1JKR C;  2XSD C;  4IHW A;  3BTJ A;  2R5Z A;  1LFU P;  1NTC A;  2FBQ A;  2JA7 J;  2DJN A;  2RAS A;  1ETQ A;  1IUF A;  2G3B A;  5IYD J;  4MXM A;  1VF9 A;  1BW6 A;  2LY9 A;  3BG5 A;  4M3G A;  1TWA J;  4V2G A;  2K9N A;  5K58 A;  2NOG A;  3CJD A;  4YZE A;  3SDG A;  2PBX A;  4XRM A;  2HXO A;  4XK4 A;  2G0E A;  2VKV A;  1FTT A;  2VPR A;  3CDL A;  3PO2 J;  3VOX A;  2CJJ A;  2M0C A;  1PUF B;  1ITY A;  2JJ7 A;  5M5W J;  4DYQ A;  3NPI A;  2YS9 A;  2CUE A;  3LSJ A;  1PUF A;  2GM4 A;  1WH5 A;  3M3Y J;  5D19 A;  3JRI A;  1ZQ3 P;  5HBU A;  4M3E A;  1TWF J;  2KDZ A;  2CRG A;  3HOU J;  1ORK A;  2LLK A;  5HAW A;  1LE8 B;  4AUX A;  3H0G J;  1NK2 P;  3G1O A;  3O8H A;  3HDD A;  1LE8 A;  1IC8 A;  3IH3 A;  5DTD A;  4MO7 A;  3G7R A;  1CQT A;  3GTO J;  2HKU A;  3KNW A;  2JMW A;  2XB5 A;  3V78 A;  2ME0 A;  3VW0 A;  1XS9 A;  1H8A C;  4BBS J;  3LSP A;  2JWT A;  4RDU A;  1BL0 A;  3HE0 A;  2PMZ N;  5EG0 A;  2LD5 A;  4D7N A;  1IJW C;  2CUF A;  4IHV A;  3GTM J;  3HIM A;  4MFE A;  1G2H A;  2E2H J;  3V6G A;  4UUT A;  3PO3 J;  3VVZ A;  5IYB J;  4XRS A;  2ZOY A;  3KKC A;  1P7J A;  2ECC A;  2FD5 A;  3JRF A;  1A5J A;  1FEX A;  4JL3 A;  1ZK8 A;  4M3B A;  2IU5 A;  5EZH A;  3K2A A;  4A3M J;  4GCK A;  5GPA A;  3I4M J;  1U9N A;  1HLV A;  3HTJ A;  2QCO A;  1QPI A;  1IG7 A;  3LHQ A;  3NNR A;  3BR2 A;  1RR7 A;  3GTQ J;  4A93 J;  2UXP A;  3BRU A;  2WB1 N;  2JA5 J;  5EFY A;  2ID6 A;  1GDT A;  2QTQ A;  4C2M J;  3QQA A;  1OJL A;  1JT6 A;  3O8G A;  1K83 J;  2G7G A;  1F43 A;  3I4N J;  3NAU A;  3TP0 A;  3SFI A;  5GP9 A;  2Y2Z A;  1VFC A;  1ZTR A;  1B8I A;  5EDN A;  1IRZ A;  5EGO A;  1MBE A;  1OFC X;  5EEA A;  4ICH A;  3RQI A;  2DN0 A;  5C3E J;  3VOK A;  4MIM A;  4A3B J;  1RET A;  4A3F J;  3VUQ A;  2HYJ A;  3BTI A;  5F04 A;  3S14 J;  1DU0 A;  1JJ8 C;  2X6O A;  3O60 A;  3RD3 A;  3ZQF A;  5E3L A;  1ZR2 A;  3KKD A;  5HSZ A;  1JT0 A;  2L7F P;  2HYT A;  3BT9 A;  3FIS A;  5DS9 A;  1JUS A;  1JTX A;  2IEK A;  5IOZ A;  4D5F A;  3QPL A;  4CYC A;  1WGX A;  2JN6 A;  2JA8 J;  4GCT A;  1B72 A;  3BR1 A;  3HBL A;  1Y1W J;  2RHA A;  5FKO A;  3FIW A;  5F0H A;  1W0U A;  3HGY A;  2CQX A;  3LJL A;  2DA7 A;  3NAR A;  2XRL A;  2ELK A;  1MSE C;  2EQR A;  3RZD J;  4A3C J;  3VPR A;  2R5Z B;  1MH3 A;  4S0H B;  4D7M A;  1FJL A;  1S7E A;  3NRG A;  2DG8 A;  3OIO A;  2Y9Z A;  3TW7 A;  4FE4 A;  3JRE A;  3Q0V A;  1WPK A;  2DA4 A;  2WV1 A;  3Q3S A;  4QTR A;  3F0C A;  2XGC A;  4M3F A;  4GCL A;  2NVQ J;  3AQS A;  3S1R J;  4G12 A;  1RKT A;  2UXO A;  2XGD A;  5BNG A;  4ACI A;  1ZGW A;  2E2I J;  5HOD A;  2R92 J;  1T33 A;  1SAN A;  1JJ6 C;  2NS8 A;  2JK3 A;  2K9Q A;  5IPA A;  1TC3 C;  2R7Z J;  5IP6 A;  3CWR A;  3TW6 A;  4X6A J;  3C07 A;  3Q0W A;  1U8B A;  4DYR A;  1QVT A;  2DMQ A;  2HOA A;  4LOC A;  5FKN A;  2M9H A;  5K7F A;  2O7T A;  1H89 C;  3D1N I;  3S2H J;  1W0T A;  1WCM J;  1HOM A;  3BR5 A;  2NVY J;  5IP9 J;  1ENH A;  3MVP A;  4ME9 A;  4KWA A;  4L62 A;  2DTZ A;  3GBG A;  3IUV A;  2HDD A;  3QPS A;  2X48 A;  2O9L A;  5FKM A;  4BXX J;  2ZCX A;  2F07 A;  5GPC A;  5CXI A;  4Y52 J;  2NX4 A;  2VI6 A;  3VVY A;  2WAQ N;  3CRJ A;  1FTZ A;  2HQ5 A;  2G7L A;  4HKU A;  5FKL A;  3GTP J;  3CCY A;  2D6Y A;  3PPB A;  1ETO A;  5AQC A;  4L5E A;  4DZJ A;  5EG0 B;  3HTI A;  1QRY A;  3PAS A;  5K7Z A;  4FCY A;  1D5Y A;  4I76 A;  9ANT A;  2MSY A;  1ETY A;  3HTH A;  4AYB N;  3JRH A;  3NI7 A;  5IYC J;  1HCR A;  3JR9 A;  3OSF A;  4A3I J;  2XB0 X;  1JKQ C;  3GTG J;  3FK7 A;  4BY7 J;  3BTL A;  2M34 A;  4I6Z A;  3OSG A;  2EZI A;  1GV5 A;  2ECB A;  1UI5 A;  5CW8 A;  3VIB A;  2MGQ A;  3HEF A;  4FE7 A;  2G7S A;  2Y9Y A;  2XDN A;  4MK6 A;  2L7M P;  3LOC A;  3OOU A;  1ZKG A;  3BR6 A;  1IDY A;  1MBH A;  2K40 A;  2WGB A;  2EZL A;  3G56 A;  2ZOZ A;  2TRT A;  2W48 A;  5J1R A;  2GLO A;  3BNI A;  3ZQL A;  1IDZ A;  5M3M J;  1UHS A;  2LK2 A;  3ZQH A;  3NXC A;  2L7Z A;  2O8K A;  2QF7 A;  3S15 J;  3PM1 A;  1RKW A;  4A3E J;  3HM5 A;  2K9S A;  1O4X A;  2M2E A;  4D5C A;  3A02 A;  1B8I B;  5EGO B;  1X58 A;  1QVU A;  2OPT A;  1VI0 A;  4JYK A;  2HXI A;  5H9T A;  5EZG A;  3CMY A;  4C3H J;  1EF4 A;  2QOP A;  5D18 A;  2HI3 A;  1AU7 A;  3F1B A;  1VND A;  2LR8 A;  3JRG A;  3EGQ A;  3B6C A;  3VW1 A;  1ETW A;  4XID A;  1MBF A;  1FIP A;  3LSG A;  4IEJ A;  2D5V A;  3QBM A;  5E3N A;  2Y30 A;  2DA1 A;  2GFN A;  4AF5 A;  5J1U A;  3GTJ J;  3S5R A;  1UI6 A;  4DZP A;  2RAE A;  3BQZ A;  4GFB A;  4IHX A;  3EUP A;  4CYC B;  4QIW N;  1A6I A;  1BA5 A;  2IAI A;  4J19 A;  5DAJ A;  3RZO J;  2HOT A;  1B72 B;  1GUU A;  2Y0S N;  2N8G A;  3L1P A;  1MH4 A;  2OF7 A;  2Y31 A;  3BG3 A;  4RBO A;  2YU9 J;  1GVD A;  1TWG J;  5F0C A;  2DA2 A;  1I6H J;  3QKX A;  1X2N A;  3BTC A;  3BR3 A;  5E3M A;  3JSJ A;  5CXG A;  2DMN A;  4FIS A;  4QSH A;  1BW5 A;  4NEL A;  3RH2 A;  3A03 A;  1OCP A;  1OCT C;  3K7A J;  1UMQ A;  5JLW A;  2Q24 A;  3FKI J;  4XRS G;  4BBR J;  5M3F J;  1YRN A;  2GUH A;  2DMT A;  3ZQG A;  5FLV A;  2E1O A;  3BQY A;  3FRQ A;  3M4O J;  2VUM J; 
#chains in the Genus database with same CATH topology
 3HOY J;  3WTT C;  5F64 A;  5LEK A;  5C4X J;  3QOE A;  3CZ6 A;  1BJZ A;  1I3Q J;  3RCO A;  1MJB A;  2B7E A;  1BR2 A;  1J2X A;  4PSW A;  1WVR A;  1FMV A;  3ZQ7 A;  4FTH A;  3HHG A;  1UHM A;  3Q9S A;  4BKX A;  1BC7 C;  1MND A;  3FDY A;  2FBI A;  3HRS A;  2LDU A;  2PN6 A;  4UVB A;  2JVH A;  4ZTJ A;  1DU6 A;  1MNM C;  3GZI A;  4L9T A;  1LFP A;  3PUB A;  1AKH A;  4DVY P;  2CW7 A;  2R7F A;  3E5Q A;  4V2F A;  4EM0 B;  3CCJ I;  3GEU A;  4A3G J;  1MKM A;  3OIP A;  3R60 A;  4F91 B;  3CCM I;  3IHU A;  3RPQ A;  1R9T J;  2HGC A;  2QM3 A;  4M9S A;  1HC8 A;  3GWZ A;  1O57 A;  2NP5 A;  5D1R A;  4B3A A;  1SGM A;  1Y8R B;  2CQK A;  5J8F A;  2OA4 A;  1MIJ A;  2AO9 A;  2NP3 A;  1J5Y A;  2R5Y A;  2EV5 A;  2QQ9 A;  3G1L A;  3TKY A;  3JW4 A;  2X85 A;  4ZYA A;  1O3T A;  3MKZ A;  3HRM A;  2YVE A;  5DYM A;  1MZB A;  3JAM K;  2KIU A;  2DA5 A;  3L2R A;  3W6V A;  2AXL A;  4JX4 A;  3C18 A;  2HYF A;  2GXB A;  1JUM A;  2Q2E B;  2HVR A;  5KAI C;  2DYR H;  2F4I A;  2COB A;  2IVM A;  2EA4 A;  3WTS C;  2X51 A;  4EEF G;  1D5V A;  2LY1 A;  3ASN H;  4AIJ A;  3F3X A;  4CH7 A;  4JK1 X;  4M71 A;  3E6C C;  4A3L J;  1PP8 F;  2HU9 A;  4RGU A;  2W82 A;  2I10 A;  1DPR A;  4I0A A;  5AIP A;  4FX4 A;  3ZQC A;  4ENJ A;  2BY1 A;  3ZOB A;  4A5M A;  5D5W B;  2VON A;  2XPV A;  5B1B H;  4UDS A;  5EJC A;  2HZD A;  2MG4 A;  4A3D J;  2IA0 A;  5C4J J;  3DTE A;  2HKX A;  2PJP A;  1OCO H;  3ZXS A;  2V57 A;  4OOI A;  3V7C A;  2JUG A;  4MQV A;  4ENK A;  3TED A;  2KP6 A;  3CCV I;  2HQA A;  4UB8 C;  3EYI A;  1NG6 A;  1ZRF A;  2XPW A;  4BUP A;  3JSO A;  1ETX A;  2BXY A;  5F27 A;  5JVG F;  1ZG1 A;  1UFM A;  2NVT J;  3S1Q J;  1DP3 A;  5JI6 A;  1N75 A;  1RUN A;  3DCF A;  4HX7 A;  2QQ8 A;  4A2U A;  5DDG A;  2W85 A;  2E19 A;  1U6G A;  2JPB A;  3WE2 A;  2YVH A;  4XL9 A;  1SFK A;  3ANG A;  5ILS A;  5FHP A;  2MD5 A;  4GGG A;  2Z5U A;  1HDD C;  2F5C A;  2LYC A;  4DYC A;  2FNA A;  2ID3 A;  1R00 A;  1ZRC A;  4J01 A;  4N4O B;  2OI8 A;  2FEZ A;  1BM9 A;  1IXS B;  3ERM A;  1JKP C;  2ZB9 A;  3MZH A;  5EF6 A;  4Y4R A;  4PGG A;  1BR1 A;  2X6X A;  1MBJ A;  4JP0 A;  2MH9 A;  1XC5 A;  4HDV A;  2LMD A;  4M9Z A;  2PZ9 A;  2KIS A;  5L3G A;  2WUI A;  5CYV A;  2NVX J;  1JE8 A;  4BHC A;  4IHY A;  3SJM A;  1Z6T A;  4DNC A;  2DDB A;  4HQM A;  1IV6 A;  4ABZ A;  3PNY A;  3IKV A;  3MN2 A;  4BJ5 C;  3NWT A;  3S8P A;  4OIP F;  3VP5 A;  1YRN B;  5C44 J;  3MFK A;  4GFL A;  2LKS A;  3R0J A;  4A12 A;  1MJA A;  2KZV A;  1YJ9 I;  4X1E A;  5D5U B;  1Z7U A;  3LAJ A;  1SFX A;  3H9Q A;  2HOS A;  2XDV A;  2CQQ A;  3FM3 A;  2Y0S A;  1FYM A;  2ZO4 A;  4I99 C;  2CFX A;  5FGM A;  1QU3 A;  1Y6I A;  2DMU A;  3N4M A;  3D0S A;  3E5U A;  3O3K A;  2GXG A;  1SFO J;  3HRU A;  3A0H C;  1TTY A;  3AKZ A;  2V79 A;  2QBY A;  1YIT I;  1V5E A;  3A01 A;  3H3Z A;  1Y1V J;  1CF7 B;  2A5W A;  1FY7 A;  2PLY A;  5FFX A;  1BR4 A;  2XSD C;  3OYG A;  3ERE D;  3PQJ A;  2ZXI A;  1NTC A;  4RM3 A;  2JA7 J;  2ZSH B;  5H20 A;  2DDA A;  3FKJ A;  5DCM B;  4OIO F;  2IS1 A;  5IYD J;  4V2G A;  2Z2S B;  4XNF A;  5LRR A;  2EB7 A;  2HZT A;  3EYY A;  3ZQQ A;  4Z6Y A;  4H4K C;  5GAG J;  3I53 A;  3TGN A;  3CJD A;  2MD0 A;  1G3T A;  2M1B A;  3IRQ A;  3J81 Z;  1WJF A;  1BIA A;  2VPR A;  3PO2 J;  2ISY A;  1BBY A;  4KJZ A;  4P55 A;  3TO7 A;  4UVA A;  4HW0 A;  2G7H A;  3M07 A;  4IVN A;  2YS9 A;  3RKY A;  4PUS A;  4KT5 C;  5F1R A;  2V7F A;  4M3E A;  2R7V A;  3HOU J;  4BYY A;  1W7P D;  1C0W A;  1FOK A;  1ZG3 A;  4KA4 A;  2DLL A;  1XCB A;  2FML A;  3BJ6 A;  3PSI A;  3G4S I;  1LE8 A;  2E71 A;  5HLG A;  3IH3 A;  4RM2 A;  1IC8 A;  3ZMT A;  1CQT A;  3GTO J;  2XB5 A;  3E5X A;  4NC7 A;  1LQ1 A;  1U2W A;  2F48 A;  2BY3 A;  3KP7 A;  4AWX B;  3LSP A;  2JWT A;  1MGT A;  1ONV A;  3DEE A;  2QEX I;  4D7N A;  4KIC A;  1Z9C A;  4II2 A;  5HDK A;  4G9Y A;  3OYK A;  4M73 A;  1DGW Y;  2KIQ A;  4R1H A;  5LGT A;  2RC4 A;  2R7W A;  3KKC A;  3JRF A;  1A5J A;  1ZN2 A;  1USS A;  4EVI A;  4M3B A;  4OIQ F;  3HPG A;  2PBI A;  3K2A A;  2XAQ A;  1P92 A;  3CCQ I;  3ZCO A;  1HLV A;  1JI8 A;  3OS0 A;  1PJR A;  1QPI A;  2PG4 A;  4BXU A;  1IF1 A;  3NNR A;  3BRU A;  3PFY A;  1D8J A;  5EFY A;  1MDM A;  2ID6 A;  2Q1Z B;  3H5N A;  3LA2 A;  4NUB A;  4C2M J;  4CA0 A;  3QQA A;  3O8G A;  1F43 A;  3F23 A;  4LLL A;  3BLY A;  3D5L A;  3EDP A;  2E1M C;  2K3F A;  2Y2Z A;  1VFC A;  1B8I A;  5EGO A;  1BI1 A;  1OFC X;  3DU6 A;  3W2V A;  4ICH A;  3GYH X;  4B09 A;  4MIM A;  4IQJ A;  4A3B J;  3IRR A;  3BRO A;  3OL3 A;  3BTI A;  3S14 J;  1ZGJ A;  5KHD A;  2OTL I;  3O60 A;  3ZQF A;  5E3L A;  1ZG5 A;  3OOP A;  4EJT A;  1D0X A;  2R7O A;  4A6E A;  3FIS A;  1H9G A;  3HRT A;  3R0A A;  5HDN A;  4RAZ A;  2ETH A;  2VC0 A;  3BDD A;  3HSE A;  3I3L A;  4CYC A;  2CQ7 A;  2JN6 A;  3VDX A;  3REO A;  3BR1 A;  3HBL A;  4D9J A;  4IRI A;  2HNH A;  1MW7 A;  5F0H A;  1ZEL A;  5AIQ A;  3HGY A;  2QBY B;  2CQX A;  4OMZ A;  3NAR A;  3DWL E;  2ELK A;  2Z3Y A;  3KZY A;  4XOR A;  1MSE C;  2E5N A;  4BU2 A;  3VPR A;  3VYU B;  1MH3 A;  4S0H B;  1S7E A;  2KKO A;  2IT0 A;  3HYI A;  3GZN B;  2EFP A;  3M8E A;  3K70 C;  3OIO A;  2DG8 A;  4U0Y A;  1KU7 A;  1Q1H A;  5JHU A;  3KP3 A;  1SD7 A;  2BV6 A;  1WPK A;  3GXO A;  3LFU A;  1O3Q A;  2H8W A;  3FXQ A;  2WV1 A;  2ZFU A;  3RIR A;  3F0C A;  3F8C A;  4U0V A;  3FZV A;  5FLX Z;  4G12 A;  4FHT A;  3VSL A;  2FXA A;  4IJA A;  1VTN C;  1FPQ A;  2XGD A;  4XN3 A;  3QPH A;  5HOD A;  3VSK A;  4YEJ A;  2NS8 A;  2K9Q A;  3LFK A;  1XD7 A;  4Y33 A;  3Q0W A;  4BH9 A;  4CSW A;  1WWX A;  2M9H A;  2QWW A;  3OIQ A;  2K3P A;  2WBM A;  4E4H A;  1H89 C;  1K4S A;  4L18 B;  1NH3 A;  1W0T A;  1WCM J;  1HOM A;  2JUC A;  4OAZ A;  2XGX A;  4ME9 A;  3MVP A;  1UG0 A;  3EUH C;  4HRI A;  2DTZ A;  3VWB A;  3IUV A;  3F21 A;  2W4S A;  4RAG A;  3IL2 A;  4DIQ A;  2E35 A;  4ZH4 F;  1FSE A;  1FYL A;  3S32 A;  2A61 A;  1LDD A;  2B1E A;  2DPU A;  3VVY A;  1SC7 A;  3PQK A;  1B9M A;  2HQ5 A;  2VOP A;  4HKU A;  3ZR8 X;  1ETO A;  2Z99 A;  5TIS C;  3VEP A;  1VQ9 I;  2BHY A;  4KUM A;  4H0E A;  3LQR A;  3DV8 A;  3CLO A;  2H94 A;  2ZY9 A;  5AON A;  1TLH B;  2HYG D;  5KAF C;  4AYB N;  3R6S A;  3ECH A;  1ZAR A;  3OSF A;  4A3I J;  4EJV A;  2KFD A;  4Q4Z F;  2UV1 A;  4C2M A;  5CW8 A;  3VIB A;  1W5S A;  4M72 A;  4AIH A;  3HEF A;  2G7S A;  2UUZ A;  1FT9 A;  4Q47 A;  2H09 A;  4OIR F;  4MK6 A;  3LOC A;  1ZKG A;  5LBQ A;  1MBH A;  2BZT A;  2WGB A;  2E1M B;  2KRC A;  2EZL A;  3G56 A;  2V6E A;  5CPR B;  2W48 A;  1MDM B;  2PMZ A;  1ZLK A;  1XGO A;  4RLF A;  3ZQH A;  4O3M A;  2QF7 A;  2ZME A;  2TDX A;  3RYP A;  2VOD A;  3P9I A;  4YRV A;  2A6H F;  1S5L C;  1B8I B;  5EGO B;  1X58 A;  1QVU A;  3GFJ A;  3CMY A;  5H2F C;  1EF4 A;  5DV5 A;  5D18 A;  2ZME C;  3QWL A;  2IJL A;  2ZJR F;  1XSD A;  1AU7 A;  2VIX A;  2ZFW A;  4IKF A;  3B6C A;  3L7W A;  1V55 H;  1P6R A;  4EMS A;  3V4G A;  4KIT B;  1FIP A;  3LSG A;  2KRF A;  3SHF A;  5LFA A;  4IEJ A;  1S7A A;  3I64 A;  2BE5 F;  4AF5 A;  3H9J A;  2O3F A;  2UXX A;  1NHA A;  4C9Y A;  2OAZ A;  4AID A;  4GFB A;  3K2Z A;  3ABU A;  1LVA A;  2BVL A;  1AA7 A;  2F4M B;  2KHM A;  3K4B A;  4CYC B;  5BPD A;  4J19 A;  5DAJ A;  2HOT A;  1GXQ A;  3L1P A;  1GVD A;  4PCQ A;  4KDP A;  3BTC A;  1OPC A;  1GHC A;  1S7O A;  2QUF A;  1OQY A;  1S6L A;  3K7A J;  2Q24 A;  1Z3Y A;  5D5V B;  2Y69 H;  5HS8 A;  1TL8 A;  2WA0 A;  2P4W A;  1SD6 A;  1YOV B;  1N25 A;  3LWF A;  3M4O J;  2REK A;  5DUK A;  4CCN A;  1Z0X A;  5KCM A;  1Q1V A;  1W5T A;  2BY0 A;  3EET A;  1ZR4 A;  1NK3 P;  4W1U A;  1G4D A;  4JKZ A;  3BCA A;  3CJR B;  3FMQ A;  4CCL A;  2RVC A;  3HOT A;  1RR8 C;  1MMG A;  4HNV A;  3CO6 C;  3JRD A;  2C6Y A;  2FUG 2;  4XOT A;  1O7L A;  3G6E I;  3HGG A;  3DTI A;  3NQO A;  3H5A A;  3DLA A;  3CMA I;  1X1A A;  1MMA A;  5EYR A;  1IAW A;  1GXP A;  2NS7 A;  2FJ1 A;  1XSX A;  2VAS A;  4KNY A;  2FA5 A;  2EH3 A;  4XKV A;  4XIC A;  3ZQI A;  2X1C A;  4NBQ A;  3G1M A;  3LNQ A;  1ULY A;  5D6E A;  5CVV A;  4IRH A;  1D0Z A;  3T6N A;  3L09 A;  2BEO A;  5J4Y A;  5CLS A;  1KQ9 A;  1RPW A;  1X3Z B;  3J7A O;  2LKX A;  3CCR I;  1X1D A;  3HIF A;  4XSX F;  4EV0 A;  4A0Z A;  1R5H A;  2O5R A;  3E0J B;  4UVC A;  1OCR H;  2STW A;  2DMP A;  1R5I D;  4XOP A;  4XLC A;  4DGW B;  3M9A A;  2XV4 S;  4HA8 A;  4B3X A;  3WTW C;  1MMN A;  5IT9 K;  3BOQ A;  3PNV A;  3SWH A;  1Z1D A;  1ODD A;  2GA1 A;  3M1E A;  3C2B A;  3PSF A;  5IOY A;  2B63 J;  3LA3 A;  5D8L B;  3S1N J;  1P7I A;  2L7K A;  3GZ5 A;  3NWS A;  3KEY A;  1FNN A;  2EZK A;  5IP7 J;  1R4M B;  1PYV A;  2IP2 A;  2DQL A;  3KLO A;  4CIC A;  2E60 A;  2FOW A;  4KMU X;  3C3W A;  4UUS B;  3HOV J;  2UXU A;  3J80 Z;  1KYZ A;  3ON2 A;  2DJI A;  4RB1 A;  1Z91 A;  2Y0M A;  4Q48 A;  1J0R A;  1R71 A;  4XKB A;  4F7Z A;  4IRV A;  1X3W B;  1W7P A;  2E2J J;  4BHP A;  1R22 A;  4YG2 F;  4G94 A;  3CP8 A;  1BI3 A;  2OV7 A;  3GZ6 A;  5GAD J;  1M1E B;  2W25 A;  3BR0 A;  2YUS A;  1I5Z A;  5FJ8 J;  1IN5 A;  2NOJ B;  3E3V A;  4XKW A;  2QKO A;  1B9N A;  3WHB A;  4P9U A;  1VQ7 I;  3HOX J;  3HB9 A;  1UJ8 A;  3ZMS A;  3S3M A;  1P4A A;  4ZC3 A;  2Y48 A;  3MWM A;  3BPX A;  3I5U A;  2L9V A;  4C30 A;  5J1Y A;  2E7W A;  1A31 A;  2CSO A;  5JFR A;  4ZTF A;  3LWJ A;  4CGR A;  3BJO A;  1BOB A;  3RYR A;  2FRH A;  4XLH A;  2WB1 A;  4MGR A;  3HOZ J;  4GDF A;  2M4G A;  3B6A A;  3H3U A;  1BC8 C;  1WI9 A;  1TNS A;  1V5F A;  3MKL A;  5C4Y A;  1Z77 A;  5DEQ A;  2AQE A;  4CUG A;  3MD2 A;  2ME6 A;  2DA3 A;  2EJR A;  2IGM A;  3VVX A;  2KL4 A;  3HSR A;  2VT2 A;  3WTU C;  2CS3 A;  4HF0 A;  1K61 A;  1GV2 A;  3AG2 H;  2EBI A;  1J09 A;  2DBB A;  3LAP A;  1E0E A;  2VJ4 A;  1R4N B;  1HF0 A;  4M6X A;  2EIL H;  3BCB A;  1YX5 A;  4F52 A;  2XKP A;  2OU2 A;  1WFX A;  2KRH A;  2ISZ A;  1MBK A;  1QQI A;  2DW4 A;  1N77 A;  4EJU A;  4M6V A;  4LMY A;  2DPD A;  5K7H A;  1VQO I;  4L5J A;  3GTK J;  4UNO A;  1QO0 D;  3KYC B;  4NN1 A;  1I1S A;  1TZL A;  1SFU A;  4LLN A;  3S1M J;  4RGS A;  4GFK A;  1WSU A;  4RMN A;  2CFO A;  2HTS A;  1TNT A;  5FGL A;  3GO5 A;  3OYM A;  1I50 J;  2CUJ A;  2A5Y B;  4PXI A;  2M8G X;  1QNT A;  3K4J A;  1JGG A;  4L9J A;  3BG6 A;  3L2U A;  4G8X A;  4G6T B;  4G6D A;  1LFU P;  3PIP F;  1YJW I;  1S29 A;  1X1B A;  1CF7 A;  3F8N A;  4EJO A;  4IF4 A;  5DM6 F;  1XMK A;  1ETQ A;  1IUF A;  2CMP A;  1EH8 A;  3PUF A;  4A5N A;  3BG5 A;  4M3G A;  5DCM A;  2F4O B;  2VBX A;  2E36 A;  2ZJQ F;  4QPQ A;  4PFO A;  2NOG A;  2AQF A;  4YZE A;  4CCO A;  2JVG A;  1VQ8 I;  1BI2 A;  4RB0 A;  2B0L A;  1B59 A;  2CW0 F;  4E6K G;  5FD6 A;  3GFM A;  3VOX A;  2CJJ A;  4AIK A;  4KFC A;  1V3F A;  4P9F A;  4XON A;  1ITY A;  5M5W J;  1T98 A;  3GLX A;  3NPI A;  1U5T A;  1ZLJ A;  2DFH A;  3QP6 A;  4UHT A;  2XAH A;  1RC9 A;  2CUE A;  3LSJ A;  3FXU A;  1LUJ B;  3N05 A;  1BI0 A;  2MC3 A;  4PGH A;  1YHQ I;  1W4M A;  2KDZ A;  2CRG A;  2HPM A;  1XN7 A;  1RUO A;  1ORK A;  1QHH D;  4ESB A;  3H0G J;  1RZ4 A;  1O7F A;  4BAY A;  4HZF A;  3K4M A;  1NK2 P;  2O61 A;  3DLL F;  1IN7 A;  2EV6 A;  1U5T C;  5E79 C;  2WAQ A;  4HF1 A;  3KCC A;  1F5T A;  3G7R A;  4BNC A;  4XQF A;  3K4L A;  1JGS A;  4XM3 A;  1W7P B;  2HKU A;  3V78 A;  1YQA A;  3VW0 A;  3ABT A;  4E7I A;  3OMY A;  4BBS J;  4ZDP A;  1IV8 A;  3MMY B;  2Z9O A;  1BN5 A;  4O6J A;  3S2W A;  5EG0 A;  3ELK A;  4ZYE A;  4IHV A;  1G2H A;  2ELH A;  2VB6 A;  4D0P A;  5E17 F;  3PO3 J;  2PFB A;  5F6F A;  3F22 A;  3PFI A;  3DF8 A;  3RQ4 A;  3T8T A;  3VVZ A;  1LPQ A;  5ED4 A;  2ZOY A;  1FSH A;  2ECC A;  4XLE A;  1RI7 A;  3UNG C;  3NS4 A;  1R1V A;  3OYN A;  4GCK A;  3CLQ A;  1UZC A;  1G3Y A;  2ESN A;  4I09 A;  4IX7 A;  1EV7 A;  4OU0 A;  2DK5 A;  2XRN A;  3HJE A;  1RR7 A;  4I7H A;  3CF5 F;  3A2K A;  3GTQ J;  4A93 J;  2UXP A;  2WB1 N;  3EPZ A;  1YX3 A;  3H36 A;  4WXD A;  2O8X A;  5CVI A;  2CW8 A;  3ZN1 A;  1OJL A;  4BQN A;  3GF2 A;  1KU3 A;  4EM2 A;  4RAF A;  2CGP A;  3HL2 A;  1OYW A;  5GP9 A;  1ZTR A;  1TW3 A;  3D5S C;  1MBE A;  2IRF G;  4ESF A;  3RQI A;  4LGW A;  4BEH A;  2AS5 F;  4KT6 A;  5C3E J;  1KZH A;  1OKR A;  2XAG A;  2A2F X;  1ZRD A;  2X6Y A;  2F6C A;  4A3F J;  3VFZ A;  2HYJ A;  1X4O A;  2I5U A;  2DTR A;  3L2V A;  3RD3 A;  3KKD A;  1LKX A;  2JPC A;  3VOE A;  4E7L A;  3F9K A;  1YS7 A;  3B73 A;  1B1B A;  2EFO A;  1JTX A;  1IRF A;  6PAX A;  2JA8 J;  4LD5 A;  1Y1W J;  2RHA A;  4U0W A;  3I58 A;  2XRL A;  2R7Q A;  2EQR A;  3RZD J;  5D5X B;  3FXR A;  1HKT A;  1MD0 A;  1S72 I;  4MNU A;  1VQ5 I;  3QYB A;  3TW7 A;  2XAJ A;  2A68 F;  3OYF A;  1D1B A;  3W3C A;  4KN7 X;  3OS2 A;  1I27 A;  2XGC A;  3ZN0 A;  2VBZ A;  2OQR A;  2NVQ J;  3S1R J;  5B66 C;  1IO2 A;  4QPO A;  3FM5 A;  4IL6 C;  4ACI A;  2P0W A;  4G6Q A;  2NRA C;  5E1W A;  4DQ2 A;  4J00 A;  2P5V A;  1SAN A;  1JJ6 C;  3M8J A;  2JK3 A;  4HNU A;  2VPL A;  3CUQ B;  4GYI A;  4KIG A;  3TW6 A;  5D8K B;  1DDN A;  1YIJ I;  2HOA A;  1X1C A;  1U5T B;  5FKN A;  2O7T A;  1QZE A;  1W1W E;  3AG3 H;  1XGN A;  3WTV C;  3D1N I;  3TQN A;  2K9L A;  3BR5 A;  2NVY J;  3LMM A;  4KWA A;  4L62 A;  3GBG A;  2VL8 A;  2ZCX A;  2X48 A;  3QPT A;  2VOO A;  5GPC A;  4CHU A;  5CXI A;  4Y52 J;  2NX4 A;  2RQQ A;  5DD4 A;  4R79 A;  2WAQ N;  5KK1 A;  3CRJ A;  2IS2 A;  2PQ8 A;  2K5C A;  3DFG A;  3PJR A;  1ZGA A;  5AQC A;  2LKP A;  5H6R A;  1KQ8 A;  5EG0 B;  1QRY A;  2VLA A;  4FET A;  3QYE A;  1D5Y A;  4I76 A;  3CTA A;  9ANT A;  2MSY A;  2DFE A;  3HTH A;  1HCR A;  3U2R A;  1T2K A;  1DPU A;  2WAF A;  3RTR A;  1JKQ C;  3PIO F;  2OCE A;  3FK7 A;  3BTL A;  4I6Z A;  3AG4 H;  2EZI A;  2KMU A;  3HTU A;  3JTG A;  1IZ1 A;  1I3A A;  4KIB A;  4OAY A;  3FHZ A;  2XUB A;  2IXS A;  2XDN A;  4B44 A;  3CC7 I;  2ZOZ A;  3BY6 A;  2J5P A;  2TRT A;  3K1M A;  5J1R A;  1JHF A;  4HF2 A;  2YX4 A;  1IDZ A;  5M3M J;  2M5W A;  1WJ5 A;  2LK2 A;  3WU2 C;  2MLG A;  1VQP I;  4FT8 A;  2GIZ A;  3LQQ A;  3S15 J;  3H0D A;  3PM1 A;  2PI0 A;  4S05 A;  1VQ6 I;  4G7O F;  3KEQ A;  2ICW G;  2CG4 A;  2K9S A;  3GFL A;  2M2E A;  1U0J A;  2L02 A;  4BEH B;  2P6S A;  3SZG A;  2D1H A;  4PZJ A;  3CME I;  2HEO A;  2QOP A;  2FE3 A;  2HI3 A;  3IP4 B;  3EUK L;  1G59 A;  2XHK A;  3F1B A;  2LR8 A;  1K79 A;  3EGQ A;  2F2E A;  2VKD A;  1MBF A;  2FBH A;  2W00 A;  5E3N A;  2DA1 A;  5HNF A;  4NB5 A;  3O6B B;  2DI3 A;  3FBN B;  4YIR X;  2XSJ C;  3EUA A;  2GWR A;  1J7K A;  3CMM A;  2OQG A;  4WXC A;  2Y0S N;  2KPM A;  2OF7 A;  2HFH A;  2ZCW A;  3LST A;  1IRG A;  4FQG A;  1I6H J;  2IPQ X;  3BR3 A;  1MMS A;  5D4R A;  4E70 A;  5CXG A;  4FIS A;  4QSH A;  3LA7 A;  1BW5 A;  2BVM A;  1MNE A;  2LG4 A;  4WX9 A;  4QWQ A;  1OCT C;  1UMQ A;  5B5E C;  5JLW A;  3KP5 A;  3KZI C;  4L9V A;  4BS9 A;  3I9V 2;  3ZQG A;  2R7U A;  4WCG A;  4ETS A;  2L0K A;  1R5G A;  2A69 F;  2EZH A;  1FBU A;  4A69 C;  2UXN A;  3TDU C;  1POG A;  1FOW A;  4HSR A;  4JQF A;  4PFP A;  4N4N B;  3WE3 A;  1LEA A;  5E3O A;  4BQA A;  1D3Y A;  4I01 A;  3C7J A;  2J5O A;  2UXI A;  1ZYR F;  1N78 A;  3H5R A;  1X2M A;  5HLT A;  3COA C;  3EUH A;  1AWC A;  2GEN A;  2FNP A;  2LFB A;  4HDU A;  1YTY A;  1A35 A;  1WH7 A;  3K69 A;  3IAS 2;  3U1K A;  3KEO A;  2L4A A;  4DW6 A;  4N9I A;  3ABL H;  1HDP A;  3L00 A;  2V6C A;  3Q5F A;  1T56 A;  4BJT A;  4F92 B;  4HX4 A;  4JX6 A;  2XGE A;  1B6A A;  1XDU A;  2FF4 A;  4XLN F;  4B4C A;  1SMY F;  4AU7 A;  3S2D J;  1W36 D;  3J7A Y;  1RES A;  2P81 A;  5EEG A;  2H1K A;  2VBW A;  4ENM A;  5FKK A;  4XMY A;  3R61 A;  1XG1 A;  3FXM A;  4EM1 A;  2PX9 A;  4GYG A;  1V5G A;  3P7N A;  3U9G A;  2EIK H;  3MQ0 A;  3K6G A;  3M1C A;  4NNJ A;  4EJW A;  1RRJ A;  3UKG A;  4A3J J;  5ICC A;  1E17 A;  5TJJ A;  4CZC A;  2QWT A;  3BZK A;  1V4R A;  3DEW A;  3VW2 A;  2DOF A;  3WHC A;  3OYC A;  4AC0 A;  4CO8 A;  1Z21 A;  1EKE A;  1DQU A;  4YFN F;  1IGN A;  1IXC A;  3TO9 A;  2DT7 B;  2GA2 A;  2BW3 A;  2TCT A;  5K1Y A;  2G7U A;  4IQ4 A;  5HLH A;  3E7Q A;  3S17 J;  4A6D A;  4UUS A;  2V1U A;  1SVM A;  3CJN A;  3QOD A;  4NQW A;  2MA3 A;  2GOM A;  4CDG A;  2OJE D;  5CKT A;  3K4C A;  1V54 H;  5J3L A;  5ICG A;  1TWH J;  2A3S A;  2O03 A;  3OY9 A;  2Q0O A;  1P4X A;  1HBX G;  2FMY A;  3BG9 A;  1LFB A;  3NEU A;  4ITV A;  3ZGK A;  1PP7 U;  3FK6 A;  3K10 A;  2K7L A;  2DAO A;  2VKE A;  4AC6 A;  3H1C A;  3QRF F;  3E97 A;  3L2Q A;  5L3D A;  2EK5 A;  3J81 K;  1UEL B;  4A3K J;  1GVJ A;  2EIM H;  2ZJ2 A;  1T8I A;  1F36 A;  3OR1 C;  2ZSI B;  3O2P E;  3VYR B;  4LK1 F;  3IH2 A;  4HG2 A;  3ZRG A;  2MAB A;  4JBA A;  1ETK A;  1BJA A;  1QZY A;  1P2F A;  2MW8 A;  5LD2 C;  3HC7 A;  5BMZ A;  2I8D A;  4Y13 A;  2ELJ A;  2M7B A;  5KNL A;  3ANP A;  5F08 A;  5FMP A;  2WC2 A;  1T38 A;  1D8K A;  5JLX A;  5ICF A;  2WAE A;  2G9W A;  4HLX A;  4WXH A;  2LP0 A;  2WV0 A;  3HOW J;  2XPU A;  2DG7 A;  4UXN A;  1Y0U A;  2XVC A;  4ENN A;  3E7L A;  4ON0 A;  3W2A A;  2KZG A;  1L3L A;  2F5D A;  2R3S A;  4PK4 A;  3WGH A;  1AOY A;  2QZ8 A;  3BJA A;  1Z3X A;  3JAM Z;  2MH2 A;  2DFI A;  5HS7 A;  3DKX A;  4ZYG A;  5ILV A;  1OLT A;  4CZZ A;  1FWZ A;  1Z67 A;  3IWZ A;  1JUP A;  3AQT A;  3F72 A;  1HQC A;  2L9R A;  4W97 A;  2ZXH A;  1FYK A;  2JZY A;  2CYY A;  2R7R A;  1XPX A;  1MSF C;  3HTA A;  2VQC A;  2YX7 A;  3PL8 A;  1Z05 A;  5D4S A;  2FJI 1;  4RB2 C;  5D6F A;  5LRS A;  4UY8 I;  3F8M A;  3COL A;  2FOK A;  3KET A;  5J4V A;  3CJT B;  1Z7L A;  1P4W A;  1QPM A;  1NG7 A;  4MLO A;  3T1B A;  1JKR C;  3BTJ A;  2R5Z A;  1WZ2 A;  3UR3 C;  2FBQ A;  4RS8 A;  2XC7 A;  2BOL A;  2V26 A;  1TP4 A;  3FMS A;  3JTH A;  4YFX F;  1YE9 A;  2B9S A;  3WTX C;  3ML6 A;  2CQN A;  4S04 A;  3MKY B;  2V4J C;  4HOB A;  1XDS A;  2YR2 A;  3FWE A;  1VF9 A;  2LY9 A;  1IW7 F;  3DBH B;  4I2O A;  3RPU D;  1HKS A;  4U7D A;  4U9L A;  5K58 A;  5K5Q A;  4NHJ A;  4LK0 F;  3SDG A;  3A1Y A;  2PBX A;  4UUV A;  2DOD A;  2HTJ A;  2HXO A;  3V8L A;  2YSR A;  2HPI A;  2L2O A;  2G0E A;  1KQ0 A;  2XAF A;  4XKC A;  1LB2 A;  2DOA A;  5KVR A;  2M0C A;  1PUF B;  2JJ7 A;  2L5Q A;  4DYQ A;  2Y75 A;  3E6D A;  2R7T A;  4G7Z F;  4PJN A;  2GM4 A;  1WH5 A;  5D19 A;  4QLC U;  3JRI A;  1ZQ3 P;  1TWF J;  4NC8 A;  5CVR A;  1REP C;  1IN8 A;  5B1A H;  1G3S A;  3QU3 A;  3GUD A;  2LLK A;  5HAW A;  2BW3 B;  1XTA A;  2EWN A;  2X6W A;  3G1O A;  5E18 F;  3O8H A;  3HDD A;  3V7R A;  3CCL I;  2ZNZ A;  3EQL F;  2M8E A;  4OMY A;  1PUE E;  3KX2 A;  1EH6 A;  2E7X A;  4MO7 A;  3ZP5 A;  4NQW B;  3GCM A;  3KNW A;  2QYO A;  2ME0 A;  3A0B C;  5E8I A;  1H8A C;  3WU0 A;  1BL0 A;  2E5Z A;  2MFZ A;  3K1P A;  2PMZ N;  5FLX K;  4A0X A;  2CUF A;  5CQG A;  3FXO A;  3GTM J;  3HIM A;  1FC3 A;  4MFE A;  3L2C A;  2E2H J;  2CV1 A;  1Y56 A;  5HOO A;  3V6G A;  4HLY A;  4GRI A;  5IYB J;  2XAS A;  1VQK I;  1X1P A;  3CP2 A;  1P7J A;  4Y15 A;  1K4T A;  4JL3 A;  3K9T A;  4OD5 A;  3OYE A;  5EZH A;  1KYW A;  1H9T A;  5GPA A;  4LB6 B;  5HDG A;  3C2G A;  1U9N A;  4IPA A;  3HG9 A;  5J8C A;  4RGX A;  3LHQ A;  1SD5 A;  4F55 A;  4IOA F;  1MJ9 A;  2NYX A;  3OV8 A;  1RNL A;  4ZZL A;  2F5F A;  3BG7 A;  2JA5 J;  2NNN A;  3ZMZ A;  1GDT A;  2QTQ A;  1ZH5 A;  5L3C A;  2VC1 A;  3IWF A;  1JT6 A;  3RKW A;  2G7G A;  3I4N J;  3E6B A;  5FRM A;  3TP0 A;  5B3S H;  2STT A;  2EFW A;  2VE8 A;  2F5V A;  3ULQ B;  2X1D A;  1IRZ A;  4HEA 2;  5EDN A;  2NS0 A;  3F8B A;  2PMH A;  5A2Q Z;  2DN0 A;  1UAA A;  3VOK A;  3WU1 B;  3QP5 A;  3X2Q H;  2KIF A;  2VJ5 A;  3VYS B;  1RET A;  2H27 A;  1W5C C;  3VUQ A;  1DU0 A;  1JHH A;  3HTS B;  2GZW A;  2CO5 A;  5ERI A;  5GAH J;  3H35 A;  3NRV A;  5HSZ A;  1JT0 A;  3BT9 A;  3DBL B;  2HWV A;  1BOA A;  3LSK A;  4XLA A;  2IEK A;  3L2W A;  3SEZ A;  1QZZ A;  3CCE I;  1WGX A;  2L3D A;  1VQL I;  4ZDO A;  4AVP A;  2HQN A;  5FKO A;  3T0Y A;  3WOD F;  2VXZ A;  1EJ9 A;  1YYV A;  3LJL A;  4MEX F;  4U7B A;  1TQI A;  3SZT A;  3CES A;  4A3C J;  1YO5 C;  2HOE A;  5GAE J;  3CC2 I;  2R5Z B;  3BZC A;  4HAM A;  4JOM A;  4IZZ A;  5FB2 A;  2Y9Z A;  1GLN A;  2QQA A;  1SFE A;  3I54 A;  1SVO A;  3I59 A;  1B4A A;  3JRE A;  3VTI A;  1LJ9 A;  2VJJ A;  5E1Z B;  3Q3S A;  2BHZ A;  2CWE A;  2F5E A;  5L3B A;  4FAS D;  4M3F A;  4CXF A;  5ILU A;  4GCL A;  4P5O A;  3AQS A;  4M9X A;  3ZPL A;  1RKT A;  1YW9 A;  4LB5 A;  2CH0 A;  3TL4 X;  2M7A A;  3RI4 A;  5BNG A;  2LSO A;  2R92 J;  1T33 A;  1WRJ A;  4A0Y A;  2R7Z J;  5IP6 A;  4LJZ F;  4X6A J;  4XRF A;  5IT3 A;  1QVT A;  2DMQ A;  1S3J A;  4LOC A;  5K7F A;  3CDH A;  3CUQ A;  4BHB A;  4MTD A;  5DUI A;  1YI2 I;  2R4G A;  3S2H J;  4I0B A;  2D45 A;  1OYI A;  2YPR A;  3HUG B;  5BQT A;  1F4K A;  2HDD A;  5K5R A;  4BXX J;  2O9L A;  5FKM A;  5E8G A;  5FO5 A;  2VJI A;  2F07 A;  3CUQ C;  4LIU A;  3J7Z I;  5HNH A;  3T5X A;  2VI6 A;  1FTZ A;  4M74 A;  3ISP A;  2M87 A;  4WIB A;  5FKL A;  3GTP J;  3CCY A;  3PPB A;  3P5J A;  3B02 A;  3ESW B;  4L5E A;  1Y8Q B;  4Y17 A;  5E20 A;  2P5K A;  3GLL A;  3VOD A;  4DZJ A;  2VE9 A;  5K7Z A;  1YLF A;  4FCY A;  1HST A;  4P96 A;  5EEH A;  2KIM A;  4II3 A;  2LBF B;  3I0T A;  3ROU A;  1TW2 A;  3JRH A;  3NI7 A;  5GTH C;  3KP2 A;  2XB0 X;  1SEU A;  3IUO A;  1W36 C;  3OSG A;  1GV5 A;  2ECB A;  2GAU A;  2RN7 A;  4WF2 A;  3E6M A;  1UI5 A;  2MGQ A;  2RV8 A;  5HLI A;  4BXF A;  5K5O A;  3WGI A;  2HVQ A;  3ABM H;  4FE7 A;  1T39 A;  2LF8 A;  4LIV A;  4G7H F;  4N9H A;  3GEZ A;  3HKZ A;  3OOU A;  3BR6 A;  3E1S A;  2K40 A;  2VBY A;  2L54 A;  5H6Q A;  1XGS A;  1WJA A;  1FZP B;  1UHS A;  2RDP A;  5LHI A;  2AXT C;  2L7Z A;  2OD5 A;  3OL4 A;  4IOC F;  2JSP A;  1RKW A;  2WY8 Q;  3HM5 A;  4A3E J;  2LOO A;  3WG7 H;  4D5C A;  3A02 A;  5LEJ A;  1DUX C;  3WG9 A;  1XMX A;  1FBQ A;  2M30 A;  3LSM A;  5HVQ C;  1VI0 A;  1YIO A;  1TQP A;  1XGM A;  4TV7 A;  4HNT A;  4BL0 B;  2W24 A;  3K1N A;  1VND A;  3JRG A;  1RIO H;  3VW1 A;  2EA2 A;  2YU3 A;  4XID A;  3KYD B;  2ZBK A;  3KPH A;  1K7A A;  3GFI A;  2D5V A;  3QBM A;  3J7Y J;  2RRE A;  1TQM A;  2RNJ A;  5J1U A;  2MLK A;  1E3H A;  4AD9 A;  3IC7 A;  5L3E A;  4DZP A;  4IHX A;  3BQZ A;  1E2X A;  4GO1 A;  2DOE A;  5DD8 A;  1R49 A;  3DPL C;  1A6I A;  4NC6 A;  4EGZ A;  2IAI A;  5DM7 F;  3RZO J;  1GUU A;  2PFV A;  2N8G A;  1MH4 A;  4RBO A;  3ASO H;  3BG3 A;  3S93 A;  3J80 K;  4EGY A;  2DA2 A;  1X2N A;  2QVO A;  3H9G A;  3RDI A;  4LLG F;  5E3M A;  3I55 I;  3KYL A;  1J75 A;  5LGU A;  2DMN A;  1OMI A;  3D5R C;  4E7H A;  2ZNY A;  4NEL A;  3WGG A;  3A03 A;  4AM3 A;  5CVU A;  3Q9V A;  2BY2 A;  3FKI J;  4XRS G;  3F6V A;  3OS1 A;  2GUH A;  5E1X A;  2OBP A;  3DXJ F;  5LLQ A;  3I59 B;  1K6O A;  5FLV A;  2IGK A;  1YW7 A;  2E1O A;  3BQY A;  4F3Q A;  2VUM J;  4OD4 A;  3DEU A;  3CQZ J;  1AHD P;  2O0Y A;  3JSP A;  3DTK A;  1WI3 A;  1F9N A;  1HA8 A;  2DQR A;  1ZAO A;  4CYD A;  4JX5 A;  1FLI A;  3LSH A;  4L9N A;  2VQG A;  2DA6 A;  3TOA A;  1SMT A;  3BZ6 A;  2K9M A;  2AHQ A;  1K6Y A;  4XSZ F;  5FFZ A;  3BJB A;  1J59 A;  3N97 A;  3IH4 A;  3BC8 A;  4JNN A;  1G6N A;  1AKH B;  3BCG A;  3W6J B;  3HOS A;  2H8R A;  1IN6 A;  1XSV A;  1QA6 A;  1T08 B;  1ETV A;  5J6X A;  2GQQ A;  4BE1 A;  4C3I J;  5JHF A;  3LSI A;  2O6G E;  1G3W A;  3GTL J;  2R5Y B;  1XB4 A;  2CU7 A;  2ZCM A;  3DPU A;  5A2Q K;  4XR6 A;  5CVJ A;  1UHW A;  1Y39 A;  2KQR A;  5IY5 H;  5M5Y J;  4C2T A;  2BYV E;  2FSW A;  3W2W A;  2K86 A;  3DPT A;  3DPJ A;  1FIA A;  2H1L A;  2LC2 A;  1EA3 A;  1G8X A;  3MKW B;  3DQV C;  1UG2 A;  1F1Z A;  1FX7 A;  3V7S A;  1WQ2 A;  2X4H A;  2IBD A;  4E7Z A;  1MBG A;  3RPU A;  4YIF A;  2MC4 A;  5CJ9 A;  4BY1 J;  4UB6 C;  2V1X A;  4KYW A;  2LVS A;  2R0Q C;  1Z6R A;  3SQN A;  4CCK A;  1ERD A;  3JRA A;  5F1J A;  2ESH A;  3ZMD A;  3IAM 2;  3S16 J;  4PJJ A;  4BDZ A;  4Q5S F;  2KDO A;  1D1A A;  1X4P A;  5L3F A;  2L9S A;  2FQ4 A;  4C2U A;  4K2E A;  1R23 A;  3IKT A;  2HQR A;  3G73 A;  3HKZ N;  4OIN F;  4YEL A;  1TWC J;  2QIB A;  1GT0 C;  3AFH A;  1K78 A;  2KT0 A;  3HHH A;  2XKO A;  4IHT A;  4GXO A;  3AG1 H;  3K4K A;  3GVA A;  4MFD A;  2PEX A;  4ZDL A;  4U88 A;  1WJD A;  1ON1 A;  3SZP A;  4AYB A;  2ZCN A;  2ACJ A;  4HX8 A;  3ON4 A;  2KLO A;  3C2H A;  2BGC A;  2LF7 A;  3LL7 A;  1JTY A;  3F8F A;  3M8F A;  2OTJ I;  1U78 A;  3GW2 A;  1I6X A;  2GOX B;  4U9N A;  1I1G A;  3RSN A;  2JA6 J;  4NDL A;  2X9D A;  4E7S A;  3KLN A;  3KZ9 A;  3KP6 A;  2UXH A;  3H3V K;  1APL C;  1R58 A;  4O5V A;  2ZC2 A;  2O7O A;  4M3D A;  2H6C A;  2NVU B;  3SEQ A;  4C3J J;  1H88 C;  3P9K A;  3R4K A;  4HST A;  2WTE A;  3LSR A;  1A04 A;  3U21 A;  5FLM J;  4D1Q A;  4L0Z B;  5BS6 A;  1YS6 A;  3FX3 A;  2Z1D A;  3U1D A;  3OYD A;  4WK8 F;  1JXS A;  3GME A;  5F0F A;  3KFW X;  4ZJZ A;  4L5I A;  5J47 A;  2OER A;  3TP3 A;  1X19 A;  2GBY A;  3DBR B;  3TOB A;  4B1R A;  3MNL A;  2JT1 A;  1WJB A;  4BAC A;  1IXR C;  4N0B A;  2D1V A;  4EAT A;  2RQP A;  2OUM A;  2DT5 A;  2BXZ A;  1KU9 A;  3MZY A;  2R93 J;  2EFN A;  3CF2 A;  3Q0U A;  2FX0 A;  5FRN A;  1P9Q C;  1D1C A;  2QQB A;  3H92 A;  1YJN I;  4Y7N J;  4B48 A;  2ADU A;  1VQN I;  1JKO C;  5IT9 Z;  2W1O A;  2IGN A;  2V1D A;  2RNG A;  3S3N A;  1TT5 B;  4LG0 A;  5JR3 A;  4PJM A;  2XF6 A;  1E3O C;  1T0F A;  1VQ4 I;  2OC6 A;  1XCV A;  2VN2 A;  2GXA A;  1X3U A;  3B81 A;  3A4C A;  2EIJ H;  3JRB A;  5BOX A;  1I39 A;  2LTP A;  5J40 A;  3V8K A;  2P6T A;  3A01 B;  1A36 A;  3RKQ A;  2M0M A;  3BHQ A;  2WAD A;  3IV5 A;  2XRO A;  5M5X J;  3FXJ A;  1MMD A;  2W53 A;  2VT3 A;  4XBF A;  1SVL A;  1T0F C;  1U9O A;  2A6E F;  4DJA A;  4HPQ A;  3JRC A;  2HVS A;  3P9T A;  2IGO A;  4IHW A;  3QOP A;  2KJC A;  3T8R A;  4CCJ A;  2A05 A;  2IS4 A;  2LY2 A;  2QKL B;  2VQL A;  1DP7 P;  1ZRE A;  2DJN A;  2RAS A;  2EV0 A;  1TT0 A;  2G3B A;  4ANJ A;  4MXM A;  1BW6 A;  2ZXW H;  1TWA J;  1WKM A;  2KJB A;  2OZU A;  3OWT A;  3PNT A;  2K9N A;  4HYE A;  3OYJ A;  2JA2 A;  4PDK A;  4GCV A;  3DP7 A;  4XRM A;  2H6B A;  2COM A;  4XK4 A;  3WTY C;  3CJQ B;  2QEN A;  2ZKZ A;  2VKV A;  1FTT A;  2K4J A;  2PMU A;  2X0L A;  2YVX A;  3CDL A;  1LDJ A;  2D2W A;  3BPV A;  1IUY A;  4HQE A;  3DKY A;  3OYL A;  2E34 A;  1PUF A;  4ASN A;  3M3Y J;  3M7G A;  4KIF A;  4ZYH A;  5HBU A;  4BE2 A;  1HKQ A;  5GTI C;  1VQM I;  2QSF X;  2VXD A;  2WY7 Q;  1U3E M;  1LE8 B;  4AUX A;  3HPH A;  1IN4 A;  5LHH A;  3TDZ C;  3SYT A;  5FD5 A;  1HW1 A;  2W57 A;  2UWM A;  5CQE A;  2EPF A;  1KGS A;  5DTD A;  3QU6 A;  3RJP A;  3GX4 X;  1R7J A;  2NAZ A;  3VYT B;  1K78 B;  2BBY A;  1QHG A;  2JMW A;  2P8T A;  1UCR A;  1SD4 A;  2OCC H;  1XS9 A;  4YII A;  2L4M A;  1QBJ A;  4RDU A;  3HE0 A;  2LD5 A;  1E3P A;  1R1U A;  1IJW C;  2QSH X;  3CO7 C;  2IW5 A;  1HW5 A;  2CV0 A;  2V1N A;  1R36 A;  4UUT A;  3JCU C;  3OYA A;  2PJR A;  2DFF A;  2V9P A;  2M3A A;  4XRS A;  2B3W A;  2FD5 A;  2QSG X;  2XF7 A;  4WWC A;  1HW2 A;  1FEX A;  1ZK8 A;  3VB2 A;  4UV8 A;  3I4P A;  4UV9 A;  4FX0 A;  1LDK B;  2IU5 A;  4BQQ A;  2FU4 A;  4A3M J;  3HSF A;  2JQ7 A;  1ZHF A;  3I4M J;  3KE2 A;  3I56 I;  1OCC H;  2QCO A;  3HTJ A;  1A6Q A;  1IG7 A;  2XIG A;  3BR2 A;  3CD6 I;  1XMA A;  2E1C A;  4BJ6 C;  3CCS I;  3G2B A;  2Z33 A;  3HXL A;  3TO6 A;  4F93 B;  4HV5 A;  3AL0 C;  5TRD A;  2R7S A;  1K83 J;  2L01 A;  5HS9 A;  1R1T A;  2RKH A;  3FHN A;  3NAU A;  2K02 A;  1EH7 A;  3SFI A;  5EEA A;  4Z2Y A;  1T6S A;  3KP4 A;  1H0M A;  4IXA A;  1ON2 A;  2DO7 A;  3CDI A;  2W7N A;  1YG2 A;  1D0Y A;  2JRM A;  3QYF A;  3BP8 A;  4E7J A;  5F04 A;  1OCZ H;  2A07 F;  1JJ8 C;  2X6O A;  4XN0 A;  3OYI A;  2EIN H;  1ZR2 A;  2QLZ A;  4LG3 A;  2HYT A;  2L7F P;  2ZXJ A;  3RKX A;  4LG0 B;  2Q8K A;  5DS9 A;  4MTE A;  2P5L C;  2JSC A;  2CUZ A;  2UZK A;  4KIS A;  1JUS A;  1QGP A;  5IOZ A;  4M6Y A;  4D5F A;  3QPL A;  2Z16 A;  4RGR A;  4GCT A;  1B72 A;  2XAU A;  2HDW A;  2QGU A;  3ABK H;  1WJC A;  3FIW A;  5DCF A;  1W0U A;  4XLP F;  5LGN A;  3W6K B;  2DA7 A;  2LRE A;  2K27 A;  1FJL A;  2NNY A;  4D7M A;  4BDY A;  1OIS A;  1KON A;  4B8X A;  3NRG A;  4KMF A;  5FRO A;  4CCM A;  1YW8 A;  4FE4 A;  2QA4 I;  3Q0V A;  4B43 A;  4RAY A;  1T95 A;  2DA4 A;  4QTR A;  1LVK A;  1O3S A;  4IHS A;  3ZMV A;  2IA1 A;  4HBL A;  4I98 B;  1R6R A;  2UXO A;  4XLF A;  3ONQ A;  4ZYD A;  4ESJ A;  2DCE A;  4MHG A;  1ZGW A;  2E2I J;  4U87 A;  5IPA A;  1TC3 C;  1VZ0 A;  4B47 A;  3ECO A;  4OWR B;  3CWR A;  5BPI A;  3C07 A;  1U8B A;  4DYR A;  2IA2 A;  4I02 A;  4PJ0 C;  2OZ6 A;  1PVE A;  1FOY A;  3V42 A;  5ICE A;  1UB9 A;  2NXN B;  2EFQ A;  3FMR A;  2VQH A;  3FXL A;  3OR2 C;  5IP9 J;  1ENH A;  1ACI A;  1HXD A;  2DU9 A;  3KIO A;  4LIT A;  3FF5 A;  3QPS A;  2FQ3 A;  3MEX A;  2FBK A;  3MCZ A;  3TMO A;  1YFH A;  2DYS H;  3HUG A;  3MAJ A;  4E7K A;  1KA8 A;  1CGP A;  2IS6 A;  3G3Z A;  4IRG A;  2MBF A;  4YFK F;  2G7L A;  3OYH A;  2D6Y A;  4RLQ A;  2V9K A;  2LNB A;  3HTI A;  3PAS A;  4X0G A;  3SDB A;  2Q2E A;  3SXY A;  2P7C B;  1LEB A;  2QKM B;  1ETY A;  2PJR B;  3ZMU A;  5IYC J;  3P9C A;  1SAU A;  1OR7 A;  3JR9 A;  2K4B A;  2LBF A;  1PDN C;  3GTG J;  1HSJ A;  2MYS A;  3DU5 A;  4BY7 J;  2M34 A;  1STZ A;  3AAF A;  1FMW A;  1FOX A;  2HKO A;  2ZJP F;  4DBR A;  1KU2 A;  3DKW A;  3AL0 B;  2Y9Y A;  2GIV A;  2VKH A;  4DBQ A;  1U8R A;  3TBI A;  1OR7 C;  2L7M P;  4PSX A;  2WWY A;  4BE0 A;  3FBI B;  3WTZ A;  4CGZ A;  1IDY A;  2RGV A;  4L0Y B;  4DOZ A;  2ZME B;  3CCU I;  2GLO A;  3BNI A;  1FP1 D;  1S8N A;  2DT6 A;  2JTV A;  3ZQL A;  2L9N A;  3NXC A;  2O8K A;  1UST A;  2X1E A;  1S9H A;  3OYB A;  1SAX A;  1FP2 A;  2LH9 A;  4PJL A;  3S3O A;  5LHG A;  2HR3 A;  2R7D A;  1O4X A;  3C1D A;  3CC4 I;  3K8P C;  4RA2 A;  2LRD A;  2OPT A;  4JYK A;  2DXI A;  2HXI A;  5H9T A;  1LNW A;  5TGT A;  5EZG A;  2E1N A;  4MEY F;  4C3H J;  1XX5 A;  4R8H A;  3CUO A;  1IRX A;  2CV2 A;  2HS5 A;  1ETW A;  4LFU A;  4KN4 X;  5JVT A;  4ZZD A;  3K70 D;  1DGR M;  4MQ9 F;  2W84 A;  1FBS A;  2M4K A;  2Y30 A;  3MZ8 A;  4V19 K;  2GFN A;  2V9V A;  3FXK A;  3HZJ A;  1WHU A;  3F6O A;  1WJE A;  3I71 A;  3K4N A;  4BQO A;  2RAE A;  4EQQ A;  3GTJ J;  1UI6 A;  3EUP A;  3S5R A;  4BGD A;  4RB3 C;  2A6T A;  1O3R A;  4QIW N;  2JRT A;  1BA5 A;  2K85 A;  1B72 B;  2R7X A;  4P1W A;  4HV6 A;  2Y31 A;  2YU9 J;  1TWG J;  5F0C A;  2M45 A;  3KZZ A;  3SFZ A;  3QKX A;  4IO9 F;  4AVZ A;  3JSJ A;  1L0O C;  3L9F A;  1OYY A;  1Y0N A;  3V8J A;  1TBX A;  3BWG A;  3RH2 A;  4Y3O A;  1OCP A;  2DK8 A;  4BBR J;  5M3F J;  1YRN A;  1J9I A;  1BIB A;  2DMT A;  2XF5 A;  2HDC A;  3G71 I;  3K0L A;  2P7V B;  3FRQ A;  3QAH A; 
#chains in the Genus database with same CATH homology
 3HOY J;  3CQZ J;  1AHD P;  1Z0X A;  2L0K A;  1WI3 A;  2EZH A;  1Q1V A;  4A69 C;  5C4X J;  1ZR4 A;  1NK3 P;  1BJZ A;  1I3Q J;  1POG A;  4W1U A;  4JX5 A;  4JKZ A;  2DA6 A;  5E3O A;  4FTH A;  2REK A;  4HNV A;  3JRD A;  2UXI A;  2AHQ A;  4BKX A;  3HGG A;  3BJB A;  1X2M A;  3IH4 A;  5EYR A;  4JNN A;  2GEN A;  1AKH B;  2LFB A;  3BCG A;  2H8R A;  1DU6 A;  1WH7 A;  2NS7 A;  1MNM C;  1ETV A;  2FJ1 A;  4DW6 A;  3GZI A;  1AKH A;  4V2F A;  2EH3 A;  3GEU A;  4C3I J;  1HDP A;  4A3G J;  4XIC A;  3ZQI A;  1T56 A;  3G1M A;  3LNQ A;  1R9T J;  3GTL J;  5D1R A;  4JX6 A;  2XGE A;  2CU7 A;  2R5Y B;  4B3A A;  4B4C A;  3S2D J;  1SGM A;  2NP5 A;  2ZCM A;  3T6N A;  2AO9 A;  1RES A;  2P81 A;  2H1K A;  2NP3 A;  1RPW A;  2R5Y A;  3G1L A;  5M5Y J;  2LKX A;  5FKK A;  1XG1 A;  2YVE A;  1FIA A;  3DPJ A;  2DA5 A;  2DMP A;  3W6V A;  1UG2 A;  4JX4 A;  1JUM A;  2IBD A;  3UKG A;  4A3J J;  3C2B A;  1MBG A;  5IOY A;  2QWT A;  2COB A;  2B63 J;  3DEW A;  3VW2 A;  4BY1 J;  3S1N J;  3WHC A;  1P7I A;  4AC0 A;  2LVS A;  4EEF G;  2R0Q C;  2EZK A;  5IP7 J;  3JRA A;  5F1J A;  1IGN A;  3S16 J;  4UUS B;  4A3L J;  2TCT A;  3HOV J;  2UXU A;  2I10 A;  3E7Q A;  3S17 J;  3ZQC A;  4UUS A;  2FQ4 A;  3ON2 A;  3HKZ N;  3ZOB A;  1TWC J;  2QIB A;  1GT0 C;  4UDS A;  2XPV A;  2E2J J;  2KT0 A;  5J3L A;  1TWH J;  2MG4 A;  4A3D J;  4MFD A;  5C4J J;  3BR0 A;  3BG9 A;  1LFB A;  2YUS A;  2V57 A;  2ZCN A;  3FK6 A;  3ON4 A;  3TED A;  2VKE A;  1JTY A;  5FJ8 J;  4AC6 A;  2XPW A;  1ETX A;  5F27 A;  3S1Q J;  2NVT J;  2QKO A;  1U78 A;  3WHB A;  3HOX J;  3DCF A;  3HB9 A;  2JA6 J;  2E19 A;  4NDL A;  2X9D A;  4A3K J;  2YVH A;  3ANG A;  5J1Y A;  5FHP A;  3KZ9 A;  2UXH A;  1F36 A;  3H3V K;  1APL C;  1HDD C;  4CGR A;  4DYC A;  3LWJ A;  2ID3 A;  3IH2 A;  2O7O A;  4M3D A;  4C3J J;  1H88 C;  2OI8 A;  1ETK A;  2MW8 A;  1JKP C;  2ZB9 A;  5EF6 A;  3HOZ J;  3LSR A;  3B6A A;  4JP0 A;  1MBJ A;  3MKL A;  1XC5 A;  5FLM J;  5C4Y A;  3ANP A;  1Z77 A;  5F08 A;  5FMP A;  2PZ9 A;  5JLX A;  2ME6 A;  2DA3 A;  2WUI A;  3VVX A;  5F0F A;  2NVX J;  2OER A;  2LP0 A;  3TP3 A;  2GBY A;  3SJM A;  4IHY A;  3HOW J;  4B1R A;  3MNL A;  2XPU A;  2DG7 A;  1IV6 A;  1K61 A;  1GV2 A;  4ABZ A;  2EBI A;  3MN2 A;  3E7L A;  1HF0 A;  3VP5 A;  1YRN B;  5C44 J;  2R93 J;  4GFL A;  3Q0U A;  2FX0 A;  4X1E A;  4Y7N J;  1MBK A;  1JKO C;  1JUP A;  3AQT A;  2HOS A;  4M6V A;  5K7H A;  2CQQ A;  2L9R A;  4W97 A;  3GTK J;  1E3O C;  4NN1 A;  1MSF C;  3B81 A;  3HTA A;  3JRB A;  2DMU A;  2LTP A;  3S1M J;  4GFK A;  3BHQ A;  3A01 B;  3RKQ A;  3IV5 A;  1SFO J;  5M5X J;  3COL A;  5FGL A;  1I50 J;  3A01 A;  4PXI A;  2W53 A;  2M8G X;  1JGG A;  1U9O A;  1Y1V J;  3JRC A;  4MLO A;  3P9T A;  1JKR C;  2XSD C;  4IHW A;  3BTJ A;  2R5Z A;  1LFU P;  1NTC A;  2FBQ A;  2JA7 J;  2DJN A;  2RAS A;  1ETQ A;  1IUF A;  2G3B A;  5IYD J;  4MXM A;  1VF9 A;  1BW6 A;  2LY9 A;  3BG5 A;  4M3G A;  1TWA J;  4V2G A;  2K9N A;  5K58 A;  2NOG A;  3CJD A;  4YZE A;  3SDG A;  2PBX A;  4XRM A;  2HXO A;  4XK4 A;  2G0E A;  2VKV A;  1FTT A;  2VPR A;  3CDL A;  3PO2 J;  3VOX A;  2CJJ A;  2M0C A;  1PUF B;  1ITY A;  2JJ7 A;  5M5W J;  4DYQ A;  3NPI A;  2YS9 A;  2CUE A;  3LSJ A;  1PUF A;  2GM4 A;  1WH5 A;  3M3Y J;  5D19 A;  3JRI A;  1ZQ3 P;  5HBU A;  4M3E A;  1TWF J;  2KDZ A;  2CRG A;  3HOU J;  1ORK A;  2LLK A;  5HAW A;  1LE8 B;  4AUX A;  3H0G J;  1NK2 P;  3G1O A;  3O8H A;  3HDD A;  1LE8 A;  1IC8 A;  3IH3 A;  5DTD A;  4MO7 A;  3G7R A;  1CQT A;  3GTO J;  2HKU A;  3KNW A;  2JMW A;  2XB5 A;  3V78 A;  2ME0 A;  3VW0 A;  1XS9 A;  1H8A C;  4BBS J;  3LSP A;  2JWT A;  4RDU A;  1BL0 A;  3HE0 A;  2PMZ N;  5EG0 A;  2LD5 A;  4D7N A;  1IJW C;  2CUF A;  4IHV A;  3GTM J;  3HIM A;  4MFE A;  1G2H A;  2E2H J;  3V6G A;  4UUT A;  3PO3 J;  3VVZ A;  5IYB J;  4XRS A;  2ZOY A;  3KKC A;  1P7J A;  2ECC A;  2FD5 A;  3JRF A;  1A5J A;  1FEX A;  4JL3 A;  1ZK8 A;  4M3B A;  2IU5 A;  5EZH A;  3K2A A;  4A3M J;  4GCK A;  5GPA A;  3I4M J;  1U9N A;  1HLV A;  3HTJ A;  2QCO A;  1QPI A;  1IG7 A;  3LHQ A;  3NNR A;  3BR2 A;  1RR7 A;  3GTQ J;  4A93 J;  2UXP A;  3BRU A;  2WB1 N;  2JA5 J;  5EFY A;  2ID6 A;  1GDT A;  2QTQ A;  4C2M J;  3QQA A;  1OJL A;  1JT6 A;  3O8G A;  1K83 J;  2G7G A;  1F43 A;  3I4N J;  3NAU A;  3TP0 A;  3SFI A;  5GP9 A;  2Y2Z A;  1VFC A;  1ZTR A;  1B8I A;  5EDN A;  1IRZ A;  5EGO A;  1MBE A;  1OFC X;  5EEA A;  4ICH A;  3RQI A;  2DN0 A;  5C3E J;  3VOK A;  4MIM A;  4A3B J;  1RET A;  4A3F J;  3VUQ A;  2HYJ A;  3BTI A;  5F04 A;  3S14 J;  1DU0 A;  1JJ8 C;  2X6O A;  3O60 A;  3RD3 A;  3ZQF A;  5E3L A;  1ZR2 A;  3KKD A;  5HSZ A;  1JT0 A;  2L7F P;  2HYT A;  3BT9 A;  3FIS A;  5DS9 A;  1JUS A;  1JTX A;  2IEK A;  5IOZ A;  4D5F A;  3QPL A;  4CYC A;  1WGX A;  2JN6 A;  2JA8 J;  4GCT A;  1B72 A;  3BR1 A;  3HBL A;  1Y1W J;  2RHA A;  5FKO A;  3FIW A;  5F0H A;  1W0U A;  3HGY A;  2CQX A;  3LJL A;  2DA7 A;  3NAR A;  2XRL A;  2ELK A;  1MSE C;  2EQR A;  3RZD J;  4A3C J;  3VPR A;  2R5Z B;  1MH3 A;  4S0H B;  4D7M A;  1FJL A;  1S7E A;  3NRG A;  2DG8 A;  3OIO A;  2Y9Z A;  3TW7 A;  4FE4 A;  3JRE A;  3Q0V A;  1WPK A;  2DA4 A;  2WV1 A;  3Q3S A;  4QTR A;  3F0C A;  2XGC A;  4M3F A;  4GCL A;  2NVQ J;  3AQS A;  3S1R J;  4G12 A;  1RKT A;  2UXO A;  2XGD A;  5BNG A;  4ACI A;  1ZGW A;  2E2I J;  5HOD A;  2R92 J;  1T33 A;  1SAN A;  1JJ6 C;  2NS8 A;  2JK3 A;  2K9Q A;  5IPA A;  1TC3 C;  2R7Z J;  5IP6 A;  3CWR A;  3TW6 A;  4X6A J;  3C07 A;  3Q0W A;  1U8B A;  4DYR A;  1QVT A;  2DMQ A;  2HOA A;  4LOC A;  5FKN A;  2M9H A;  5K7F A;  2O7T A;  1H89 C;  3D1N I;  3S2H J;  1W0T A;  1WCM J;  1HOM A;  3BR5 A;  2NVY J;  5IP9 J;  1ENH A;  3MVP A;  4ME9 A;  4KWA A;  4L62 A;  2DTZ A;  3GBG A;  3IUV A;  2HDD A;  3QPS A;  2X48 A;  2O9L A;  5FKM A;  4BXX J;  2ZCX A;  2F07 A;  5GPC A;  5CXI A;  4Y52 J;  2NX4 A;  2VI6 A;  3VVY A;  2WAQ N;  3CRJ A;  1FTZ A;  2HQ5 A;  2G7L A;  4HKU A;  5FKL A;  3GTP J;  3CCY A;  2D6Y A;  3PPB A;  1ETO A;  5AQC A;  4L5E A;  4DZJ A;  5EG0 B;  3HTI A;  1QRY A;  3PAS A;  5K7Z A;  4FCY A;  1D5Y A;  4I76 A;  9ANT A;  2MSY A;  1ETY A;  3HTH A;  4AYB N;  3JRH A;  3NI7 A;  5IYC J;  1HCR A;  3JR9 A;  3OSF A;  4A3I J;  2XB0 X;  1JKQ C;  3GTG J;  3FK7 A;  4BY7 J;  3BTL A;  2M34 A;  4I6Z A;  3OSG A;  2EZI A;  1GV5 A;  2ECB A;  1UI5 A;  5CW8 A;  3VIB A;  2MGQ A;  3HEF A;  4FE7 A;  2G7S A;  2Y9Y A;  2XDN A;  4MK6 A;  2L7M P;  3LOC A;  3OOU A;  1ZKG A;  3BR6 A;  1IDY A;  1MBH A;  2K40 A;  2WGB A;  2EZL A;  3G56 A;  2ZOZ A;  2TRT A;  2W48 A;  5J1R A;  2GLO A;  3BNI A;  3ZQL A;  1IDZ A;  5M3M J;  1UHS A;  2LK2 A;  3ZQH A;  3NXC A;  2L7Z A;  2O8K A;  2QF7 A;  3S15 J;  3PM1 A;  1RKW A;  4A3E J;  3HM5 A;  2K9S A;  1O4X A;  2M2E A;  4D5C A;  3A02 A;  1B8I B;  5EGO B;  1X58 A;  1QVU A;  2OPT A;  1VI0 A;  4JYK A;  2HXI A;  5H9T A;  5EZG A;  3CMY A;  4C3H J;  1EF4 A;  2QOP A;  5D18 A;  2HI3 A;  1AU7 A;  3F1B A;  1VND A;  2LR8 A;  3JRG A;  3EGQ A;  3B6C A;  3VW1 A;  1ETW A;  4XID A;  1MBF A;  1FIP A;  3LSG A;  4IEJ A;  2D5V A;  3QBM A;  5E3N A;  2Y30 A;  2DA1 A;  2GFN A;  4AF5 A;  5J1U A;  3GTJ J;  3S5R A;  1UI6 A;  4DZP A;  2RAE A;  3BQZ A;  4GFB A;  4IHX A;  3EUP A;  4CYC B;  4QIW N;  1A6I A;  1BA5 A;  2IAI A;  4J19 A;  5DAJ A;  3RZO J;  2HOT A;  1B72 B;  1GUU A;  2Y0S N;  2N8G A;  3L1P A;  1MH4 A;  2OF7 A;  2Y31 A;  3BG3 A;  4RBO A;  2YU9 J;  1GVD A;  1TWG J;  5F0C A;  2DA2 A;  1I6H J;  3QKX A;  1X2N A;  3BTC A;  3BR3 A;  5E3M A;  3JSJ A;  5CXG A;  2DMN A;  4FIS A;  4QSH A;  1BW5 A;  4NEL A;  3RH2 A;  3A03 A;  1OCP A;  1OCT C;  3K7A J;  1UMQ A;  5JLW A;  2Q24 A;  3FKI J;  4XRS G;  4BBR J;  5M3F J;  1YRN A;  2GUH A;  2DMT A;  3ZQG A;  5FLV A;  2E1O A;  3BQY A;  3FRQ A;  3M4O J;  2VUM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...