5F27A

Structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 2 at 1.68a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
187
Chain Sequence
DRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A fragment merging approach towards the development of small molecule inhibitors of Mycobacterium tuberculosis EthR for use as ethionamide boosters.
pubmed doi rcsb
molecule keywords HTH-type transcriptional regulator EthR
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 80
structure length 187
sequence length 191
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5f27A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5f27A02
4A3KJ 4XK4A 2ZOZA 4DZPA 1UMQA 3VW0A 4M3GA 3VUQA 5FKOA 3H3VK 3NNRA 2DMUA 4B3AA 1JKQC 4ME9A 1ZTRA 4JP0A 3S17J 1LE8B 1OFCX 3RZOJ 5EG0B 3HGYA 2CUEA 2X48A 4DW6A 4YZEA 3C2BA 4PXIA 3LSJA 1MBKA 2G7SA 3BR5A 3A01B 3VOXA 2IAIA 1BA5A 1XC5A 4C3HJ 2LR8A 3ZQLA 2XPVA 5FHPA 1UHSA 2XPUA 3I4NJ 2WV1A 2PZ9A 2YS9A 5DS9A 1HLVA 1Q1VA 4A3LJ 2DA5A 5IYBJ 1AHDP 3LSPA 1BW6A 3CMYA 4BY1J 4MXMA 2M0CA 2QCOA 5M3MJ 2WAQN 2X6OA 2ZB9A 2ZOYA 3VVXA 4M3FA 3JRBA 3MN2A 5E3MA 4A69C 2LD5A 3JRIA 3AQTA 2XPWA 2Y0SN 3RQIA 4FCYA 3BTJA 2E2IJ 3S2HJ 5DTDA 2HKUA 3JRFA 2HI3A 3ANPA 5M3FJ 1UI6A 4QSHA 2REKA 1YRNA 3OIOA 1I50J 2DA2A 2Y9YA 3MKLA 4G12A 4BY7J 1PUFA 4DYQA 2ZCXA 5CXIA 1H89C 1T33A 1AU7A 4FISA 2K9NA 2VKEA 3QPLA 3S1QJ 4AYBN 4UUSB 5J3LA 1JGGA 3GTMJ 3HIMA 2W53A 2QKOA 5C3EJ 3V6GA 4A3IJ 3HM5A 2FJ1A 3RD3A 4IEJA 3SFIA 1ETOA 1NTCA 3T6NA 4C2MJ 1JUMA 4Y7NJ 3B6AA 3LNQA 2DN0A 2CU7A 5CXGA 2GLOA 2LFBA 5EGOA 1MBJA 3K2AA 2HXIA 2CRGA 2ID6A 2M8GX 3ZQHA 1JUPA 3VIBA 1RKTA 2CUFA 3NXCA 4GCLA 5JLXA 5IP6A 1LFUP 2UXIA 2DA3A 5IYDJ 4XRMA 3PO2J 1FIPA 2ZCMA 3NPIA 2DTZA 4DZJA 3COLA 3LSGA 3S16J 2OF7A 2NX4A 2DMTA 4IHYA 1H88C 1TC3C 1WI3A 2FBQA 2NVXJ 4M3EA 4A3MJ 1JT0A 2I10A 2RASA 1NK3P 4MFEA 2IBDA 2N8GA 4JYKA 1ZR4A 2OI8A 2QF7A 3PASA 1R9TJ 5IOZA 5D18A 5HBUA 3SJMA 4D7MA 1BW5A 2LTPA 3RH2A 4W97A 2GUHA 3PM1A 2ECCA 2LK2A 5FJ8J 4IHVA 2L9RA 3G7RA 5K7FA 3Q0UA 3RZDJ 3MVPA 5AQCA 5M5XJ 3NAUA 1S7EA 1VF9A 1W0UA 3MNLA 4MK6A 3QBMA 4Y52J 3WHBA 4ABZA 9ANTA 2R7ZJ 3G56A 2EZIA 2W48A 2HXOA 4MLOA 4DYRA 1LE8A 3M3YJ 3BJBA 4XIDA 3G1OA 3KKCA 3GTJJ 1F36A 3LSRA 2MSYA 5EZGA 4GFBA 5K7HA 1GT0C 1FEXA 2L7FP 1TWCJ 4A3JJ 2JJ7A 3KNWA 2XB5A 1BJZA 3G1MA 3FK6A 2R93J 2ME6A 3GTGJ 3HOYJ 5GP9A 3IH4A 4M3DA 2R5ZA 1BL0A 5JLWA 2LY9A 2R5YB 2E2JJ 2JA8J 3BT9A 1Y1WJ 2NVQJ 1TWHJ 3FKIJ 2MG4A 3HGGA 3JR9A 1MSFC 2G7LA 2GENA 4C3IJ 2DA1A 2G0EA 3BTIA 2H1KA 4JL3A 4AC6A 4C3JJ 4CYCA 2YU9J 3GTPJ 3BNIA 4GCKA 3VPRA 4AF5A 4M6VA 1A6IA 1MBFA 2XGDA 3WHCA 1ZQ3P 1AKHA 3LWJA 1SGMA 5IP9J 2ME0A 3BR6A 2NS8A 5J1YA 1MH4A 4QTRA 2DMPA 1B72B 1CQTA 2DA4A 2RHAA 2UXOA 3K7AJ 3C07A 1T56A 1SFOJ 1P7IA 3JRCA 2B63J 1E3OC 2OERA 3JSJA 2TCTA 2EQRA 4FE7A 3IH2A 3JRGA 2DJNA 1U78A 3LOCA 3GZIA 3DCFA 1B8IB 1MH3A 1IG7A 3HB9A 4A3FJ 3ANGA 3GBGA 5BNGA 2G3BA 1RPWA 5C4JJ 1JKRC 1IRZA 2Q24A 2YVEA 5J1UA 2VKVA 2QWTA 2JA5J 1HOMA 2X9DA 2O7OA 1IDYA 1F43A 1VFCA 3VOKA 2EH3A 3BQZA 3TEDA 3EUPA 1OCTC 1IDZA 4A93J 2WGBA 3OSFA 2JN6A 5F04A 2DG8A 1I3QJ 2Y9ZA 2AHQA 1HF0A 5K58A 4EEFG 3TP3A 1G2HA 2YVHA 4IHXA 2E19A 4NELA 2JA6J 2L7MP 5HSZA 2GFNA 3O8GA 3BG9A 2IU5A 4L5EA 3NI7A 1O4XA 2HDDA 1OJLA 3F0CA 3OSGA 1JJ8C 3HOWJ 3HTHA 4D7NA 3ON2A 3NARA 4GFKA 3GTOJ 3ON4A 5FKNA 1MNMC 1JKPC 4RDUA 3W6VA 5IP7J 2MW8A 4RBOA 3IV5A 2GBYA 5C4XJ 3VW1A 2YUSA 3ZQCA 3P9TA 2HOAA 2E1OA 3EGQA 2E2HJ 2Y30A 3HE0A 2XRLA 1P7JA 3L1PA 4ICHA 3ZOBA 5C44J 1W0TA 4HNVA 2IEKA 5HODA 2L0KA 2K9QA 3O8HA 2PMZN 5E3NA 1A5JA 3S1RJ 3M4OJ 2QOPA 2ID3A 1Z0XA 4D5CA 1Z77A 2G7GA 4QIWN 3TW7A 3S15J 3CDLA 2R5YA 3UKGA 5FKLA 3LJLA 1JTXA 2CQXA 2ZCNA 3HTAA 2ELKA 2JA7J 5F0FA 4LOCA 3GTQJ 1YRNB 2NS7A 4AC0A 2F07A 1PUFB 1TWAJ 3PPBA 3E7QA 2KT0A 3HEFA 2HQ5A 2AO9A 3I4MJ 1OCPA 5CW8A 1D5YA 3BR2A 3BR3A 5EG0A 3FIWA 1MSEC 1IGNA 2EZHA 1DU6A 2DMQA 2RAEA 1XS9A 3A01A 5EZHA 3VP5A 5EYRA 2O7TA 3CQZJ 4A3EJ 3V78A 4BBRJ 4BXXJ 4GFLA 4KWAA 4X6AJ 5EGOB 2NVTJ 1EF4A 3HOXJ 4B4CA 1QVUA 4M3BA 5E3LA 1ITYA 1JJ6C 3B6CA 3BR0A 4I76A 5F0CA 3FISA 1H8AC 3HOUJ 4MO7A 2HYJA 3A03A 4HKUA 3TW6A 1U9NA 4MFDA 3TP0A 1WH5A 3PO3J 1ENHA 5GPCA 4V2FA 3Q3SA 4JX5A 1ETWA 4J19A 5M5WJ 3JRDA 4B1RA 1HDPA 1TWGJ 3B81A 2LLKA 2CQQA 5FKKA 1MBHA 4DYCA 2LP0A 2Y2ZA 3HTJA 5J1RA 3DPJA 2OPTA 2XB0X 3BR1A 5FLMJ 5FGLA 3LHQA 1GUUA 2L7ZA 2Y31A 3CCYA 2FQ4A 1GV5A 2CJJA 1X2NA 4CGRA 4UUTA 4V2GA 2M9HA 2EZLA 2FD5A 1JTYA 1JKOC 2EBIA 3BRUA 2QTQA 3HTIA 4NN1A 4JX6A 1IC8A 4UUSA 2XSDC 3BG3A 1HCRA 1ETQA 4JNNA 2MGQA 5FLVA 5EEAA 1FTTA 5E3OA 5M5YJ 2DA6A 4MIMA 3BQYA 5F1JA 4W1UA 2HYTA 3O60A 3CJDA 1MBEA 1QVTA 2DMNA 2R5ZB 3CWRA 3VW2A 3RKQA 4IHWA 2UXHA 5F27A 2NP5A 5FMPA 3HBLA 1FIAA 2XGCA 1GV2A 3QQAA 5EFYA 1IV6A 3GTKJ 3S1MJ 3DEWA 4I6ZA 4FE4A 2NOGA 3E7LA 2XDNA 2O8KA 3S1NJ 1WCMJ 2K9SA 3GEUA 5GPAA 4CYCB 3H0GJ 3JRAA 5F0HA 2D5VA 2EZKA 1MBGA 2NP3A 2H8RA 3Q0VA 1AKHB 5IYCJ 2HOSA 3QKXA 2K40A 4BBSJ 4L62A 5HAWA 2DA7A 4XICA 3ZQFA 4A3GJ 1XG1A 2GM4A 1ETXA 1JUSA 3HOVJ 3VVZA 1GDTA 1JT6A 3IUVA 1RETA 4FTHA 5D1RA 1POGA 1U9OA 3GTLJ 4XRSA 2M2EA 4XRSG 4BKXA 1ZK8A 2KDZA 4A3CJ 4X1EA 5EF6A 1X2MA 1RKWA 1IUFA 1VNDA 5DAJA 1ORKA 1IJWC 2R92J 1X58A 3HOZJ 2UXUA 1SANA 1VI0A 1FJLA 2M34A 4UDSA 5FKMA 2R0QC 1HDDC 1UI5A 4A3DJ 3A02A 3HKZN 2DG7A 1WH7A 3Q0WA 4S0HB 2HOTA 1K61A 1K83J 2XGEA 2ECBA 1GVDA 2JK3A 4NDLA 5EDNA 2COBA 3S2DJ 4ACIA 1QRYA 5C4YA 2PBXA 3FK7A 2JWTA 1ETYA 1ZGWA 3IH3A 3KZ9A 1APLC 5K7ZA 3HDDA 1ETKA 3BHQA 2WUIA 4GCTA 2V57A 3S5RA 2D6YA 1ZR2A 2TRTA 1U8BA 3KKDA 2NVYJ 3S14J 3BG5A 3CRJA 3BTLA 5H9TA 2O9LA 4A3BJ 3VVYA 1B72A 1TWFJ 5D19A 2WB1N 1RR7A 3ZQIA 1WPKA 4JKZA 3JRHA 1RESA 1ETVA 3BTCA 4JX4A 3D1NI 1NK2P 1QPIA 3NRGA 3SDGA 3FRQA 1LFBA 2FX0A 3JREA 2JMWA 1ZKGA 2QIBA 1UG2A 3ZQGA 4AUXA 5IOYA 3QPSA 1Y1VJ 2P81A 2VPRA 3OOUA 1B8IA 3AQSA 2LVSA 5F08A 1DU0A 1I6HJ 2VI6A 2LKXA 3BCGA 2UXPA 3F1BA 5IPAA 1WGXA 1FTZA 2VUMJ 3G1LA 4D5FA
chains in the Genus database with same CATH superfamily
5E17F 3SWHA 1LDJA 4HYEA 1MMSA 4ZYHA 3EUHA 1A31A 1XD7A 2LKPA 2Q2EA 1ZTRA 3CP2A 4JP0A 1BI2A 3S17J 1EJ9A 1VQ5I 1R4MB 3RZOJ 2X48A 3MKYB 4PXIA 5TJJA 1TBXA 4EM1A 1XC5A 2WY7Q 3PNTA 2LR8A 3MCZA 2XPVA 4HAMA 3ZQLA 5FHPA 3V8JA 4Z6YA 2YS9A 3VDXA 1Q1VA 1O7FA 1HLVA 2X6XA 2BEOA 5IYBJ 3O6BB 2J5PA 4LIUA 3LSPA 3MFKA 2PJRB 1MDMB 2BOLA 1OYWA 3VFZA 3CMYA 2FXAA 1ZLKA 4BY1J 2VC0A 2K9LA 3OIQA 1DQUA 4U0VA 2XC7A 2WAQN 4CCNA 2ZB9A 2NYXA 3DKWA 4M3FA 4PUSA 4KNYA 1TT5B 1IRGA 3KPHA 5A2QZ 1R23A 4IVNA 3WE2A 3MN2A 4I98B 4A69C 4XLFA 3JRIA 4OAZA 4OIOF 3AQTA 4FCYA 3G6EI 4ZTFA 2A05A 2E2IJ 4U9LA 2PG4A 2MLKA 2HI3A 3WTTC 3WGGA 5M3FJ 3L00A 3K70C 4PSWA 4ESBA 3VWBA 3ZPLA 1UI6A 1HSTA 3BPXA 4BQAA 1P6RA 3HZJA 4B09A 2DA2A 1WJBA 2GQQA 3K4NA 4RAGA 4G12A 1PUFA 2ZCXA 3OYFA 2AXLA 2CYYA 4ZZLA 5CXIA 1D1CA 2X0LA 3BZCA 4HZFA 2NAZA 2K9NA 5GAHJ 4B8XA 4ENJA 1JGGA 3HIMA 4L5IA 5C3EJ 3V6GA 4A3IJ 2DQRA 4IEJA 3SFIA 5A2QK 1JUMA 4Y7NJ 2DN0A 1BOBA 2VJJA 1FBQA 2GLOA 2LFBA 3C18A 5EGOA 3K2AA 4S04A 2K85A 4KT5C 4LD5A 3OYAA 3ZQHA 1U3EM 2ZCWA 1JUPA 3H0DA 1OR7A 1KA8A 1K78B 1D0XA 1BI0A 5IYDJ 4M73A 2DTZA 4DZJA 2OF7A 3CP8A 4HW0A 3HJEA 2LMDA 3CMEI 2QSGX 1WZ2A 2Z2SB 2FBQA 3J7AO 2OTJI 2I10A 2RASA 2P5KA 1PYVA 4M74A 2Y0SA 4MFEA 3V7SA 4XKBA 3VYRB 3PASA 1F5TA 1IRXA 3U2RA 4RGUA 3T0YA 1Y8RB 2O6GE 5KK1A 2K3PA 4RM2A 5LBQA 2XAGA 2E1MB 4CYDA 3CCQI 2LK2A 1QHHD 1XGOA 5K7FA 3Q0UA 3LQRA 3RZDJ 5AQCA 3FDYA 4AYBA 3CTAA 1B9MA 1S7EA 1VF9A 5JHFA 2XAJA 1TW2A 2FUG2 4MEXF 1ZAOA 2V6CA 4ABZA 3G56A 3ML6A 4IO9F 1LE8A 2QLZA 3G1OA 4A0YA 2EB7A 5DEQA 5BPDA 3LSRA 1YQAA 4UVCA 4AIJA 3KNWA 1MW7A 1BJZA 3OYBA 2ME6A 2Z5UA 1QNTA 2L9NA 4M3DA 2F48A 2RC4A 3CUQA 3FXQA 5JLWA 3K8PC 2K3FA 5DDGA 1Y1WJ 2BGCA 2KJCA 1USTA 3ELKA 4CICA 1T39A 4YELA 5L3FA 2G7LA 3FBNB 3CJRB 3S93A 1KQ8A 1KU7A 2YU9J 5LLQA 3GTPJ 3SZTA 3VPRA 4AF5A 4M6VA 1JHHA 4OMZA 1B9NA 3PL8A 3K4JA 2KIMA 1AKHA 3LWJA 5IP9J 2ME0A 2IGKA 3BR6A 2M4KA 1Z3YA 5DD8A 3TDUC 5B3SH 1D5VA 1SD4A 1WI9A 4XSZF 1B72B 4A0XA 2MD0A 2RHAA 2HPIA 1SFOJ 2Y69H 4M6YA 1R22A 1LKXA 4P1WA 4BUPA 2DAOA 1W7PD 4BL0B 4GO1A 4J00A 2GWRA 3KP3A 4K2EA 1T0FC 2V7FA 1K6YA 3GLLA 4NBQA 3PUFA 3G2BA 1YI2I 2MYSA 5J8CA 3RKWA 3I56I 3BCAA 3QP5A 3HB9A 3GBGA 1R36A 1MJBA 1JGSA 3ZN1A 2QWTA 2DFFA 3RYRA 2JA5J 2H8WA 3VOKA 2EH3A 3TEDA 3T8RA 2R7UA 4A93J 2WGBA 3WTSC 1WJ5A 3VB2A 1MKMA 2W00A 1I3QJ 3ZQQA 1OYYA 3PFYA 2Y9ZA 1EH8A 4R79A 1F4KA 3FKJA 1G2HA 2YVHA 4IHXA 1MJAA 2E19A 4NELA 3K4CA 4GYGA 3F8CA 4ASNA 2M4GA 3NI7A 2VBXA 4DBQA 3QODA 3NARA 1MNMC 1QO0D 3DXJF 1JKPC 3W6VA 4RGRA 1RUOA 5IP7J 4RBOA 4IOAF 2RNGA 3WE3A 2GBYA 2AS5F 3VW1A 2KMUA 5E79C 2HOAA 1D1AA 2E1OA 2HQNA 4H0EA 2Y30A 3HE0A 1K7AA 2WADA 1P7JA 3KZYA 2ADUA 2FMLA 2IEKA 2V6EA 5HODA 2L0KA 3F8MA 4YFXF 1R1TA 2JUCA 2K9QA 2KISA 2PMZN 3Q5FA 1A5JA 2KKOA 4PJLA 3WGHA 2P5LC 2QOPA 4D5CA 4Q47A 2QUFA 4E6KG 3BOQA 3CF2A 2XASA 4XRFA 2DYRH 3TW7A 4QIWN 3S15J 3UKGA 1EKEA 2XAHA 1JTXA 1SC7A 2EV5A 2EWNA 1W36D 2E36A 3JSPA 5HLGA 3HTAA 1TQIA 2BVMA 3B02A 4XLCA 3K1NA 4TV7A 4MQVA 4O3MA 2FMYA 4AC0A 2IT0A 4G94A 1W36C 1K6OA 1TWAJ 3QOPA 3D5LA 4IRHA 3E7QA 3PPBA 4B44A 2KT0A 5IT3A 5CW8A 2YU3A 1P4WA 5DCMB 4RM3A 2HEOA 2A07F 4RAZA 2QBYB 5CVVA 1ONVA 1PUEE 3A01A 4AM3A 3VP5A 1V4RA 3CQZJ 3V78A 4BBRJ 2O5RA 3VSLA 4EM0B 2QQBA 4B4CA 2EINH 2FSWA 4FQGA 3HRTA 3QRFF 1H8AC 3CJNA 4MO7A 4MTDA 3BJ6A 3A03A 1G8XA 2V1XA 1NHAA 3VOEA 3E5QA 4U7BA 2B1EA 3PO3J 3VEPA 3ZCOA 2C6YA 1X3WB 3PIPF 3CCRI 1BOAA 2O3FA 2VBYA 3C2HA 1TWGJ 2XUBA 4HRIA 4LG0A 3B81A 2LLKA 4EGZA 3WU1B 1VQ6I 1UCRA 3D0SA 4DQ2A 5J4VA 3BR1A 3MMYB 1WJCA 1R49A 1Z9CA 1D1BA 1GUUA 1S72I 3OIPA 2L7ZA 1SVMA 1GV5A 1X1CA 2CJJA 2B3WA 5B1BH 4UXNA 1ON2A 2LG4A 3V4GA 4CGRA 4UUTA 2VB6A 2M9HA 4CDGA 1T2KA 2EZLA 3O3KA 2FD5A 1JTYA 3DLAA 1MJ9A 2LH9A 2RKHA 4OU0A 2FOKA 2K02A 1IC8A 4UUSA 3F9KA 3BG3A 3M7GA 1SFKA 3C1DA 3IWZA 1WRJA 1ETQA 3A4CA 4JNNA 5HS9A 5FLVA 3IL2A 1R71A 4B47A 1FTTA 1BR1A 4IF4A 4MIMA 3DFGA 4W1UA 4Y13A 2JRTA 3R0JA 3FMSA 2R5ZB 3HUGA 2CV2A 4IHWA 4KT6A 2DFEA 1FYKA 4AIKA 1FIAA 2XGCA 1IV6A 2DOEA 3CUQC 4NC8A 4I6ZA 1YOVB 2CQKA 2NOGA 3E7LA 1VQPI 2XDNA 3LWFA 3E97A 1FBSA 4R8HA 1DP3A 1LFPA 1NG7A 2Z1DA 3TL4X 2R7SA 3I5UA 4HEA2 2HNHA 1N77A 4E7IA 4PDKA 1RR8C 1XX5A 1Z3XA 3Q0VA 4NQWB 5E1ZB 5J6XA 2HGCA 2K40A 1H9TA 4D0PA 4IZZA 4HOBA 1O3QA 3HXLA 2VJ4A 4C30A 4GDFA 4NNJA 2CMPA 4Z2YA 2JSPA 4I0AA 4I99C 4AVPA 1XG1A 2O8XA 2IS4A 3A0HC 5HDKA 2MH2A 1RETA 3SYTA 3J81Z 2F4MB 4XNFA 1U9OA 4XRSA 4L0YB 1X4PA 1X3UA 4CSWA 3E3VA 2KDZA 4X1EA 5KHDA 5LRRA 2PEXA 3ZXSA 2KRCA 2OV7A 1FJLA 2M34A 1BIBA 4M72A 1O57A 4HSTA 1ZG5A 5L3EA 4G9YA 4BJ5C 3HKZN 3TO9A 1F9NA 3U9GA 2QEXI 2ZKZA 4S0HB 1K83J 2ECBA 2F5FA 1EV7A 5CKTA 3S2DJ 1I1SA 2OCEA 3E5XA 5LHHA 4U9NA 1YO5C 3OL3A 3J81K 5E20A 3MKWB 1SEUA 5GADJ 2MBFA 3DKXA 3IH3A 2DT5A 3ZR8X 3PJRA 4R1HA 3BHQA 1U2WA 1Y0NA 4GCTA 5DV5A 2V57A 2PQ8A 4HNTA 4RGXA 1SFUA 3MKZA 2BVLA 4HDUA 3KKDA 2NVYJ 3CRJA 1N25A 5L3CA 2O9LA 1T08B 1DGWY 4F93B 2DW4A 4QWQA 2WB1N 2CFXA 4I0BA 4ZYEA 1R5GA 3JRHA 3ZP5A 4JX4A 1PP7U 1NK2P 5HLIA 1NH3A 3ERED 3FRQA 5IT9Z 2FX0A 3H1CA 3JREA 2X4HA 2QIBA 2VPLA 2Z9OA 2H94A 3M1EA 1ODDA 2ELJA 2STWA 2QGUA 2P81A 2VKDA 2A5WA 2WA0A 2TDXA 5F08A 1I6HJ 1P4XA 3KP7A 1ON1A 2JPCA 3BCGA 5DUKA 1ULYA 3NWSA 2PLYA 4LK0F 3COAC 3TMOA 4HSRA 5IPAA 1WGXA 1PP8F 5LGUA 1B1BA 3KYLA 2CQNA 4D5FA 4A3KJ 4XK4A 4KMUX 4ESFA 2ZOZA 5IT9K 2XIGA 4I2OA 4O5VA 2FJI1 3NNRA 4B3AA 3MWMA 2OQGA 2DTRA 4ME9A 2JQ7A 3RTRA 4BYYA 1R5ID 5EG0B 3DPLC 1KYZA 4FETA 2IS1A 1GXQA 3BDDA 3GX4X 5E1XA 3LSJA 1MBKA 3CMMA 3SXYA 3ULQB 3ABTA 2CW8A 2L9SA 3WTZA 2OA4A 4C3HJ 4XKCA 3SEZA 3LA2A 5KNLA 2KIFA 3A1YA 2WV1A 2X85A 3HPGA 4MEYF 2DDAA 3SZPA 2Y48A 3AG3H 2R7RA 2A69F 2DA5A 3T8TA 1FYLA 5ILVA 4A3LJ 2QQ8A 3IHUA 3KP5A 1D0YA 2B9SA 1AHDP 2CG4A 3QAHA 1A35A 1R5HA 3E5UA 1M1EB 2VKHA 4HV6A 2IA1A 5FROA 1Z91A 4Q5SF 4E4HA 2RN7A 2GZWA 2D1VA 4ZYAA 3DBLB 1J59A 3CLQA 4BS9A 5E3MA 2F5EA 4A5NA 3DV8A 3IC7A 2HTSA 4XN0A 1IN8A 2H1LA 3OYGA 1WWXA 3F3XA 3GUDA 4JOMA 1J0RA 3ANPA 4A6EA 2A6TA 4QSHA 1YRNA 2REKA 3M8EA 3K1PA 2X1EA 2FE3A 2Y9YA 3EUAA 3QOEA 1U8RA 3EDPA 2VKEA 3GMEA 3QPLA 4M9XA 3PIOF 2ACJA 1RZ4A 2HYGD 2HZDA 5CPRB 2DYSH 1A36A 3L2RA 5J4YA 5IY5H 2XHKA 4C2MJ 2FOWA 2OAZA 1QU3A 2OD5A 3KLOA 3ECHA 1AWCA 3D5RC 3H35A 5HNFA 4LB5A 1TLHB 2CGPA 3HOTA 1MBJA 2HXIA 2OUMA 3BLYA 5FO5A 5FFZA 1W5TA 1RKTA 4BXUA 4GCLA 5GTIC 4UV8A 3PO2J 2ZCMA 3COLA 3S16J 4KIGA 3SZGA 1H88C 3CC2I 1UZCA 3S3MA 3F6VA 2VE8A 4PJJA 3TOBA 2RGVA 3I59A 1ZR4A 5FFXA 1R7JA 2QF7A 3FXMA 1TTYA 3ISPA 5D18A 3LMMA 1LEBA 5HBUA 4G6QA 4IKFA 4N0BA 2LTPA 3CJQB 3RH2A 2OZ6A 3PNVA 4W97A 4ENNA 3PM1A 2P4WA 1Z67A 2R4GA 1OMIA 1HKTA 3RKXA 1W0UA 4Y52J 3CUOA 3ZRGA 3RPQA 4HLYA 1Y56A 2CW7A 3LSHA 2EZIA 4HDVA 2HXOA 3R60A 4DYRA 4RAYA 4XIDA 2ETHA 1U6GA 3VSKA 4HLXA 3GTJJ 1F36A 3HL2A 1LPQA 4GFBA 4L0ZB 4U7DA 1GT0C 2FEZA 5HLHA 2GOXB 2JJ7A 2QQ9A 2XB5A 4RAFA 3H3UA 1BL0A 2JA8J 2E2JJ 3N05A 2Y0MA 1W5SA 2P8TA 2K5CA 2VC1A 1TWHJ 2W85A 3F6OA 2MG4A 3FKIJ 1XGNA 3HGGA 4ZDPA 3JR9A 1HW2A 2PJRA 1MDMA 4U0WA 3OS1A 1MSFC 4XN3A 1GVJA 3DEEA 2LY2A 1TW3A 4JL3A 3I54A 2IVMA 4C3JJ 4FT8A 4YEJA 5HS7A 2PBIA 2IRFG 3D5SC 1MBFA 4KYWA 4F52A 1LDKB 4GXOA 1J5YA 4OD4A 4E7ZA 5D8LB 4CHUA 1MH4A 2IA0A 4QTRA 1CQTA 3F23A 2UXOA 2QENA 2W7NA 3W2VA 4DOZA 1O3RA 3I0TA 1O7LA 2V9VA 4WIBA 3JRCA 5F1RA 2B63J 4C2TA 2EFPA 4M6XA 5DM6F 4X0GA 1W7PB 4HX7A 3JSJA 3I71A 4HQEA 2HU9A 1X1PA 3ASOH 2BHYA 2MA3A 3BG7A 3IH2A 4FE7A 4ESJA 2ISYA 4P5OA 3U1DA 2PMHA 1EH7A 4AIDA 1IN4A 2BYVE 2DJNA 2EFOA 3CCLI 1YITI 4J01A 3LOCA 4LITA 1B8IB 3AKZA 2WAEA 3C2GA 3ANGA 2G3BA 3J80Z 1RPWA 1SD5A 2HWVA 2Q24A 4XSXF 5J1UA 1EA3A 3E6MA 3BCBA 4XOPA 2X9DA 2O7OA 3Q9SA 1F43A 4XLNF 4KISA 3LSIA 1HQCA 1UHMA 1OCTC 4PK4A 1KONA 2X1CA 3GW2A 5F04A 2DG8A 2FF4A 2HTJA 5GAGJ 1SD6A 1HF0A 4YIIA 4BE1A 2K4BA 5HSZA 3O8GA 3BG9A 2R7WA 4L5EA 2IGMA 2L4MA 4KMFA 2HR3A 3SHFA 3OSGA 3HOWJ 2EJRA 2BW3A 3DTIA 2MW8A 4KIFA 3DEUA 1ZARA 2W82A 5LHGA 3NQOA 1FC3A 3TO7A 1KZHA 2E2HJ 2ZNYA 2XRLA 3JCUC 3EETA 4IRIA 4UY8I 3WTYC 1W0TA 4HNVA 3F8FA 2FBIA 1I39A 4UVBA 3UNGC 4JK1X 2EFQA 3AG2H 1VQ4I 3M4OJ 1SD7A 2ICWG 4L9VA 1Z77A 2G7GA 3IRQA 2M1BA 3KYDB 3LJLA 4IL6C 3P9IA 2XKOA 5ICEA 3BC8A 2CQXA 4AU7A 3N97A 2L5QA 4EQQA 3I55I 5DYMA 3DU6A 3UR3C 3WODF 4D1QA 2JA7J 3TOAA 4N4NB 1PUFB 4EV0A 4M71A 1K4TA 2W1OA 3HEFA 4RLFA 2HQ5A 2WY8Q 3I9V2 4U88A 1IN7A 1I27A 3BR3A 4MGRA 1R1UA 1XCBA 1Z21A 3K69A 1FLIA 1V5FA 1LEAA 5EZHA 3KYCB 1IUYA 2O7TA 3W2AA 4A3EJ 4UUVA 4BXXJ 5CQGA 4KWAA 5EGOB 3OWTA 3JAMZ 3JW4A 3HOXJ 1EF4A 1QVUA 5DD4A 3RYPA 1ITYA 5L3BA 3BY6A 3BR0A 5JI6A 2ESHA 5F0CA 3FMQA 1V5GA 1ZG1A 3E0JB 3ZMVA 1GLNA 3H92A 4H4KC 3TP0A 2R7FA 1BR4A 4V19K 2OBPA 1BM9A 4KIBA 4JX5A 4HA8A 1ETWA 4B1RA 2UUZA 2PMUA 1WKMA 5KAFC 2LY1A 3IKTA 1TL8A 1LJ9A 3QP6A 3QBMA 2Y2ZA 3N4MA 4HKUA 2F5VA 2OPTA 2XB0X 5FLMJ 1XMKA 3LHQA 2BZTA 2Y31A 1VQNI 3JAMK 3CCYA 2O61A 2FQ4A 4G8XA 3AG4H 1DPUA 1IF1A 4BE2A 4M9ZA 5K1YA 1X2NA 2BV6A 4OMYA 4N9HA 3U1KA 4S05A 3HHGA 2WBMA 1ZELA 2HQAA 4LK1F 3F22A 4NN1A 1DP7P 1PVEA 4XR6A 1HCRA 3MZHA 2BE5F 5DCFA 5LGNA 3H36A 2EK5A 2P0WA 5F1JA 2HYTA 3CJDA 2BXYA 1MBEA 3CF5F 1KYWA 1XDSA 3IWFA 3IKVA 1WJFA 1KQ0A 3CUQB 2NP5A 1X1BA 3V7RA 4L5JA 5EFYA 5ICCA 3CCJI 5D8KB 3GTKJ 3DEWA 2XVCA 2UXXA 1HXDA 2O8KA 3K2ZA 1WCMJ 2HVRA 1FMVA 4CZCA 5GPAA 3GEUA 3H0GJ 1SAXA 3IAS2 2X6YA 3EUHC 2H8RA 1GXPA 4WWCA 2A5YB 1AKHB 1UG0A 5IYCJ 2HOSA 1H0MA 2DFHA 2EIKH 1BJAA 2GXGA 4BQOA 1QA6A 1WSUA 3FXUA 5LRSA 1VQMI 3L2WA 2M87A 3EQLF 1GDTA 4N4OB 3WG9A 3IUVA 1DGRM 2M2EA 1P4AA 5J40A 5DCMA 4A3CJ 1X2MA 4DJAA 4WF2A 1Y0UA 3K9TA 3CCVI 1W4MA 1VNDA 2HFHA 3ZGKA 2F2EA 3MEXA 3MZ8A 2R92J 1SANA 2XGXA 2I8DA 5FKMA 1LQ1A 1TZLA 4HNUA 4O6JA 5CVRA 1FNNA 1UI5A 4A3DJ 2V4JC 2DG7A 1WHUA 2XGEA 1F1ZA 2E34A 3BP8A 1GVDA 4II3A 5EDNA 1MNEA 2K86A 1QRYA 3O2PE 3FK7A 2CUZA 4I01A 3W6JB 3KZ9A 1ZLJA 1S7AA 5K7ZA 3R4KA 2O0YA 1TQMA 1JHFA 2X51A 4YFKF 2WUIA 1J9IA 2D6YA 1Z7LA 4ZTJA 4LIVA 2DOAA 4C2UA 4CUGA 3LAJA 5H9TA 4I7HA 3RIRA 2LNBA 1S29A 5EJCA 5D19A 3GLXA 4QPOA 5EEHA 2NNNA 4ZZDA 2YR2A 1QZZA 3D1NI 1PDNC 4WXHA 1XSXA 3X2QH 1ZKGA 3RCOA 1OR7C 5K5RA 4BDZA 3PQKA 2EILH 4BHCA 3G4SI 3QPSA 1RUNA 5ILSA 4KN4X 3H9QA 4ZH4F 2OCCH 1DU0A 2VI6A 4LLLA 2DFIA 2LKXA 4CH7A 3FHZA 3CDIA 2KL4A 2VQGA 1FTZA 4HF1A 2VUMJ 2ESNA 3G1LA 5J1RA 1XPXA 4HBLA 5GAEJ 1R6RA 3OYEA 1UMQA 1IZ1A 5FKOA 2JPBA 2LBFA 3I4PA 1JKQC 3SQNA 1MD0A 2LRDA 4HQMA 3PFIA 2VOPA 1OFCX 1E0EA 3ZMSA 3QYEA 2ZMEA 2V9PA 1R1VA 4YZEA 2MD5A 3C2BA 3A01B 3KETA 3VOXA 1BA5A 2K7LA 4QLCU 2XPUA 2EFNA 2CW0F 5DS9A 1IXRC 1G3TA 1S6LA 2DI3A 3OYHA 1WJAA 5E1WA 1BW6A 3LAPA 4MXMA 1IXSB 5H20A 5M3MJ 5CQEA 4RB1A 3OS0A 2X6OA 1UFMA 4F92B 5D4RA 3VVXA 3JRBA 1E17A 4BHPA 3WTWC 4WCGA 4GYIA 4LG0B 4UVAA 4ON0A 2DCEA 3TO6A 2ZSHB 2EIMH 2KLOA 2XPWA 2Y0SN 3FXJA 4G6TB 3BTJA 1BIAA 3RQIA 5LHIA 2VOOA 3NS4A 3VYSB 3HRUA 2NXNB 5HVQC 2V79A 3OIOA 3MKLA 4PCQA 4BY7J 1IN5A 2AQEA 2JZYA 3TDZC 1H89C 5B66C 3ZMDA 2K4JA 5FRMA 1T33A 1T6SA 2K27A 1AU7A 5JHUA 1UELB 5LD2C 3S1QJ 1IN6A 4UB8C 4AYBN 4UUSB 5J3LA 3GTMJ 2QKOA 3HM5A 3GWZA 4NC6A 1FBUA 1U5TA 4OIPF 1NTCA 2CH0A 2X1DA 1EH6A 3OOPA 3CMAI 2CU7A 1FOYA 2CV1A 1STZA 2FQ3A 1TP4A 3K10A 2HDCA 4XLAA 3V8LA 2DDBA 3KZZA 2ID6A 4LJZF 1I3AA 2DOFA 3BJAA 2CUFA 5IP6A 3EPZA 2HOEA 2VJIA 2DA3A 3NPIA 4XRMA 5K5QA 1FIPA 1I1GA 2WAQA 4CXFA 4IHYA 1WI3A 1OISA 4M3EA 4A3MJ 1JT0A 4DVYP 4EGYA 4XKVA 1NK3P 3VYUB 1YYVA 1WJDA 4JYKA 5FGMA 1XGSA 4AIHA 4GRIA 1QZEA 2EV6A 4D7MA 3SJMA 4EJTA 1BW5A 1KGSA 2KIUA 3QWLA 3RPUD 2ECCA 2XKPA 5KAIC 5FJ8J 1QZYA 2DO7A 3NWTA 3TKYA 3MNLA 5FD5A 4OINF 3WTVC 1G59A 4ZDLA 2HKOA 3BJBA 3M3YJ 1YW8A 3ZN0A 4C2MA 1GHCA 5J8FA 3KKCA 3L7WA 1D8JA 2MSYA 1FEXA 4A12A 4QPQA 3HC7A 1TWCJ 1MMAA 2OC6A 5D5WB 3HOYJ 3FK6A 4BJ6C 3GTGJ 5GP9A 3IH4A 1FOKA 2VASA 3E1SA 4CGZA 2QWWA 4XOTA 2R5YB 4LLNA 3I58A 2A6HF 3BT9A 1C0WA 2NVQJ 3AAFA 1LB2A 3RQ4A 3FF5A 2DU9A 4IQJA 3DU5A 4C3IJ 1CF7B 2ZJQF 4AC6A 1YHQI 3I64A 4CYCA 1LNWA 4WK8F 3OYMA 1A6IA 4XBFA 1L0OC 4XL9A 4BDYA 3GFJA 2HYFA 1ZGJA 4OOIA 5AIQA 2LKSA 2DXIA 4RS8A 5HS8A 1O3SA 1N75A 1IV8A 3GFMA 5J1YA 2DMPA 3K7AJ 3HRSA 1T56A 3R0AA 1P7IA 4I02A 1K79A 2XSJC 2V1UA 1E3OC 2OERA 4ZYGA 2TCTA 4IHTA 2EQRA 2E7WA 4WXCA 3GVAA 3PQJA 5F6FA 2VONA 3JRGA 3LA3A 4L9TA 4YG2F 3DCFA 1MH3A 3RI4A 4XLPF 2IA2A 2P6TA 3L2QA 4A3FJ 5FRNA 2QZ8A 3DP7A 3DBRB 5C4JJ 1JKRC 1V54H 1IRZA 3FBIB 2YVEA 2JRMA 1K4SA 1VTNC 2NRAC 2L02A 1HOMA 1IDYA 3P9CA 2NVUB 1VFCA 4IRGA 5GTHC 3BQZA 5FLXZ 2KQRA 3DQVC 4MQ9F 5D5XB 1OKRA 4YIRX 3EUPA 1BI3A 2QM3A 2CQ7A 4BEHA 3OSFA 4II2A 4A5MA 3REOA 4IRVA 3W6KB 2M7BA 3W2WA 2JVHA 4JBAA 2V1DA 2CSOA 2Z16A 1J7KA 2P5VA 1OYIA 5TRDA 3TP3A 3J7ZI 4ENKA 1CGPA 2LF8A 2GFNA 2IXSA 1L3LA 4KN7X 4FX0A 1MMDA 3K4LA 3RJPA 4DIQA 2HDDA 4UB6C 4GFKA 2ZMEC 4LLGF 4D7NA 1VQOI 2V9KA 3ON2A 3ON4A 5FKNA 2Q8KA 4RDUA 2BY3A 4RGSA 4Y4RA 1V5EA 5C4XJ 4EJOA 2YUSA 2DT6A 3L1PA 4ICHA 1BBYA 2DPDA 2WTEA 3KX2A 3PSFA 3LL7A 3ZOBA 5C44J 3CZ6A 4CZZA 2V26A 5ERIA 1YW7A 5CJ9A 4MNUA 1X1DA 3O8HA 4KDPA 3BROA 3F72A 5E3NA 2IS2A 2ID3A 4ZC3A 2UWMA 3R61A 3KFWX 1FMWA 5HDGA 1BI1A 4FX4A 3KIOA 4BGDA 4IXAA 2GIZA 4ZJZA 2ZCNA 2EA4A 2QYOA 1D3YA 4LOCA 4AWXB 1YS7A 3CDHA 3AL0B 1YRNB 4OD5A 1YFHA 2F07A 4JQFA 1SFEA 1S8NA 1Z6TA 3A2KA 5FB2A 2AO9A 1RC9A 3I4MJ 2E35A 1D5YA 5D6EA 1IGNA 1BR2A 1G3SA 3DLLF 3BJOA 1XS9A 2GA2A 2HVQA 1AA7A 4DBRA 5EYRA 5BOXA 1U5TC 3RKYA 4PJ0C 4RMNA 2VODA 2NS0A 4X6AJ 2NVTJ 1OCOH 3MZYA 3FWEA 2Y75A 5TISC 2BY0A 2COMA 4M3BA 5HNHA 3HIFA 3OYIA 3MD2A 4Y3OA 1FOXA 2IGNA 1T0FA 2L54A 3FISA 3WGIA 3HOUJ 1HW1A 3HPHA 2HYJA 2VT2A 2P6SA 4GCVA 2PMZA 5FD6A 5EEGA 4MFDA 1WH5A 1ENHA 2OZUA 4EATA 5CVUA 3Q3SA 2MLGA 4J19A 1WJEA 2ZFWA 2AQFA 3HRMA 4E7HA 1SMTA 1R58A 2FBKA 3OMYA 4PJNA 4ANJA 1IO2A 3KLNA 2CQQA 2X6WA 5FKKA 1MBHA 4DYCA 2LP0A 2VE9A 3KP4A 1QBJA 3HTJA 3QU3A 3TQNA 2XROA 2UV1A 3I53A 3KP2A 4Q48A 5F64A 1FWZA 1LUJB 3GXOA 2W84A 2FRHA 2ZJ2A 3LSMA 3LA7A 2ZXWH 4V2GA 4XLEA 4YFNF 2ZJRF 4HF2A 1JKOC 2XAQA 3HTIA 4LGWA 1O3TA 2QKMB 3BZ6A 3DPTA 1ZRCA 4F3QA 2FBHA 5EEAA 5E3OA 5HOOA 2DA6A 2PJPA 3BQYA 3HOSA 4EMSA 4KJZA 5LEJA 2ZY9A 3O60A 2VBWA 2DPUA 2LC2A 2Z33A 3CWRA 2DK5A 1SVLA 2VIXA 4MHGA 3KCCA 3RKQA 2UXHA 4PJMA 5F27A 1K78A 1Z05A 3QQAA 3S1MJ 2WWYA 2XRNA 1LVAA 1HKSA 1RRJA 1G3WA 3S1NJ 3GCMA 3M1CA 1R00A 1ZG3A 2UXNA 4B43A 2Q2EB 3JRAA 2R7TA 2D5VA 2L01A 4F91B 1MBGA 2O03A 2NP3A 4G7ZF 1E3PA 4BAYA 1HBXG 2GXAA 2BXZA 4RA2A 5BPIA 4CCLA 2JSCA 2YX7A 3FXRA 3K70D 2M30A 5E8IA 4BBSJ 4L62A 3J80K 2RNJA 3KEQA 4RLQA 5HAWA 4WX9A 4IOCF 3ZQFA 3BZKA 5D5VB 2XAFA 4YRVA 4AD9A 2E1CA 3VODA 3GFLA 1JT6A 4IPAA 2ZJPF 1H9GA 1BC7C 1POGA 4DGWB 4XRSG 1ZK8A 3LSTA 5EF6A 1RKWA 3H5NA 3FM3A 2W24A 2E60A 5DAJA 4NUBA 1ORKA 4F55A 1YW9A 1X58A 1SFXA 3QU6A 5HLTA 4UDSA 2W25A 3ZMUA 1HDDC 1WH7A 1Y39A 3CCUI 2MC3A 3Q0WA 2LOOA 2HOTA 1K61A 3K1MA 3LFUA 1OLTA 2JUGA 3DF8A 3S3NA 2PBXA 2JWTA 1HSJA 1ETYA 1ZGWA 3AL0C 2FNPA 3L2UA 1XDUA 2ZXIA 5CVIA 3HDDA 2KRHA 2YPRA 3IRRA 1XMXA 3S5RA 1S7OA 2DQLA 2IJLA 1ZR2A 2TRTA 1IXCA 2R3SA 2JA2A 1ZREA 2R7OA 2GIVA 3S8PA 1T38A 3VVYA 2M0MA 1TWFJ 1B72A 2BW3B 1LVKA 2L2OA 5CVJA 2NNYA 1XSDA 2M7AA 3L09A 1WPKA 5BMZA 4HG2A 5KVRA 4RB3C 5H6RA 4JKZA 1ETVA 1YS6A 5K5OA 3W3CA 1LFBA 3OY9A 3S32A 2JMWA 2VQLA 5B5EC 2HVSA 1UG2A 1YE9A 4LG3A 3ZQGA 3L2VA 5IOYA 1Y1VJ 3HKZA 2A68F 1X4OA 2LVSA 4ZDOA 2EFWA 5JFRA 2E1NA 1SAUA 4E7KA 1W5CC 2OU2A 4B48A 1XCVA 1MNDA 2H6BA 3WTUC 1VQLI 3LQQA 2EA2A 4UNOA 3CLOA 2B7EA 1J09A 1TNTA 2QQAA 2PFBA 3CCEI 4HF0A 1LDDA 2GXBA 4G6DA 2BY1A 4DZPA 2E1MC 3VW0A 4M3GA 4U87A 3VUQA 3H3VK 2DMUA 3SFZA 1LE8B 2RQPA 3JTGA 1OCRH 4LMYA 1JI8A 3HGYA 3MAJA 3NEUA 2ZSIB 2CUEA 3WTXC 2WB1A 4DW6A 2VBZA 4BQQA 3ABLH 3BWGA 3G3ZA 4F7ZA 1JXSA 2G7SA 1QGPA 3BR5A 3GEZA 2WAFA 2IAIA 3DBHB 2D1HA 3TGNA 3PSIA 2F5DA 1UHSA 3F8NA 3I4NJ 2PZ9A 3H5AA 3ASNH 3PNYA 4HX8A 4OAYA 4A0ZA 4EM2A 1VQ9I 5L3DA 3IUOA 2CS3A 1FP2A 2M0CA 2QCOA 1ZRFA 2JT1A 2XV4S 5H6QA 4RB0A 3CC4I 4KA4A 2ZOYA 1FPQA 4LB6B 2IGOA 1R4NB 3GZ5A 2OQRA 2VJ5A 3HSRA 2LD5A 3K6GA 4U0YA 4KUMA 3S2HJ 4P96A 2HKUA 1KU2A 3OR2C 5DTDA 3JRFA 3OS2A 3RPUA 4XORA 3CCSI 2QSFX 4CCKA 1I50J 1E3HA 4RB2C 4PFPA 3EYIA 3RSNA 4DYQA 1FYMA 5JVGF 3GO5A 3H5RA 4FISA 5HDNA 1KQ9A 1XSVA 1QQIA 3T5XA 2W53A 3OYKA 1RIOH 3E6BA 2FJ1A 4IQ4A 2QBYA 3RD3A 1ETOA 3T6NA 4NHJA 2LDUA 2HZTA 2AXTC 1P9QC 3B6AA 2R7DA 3LNQA 1U0JA 1UHWA 2HS5A 1YJ9I 5CXGA 4L9JA 3RDIA 2CRGA 2M8GX 1A6QA 3K4BA 3OL4A 4A2UA 3VIBA 4EVIA 3NXCA 5JLXA 1I6XA 1LFUP 2UXIA 1SMYF 2Q1ZB 2IW5A 2L7KA 3LSGA 2NX4A 2DMTA 1Z7UA 2YX4A 1HA8A 1TC3C 3ZMTA 1YIJI 4UHTA 2NVXJ 2HDWA 1Z6RA 3HTSB 4ETSA 2OTLI 1FY7A 2IBDA 2N8GA 1BC8C 2OI8A 4BQNA 2ELHA 2OJED 1R9TJ 3KZIC 5IOZA 5JVTA 3HG9A 5ICFA 1S5LC 1Y8QB 2GUHA 5BS6A 3BPVA 1MIJA 2WV0A 4IHVA 2L9RA 2RVCA 3P7NA 3G7RA 3MVPA 3WU2C 5D4SA 3NAUA 4BHBA 5M5XJ 2STTA 4MK6A 2DODA 1A04A 2H09A 3HTUA 3WHBA 9ANTA 1XN7A 2R7ZJ 1T98A 2W48A 3C7JA 4MLOA 1UJ8A 2GA1A 4NB5A 1FSEA 4FHTA 1REPC 2MFZA 5EZGA 5K7HA 3DTEA 3HYIA 2KP6A 2L7FP 4A3JJ 5DM7F 3G1MA 3ABMH 2R93J 2VL8A 3P9KA 2R5ZA 2LSOA 2ISZA 3CCMI 5J47A 2LY9A 4PZJA 3ECOA 4XQFA 4OWRB 5CLSA 3BG6A 2BBYA 4CCMA 3K4KA 3ROUA 3ZQ7A 2MC4A 4P9UA 2QVOA 2GENA 1WQ2A 2DA1A 2G0EA 3BTIA 3OV8A 2H1KA 1B6AA 4BNCA 1B59A 2R7VA 3DTKA 1ACIA 3E6DA 3BNIA 4GCKA 5BQTA 2ZC2A 2RREA 2XGDA 4NQWA 2ZNZA 3WHCA 1ZQ3P 2LF7A 3M8JA 1SGMA 3H9JA 3FZVA 4Y33A 2EPFA 5LGTA 1YJWI 2PN6A 2NS8A 3C07A 1FOWA 2DA4A 2B0LA 3NRVA 2KFDA 1HC8A 3OYLA 3CESA 3GYHX 4PFOA 1QHGA 2L4AA 2XF6A 2J5OA 1U78A 4YIFA 1I5ZA 3J7YJ 3GZIA 3G73A 2QA4I 1IG7A 4BACA 1YG2A 5BNGA 2CO5A 3TBIA 1YLFA 2VKVA 2CUJA 4HX4A 1DPRA 1Y6IA 2QSHX 5E18F 1MGTA 2RV8A 2W57A 1MZBA 3E6CC 4XKWA 1IDZA 4KFCA 4XLHA 2JN6A 4XM3A 3KEOA 4FASD 3F8BA 3C3WA 2E5NA 2LBFB 1MMNA 2AHQA 3V7CA 2VT3A 4EEFG 5K58A 5KCMA 4D9JA 2YVXA 3JSOA 1HW5A 2JA6J 2L7MP 3AG1H 2XF5A 2ZMEB 4M9SA 2IU5A 2G9WA 2FA5A 1O4XA 2P7CB 1OJLA 3F0CA 1JJ8C 3HTHA 3T1BA 3QYFA 3GTOJ 4G7OF 3HUGB 1MMGA 1UB9A 2Z3YA 3IV5A 4N9IA 4G7HF 3ZQCA 3P9TA 3ZMZA 3OYJA 1WVRA 2VN2A 3WG7H 4CA0A 3EGQA 1X3ZB 4BU2A 3OYDA 3SDBA 2M45A 2H6CA 3L2CA 1XTAA 1ZN2A 2ZFUA 1FZPB 3S1RJ 1Z0XA 2VLAA 2A6EF 3L9FA 2PFVA 3GZ6A 5ICGA 3FXOA 3KE2A 3CC7I 1VQ8I 3CDLA 3FX3A 5CYVA 5FKLA 3Q9VA 5AIPA 1P2FA 2R5YA 1S3JA 1V3FA 5TGTA 2F6CA 4L18B 2R7QA 2ELKA 4XONA 2A3SA 5F0FA 3GTQJ 1ZYRF 2NS7A 1CF7A 2ZXHA 3HSFA 1G6NA 2W4SA 4HPQA 2E71A 3EYYA 1JE8A 1OCPA 4I09A 2M5WA 3BR2A 5EG0A 3FIWA 1MSEC 3LFKA 2KPMA 2KJBA 2EZHA 1DU6A 1U5TB 5LEKA 2DMQA 1YTYA 2RAEA 3ERMA 2WC2A 3FHNA 3A0BC 2D45A 2GAUA 1X19A 3S2WA 2KHMA 1TQPA 2DJIA 4EJWA 2ZXJA 4IJAA 1XB4A 2JVGA 2XF7A 4E7SA 3OYNA 5E3LA 3H3ZA 1JJ6C 3B6CA 1XGMA 1PJRA 3CJTB 4I76A 2Q0OA 4KICA 2IPQX 3VTIA 2KIQA 2E5ZA 3IP4B 3TW6A 1U9NA 4PGGA 2G7HA 5GPCA 4IHSA 4V2FA 3V8KA 2EIJH 4PGHA 2NOJB 1IRFA 2KZVA 4EJUA 5M5WJ 3JRDA 2MABA 3KP6A 1HDPA 4BXFA 3ABKH 2PX9A 1D8KA 4OIQF 2F4IA 2FU4A 1TT0A 1ZRDA 3DPJA 5FGLA 4BJTA 1QPMA 3I3LA 5H2FC 1ZH5A 1KU3A 2DK8A 3WU0A 3G71I 4P9FA 2RDPA 2XDVA 3K4MA 1FX7A 1Q1HA 2BY2A 1FT9A 2PI0A 2EBIA 2HQRA 3ESWB 2CWEA 3FM5A 2QTQA 3LSKA 3BRUA 1D0ZA 2ZO4A 4JX6A 3KEYA 2XSDC 3HSEA 1S9HA 5ED4A 4XMYA 2MGQA 4KITB 5M5YJ 4NC7A 2R7XA 1YX3A 4OIRF 3GFIA 1AOYA 5LFAA 1QVTA 2DMNA 3K0LA 3VW2A 1DDNA 1RNLA 2Z99A 4CO8A 3VYTB 5FMPA 3HBLA 1OPCA 1NG6A 1GV2A 3JTHA 4GGGA 5AONA 2VQHA 4IX7A 1BN5A 4FE4A 4P55A 3QPTA 1J2XA 1ERDA 2FNAA 3ONQA 1DUXC 2K9SA 3V42A 2DLLA 2M8EA 4A6DA 4CYCB 2HKXA 3DPUA 4E70A 5F0HA 2EZKA 3OYCA 1IAWA 3QKXA 2KRFA 1UAAA 2ZBKA 1USSA 5B1AH 2DA7A 1OCZH 1X1AA 2D2WA 4XICA 2V1NA 4A3GJ 1YIOA 1FP1D 2DBBA 1IW7F 2GM4A 1ETXA 1JUSA 2K9MA 2KZGA 5L3GA 2HPMA 3HOVJ 5FLXK 3VVZA 2XAUA 5D6FA 5ILUA 4FTHA 5D1RA 2RQQA 3CD6I 3GTLJ 2H27A 4CCOA 4BKXA 1VQKI 1YJNI 1WFXA 4HV5A 4Y15A 3GF2A 1IUFA 3DKYA 5DUIA 5JR3A 1XMAA 3J7AY 1IJWC 1FSHA 3HOZJ 4BE0A 2UXUA 1VI0A 4ZYDA 3FXLA 4B3XA 1ZGAA 2F5CA 2R0QC 2P7VB 1Z1DA 3A02A 4DNCA 2A61A 3M07A 4WXDA 2QKLB 2LREA 4LFUA 2F4OB 1J75A 3ABUA 1T8IA 2JK3A 2L3DA 3IAM2 2COBA 4NDLA 4ACIA 3FXKA 3R6SA 4PSXA 2IP2A 5C4YA 4UV9A 3CO7C 1OQYA 3PUBA 4BEHB 1P92A 2VXZA 3AFHA 1T95A 4Y17A 1E2XA 1W1WE 2MH9A 2UZKA 2GOMA 1APLC 1ETKA 3P5JA 5D5UB 3OR1C 3FMRA 2VQCA 2I5UA 2L9VA 4C9YA 1VQ7I 1U8BA 3H9GA 3QPHA 3BG5A 2EV0A 2YSRA 3BTLA 3QYBA 3S14J 1YX5A 1RI7A 2A2FX 4A3BJ 4MTEA 1N78A 3CO6C 4AVZA 2G7UA 4EJVA 2CV0A 1RR7A 2LYCA 3ZQIA 1TNSA 3M9AA 1V55H 3NRGA 1RESA 3BTCA 1QPIA 3HHHA 3SDGA 6PAXA 1W7PA 1G3YA 2KDOA 4L9NA 2E7XA 2IS6A 4ITVA 3SEQA 1G4DA 5E8GA 4E7JA 3GZNB 4BH9A 4AUXA 1OCCH 3MQ0A 2CFOA 2DT7B 2JTVA 2VPRA 3OOUA 4CCJA 4Q4ZF 1B8IA 3S3OA 3AQSA 3I59B 4ENMA 1KU9A 1HKQA 4E7LA 1SVOA 2UXPA 3DWLE 2VXDA 3M8FA 1VZ0A 3U21A 3F1BA 3EUKL 2BHZA 3F21A 1ZHFA 3B73A 4GFLA 2M3AA 1B4AA
chains in the Genus database with same CATH topology
4A3KJ 4XK4A 2ZOZA 4DZPA 1UMQA 3VW0A 4M3GA 3VUQA 5FKOA 3H3VK 3NNRA 2DMUA 4B3AA 1JKQC 4ME9A 1ZTRA 4JP0A 3S17J 1LE8B 1OFCX 3RZOJ 5EG0B 3HGYA 2CUEA 2X48A 4DW6A 4YZEA 3C2BA 4PXIA 3LSJA 1MBKA 2G7SA 3BR5A 3A01B 3VOXA 2IAIA 1BA5A 1XC5A 4C3HJ 2LR8A 3ZQLA 2XPVA 5FHPA 1UHSA 2XPUA 3I4NJ 2WV1A 2PZ9A 2YS9A 5DS9A 1HLVA 1Q1VA 4A3LJ 2DA5A 5IYBJ 1AHDP 3LSPA 1BW6A 3CMYA 4BY1J 4MXMA 2M0CA 2QCOA 5M3MJ 2WAQN 2X6OA 2ZB9A 2ZOYA 3VVXA 4M3FA 3JRBA 3MN2A 5E3MA 4A69C 2LD5A 3JRIA 3AQTA 2XPWA 2Y0SN 3RQIA 4FCYA 3BTJA 2E2IJ 3S2HJ 5DTDA 2HKUA 3JRFA 2HI3A 3ANPA 5M3FJ 1UI6A 4QSHA 2REKA 1YRNA 3OIOA 1I50J 2DA2A 2Y9YA 3MKLA 4G12A 4BY7J 1PUFA 4DYQA 2ZCXA 5CXIA 1H89C 1T33A 1AU7A 4FISA 2K9NA 2VKEA 3QPLA 3S1QJ 4AYBN 4UUSB 5J3LA 1JGGA 3GTMJ 3HIMA 2W53A 2QKOA 5C3EJ 3V6GA 4A3IJ 3HM5A 2FJ1A 3RD3A 4IEJA 3SFIA 1ETOA 1NTCA 3T6NA 4C2MJ 1JUMA 4Y7NJ 3B6AA 3LNQA 2DN0A 2CU7A 5CXGA 2GLOA 2LFBA 5EGOA 1MBJA 3K2AA 2HXIA 2CRGA 2ID6A 2M8GX 3ZQHA 1JUPA 3VIBA 1RKTA 2CUFA 3NXCA 4GCLA 5JLXA 5IP6A 1LFUP 2UXIA 2DA3A 5IYDJ 4XRMA 3PO2J 1FIPA 2ZCMA 3NPIA 2DTZA 4DZJA 3COLA 3LSGA 3S16J 2OF7A 2NX4A 2DMTA 4IHYA 1H88C 1TC3C 1WI3A 2FBQA 2NVXJ 4M3EA 4A3MJ 1JT0A 2I10A 2RASA 1NK3P 4MFEA 2IBDA 2N8GA 4JYKA 1ZR4A 2OI8A 2QF7A 3PASA 1R9TJ 5IOZA 5D18A 5HBUA 3SJMA 4D7MA 1BW5A 2LTPA 3RH2A 4W97A 2GUHA 3PM1A 2ECCA 2LK2A 5FJ8J 4IHVA 2L9RA 3G7RA 5K7FA 3Q0UA 3RZDJ 3MVPA 5AQCA 5M5XJ 3NAUA 1S7EA 1VF9A 1W0UA 3MNLA 4MK6A 3QBMA 4Y52J 3WHBA 4ABZA 9ANTA 2R7ZJ 3G56A 2EZIA 2W48A 2HXOA 4MLOA 4DYRA 1LE8A 3M3YJ 3BJBA 4XIDA 3G1OA 3KKCA 3GTJJ 1F36A 3LSRA 2MSYA 5EZGA 4GFBA 5K7HA 1GT0C 1FEXA 2L7FP 1TWCJ 4A3JJ 2JJ7A 3KNWA 2XB5A 1BJZA 3G1MA 3FK6A 2R93J 2ME6A 3GTGJ 3HOYJ 5GP9A 3IH4A 4M3DA 2R5ZA 1BL0A 5JLWA 2LY9A 2R5YB 2E2JJ 2JA8J 3BT9A 1Y1WJ 2NVQJ 1TWHJ 3FKIJ 2MG4A 3HGGA 3JR9A 1MSFC 2G7LA 2GENA 4C3IJ 2DA1A 2G0EA 3BTIA 2H1KA 4JL3A 4AC6A 4C3JJ 4CYCA 2YU9J 3GTPJ 3BNIA 4GCKA 3VPRA 4AF5A 4M6VA 1A6IA 1MBFA 2XGDA 3WHCA 1ZQ3P 1AKHA 3LWJA 1SGMA 5IP9J 2ME0A 3BR6A 2NS8A 5J1YA 1MH4A 4QTRA 2DMPA 1B72B 1CQTA 2DA4A 2RHAA 2UXOA 3K7AJ 3C07A 1T56A 1SFOJ 1P7IA 3JRCA 2B63J 1E3OC 2OERA 3JSJA 2TCTA 2EQRA 4FE7A 3IH2A 3JRGA 2DJNA 1U78A 3LOCA 3GZIA 3DCFA 1B8IB 1MH3A 1IG7A 3HB9A 4A3FJ 3ANGA 3GBGA 5BNGA 2G3BA 1RPWA 5C4JJ 1JKRC 1IRZA 2Q24A 2YVEA 5J1UA 2VKVA 2QWTA 2JA5J 1HOMA 2X9DA 2O7OA 1IDYA 1F43A 1VFCA 3VOKA 2EH3A 3BQZA 3TEDA 3EUPA 1OCTC 1IDZA 4A93J 2WGBA 3OSFA 2JN6A 5F04A 2DG8A 1I3QJ 2Y9ZA 2AHQA 1HF0A 5K58A 4EEFG 3TP3A 1G2HA 2YVHA 4IHXA 2E19A 4NELA 2JA6J 2L7MP 5HSZA 2GFNA 3O8GA 3BG9A 2IU5A 4L5EA 3NI7A 1O4XA 2HDDA 1OJLA 3F0CA 3OSGA 1JJ8C 3HOWJ 3HTHA 4D7NA 3ON2A 3NARA 4GFKA 3GTOJ 3ON4A 5FKNA 1MNMC 1JKPC 4RDUA 3W6VA 5IP7J 2MW8A 4RBOA 3IV5A 2GBYA 5C4XJ 3VW1A 2YUSA 3ZQCA 3P9TA 2HOAA 2E1OA 3EGQA 2E2HJ 2Y30A 3HE0A 2XRLA 1P7JA 3L1PA 4ICHA 3ZOBA 5C44J 1W0TA 4HNVA 2IEKA 5HODA 2L0KA 2K9QA 3O8HA 2PMZN 5E3NA 1A5JA 3S1RJ 3M4OJ 2QOPA 2ID3A 1Z0XA 4D5CA 1Z77A 2G7GA 4QIWN 3TW7A 3S15J 3CDLA 2R5YA 3UKGA 5FKLA 3LJLA 1JTXA 2CQXA 2ZCNA 3HTAA 2ELKA 2JA7J 5F0FA 4LOCA 3GTQJ 1YRNB 2NS7A 4AC0A 2F07A 1PUFB 1TWAJ 3PPBA 3E7QA 2KT0A 3HEFA 2HQ5A 2AO9A 3I4MJ 1OCPA 5CW8A 1D5YA 3BR2A 3BR3A 5EG0A 3FIWA 1MSEC 1IGNA 2EZHA 1DU6A 2DMQA 2RAEA 1XS9A 3A01A 5EZHA 3VP5A 5EYRA 2O7TA 3CQZJ 4A3EJ 3V78A 4BBRJ 4BXXJ 4GFLA 4KWAA 4X6AJ 5EGOB 2NVTJ 1EF4A 3HOXJ 4B4CA 1QVUA 4M3BA 5E3LA 1ITYA 1JJ6C 3B6CA 3BR0A 4I76A 5F0CA 3FISA 1H8AC 3HOUJ 4MO7A 2HYJA 3A03A 4HKUA 3TW6A 1U9NA 4MFDA 3TP0A 1WH5A 3PO3J 1ENHA 5GPCA 4V2FA 3Q3SA 4JX5A 1ETWA 4J19A 5M5WJ 3JRDA 4B1RA 1HDPA 1TWGJ 3B81A 2LLKA 2CQQA 5FKKA 1MBHA 4DYCA 2LP0A 2Y2ZA 3HTJA 5J1RA 3DPJA 2OPTA 2XB0X 3BR1A 5FLMJ 5FGLA 3LHQA 1GUUA 2L7ZA 2Y31A 3CCYA 2FQ4A 1GV5A 2CJJA 1X2NA 4CGRA 4UUTA 4V2GA 2M9HA 2EZLA 2FD5A 1JTYA 1JKOC 2EBIA 3BRUA 2QTQA 3HTIA 4NN1A 4JX6A 1IC8A 4UUSA 2XSDC 3BG3A 1HCRA 1ETQA 4JNNA 2MGQA 5FLVA 5EEAA 1FTTA 5E3OA 5M5YJ 2DA6A 4MIMA 3BQYA 5F1JA 4W1UA 2HYTA 3O60A 3CJDA 1MBEA 1QVTA 2DMNA 2R5ZB 3CWRA 3VW2A 3RKQA 4IHWA 2UXHA 5F27A 2NP5A 5FMPA 3HBLA 1FIAA 2XGCA 1GV2A 3QQAA 5EFYA 1IV6A 3GTKJ 3S1MJ 3DEWA 4I6ZA 4FE4A 2NOGA 3E7LA 2XDNA 2O8KA 3S1NJ 1WCMJ 2K9SA 3GEUA 5GPAA 4CYCB 3H0GJ 3JRAA 5F0HA 2D5VA 2EZKA 1MBGA 2NP3A 2H8RA 3Q0VA 1AKHB 5IYCJ 2HOSA 3QKXA 2K40A 4BBSJ 4L62A 5HAWA 2DA7A 4XICA 3ZQFA 4A3GJ 1XG1A 2GM4A 1ETXA 1JUSA 3HOVJ 3VVZA 1GDTA 1JT6A 3IUVA 1RETA 4FTHA 5D1RA 1POGA 1U9OA 3GTLJ 4XRSA 2M2EA 4XRSG 4BKXA 1ZK8A 2KDZA 4A3CJ 4X1EA 5EF6A 1X2MA 1RKWA 1IUFA 1VNDA 5DAJA 1ORKA 1IJWC 2R92J 1X58A 3HOZJ 2UXUA 1SANA 1VI0A 1FJLA 2M34A 4UDSA 5FKMA 2R0QC 1HDDC 1UI5A 4A3DJ 3A02A 3HKZN 2DG7A 1WH7A 3Q0WA 4S0HB 2HOTA 1K61A 1K83J 2XGEA 2ECBA 1GVDA 2JK3A 4NDLA 5EDNA 2COBA 3S2DJ 4ACIA 1QRYA 5C4YA 2PBXA 3FK7A 2JWTA 1ETYA 1ZGWA 3IH3A 3KZ9A 1APLC 5K7ZA 3HDDA 1ETKA 3BHQA 2WUIA 4GCTA 2V57A 3S5RA 2D6YA 1ZR2A 2TRTA 1U8BA 3KKDA 2NVYJ 3S14J 3BG5A 3CRJA 3BTLA 5H9TA 2O9LA 4A3BJ 3VVYA 1B72A 1TWFJ 5D19A 2WB1N 1RR7A 3ZQIA 1WPKA 4JKZA 3JRHA 1RESA 1ETVA 3BTCA 4JX4A 3D1NI 1NK2P 1QPIA 3NRGA 3SDGA 3FRQA 1LFBA 2FX0A 3JREA 2JMWA 1ZKGA 2QIBA 1UG2A 3ZQGA 4AUXA 5IOYA 3QPSA 1Y1VJ 2P81A 2VPRA 3OOUA 1B8IA 3AQSA 2LVSA 5F08A 1DU0A 1I6HJ 2VI6A 2LKXA 3BCGA 2UXPA 3F1BA 5IPAA 1WGXA 1FTZA 2VUMJ 3G1LA 4D5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K J;  4XK4 A;  2ZOZ A;  4DZP A;  1UMQ A;  3VW0 A;  4M3G A;  3VUQ A;  5FKO A;  3H3V K;  3NNR A;  2DMU A;  4B3A A;  1JKQ C;  4ME9 A;  1ZTR A;  4JP0 A;  3S17 J;  1LE8 B;  1OFC X;  3RZO J;  5EG0 B;  3HGY A;  2CUE A;  2X48 A;  4DW6 A;  4YZE A;  3C2B A;  4PXI A;  3LSJ A;  1MBK A;  2G7S A;  3BR5 A;  3A01 B;  3VOX A;  2IAI A;  1BA5 A;  1XC5 A;  4C3H J;  2LR8 A;  3ZQL A;  2XPV A;  5FHP A;  1UHS A;  2XPU A;  3I4N J;  2WV1 A;  2PZ9 A;  2YS9 A;  5DS9 A;  1HLV A;  1Q1V A;  4A3L J;  2DA5 A;  5IYB J;  1AHD P;  3LSP A;  1BW6 A;  3CMY A;  4BY1 J;  4MXM A;  2M0C A;  2QCO A;  5M3M J;  2WAQ N;  2X6O A;  2ZB9 A;  2ZOY A;  3VVX A;  4M3F A;  3JRB A;  3MN2 A;  5E3M A;  4A69 C;  2LD5 A;  3JRI A;  3AQT A;  2XPW A;  2Y0S N;  3RQI A;  4FCY A;  3BTJ A;  2E2I J;  3S2H J;  5DTD A;  2HKU A;  3JRF A;  2HI3 A;  3ANP A;  5M3F J;  1UI6 A;  4QSH A;  2REK A;  1YRN A;  3OIO A;  1I50 J;  2DA2 A;  2Y9Y A;  3MKL A;  4G12 A;  4BY7 J;  1PUF A;  4DYQ A;  2ZCX A;  5CXI A;  1H89 C;  1T33 A;  1AU7 A;  4FIS A;  2K9N A;  2VKE A;  3QPL A;  3S1Q J;  4AYB N;  4UUS B;  5J3L A;  1JGG A;  3GTM J;  3HIM A;  2W53 A;  2QKO A;  5C3E J;  3V6G A;  4A3I J;  3HM5 A;  2FJ1 A;  3RD3 A;  4IEJ A;  3SFI A;  1ETO A;  1NTC A;  3T6N A;  4C2M J;  1JUM A;  4Y7N J;  3B6A A;  3LNQ A;  2DN0 A;  2CU7 A;  5CXG A;  2GLO A;  2LFB A;  5EGO A;  1MBJ A;  3K2A A;  2HXI A;  2CRG A;  2ID6 A;  2M8G X;  3ZQH A;  1JUP A;  3VIB A;  1RKT A;  2CUF A;  3NXC A;  4GCL A;  5JLX A;  5IP6 A;  1LFU P;  2UXI A;  2DA3 A;  5IYD J;  4XRM A;  3PO2 J;  1FIP A;  2ZCM A;  3NPI A;  2DTZ A;  4DZJ A;  3COL A;  3LSG A;  3S16 J;  2OF7 A;  2NX4 A;  2DMT A;  4IHY A;  1H88 C;  1TC3 C;  1WI3 A;  2FBQ A;  2NVX J;  4M3E A;  4A3M J;  1JT0 A;  2I10 A;  2RAS A;  1NK3 P;  4MFE A;  2IBD A;  2N8G A;  4JYK A;  1ZR4 A;  2OI8 A;  2QF7 A;  3PAS A;  1R9T J;  5IOZ A;  5D18 A;  5HBU A;  3SJM A;  4D7M A;  1BW5 A;  2LTP A;  3RH2 A;  4W97 A;  2GUH A;  3PM1 A;  2ECC A;  2LK2 A;  5FJ8 J;  4IHV A;  2L9R A;  3G7R A;  5K7F A;  3Q0U A;  3RZD J;  3MVP A;  5AQC A;  5M5X J;  3NAU A;  1S7E A;  1VF9 A;  1W0U A;  3MNL A;  4MK6 A;  3QBM A;  4Y52 J;  3WHB A;  4ABZ A;  9ANT A;  2R7Z J;  3G56 A;  2EZI A;  2W48 A;  2HXO A;  4MLO A;  4DYR A;  1LE8 A;  3M3Y J;  3BJB A;  4XID A;  3G1O A;  3KKC A;  3GTJ J;  1F36 A;  3LSR A;  2MSY A;  5EZG A;  4GFB A;  5K7H A;  1GT0 C;  1FEX A;  2L7F P;  1TWC J;  4A3J J;  2JJ7 A;  3KNW A;  2XB5 A;  1BJZ A;  3G1M A;  3FK6 A;  2R93 J;  2ME6 A;  3GTG J;  3HOY J;  5GP9 A;  3IH4 A;  4M3D A;  2R5Z A;  1BL0 A;  5JLW A;  2LY9 A;  2R5Y B;  2E2J J;  2JA8 J;  3BT9 A;  1Y1W J;  2NVQ J;  1TWH J;  3FKI J;  2MG4 A;  3HGG A;  3JR9 A;  1MSF C;  2G7L A;  2GEN A;  4C3I J;  2DA1 A;  2G0E A;  3BTI A;  2H1K A;  4JL3 A;  4AC6 A;  4C3J J;  4CYC A;  2YU9 J;  3GTP J;  3BNI A;  4GCK A;  3VPR A;  4AF5 A;  4M6V A;  1A6I A;  1MBF A;  2XGD A;  3WHC A;  1ZQ3 P;  1AKH A;  3LWJ A;  1SGM A;  5IP9 J;  2ME0 A;  3BR6 A;  2NS8 A;  5J1Y A;  1MH4 A;  4QTR A;  2DMP A;  1B72 B;  1CQT A;  2DA4 A;  2RHA A;  2UXO A;  3K7A J;  3C07 A;  1T56 A;  1SFO J;  1P7I A;  3JRC A;  2B63 J;  1E3O C;  2OER A;  3JSJ A;  2TCT A;  2EQR A;  4FE7 A;  3IH2 A;  3JRG A;  2DJN A;  1U78 A;  3LOC A;  3GZI A;  3DCF A;  1B8I B;  1MH3 A;  1IG7 A;  3HB9 A;  4A3F J;  3ANG A;  3GBG A;  5BNG A;  2G3B A;  1RPW A;  5C4J J;  1JKR C;  1IRZ A;  2Q24 A;  2YVE A;  5J1U A;  2VKV A;  2QWT A;  2JA5 J;  1HOM A;  2X9D A;  2O7O A;  1IDY A;  1F43 A;  1VFC A;  3VOK A;  2EH3 A;  3BQZ A;  3TED A;  3EUP A;  1OCT C;  1IDZ A;  4A93 J;  2WGB A;  3OSF A;  2JN6 A;  5F04 A;  2DG8 A;  1I3Q J;  2Y9Z A;  2AHQ A;  1HF0 A;  5K58 A;  4EEF G;  3TP3 A;  1G2H A;  2YVH A;  4IHX A;  2E19 A;  4NEL A;  2JA6 J;  2L7M P;  5HSZ A;  2GFN A;  3O8G A;  3BG9 A;  2IU5 A;  4L5E A;  3NI7 A;  1O4X A;  2HDD A;  1OJL A;  3F0C A;  3OSG A;  1JJ8 C;  3HOW J;  3HTH A;  4D7N A;  3ON2 A;  3NAR A;  4GFK A;  3GTO J;  3ON4 A;  5FKN A;  1MNM C;  1JKP C;  4RDU A;  3W6V A;  5IP7 J;  2MW8 A;  4RBO A;  3IV5 A;  2GBY A;  5C4X J;  3VW1 A;  2YUS A;  3ZQC A;  3P9T A;  2HOA A;  2E1O A;  3EGQ A;  2E2H J;  2Y30 A;  3HE0 A;  2XRL A;  1P7J A;  3L1P A;  4ICH A;  3ZOB A;  5C44 J;  1W0T A;  4HNV A;  2IEK A;  5HOD A;  2L0K A;  2K9Q A;  3O8H A;  2PMZ N;  5E3N A;  1A5J A;  3S1R J;  3M4O J;  2QOP A;  2ID3 A;  1Z0X A;  4D5C A;  1Z77 A;  2G7G A;  4QIW N;  3TW7 A;  3S15 J;  3CDL A;  2R5Y A;  3UKG A;  5FKL A;  3LJL A;  1JTX A;  2CQX A;  2ZCN A;  3HTA A;  2ELK A;  2JA7 J;  5F0F A;  4LOC A;  3GTQ J;  1YRN B;  2NS7 A;  4AC0 A;  2F07 A;  1PUF B;  1TWA J;  3PPB A;  3E7Q A;  2KT0 A;  3HEF A;  2HQ5 A;  2AO9 A;  3I4M J;  1OCP A;  5CW8 A;  1D5Y A;  3BR2 A;  3BR3 A;  5EG0 A;  3FIW A;  1MSE C;  1IGN A;  2EZH A;  1DU6 A;  2DMQ A;  2RAE A;  1XS9 A;  3A01 A;  5EZH A;  3VP5 A;  5EYR A;  2O7T A;  3CQZ J;  4A3E J;  3V78 A;  4BBR J;  4BXX J;  4GFL A;  4KWA A;  4X6A J;  5EGO B;  2NVT J;  1EF4 A;  3HOX J;  4B4C A;  1QVU A;  4M3B A;  5E3L A;  1ITY A;  1JJ6 C;  3B6C A;  3BR0 A;  4I76 A;  5F0C A;  3FIS A;  1H8A C;  3HOU J;  4MO7 A;  2HYJ A;  3A03 A;  4HKU A;  3TW6 A;  1U9N A;  4MFD A;  3TP0 A;  1WH5 A;  3PO3 J;  1ENH A;  5GPC A;  4V2F A;  3Q3S A;  4JX5 A;  1ETW A;  4J19 A;  5M5W J;  3JRD A;  4B1R A;  1HDP A;  1TWG J;  3B81 A;  2LLK A;  2CQQ A;  5FKK A;  1MBH A;  4DYC A;  2LP0 A;  2Y2Z A;  3HTJ A;  5J1R A;  3DPJ A;  2OPT A;  2XB0 X;  3BR1 A;  5FLM J;  5FGL A;  3LHQ A;  1GUU A;  2L7Z A;  2Y31 A;  3CCY A;  2FQ4 A;  1GV5 A;  2CJJ A;  1X2N A;  4CGR A;  4UUT A;  4V2G A;  2M9H A;  2EZL A;  2FD5 A;  1JTY A;  1JKO C;  2EBI A;  3BRU A;  2QTQ A;  3HTI A;  4NN1 A;  4JX6 A;  1IC8 A;  4UUS A;  2XSD C;  3BG3 A;  1HCR A;  1ETQ A;  4JNN A;  2MGQ A;  5FLV A;  5EEA A;  1FTT A;  5E3O A;  5M5Y J;  2DA6 A;  4MIM A;  3BQY A;  5F1J A;  4W1U A;  2HYT A;  3O60 A;  3CJD A;  1MBE A;  1QVT A;  2DMN A;  2R5Z B;  3CWR A;  3VW2 A;  3RKQ A;  4IHW A;  2UXH A;  5F27 A;  2NP5 A;  5FMP A;  3HBL A;  1FIA A;  2XGC A;  1GV2 A;  3QQA A;  5EFY A;  1IV6 A;  3GTK J;  3S1M J;  3DEW A;  4I6Z A;  4FE4 A;  2NOG A;  3E7L A;  2XDN A;  2O8K A;  3S1N J;  1WCM J;  2K9S A;  3GEU A;  5GPA A;  4CYC B;  3H0G J;  3JRA A;  5F0H A;  2D5V A;  2EZK A;  1MBG A;  2NP3 A;  2H8R A;  3Q0V A;  1AKH B;  5IYC J;  2HOS A;  3QKX A;  2K40 A;  4BBS J;  4L62 A;  5HAW A;  2DA7 A;  4XIC A;  3ZQF A;  4A3G J;  1XG1 A;  2GM4 A;  1ETX A;  1JUS A;  3HOV J;  3VVZ A;  1GDT A;  1JT6 A;  3IUV A;  1RET A;  4FTH A;  5D1R A;  1POG A;  1U9O A;  3GTL J;  4XRS A;  2M2E A;  4XRS G;  4BKX A;  1ZK8 A;  2KDZ A;  4A3C J;  4X1E A;  5EF6 A;  1X2M A;  1RKW A;  1IUF A;  1VND A;  5DAJ A;  1ORK A;  1IJW C;  2R92 J;  1X58 A;  3HOZ J;  2UXU A;  1SAN A;  1VI0 A;  1FJL A;  2M34 A;  4UDS A;  5FKM A;  2R0Q C;  1HDD C;  1UI5 A;  4A3D J;  3A02 A;  3HKZ N;  2DG7 A;  1WH7 A;  3Q0W A;  4S0H B;  2HOT A;  1K61 A;  1K83 J;  2XGE A;  2ECB A;  1GVD A;  2JK3 A;  4NDL A;  5EDN A;  2COB A;  3S2D J;  4ACI A;  1QRY A;  5C4Y A;  2PBX A;  3FK7 A;  2JWT A;  1ETY A;  1ZGW A;  3IH3 A;  3KZ9 A;  1APL C;  5K7Z A;  3HDD A;  1ETK A;  3BHQ A;  2WUI A;  4GCT A;  2V57 A;  3S5R A;  2D6Y A;  1ZR2 A;  2TRT A;  1U8B A;  3KKD A;  2NVY J;  3S14 J;  3BG5 A;  3CRJ A;  3BTL A;  5H9T A;  2O9L A;  4A3B J;  3VVY A;  1B72 A;  1TWF J;  5D19 A;  2WB1 N;  1RR7 A;  3ZQI A;  1WPK A;  4JKZ A;  3JRH A;  1RES A;  1ETV A;  3BTC A;  4JX4 A;  3D1N I;  1NK2 P;  1QPI A;  3NRG A;  3SDG A;  3FRQ A;  1LFB A;  2FX0 A;  3JRE A;  2JMW A;  1ZKG A;  2QIB A;  1UG2 A;  3ZQG A;  4AUX A;  5IOY A;  3QPS A;  1Y1V J;  2P81 A;  2VPR A;  3OOU A;  1B8I A;  3AQS A;  2LVS A;  5F08 A;  1DU0 A;  1I6H J;  2VI6 A;  2LKX A;  3BCG A;  2UXP A;  3F1B A;  5IPA A;  1WGX A;  1FTZ A;  2VUM J;  3G1L A;  4D5F A; 
#chains in the Genus database with same CATH topology
 5E17 F;  3SWH A;  1LDJ A;  4HYE A;  1MMS A;  4ZYH A;  3EUH A;  1A31 A;  1XD7 A;  2LKP A;  2Q2E A;  1ZTR A;  3CP2 A;  4JP0 A;  1BI2 A;  3S17 J;  1EJ9 A;  1VQ5 I;  1R4M B;  3RZO J;  2X48 A;  3MKY B;  4PXI A;  5TJJ A;  1TBX A;  4EM1 A;  1XC5 A;  2WY7 Q;  3PNT A;  2LR8 A;  3MCZ A;  2XPV A;  4HAM A;  3ZQL A;  5FHP A;  3V8J A;  4Z6Y A;  2YS9 A;  3VDX A;  1Q1V A;  1O7F A;  1HLV A;  2X6X A;  2BEO A;  5IYB J;  3O6B B;  2J5P A;  4LIU A;  3LSP A;  3MFK A;  2PJR B;  1MDM B;  2BOL A;  1OYW A;  3VFZ A;  3CMY A;  2FXA A;  1ZLK A;  4BY1 J;  2VC0 A;  2K9L A;  3OIQ A;  1DQU A;  4U0V A;  2XC7 A;  2WAQ N;  4CCN A;  2ZB9 A;  2NYX A;  3DKW A;  4M3F A;  4PUS A;  4KNY A;  1TT5 B;  1IRG A;  3KPH A;  5A2Q Z;  1R23 A;  4IVN A;  3WE2 A;  3MN2 A;  4I98 B;  4A69 C;  4XLF A;  3JRI A;  4OAZ A;  4OIO F;  3AQT A;  4FCY A;  3G6E I;  4ZTF A;  2A05 A;  2E2I J;  4U9L A;  2PG4 A;  2MLK A;  2HI3 A;  3WTT C;  3WGG A;  5M3F J;  3L00 A;  3K70 C;  4PSW A;  4ESB A;  3VWB A;  3ZPL A;  1UI6 A;  1HST A;  3BPX A;  4BQA A;  1P6R A;  3HZJ A;  4B09 A;  2DA2 A;  1WJB A;  2GQQ A;  3K4N A;  4RAG A;  4G12 A;  1PUF A;  2ZCX A;  3OYF A;  2AXL A;  2CYY A;  4ZZL A;  5CXI A;  1D1C A;  2X0L A;  3BZC A;  4HZF A;  2NAZ A;  2K9N A;  5GAH J;  4B8X A;  4ENJ A;  1JGG A;  3HIM A;  4L5I A;  5C3E J;  3V6G A;  4A3I J;  2DQR A;  4IEJ A;  3SFI A;  5A2Q K;  1JUM A;  4Y7N J;  2DN0 A;  1BOB A;  2VJJ A;  1FBQ A;  2GLO A;  2LFB A;  3C18 A;  5EGO A;  3K2A A;  4S04 A;  2K85 A;  4KT5 C;  4LD5 A;  3OYA A;  3ZQH A;  1U3E M;  2ZCW A;  1JUP A;  3H0D A;  1OR7 A;  1KA8 A;  1K78 B;  1D0X A;  1BI0 A;  5IYD J;  4M73 A;  2DTZ A;  4DZJ A;  2OF7 A;  3CP8 A;  4HW0 A;  3HJE A;  2LMD A;  3CME I;  2QSG X;  1WZ2 A;  2Z2S B;  2FBQ A;  3J7A O;  2OTJ I;  2I10 A;  2RAS A;  2P5K A;  1PYV A;  4M74 A;  2Y0S A;  4MFE A;  3V7S A;  4XKB A;  3VYR B;  3PAS A;  1F5T A;  1IRX A;  3U2R A;  4RGU A;  3T0Y A;  1Y8R B;  2O6G E;  5KK1 A;  2K3P A;  4RM2 A;  5LBQ A;  2XAG A;  2E1M B;  4CYD A;  3CCQ I;  2LK2 A;  1QHH D;  1XGO A;  5K7F A;  3Q0U A;  3LQR A;  3RZD J;  5AQC A;  3FDY A;  4AYB A;  3CTA A;  1B9M A;  1S7E A;  1VF9 A;  5JHF A;  2XAJ A;  1TW2 A;  2FUG 2;  4MEX F;  1ZAO A;  2V6C A;  4ABZ A;  3G56 A;  3ML6 A;  4IO9 F;  1LE8 A;  2QLZ A;  3G1O A;  4A0Y A;  2EB7 A;  5DEQ A;  5BPD A;  3LSR A;  1YQA A;  4UVC A;  4AIJ A;  3KNW A;  1MW7 A;  1BJZ A;  3OYB A;  2ME6 A;  2Z5U A;  1QNT A;  2L9N A;  4M3D A;  2F48 A;  2RC4 A;  3CUQ A;  3FXQ A;  5JLW A;  3K8P C;  2K3F A;  5DDG A;  1Y1W J;  2BGC A;  2KJC A;  1UST A;  3ELK A;  4CIC A;  1T39 A;  4YEL A;  5L3F A;  2G7L A;  3FBN B;  3CJR B;  3S93 A;  1KQ8 A;  1KU7 A;  2YU9 J;  5LLQ A;  3GTP J;  3SZT A;  3VPR A;  4AF5 A;  4M6V A;  1JHH A;  4OMZ A;  1B9N A;  3PL8 A;  3K4J A;  2KIM A;  1AKH A;  3LWJ A;  5IP9 J;  2ME0 A;  2IGK A;  3BR6 A;  2M4K A;  1Z3Y A;  5DD8 A;  3TDU C;  5B3S H;  1D5V A;  1SD4 A;  1WI9 A;  4XSZ F;  1B72 B;  4A0X A;  2MD0 A;  2RHA A;  2HPI A;  1SFO J;  2Y69 H;  4M6Y A;  1R22 A;  1LKX A;  4P1W A;  4BUP A;  2DAO A;  1W7P D;  4BL0 B;  4GO1 A;  4J00 A;  2GWR A;  3KP3 A;  4K2E A;  1T0F C;  2V7F A;  1K6Y A;  3GLL A;  4NBQ A;  3PUF A;  3G2B A;  1YI2 I;  2MYS A;  5J8C A;  3RKW A;  3I56 I;  3BCA A;  3QP5 A;  3HB9 A;  3GBG A;  1R36 A;  1MJB A;  1JGS A;  3ZN1 A;  2QWT A;  2DFF A;  3RYR A;  2JA5 J;  2H8W A;  3VOK A;  2EH3 A;  3TED A;  3T8R A;  2R7U A;  4A93 J;  2WGB A;  3WTS C;  1WJ5 A;  3VB2 A;  1MKM A;  2W00 A;  1I3Q J;  3ZQQ A;  1OYY A;  3PFY A;  2Y9Z A;  1EH8 A;  4R79 A;  1F4K A;  3FKJ A;  1G2H A;  2YVH A;  4IHX A;  1MJA A;  2E19 A;  4NEL A;  3K4C A;  4GYG A;  3F8C A;  4ASN A;  2M4G A;  3NI7 A;  2VBX A;  4DBQ A;  3QOD A;  3NAR A;  1MNM C;  1QO0 D;  3DXJ F;  1JKP C;  3W6V A;  4RGR A;  1RUO A;  5IP7 J;  4RBO A;  4IOA F;  2RNG A;  3WE3 A;  2GBY A;  2AS5 F;  3VW1 A;  2KMU A;  5E79 C;  2HOA A;  1D1A A;  2E1O A;  2HQN A;  4H0E A;  2Y30 A;  3HE0 A;  1K7A A;  2WAD A;  1P7J A;  3KZY A;  2ADU A;  2FML A;  2IEK A;  2V6E A;  5HOD A;  2L0K A;  3F8M A;  4YFX F;  1R1T A;  2JUC A;  2K9Q A;  2KIS A;  2PMZ N;  3Q5F A;  1A5J A;  2KKO A;  4PJL A;  3WGH A;  2P5L C;  2QOP A;  4D5C A;  4Q47 A;  2QUF A;  4E6K G;  3BOQ A;  3CF2 A;  2XAS A;  4XRF A;  2DYR H;  3TW7 A;  4QIW N;  3S15 J;  3UKG A;  1EKE A;  2XAH A;  1JTX A;  1SC7 A;  2EV5 A;  2EWN A;  1W36 D;  2E36 A;  3JSP A;  5HLG A;  3HTA A;  1TQI A;  2BVM A;  3B02 A;  4XLC A;  3K1N A;  4TV7 A;  4MQV A;  4O3M A;  2FMY A;  4AC0 A;  2IT0 A;  4G94 A;  1W36 C;  1K6O A;  1TWA J;  3QOP A;  3D5L A;  4IRH A;  3E7Q A;  3PPB A;  4B44 A;  2KT0 A;  5IT3 A;  5CW8 A;  2YU3 A;  1P4W A;  5DCM B;  4RM3 A;  2HEO A;  2A07 F;  4RAZ A;  2QBY B;  5CVV A;  1ONV A;  1PUE E;  3A01 A;  4AM3 A;  3VP5 A;  1V4R A;  3CQZ J;  3V78 A;  4BBR J;  2O5R A;  3VSL A;  4EM0 B;  2QQB A;  4B4C A;  2EIN H;  2FSW A;  4FQG A;  3HRT A;  3QRF F;  1H8A C;  3CJN A;  4MO7 A;  4MTD A;  3BJ6 A;  3A03 A;  1G8X A;  2V1X A;  1NHA A;  3VOE A;  3E5Q A;  4U7B A;  2B1E A;  3PO3 J;  3VEP A;  3ZCO A;  2C6Y A;  1X3W B;  3PIP F;  3CCR I;  1BOA A;  2O3F A;  2VBY A;  3C2H A;  1TWG J;  2XUB A;  4HRI A;  4LG0 A;  3B81 A;  2LLK A;  4EGZ A;  3WU1 B;  1VQ6 I;  1UCR A;  3D0S A;  4DQ2 A;  5J4V A;  3BR1 A;  3MMY B;  1WJC A;  1R49 A;  1Z9C A;  1D1B A;  1GUU A;  1S72 I;  3OIP A;  2L7Z A;  1SVM A;  1GV5 A;  1X1C A;  2CJJ A;  2B3W A;  5B1B H;  4UXN A;  1ON2 A;  2LG4 A;  3V4G A;  4CGR A;  4UUT A;  2VB6 A;  2M9H A;  4CDG A;  1T2K A;  2EZL A;  3O3K A;  2FD5 A;  1JTY A;  3DLA A;  1MJ9 A;  2LH9 A;  2RKH A;  4OU0 A;  2FOK A;  2K02 A;  1IC8 A;  4UUS A;  3F9K A;  3BG3 A;  3M7G A;  1SFK A;  3C1D A;  3IWZ A;  1WRJ A;  1ETQ A;  3A4C A;  4JNN A;  5HS9 A;  5FLV A;  3IL2 A;  1R71 A;  4B47 A;  1FTT A;  1BR1 A;  4IF4 A;  4MIM A;  3DFG A;  4W1U A;  4Y13 A;  2JRT A;  3R0J A;  3FMS A;  2R5Z B;  3HUG A;  2CV2 A;  4IHW A;  4KT6 A;  2DFE A;  1FYK A;  4AIK A;  1FIA A;  2XGC A;  1IV6 A;  2DOE A;  3CUQ C;  4NC8 A;  4I6Z A;  1YOV B;  2CQK A;  2NOG A;  3E7L A;  1VQP I;  2XDN A;  3LWF A;  3E97 A;  1FBS A;  4R8H A;  1DP3 A;  1LFP A;  1NG7 A;  2Z1D A;  3TL4 X;  2R7S A;  3I5U A;  4HEA 2;  2HNH A;  1N77 A;  4E7I A;  4PDK A;  1RR8 C;  1XX5 A;  1Z3X A;  3Q0V A;  4NQW B;  5E1Z B;  5J6X A;  2HGC A;  2K40 A;  1H9T A;  4D0P A;  4IZZ A;  4HOB A;  1O3Q A;  3HXL A;  2VJ4 A;  4C30 A;  4GDF A;  4NNJ A;  2CMP A;  4Z2Y A;  2JSP A;  4I0A A;  4I99 C;  4AVP A;  1XG1 A;  2O8X A;  2IS4 A;  3A0H C;  5HDK A;  2MH2 A;  1RET A;  3SYT A;  3J81 Z;  2F4M B;  4XNF A;  1U9O A;  4XRS A;  4L0Y B;  1X4P A;  1X3U A;  4CSW A;  3E3V A;  2KDZ A;  4X1E A;  5KHD A;  5LRR A;  2PEX A;  3ZXS A;  2KRC A;  2OV7 A;  1FJL A;  2M34 A;  1BIB A;  4M72 A;  1O57 A;  4HST A;  1ZG5 A;  5L3E A;  4G9Y A;  4BJ5 C;  3HKZ N;  3TO9 A;  1F9N A;  3U9G A;  2QEX I;  2ZKZ A;  4S0H B;  1K83 J;  2ECB A;  2F5F A;  1EV7 A;  5CKT A;  3S2D J;  1I1S A;  2OCE A;  3E5X A;  5LHH A;  4U9N A;  1YO5 C;  3OL3 A;  3J81 K;  5E20 A;  3MKW B;  1SEU A;  5GAD J;  2MBF A;  3DKX A;  3IH3 A;  2DT5 A;  3ZR8 X;  3PJR A;  4R1H A;  3BHQ A;  1U2W A;  1Y0N A;  4GCT A;  5DV5 A;  2V57 A;  2PQ8 A;  4HNT A;  4RGX A;  1SFU A;  3MKZ A;  2BVL A;  4HDU A;  3KKD A;  2NVY J;  3CRJ A;  1N25 A;  5L3C A;  2O9L A;  1T08 B;  1DGW Y;  4F93 B;  2DW4 A;  4QWQ A;  2WB1 N;  2CFX A;  4I0B A;  4ZYE A;  1R5G A;  3JRH A;  3ZP5 A;  4JX4 A;  1PP7 U;  1NK2 P;  5HLI A;  1NH3 A;  3ERE D;  3FRQ A;  5IT9 Z;  2FX0 A;  3H1C A;  3JRE A;  2X4H A;  2QIB A;  2VPL A;  2Z9O A;  2H94 A;  3M1E A;  1ODD A;  2ELJ A;  2STW A;  2QGU A;  2P81 A;  2VKD A;  2A5W A;  2WA0 A;  2TDX A;  5F08 A;  1I6H J;  1P4X A;  3KP7 A;  1ON1 A;  2JPC A;  3BCG A;  5DUK A;  1ULY A;  3NWS A;  2PLY A;  4LK0 F;  3COA C;  3TMO A;  4HSR A;  5IPA A;  1WGX A;  1PP8 F;  5LGU A;  1B1B A;  3KYL A;  2CQN A;  4D5F A;  4A3K J;  4XK4 A;  4KMU X;  4ESF A;  2ZOZ A;  5IT9 K;  2XIG A;  4I2O A;  4O5V A;  2FJI 1;  3NNR A;  4B3A A;  3MWM A;  2OQG A;  2DTR A;  4ME9 A;  2JQ7 A;  3RTR A;  4BYY A;  1R5I D;  5EG0 B;  3DPL C;  1KYZ A;  4FET A;  2IS1 A;  1GXQ A;  3BDD A;  3GX4 X;  5E1X A;  3LSJ A;  1MBK A;  3CMM A;  3SXY A;  3ULQ B;  3ABT A;  2CW8 A;  2L9S A;  3WTZ A;  2OA4 A;  4C3H J;  4XKC A;  3SEZ A;  3LA2 A;  5KNL A;  2KIF A;  3A1Y A;  2WV1 A;  2X85 A;  3HPG A;  4MEY F;  2DDA A;  3SZP A;  2Y48 A;  3AG3 H;  2R7R A;  2A69 F;  2DA5 A;  3T8T A;  1FYL A;  5ILV A;  4A3L J;  2QQ8 A;  3IHU A;  3KP5 A;  1D0Y A;  2B9S A;  1AHD P;  2CG4 A;  3QAH A;  1A35 A;  1R5H A;  3E5U A;  1M1E B;  2VKH A;  4HV6 A;  2IA1 A;  5FRO A;  1Z91 A;  4Q5S F;  4E4H A;  2RN7 A;  2GZW A;  2D1V A;  4ZYA A;  3DBL B;  1J59 A;  3CLQ A;  4BS9 A;  5E3M A;  2F5E A;  4A5N A;  3DV8 A;  3IC7 A;  2HTS A;  4XN0 A;  1IN8 A;  2H1L A;  3OYG A;  1WWX A;  3F3X A;  3GUD A;  4JOM A;  1J0R A;  3ANP A;  4A6E A;  2A6T A;  4QSH A;  1YRN A;  2REK A;  3M8E A;  3K1P A;  2X1E A;  2FE3 A;  2Y9Y A;  3EUA A;  3QOE A;  1U8R A;  3EDP A;  2VKE A;  3GME A;  3QPL A;  4M9X A;  3PIO F;  2ACJ A;  1RZ4 A;  2HYG D;  2HZD A;  5CPR B;  2DYS H;  1A36 A;  3L2R A;  5J4Y A;  5IY5 H;  2XHK A;  4C2M J;  2FOW A;  2OAZ A;  1QU3 A;  2OD5 A;  3KLO A;  3ECH A;  1AWC A;  3D5R C;  3H35 A;  5HNF A;  4LB5 A;  1TLH B;  2CGP A;  3HOT A;  1MBJ A;  2HXI A;  2OUM A;  3BLY A;  5FO5 A;  5FFZ A;  1W5T A;  1RKT A;  4BXU A;  4GCL A;  5GTI C;  4UV8 A;  3PO2 J;  2ZCM A;  3COL A;  3S16 J;  4KIG A;  3SZG A;  1H88 C;  3CC2 I;  1UZC A;  3S3M A;  3F6V A;  2VE8 A;  4PJJ A;  3TOB A;  2RGV A;  3I59 A;  1ZR4 A;  5FFX A;  1R7J A;  2QF7 A;  3FXM A;  1TTY A;  3ISP A;  5D18 A;  3LMM A;  1LEB A;  5HBU A;  4G6Q A;  4IKF A;  4N0B A;  2LTP A;  3CJQ B;  3RH2 A;  2OZ6 A;  3PNV A;  4W97 A;  4ENN A;  3PM1 A;  2P4W A;  1Z67 A;  2R4G A;  1OMI A;  1HKT A;  3RKX A;  1W0U A;  4Y52 J;  3CUO A;  3ZRG A;  3RPQ A;  4HLY A;  1Y56 A;  2CW7 A;  3LSH A;  2EZI A;  4HDV A;  2HXO A;  3R60 A;  4DYR A;  4RAY A;  4XID A;  2ETH A;  1U6G A;  3VSK A;  4HLX A;  3GTJ J;  1F36 A;  3HL2 A;  1LPQ A;  4GFB A;  4L0Z B;  4U7D A;  1GT0 C;  2FEZ A;  5HLH A;  2GOX B;  2JJ7 A;  2QQ9 A;  2XB5 A;  4RAF A;  3H3U A;  1BL0 A;  2JA8 J;  2E2J J;  3N05 A;  2Y0M A;  1W5S A;  2P8T A;  2K5C A;  2VC1 A;  1TWH J;  2W85 A;  3F6O A;  2MG4 A;  3FKI J;  1XGN A;  3HGG A;  4ZDP A;  3JR9 A;  1HW2 A;  2PJR A;  1MDM A;  4U0W A;  3OS1 A;  1MSF C;  4XN3 A;  1GVJ A;  3DEE A;  2LY2 A;  1TW3 A;  4JL3 A;  3I54 A;  2IVM A;  4C3J J;  4FT8 A;  4YEJ A;  5HS7 A;  2PBI A;  2IRF G;  3D5S C;  1MBF A;  4KYW A;  4F52 A;  1LDK B;  4GXO A;  1J5Y A;  4OD4 A;  4E7Z A;  5D8L B;  4CHU A;  1MH4 A;  2IA0 A;  4QTR A;  1CQT A;  3F23 A;  2UXO A;  2QEN A;  2W7N A;  3W2V A;  4DOZ A;  1O3R A;  3I0T A;  1O7L A;  2V9V A;  4WIB A;  3JRC A;  5F1R A;  2B63 J;  4C2T A;  2EFP A;  4M6X A;  5DM6 F;  4X0G A;  1W7P B;  4HX7 A;  3JSJ A;  3I71 A;  4HQE A;  2HU9 A;  1X1P A;  3ASO H;  2BHY A;  2MA3 A;  3BG7 A;  3IH2 A;  4FE7 A;  4ESJ A;  2ISY A;  4P5O A;  3U1D A;  2PMH A;  1EH7 A;  4AID A;  1IN4 A;  2BYV E;  2DJN A;  2EFO A;  3CCL I;  1YIT I;  4J01 A;  3LOC A;  4LIT A;  1B8I B;  3AKZ A;  2WAE A;  3C2G A;  3ANG A;  2G3B A;  3J80 Z;  1RPW A;  1SD5 A;  2HWV A;  2Q24 A;  4XSX F;  5J1U A;  1EA3 A;  3E6M A;  3BCB A;  4XOP A;  2X9D A;  2O7O A;  3Q9S A;  1F43 A;  4XLN F;  4KIS A;  3LSI A;  1HQC A;  1UHM A;  1OCT C;  4PK4 A;  1KON A;  2X1C A;  3GW2 A;  5F04 A;  2DG8 A;  2FF4 A;  2HTJ A;  5GAG J;  1SD6 A;  1HF0 A;  4YII A;  4BE1 A;  2K4B A;  5HSZ A;  3O8G A;  3BG9 A;  2R7W A;  4L5E A;  2IGM A;  2L4M A;  4KMF A;  2HR3 A;  3SHF A;  3OSG A;  3HOW J;  2EJR A;  2BW3 A;  3DTI A;  2MW8 A;  4KIF A;  3DEU A;  1ZAR A;  2W82 A;  5LHG A;  3NQO A;  1FC3 A;  3TO7 A;  1KZH A;  2E2H J;  2ZNY A;  2XRL A;  3JCU C;  3EET A;  4IRI A;  4UY8 I;  3WTY C;  1W0T A;  4HNV A;  3F8F A;  2FBI A;  1I39 A;  4UVB A;  3UNG C;  4JK1 X;  2EFQ A;  3AG2 H;  1VQ4 I;  3M4O J;  1SD7 A;  2ICW G;  4L9V A;  1Z77 A;  2G7G A;  3IRQ A;  2M1B A;  3KYD B;  3LJL A;  4IL6 C;  3P9I A;  2XKO A;  5ICE A;  3BC8 A;  2CQX A;  4AU7 A;  3N97 A;  2L5Q A;  4EQQ A;  3I55 I;  5DYM A;  3DU6 A;  3UR3 C;  3WOD F;  4D1Q A;  2JA7 J;  3TOA A;  4N4N B;  1PUF B;  4EV0 A;  4M71 A;  1K4T A;  2W1O A;  3HEF A;  4RLF A;  2HQ5 A;  2WY8 Q;  3I9V 2;  4U88 A;  1IN7 A;  1I27 A;  3BR3 A;  4MGR A;  1R1U A;  1XCB A;  1Z21 A;  3K69 A;  1FLI A;  1V5F A;  1LEA A;  5EZH A;  3KYC B;  1IUY A;  2O7T A;  3W2A A;  4A3E J;  4UUV A;  4BXX J;  5CQG A;  4KWA A;  5EGO B;  3OWT A;  3JAM Z;  3JW4 A;  3HOX J;  1EF4 A;  1QVU A;  5DD4 A;  3RYP A;  1ITY A;  5L3B A;  3BY6 A;  3BR0 A;  5JI6 A;  2ESH A;  5F0C A;  3FMQ A;  1V5G A;  1ZG1 A;  3E0J B;  3ZMV A;  1GLN A;  3H92 A;  4H4K C;  3TP0 A;  2R7F A;  1BR4 A;  4V19 K;  2OBP A;  1BM9 A;  4KIB A;  4JX5 A;  4HA8 A;  1ETW A;  4B1R A;  2UUZ A;  2PMU A;  1WKM A;  5KAF C;  2LY1 A;  3IKT A;  1TL8 A;  1LJ9 A;  3QP6 A;  3QBM A;  2Y2Z A;  3N4M A;  4HKU A;  2F5V A;  2OPT A;  2XB0 X;  5FLM J;  1XMK A;  3LHQ A;  2BZT A;  2Y31 A;  1VQN I;  3JAM K;  3CCY A;  2O61 A;  2FQ4 A;  4G8X A;  3AG4 H;  1DPU A;  1IF1 A;  4BE2 A;  4M9Z A;  5K1Y A;  1X2N A;  2BV6 A;  4OMY A;  4N9H A;  3U1K A;  4S05 A;  3HHG A;  2WBM A;  1ZEL A;  2HQA A;  4LK1 F;  3F22 A;  4NN1 A;  1DP7 P;  1PVE A;  4XR6 A;  1HCR A;  3MZH A;  2BE5 F;  5DCF A;  5LGN A;  3H36 A;  2EK5 A;  2P0W A;  5F1J A;  2HYT A;  3CJD A;  2BXY A;  1MBE A;  3CF5 F;  1KYW A;  1XDS A;  3IWF A;  3IKV A;  1WJF A;  1KQ0 A;  3CUQ B;  2NP5 A;  1X1B A;  3V7R A;  4L5J A;  5EFY A;  5ICC A;  3CCJ I;  5D8K B;  3GTK J;  3DEW A;  2XVC A;  2UXX A;  1HXD A;  2O8K A;  3K2Z A;  1WCM J;  2HVR A;  1FMV A;  4CZC A;  5GPA A;  3GEU A;  3H0G J;  1SAX A;  3IAS 2;  2X6Y A;  3EUH C;  2H8R A;  1GXP A;  4WWC A;  2A5Y B;  1AKH B;  1UG0 A;  5IYC J;  2HOS A;  1H0M A;  2DFH A;  2EIK H;  1BJA A;  2GXG A;  4BQO A;  1QA6 A;  1WSU A;  3FXU A;  5LRS A;  1VQM I;  3L2W A;  2M87 A;  3EQL F;  1GDT A;  4N4O B;  3WG9 A;  3IUV A;  1DGR M;  2M2E A;  1P4A A;  5J40 A;  5DCM A;  4A3C J;  1X2M A;  4DJA A;  4WF2 A;  1Y0U A;  3K9T A;  3CCV I;  1W4M A;  1VND A;  2HFH A;  3ZGK A;  2F2E A;  3MEX A;  3MZ8 A;  2R92 J;  1SAN A;  2XGX A;  2I8D A;  5FKM A;  1LQ1 A;  1TZL A;  4HNU A;  4O6J A;  5CVR A;  1FNN A;  1UI5 A;  4A3D J;  2V4J C;  2DG7 A;  1WHU A;  2XGE A;  1F1Z A;  2E34 A;  3BP8 A;  1GVD A;  4II3 A;  5EDN A;  1MNE A;  2K86 A;  1QRY A;  3O2P E;  3FK7 A;  2CUZ A;  4I01 A;  3W6J B;  3KZ9 A;  1ZLJ A;  1S7A A;  5K7Z A;  3R4K A;  2O0Y A;  1TQM A;  1JHF A;  2X51 A;  4YFK F;  2WUI A;  1J9I A;  2D6Y A;  1Z7L A;  4ZTJ A;  4LIV A;  2DOA A;  4C2U A;  4CUG A;  3LAJ A;  5H9T A;  4I7H A;  3RIR A;  2LNB A;  1S29 A;  5EJC A;  5D19 A;  3GLX A;  4QPO A;  5EEH A;  2NNN A;  4ZZD A;  2YR2 A;  1QZZ A;  3D1N I;  1PDN C;  4WXH A;  1XSX A;  3X2Q H;  1ZKG A;  3RCO A;  1OR7 C;  5K5R A;  4BDZ A;  3PQK A;  2EIL H;  4BHC A;  3G4S I;  3QPS A;  1RUN A;  5ILS A;  4KN4 X;  3H9Q A;  4ZH4 F;  2OCC H;  1DU0 A;  2VI6 A;  4LLL A;  2DFI A;  2LKX A;  4CH7 A;  3FHZ A;  3CDI A;  2KL4 A;  2VQG A;  1FTZ A;  4HF1 A;  2VUM J;  2ESN A;  3G1L A;  5J1R A;  1XPX A;  4HBL A;  5GAE J;  1R6R A;  3OYE A;  1UMQ A;  1IZ1 A;  5FKO A;  2JPB A;  2LBF A;  3I4P A;  1JKQ C;  3SQN A;  1MD0 A;  2LRD A;  4HQM A;  3PFI A;  2VOP A;  1OFC X;  1E0E A;  3ZMS A;  3QYE A;  2ZME A;  2V9P A;  1R1V A;  4YZE A;  2MD5 A;  3C2B A;  3A01 B;  3KET A;  3VOX A;  1BA5 A;  2K7L A;  4QLC U;  2XPU A;  2EFN A;  2CW0 F;  5DS9 A;  1IXR C;  1G3T A;  1S6L A;  2DI3 A;  3OYH A;  1WJA A;  5E1W A;  1BW6 A;  3LAP A;  4MXM A;  1IXS B;  5H20 A;  5M3M J;  5CQE A;  4RB1 A;  3OS0 A;  2X6O A;  1UFM A;  4F92 B;  5D4R A;  3VVX A;  3JRB A;  1E17 A;  4BHP A;  3WTW C;  4WCG A;  4GYI A;  4LG0 B;  4UVA A;  4ON0 A;  2DCE A;  3TO6 A;  2ZSH B;  2EIM H;  2KLO A;  2XPW A;  2Y0S N;  3FXJ A;  4G6T B;  3BTJ A;  1BIA A;  3RQI A;  5LHI A;  2VOO A;  3NS4 A;  3VYS B;  3HRU A;  2NXN B;  5HVQ C;  2V79 A;  3OIO A;  3MKL A;  4PCQ A;  4BY7 J;  1IN5 A;  2AQE A;  2JZY A;  3TDZ C;  1H89 C;  5B66 C;  3ZMD A;  2K4J A;  5FRM A;  1T33 A;  1T6S A;  2K27 A;  1AU7 A;  5JHU A;  1UEL B;  5LD2 C;  3S1Q J;  1IN6 A;  4UB8 C;  4AYB N;  4UUS B;  5J3L A;  3GTM J;  2QKO A;  3HM5 A;  3GWZ A;  4NC6 A;  1FBU A;  1U5T A;  4OIP F;  1NTC A;  2CH0 A;  2X1D A;  1EH6 A;  3OOP A;  3CMA I;  2CU7 A;  1FOY A;  2CV1 A;  1STZ A;  2FQ3 A;  1TP4 A;  3K10 A;  2HDC A;  4XLA A;  3V8L A;  2DDB A;  3KZZ A;  2ID6 A;  4LJZ F;  1I3A A;  2DOF A;  3BJA A;  2CUF A;  5IP6 A;  3EPZ A;  2HOE A;  2VJI A;  2DA3 A;  3NPI A;  4XRM A;  5K5Q A;  1FIP A;  1I1G A;  2WAQ A;  4CXF A;  4IHY A;  1WI3 A;  1OIS A;  4M3E A;  4A3M J;  1JT0 A;  4DVY P;  4EGY A;  4XKV A;  1NK3 P;  3VYU B;  1YYV A;  1WJD A;  4JYK A;  5FGM A;  1XGS A;  4AIH A;  4GRI A;  1QZE A;  2EV6 A;  4D7M A;  3SJM A;  4EJT A;  1BW5 A;  1KGS A;  2KIU A;  3QWL A;  3RPU D;  2ECC A;  2XKP A;  5KAI C;  5FJ8 J;  1QZY A;  2DO7 A;  3NWT A;  3TKY A;  3MNL A;  5FD5 A;  4OIN F;  3WTV C;  1G59 A;  4ZDL A;  2HKO A;  3BJB A;  3M3Y J;  1YW8 A;  3ZN0 A;  4C2M A;  1GHC A;  5J8F A;  3KKC A;  3L7W A;  1D8J A;  2MSY A;  1FEX A;  4A12 A;  4QPQ A;  3HC7 A;  1TWC J;  1MMA A;  2OC6 A;  5D5W B;  3HOY J;  3FK6 A;  4BJ6 C;  3GTG J;  5GP9 A;  3IH4 A;  1FOK A;  2VAS A;  3E1S A;  4CGZ A;  2QWW A;  4XOT A;  2R5Y B;  4LLN A;  3I58 A;  2A6H F;  3BT9 A;  1C0W A;  2NVQ J;  3AAF A;  1LB2 A;  3RQ4 A;  3FF5 A;  2DU9 A;  4IQJ A;  3DU5 A;  4C3I J;  1CF7 B;  2ZJQ F;  4AC6 A;  1YHQ I;  3I64 A;  4CYC A;  1LNW A;  4WK8 F;  3OYM A;  1A6I A;  4XBF A;  1L0O C;  4XL9 A;  4BDY A;  3GFJ A;  2HYF A;  1ZGJ A;  4OOI A;  5AIQ A;  2LKS A;  2DXI A;  4RS8 A;  5HS8 A;  1O3S A;  1N75 A;  1IV8 A;  3GFM A;  5J1Y A;  2DMP A;  3K7A J;  3HRS A;  1T56 A;  3R0A A;  1P7I A;  4I02 A;  1K79 A;  2XSJ C;  2V1U A;  1E3O C;  2OER A;  4ZYG A;  2TCT A;  4IHT A;  2EQR A;  2E7W A;  4WXC A;  3GVA A;  3PQJ A;  5F6F A;  2VON A;  3JRG A;  3LA3 A;  4L9T A;  4YG2 F;  3DCF A;  1MH3 A;  3RI4 A;  4XLP F;  2IA2 A;  2P6T A;  3L2Q A;  4A3F J;  5FRN A;  2QZ8 A;  3DP7 A;  3DBR B;  5C4J J;  1JKR C;  1V54 H;  1IRZ A;  3FBI B;  2YVE A;  2JRM A;  1K4S A;  1VTN C;  2NRA C;  2L02 A;  1HOM A;  1IDY A;  3P9C A;  2NVU B;  1VFC A;  4IRG A;  5GTH C;  3BQZ A;  5FLX Z;  2KQR A;  3DQV C;  4MQ9 F;  5D5X B;  1OKR A;  4YIR X;  3EUP A;  1BI3 A;  2QM3 A;  2CQ7 A;  4BEH A;  3OSF A;  4II2 A;  4A5M A;  3REO A;  4IRV A;  3W6K B;  2M7B A;  3W2W A;  2JVH A;  4JBA A;  2V1D A;  2CSO A;  2Z16 A;  1J7K A;  2P5V A;  1OYI A;  5TRD A;  3TP3 A;  3J7Z I;  4ENK A;  1CGP A;  2LF8 A;  2GFN A;  2IXS A;  1L3L A;  4KN7 X;  4FX0 A;  1MMD A;  3K4L A;  3RJP A;  4DIQ A;  2HDD A;  4UB6 C;  4GFK A;  2ZME C;  4LLG F;  4D7N A;  1VQO I;  2V9K A;  3ON2 A;  3ON4 A;  5FKN A;  2Q8K A;  4RDU A;  2BY3 A;  4RGS A;  4Y4R A;  1V5E A;  5C4X J;  4EJO A;  2YUS A;  2DT6 A;  3L1P A;  4ICH A;  1BBY A;  2DPD A;  2WTE A;  3KX2 A;  3PSF A;  3LL7 A;  3ZOB A;  5C44 J;  3CZ6 A;  4CZZ A;  2V26 A;  5ERI A;  1YW7 A;  5CJ9 A;  4MNU A;  1X1D A;  3O8H A;  4KDP A;  3BRO A;  3F72 A;  5E3N A;  2IS2 A;  2ID3 A;  4ZC3 A;  2UWM A;  3R61 A;  3KFW X;  1FMW A;  5HDG A;  1BI1 A;  4FX4 A;  3KIO A;  4BGD A;  4IXA A;  2GIZ A;  4ZJZ A;  2ZCN A;  2EA4 A;  2QYO A;  1D3Y A;  4LOC A;  4AWX B;  1YS7 A;  3CDH A;  3AL0 B;  1YRN B;  4OD5 A;  1YFH A;  2F07 A;  4JQF A;  1SFE A;  1S8N A;  1Z6T A;  3A2K A;  5FB2 A;  2AO9 A;  1RC9 A;  3I4M J;  2E35 A;  1D5Y A;  5D6E A;  1IGN A;  1BR2 A;  1G3S A;  3DLL F;  3BJO A;  1XS9 A;  2GA2 A;  2HVQ A;  1AA7 A;  4DBR A;  5EYR A;  5BOX A;  1U5T C;  3RKY A;  4PJ0 C;  4RMN A;  2VOD A;  2NS0 A;  4X6A J;  2NVT J;  1OCO H;  3MZY A;  3FWE A;  2Y75 A;  5TIS C;  2BY0 A;  2COM A;  4M3B A;  5HNH A;  3HIF A;  3OYI A;  3MD2 A;  4Y3O A;  1FOX A;  2IGN A;  1T0F A;  2L54 A;  3FIS A;  3WGI A;  3HOU J;  1HW1 A;  3HPH A;  2HYJ A;  2VT2 A;  2P6S A;  4GCV A;  2PMZ A;  5FD6 A;  5EEG A;  4MFD A;  1WH5 A;  1ENH A;  2OZU A;  4EAT A;  5CVU A;  3Q3S A;  2MLG A;  4J19 A;  1WJE A;  2ZFW A;  2AQF A;  3HRM A;  4E7H A;  1SMT A;  1R58 A;  2FBK A;  3OMY A;  4PJN A;  4ANJ A;  1IO2 A;  3KLN A;  2CQQ A;  2X6W A;  5FKK A;  1MBH A;  4DYC A;  2LP0 A;  2VE9 A;  3KP4 A;  1QBJ A;  3HTJ A;  3QU3 A;  3TQN A;  2XRO A;  2UV1 A;  3I53 A;  3KP2 A;  4Q48 A;  5F64 A;  1FWZ A;  1LUJ B;  3GXO A;  2W84 A;  2FRH A;  2ZJ2 A;  3LSM A;  3LA7 A;  2ZXW H;  4V2G A;  4XLE A;  4YFN F;  2ZJR F;  4HF2 A;  1JKO C;  2XAQ A;  3HTI A;  4LGW A;  1O3T A;  2QKM B;  3BZ6 A;  3DPT A;  1ZRC A;  4F3Q A;  2FBH A;  5EEA A;  5E3O A;  5HOO A;  2DA6 A;  2PJP A;  3BQY A;  3HOS A;  4EMS A;  4KJZ A;  5LEJ A;  2ZY9 A;  3O60 A;  2VBW A;  2DPU A;  2LC2 A;  2Z33 A;  3CWR A;  2DK5 A;  1SVL A;  2VIX A;  4MHG A;  3KCC A;  3RKQ A;  2UXH A;  4PJM A;  5F27 A;  1K78 A;  1Z05 A;  3QQA A;  3S1M J;  2WWY A;  2XRN A;  1LVA A;  1HKS A;  1RRJ A;  1G3W A;  3S1N J;  3GCM A;  3M1C A;  1R00 A;  1ZG3 A;  2UXN A;  4B43 A;  2Q2E B;  3JRA A;  2R7T A;  2D5V A;  2L01 A;  4F91 B;  1MBG A;  2O03 A;  2NP3 A;  4G7Z F;  1E3P A;  4BAY A;  1HBX G;  2GXA A;  2BXZ A;  4RA2 A;  5BPI A;  4CCL A;  2JSC A;  2YX7 A;  3FXR A;  3K70 D;  2M30 A;  5E8I A;  4BBS J;  4L62 A;  3J80 K;  2RNJ A;  3KEQ A;  4RLQ A;  5HAW A;  4WX9 A;  4IOC F;  3ZQF A;  3BZK A;  5D5V B;  2XAF A;  4YRV A;  4AD9 A;  2E1C A;  3VOD A;  3GFL A;  1JT6 A;  4IPA A;  2ZJP F;  1H9G A;  1BC7 C;  1POG A;  4DGW B;  4XRS G;  1ZK8 A;  3LST A;  5EF6 A;  1RKW A;  3H5N A;  3FM3 A;  2W24 A;  2E60 A;  5DAJ A;  4NUB A;  1ORK A;  4F55 A;  1YW9 A;  1X58 A;  1SFX A;  3QU6 A;  5HLT A;  4UDS A;  2W25 A;  3ZMU A;  1HDD C;  1WH7 A;  1Y39 A;  3CCU I;  2MC3 A;  3Q0W A;  2LOO A;  2HOT A;  1K61 A;  3K1M A;  3LFU A;  1OLT A;  2JUG A;  3DF8 A;  3S3N A;  2PBX A;  2JWT A;  1HSJ A;  1ETY A;  1ZGW A;  3AL0 C;  2FNP A;  3L2U A;  1XDU A;  2ZXI A;  5CVI A;  3HDD A;  2KRH A;  2YPR A;  3IRR A;  1XMX A;  3S5R A;  1S7O A;  2DQL A;  2IJL A;  1ZR2 A;  2TRT A;  1IXC A;  2R3S A;  2JA2 A;  1ZRE A;  2R7O A;  2GIV A;  3S8P A;  1T38 A;  3VVY A;  2M0M A;  1TWF J;  1B72 A;  2BW3 B;  1LVK A;  2L2O A;  5CVJ A;  2NNY A;  1XSD A;  2M7A A;  3L09 A;  1WPK A;  5BMZ A;  4HG2 A;  5KVR A;  4RB3 C;  5H6R A;  4JKZ A;  1ETV A;  1YS6 A;  5K5O A;  3W3C A;  1LFB A;  3OY9 A;  3S32 A;  2JMW A;  2VQL A;  5B5E C;  2HVS A;  1UG2 A;  1YE9 A;  4LG3 A;  3ZQG A;  3L2V A;  5IOY A;  1Y1V J;  3HKZ A;  2A68 F;  1X4O A;  2LVS A;  4ZDO A;  2EFW A;  5JFR A;  2E1N A;  1SAU A;  4E7K A;  1W5C C;  2OU2 A;  4B48 A;  1XCV A;  1MND A;  2H6B A;  3WTU C;  1VQL I;  3LQQ A;  2EA2 A;  4UNO A;  3CLO A;  2B7E A;  1J09 A;  1TNT A;  2QQA A;  2PFB A;  3CCE I;  4HF0 A;  1LDD A;  2GXB A;  4G6D A;  2BY1 A;  4DZP A;  2E1M C;  3VW0 A;  4M3G A;  4U87 A;  3VUQ A;  3H3V K;  2DMU A;  3SFZ A;  1LE8 B;  2RQP A;  3JTG A;  1OCR H;  4LMY A;  1JI8 A;  3HGY A;  3MAJ A;  3NEU A;  2ZSI B;  2CUE A;  3WTX C;  2WB1 A;  4DW6 A;  2VBZ A;  4BQQ A;  3ABL H;  3BWG A;  3G3Z A;  4F7Z A;  1JXS A;  2G7S A;  1QGP A;  3BR5 A;  3GEZ A;  2WAF A;  2IAI A;  3DBH B;  2D1H A;  3TGN A;  3PSI A;  2F5D A;  1UHS A;  3F8N A;  3I4N J;  2PZ9 A;  3H5A A;  3ASN H;  3PNY A;  4HX8 A;  4OAY A;  4A0Z A;  4EM2 A;  1VQ9 I;  5L3D A;  3IUO A;  2CS3 A;  1FP2 A;  2M0C A;  2QCO A;  1ZRF A;  2JT1 A;  2XV4 S;  5H6Q A;  4RB0 A;  3CC4 I;  4KA4 A;  2ZOY A;  1FPQ A;  4LB6 B;  2IGO A;  1R4N B;  3GZ5 A;  2OQR A;  2VJ5 A;  3HSR A;  2LD5 A;  3K6G A;  4U0Y A;  4KUM A;  3S2H J;  4P96 A;  2HKU A;  1KU2 A;  3OR2 C;  5DTD A;  3JRF A;  3OS2 A;  3RPU A;  4XOR A;  3CCS I;  2QSF X;  4CCK A;  1I50 J;  1E3H A;  4RB2 C;  4PFP A;  3EYI A;  3RSN A;  4DYQ A;  1FYM A;  5JVG F;  3GO5 A;  3H5R A;  4FIS A;  5HDN A;  1KQ9 A;  1XSV A;  1QQI A;  3T5X A;  2W53 A;  3OYK A;  1RIO H;  3E6B A;  2FJ1 A;  4IQ4 A;  2QBY A;  3RD3 A;  1ETO A;  3T6N A;  4NHJ A;  2LDU A;  2HZT A;  2AXT C;  1P9Q C;  3B6A A;  2R7D A;  3LNQ A;  1U0J A;  1UHW A;  2HS5 A;  1YJ9 I;  5CXG A;  4L9J A;  3RDI A;  2CRG A;  2M8G X;  1A6Q A;  3K4B A;  3OL4 A;  4A2U A;  3VIB A;  4EVI A;  3NXC A;  5JLX A;  1I6X A;  1LFU P;  2UXI A;  1SMY F;  2Q1Z B;  2IW5 A;  2L7K A;  3LSG A;  2NX4 A;  2DMT A;  1Z7U A;  2YX4 A;  1HA8 A;  1TC3 C;  3ZMT A;  1YIJ I;  4UHT A;  2NVX J;  2HDW A;  1Z6R A;  3HTS B;  4ETS A;  2OTL I;  1FY7 A;  2IBD A;  2N8G A;  1BC8 C;  2OI8 A;  4BQN A;  2ELH A;  2OJE D;  1R9T J;  3KZI C;  5IOZ A;  5JVT A;  3HG9 A;  5ICF A;  1S5L C;  1Y8Q B;  2GUH A;  5BS6 A;  3BPV A;  1MIJ A;  2WV0 A;  4IHV A;  2L9R A;  2RVC A;  3P7N A;  3G7R A;  3MVP A;  3WU2 C;  5D4S A;  3NAU A;  4BHB A;  5M5X J;  2STT A;  4MK6 A;  2DOD A;  1A04 A;  2H09 A;  3HTU A;  3WHB A;  9ANT A;  1XN7 A;  2R7Z J;  1T98 A;  2W48 A;  3C7J A;  4MLO A;  1UJ8 A;  2GA1 A;  4NB5 A;  1FSE A;  4FHT A;  1REP C;  2MFZ A;  5EZG A;  5K7H A;  3DTE A;  3HYI A;  2KP6 A;  2L7F P;  4A3J J;  5DM7 F;  3G1M A;  3ABM H;  2R93 J;  2VL8 A;  3P9K A;  2R5Z A;  2LSO A;  2ISZ A;  3CCM I;  5J47 A;  2LY9 A;  4PZJ A;  3ECO A;  4XQF A;  4OWR B;  5CLS A;  3BG6 A;  2BBY A;  4CCM A;  3K4K A;  3ROU A;  3ZQ7 A;  2MC4 A;  4P9U A;  2QVO A;  2GEN A;  1WQ2 A;  2DA1 A;  2G0E A;  3BTI A;  3OV8 A;  2H1K A;  1B6A A;  4BNC A;  1B59 A;  2R7V A;  3DTK A;  1ACI A;  3E6D A;  3BNI A;  4GCK A;  5BQT A;  2ZC2 A;  2RRE A;  2XGD A;  4NQW A;  2ZNZ A;  3WHC A;  1ZQ3 P;  2LF7 A;  3M8J A;  1SGM A;  3H9J A;  3FZV A;  4Y33 A;  2EPF A;  5LGT A;  1YJW I;  2PN6 A;  2NS8 A;  3C07 A;  1FOW A;  2DA4 A;  2B0L A;  3NRV A;  2KFD A;  1HC8 A;  3OYL A;  3CES A;  3GYH X;  4PFO A;  1QHG A;  2L4A A;  2XF6 A;  2J5O A;  1U78 A;  4YIF A;  1I5Z A;  3J7Y J;  3GZI A;  3G73 A;  2QA4 I;  1IG7 A;  4BAC A;  1YG2 A;  5BNG A;  2CO5 A;  3TBI A;  1YLF A;  2VKV A;  2CUJ A;  4HX4 A;  1DPR A;  1Y6I A;  2QSH X;  5E18 F;  1MGT A;  2RV8 A;  2W57 A;  1MZB A;  3E6C C;  4XKW A;  1IDZ A;  4KFC A;  4XLH A;  2JN6 A;  4XM3 A;  3KEO A;  4FAS D;  3F8B A;  3C3W A;  2E5N A;  2LBF B;  1MMN A;  2AHQ A;  3V7C A;  2VT3 A;  4EEF G;  5K58 A;  5KCM A;  4D9J A;  2YVX A;  3JSO A;  1HW5 A;  2JA6 J;  2L7M P;  3AG1 H;  2XF5 A;  2ZME B;  4M9S A;  2IU5 A;  2G9W A;  2FA5 A;  1O4X A;  2P7C B;  1OJL A;  3F0C A;  1JJ8 C;  3HTH A;  3T1B A;  3QYF A;  3GTO J;  4G7O F;  3HUG B;  1MMG A;  1UB9 A;  2Z3Y A;  3IV5 A;  4N9I A;  4G7H F;  3ZQC A;  3P9T A;  3ZMZ A;  3OYJ A;  1WVR A;  2VN2 A;  3WG7 H;  4CA0 A;  3EGQ A;  1X3Z B;  4BU2 A;  3OYD A;  3SDB A;  2M45 A;  2H6C A;  3L2C A;  1XTA A;  1ZN2 A;  2ZFU A;  1FZP B;  3S1R J;  1Z0X A;  2VLA A;  2A6E F;  3L9F A;  2PFV A;  3GZ6 A;  5ICG A;  3FXO A;  3KE2 A;  3CC7 I;  1VQ8 I;  3CDL A;  3FX3 A;  5CYV A;  5FKL A;  3Q9V A;  5AIP A;  1P2F A;  2R5Y A;  1S3J A;  1V3F A;  5TGT A;  2F6C A;  4L18 B;  2R7Q A;  2ELK A;  4XON A;  2A3S A;  5F0F A;  3GTQ J;  1ZYR F;  2NS7 A;  1CF7 A;  2ZXH A;  3HSF A;  1G6N A;  2W4S A;  4HPQ A;  2E71 A;  3EYY A;  1JE8 A;  1OCP A;  4I09 A;  2M5W A;  3BR2 A;  5EG0 A;  3FIW A;  1MSE C;  3LFK A;  2KPM A;  2KJB A;  2EZH A;  1DU6 A;  1U5T B;  5LEK A;  2DMQ A;  1YTY A;  2RAE A;  3ERM A;  2WC2 A;  3FHN A;  3A0B C;  2D45 A;  2GAU A;  1X19 A;  3S2W A;  2KHM A;  1TQP A;  2DJI A;  4EJW A;  2ZXJ A;  4IJA A;  1XB4 A;  2JVG A;  2XF7 A;  4E7S A;  3OYN A;  5E3L A;  3H3Z A;  1JJ6 C;  3B6C A;  1XGM A;  1PJR A;  3CJT B;  4I76 A;  2Q0O A;  4KIC A;  2IPQ X;  3VTI A;  2KIQ A;  2E5Z A;  3IP4 B;  3TW6 A;  1U9N A;  4PGG A;  2G7H A;  5GPC A;  4IHS A;  4V2F A;  3V8K A;  2EIJ H;  4PGH A;  2NOJ B;  1IRF A;  2KZV A;  4EJU A;  5M5W J;  3JRD A;  2MAB A;  3KP6 A;  1HDP A;  4BXF A;  3ABK H;  2PX9 A;  1D8K A;  4OIQ F;  2F4I A;  2FU4 A;  1TT0 A;  1ZRD A;  3DPJ A;  5FGL A;  4BJT A;  1QPM A;  3I3L A;  5H2F C;  1ZH5 A;  1KU3 A;  2DK8 A;  3WU0 A;  3G71 I;  4P9F A;  2RDP A;  2XDV A;  3K4M A;  1FX7 A;  1Q1H A;  2BY2 A;  1FT9 A;  2PI0 A;  2EBI A;  2HQR A;  3ESW B;  2CWE A;  3FM5 A;  2QTQ A;  3LSK A;  3BRU A;  1D0Z A;  2ZO4 A;  4JX6 A;  3KEY A;  2XSD C;  3HSE A;  1S9H A;  5ED4 A;  4XMY A;  2MGQ A;  4KIT B;  5M5Y J;  4NC7 A;  2R7X A;  1YX3 A;  4OIR F;  3GFI A;  1AOY A;  5LFA A;  1QVT A;  2DMN A;  3K0L A;  3VW2 A;  1DDN A;  1RNL A;  2Z99 A;  4CO8 A;  3VYT B;  5FMP A;  3HBL A;  1OPC A;  1NG6 A;  1GV2 A;  3JTH A;  4GGG A;  5AON A;  2VQH A;  4IX7 A;  1BN5 A;  4FE4 A;  4P55 A;  3QPT A;  1J2X A;  1ERD A;  2FNA A;  3ONQ A;  1DUX C;  2K9S A;  3V42 A;  2DLL A;  2M8E A;  4A6D A;  4CYC B;  2HKX A;  3DPU A;  4E70 A;  5F0H A;  2EZK A;  3OYC A;  1IAW A;  3QKX A;  2KRF A;  1UAA A;  2ZBK A;  1USS A;  5B1A H;  2DA7 A;  1OCZ H;  1X1A A;  2D2W A;  4XIC A;  2V1N A;  4A3G J;  1YIO A;  1FP1 D;  2DBB A;  1IW7 F;  2GM4 A;  1ETX A;  1JUS A;  2K9M A;  2KZG A;  5L3G A;  2HPM A;  3HOV J;  5FLX K;  3VVZ A;  2XAU A;  5D6F A;  5ILU A;  4FTH A;  5D1R A;  2RQQ A;  3CD6 I;  3GTL J;  2H27 A;  4CCO A;  4BKX A;  1VQK I;  1YJN I;  1WFX A;  4HV5 A;  4Y15 A;  3GF2 A;  1IUF A;  3DKY A;  5DUI A;  5JR3 A;  1XMA A;  3J7A Y;  1IJW C;  1FSH A;  3HOZ J;  4BE0 A;  2UXU A;  1VI0 A;  4ZYD A;  3FXL A;  4B3X A;  1ZGA A;  2F5C A;  2R0Q C;  2P7V B;  1Z1D A;  3A02 A;  4DNC A;  2A61 A;  3M07 A;  4WXD A;  2QKL B;  2LRE A;  4LFU A;  2F4O B;  1J75 A;  3ABU A;  1T8I A;  2JK3 A;  2L3D A;  3IAM 2;  2COB A;  4NDL A;  4ACI A;  3FXK A;  3R6S A;  4PSX A;  2IP2 A;  5C4Y A;  4UV9 A;  3CO7 C;  1OQY A;  3PUB A;  4BEH B;  1P92 A;  2VXZ A;  3AFH A;  1T95 A;  4Y17 A;  1E2X A;  1W1W E;  2MH9 A;  2UZK A;  2GOM A;  1APL C;  1ETK A;  3P5J A;  5D5U B;  3OR1 C;  3FMR A;  2VQC A;  2I5U A;  2L9V A;  4C9Y A;  1VQ7 I;  1U8B A;  3H9G A;  3QPH A;  3BG5 A;  2EV0 A;  2YSR A;  3BTL A;  3QYB A;  3S14 J;  1YX5 A;  1RI7 A;  2A2F X;  4A3B J;  4MTE A;  1N78 A;  3CO6 C;  4AVZ A;  2G7U A;  4EJV A;  2CV0 A;  1RR7 A;  2LYC A;  3ZQI A;  1TNS A;  3M9A A;  1V55 H;  3NRG A;  1RES A;  3BTC A;  1QPI A;  3HHH A;  3SDG A;  6PAX A;  1W7P A;  1G3Y A;  2KDO A;  4L9N A;  2E7X A;  2IS6 A;  4ITV A;  3SEQ A;  1G4D A;  5E8G A;  4E7J A;  3GZN B;  4BH9 A;  4AUX A;  1OCC H;  3MQ0 A;  2CFO A;  2DT7 B;  2JTV A;  2VPR A;  3OOU A;  4CCJ A;  4Q4Z F;  1B8I A;  3S3O A;  3AQS A;  3I59 B;  4ENM A;  1KU9 A;  1HKQ A;  4E7L A;  1SVO A;  2UXP A;  3DWL E;  2VXD A;  3M8F A;  1VZ0 A;  3U21 A;  3F1B A;  3EUK L;  2BHZ A;  3F21 A;  1ZHF A;  3B73 A;  4GFL A;  2M3A A;  1B4A A; 
#chains in the Genus database with same CATH homology
 4A3K J;  4XK4 A;  2ZOZ A;  4DZP A;  1UMQ A;  3VW0 A;  4M3G A;  3VUQ A;  5FKO A;  3H3V K;  3NNR A;  2DMU A;  4B3A A;  1JKQ C;  4ME9 A;  1ZTR A;  4JP0 A;  3S17 J;  1LE8 B;  1OFC X;  3RZO J;  5EG0 B;  3HGY A;  2CUE A;  2X48 A;  4DW6 A;  4YZE A;  3C2B A;  4PXI A;  3LSJ A;  1MBK A;  2G7S A;  3BR5 A;  3A01 B;  3VOX A;  2IAI A;  1BA5 A;  1XC5 A;  4C3H J;  2LR8 A;  3ZQL A;  2XPV A;  5FHP A;  1UHS A;  2XPU A;  3I4N J;  2WV1 A;  2PZ9 A;  2YS9 A;  5DS9 A;  1HLV A;  1Q1V A;  4A3L J;  2DA5 A;  5IYB J;  1AHD P;  3LSP A;  1BW6 A;  3CMY A;  4BY1 J;  4MXM A;  2M0C A;  2QCO A;  5M3M J;  2WAQ N;  2X6O A;  2ZB9 A;  2ZOY A;  3VVX A;  4M3F A;  3JRB A;  3MN2 A;  5E3M A;  4A69 C;  2LD5 A;  3JRI A;  3AQT A;  2XPW A;  2Y0S N;  3RQI A;  4FCY A;  3BTJ A;  2E2I J;  3S2H J;  5DTD A;  2HKU A;  3JRF A;  2HI3 A;  3ANP A;  5M3F J;  1UI6 A;  4QSH A;  2REK A;  1YRN A;  3OIO A;  1I50 J;  2DA2 A;  2Y9Y A;  3MKL A;  4G12 A;  4BY7 J;  1PUF A;  4DYQ A;  2ZCX A;  5CXI A;  1H89 C;  1T33 A;  1AU7 A;  4FIS A;  2K9N A;  2VKE A;  3QPL A;  3S1Q J;  4AYB N;  4UUS B;  5J3L A;  1JGG A;  3GTM J;  3HIM A;  2W53 A;  2QKO A;  5C3E J;  3V6G A;  4A3I J;  3HM5 A;  2FJ1 A;  3RD3 A;  4IEJ A;  3SFI A;  1ETO A;  1NTC A;  3T6N A;  4C2M J;  1JUM A;  4Y7N J;  3B6A A;  3LNQ A;  2DN0 A;  2CU7 A;  5CXG A;  2GLO A;  2LFB A;  5EGO A;  1MBJ A;  3K2A A;  2HXI A;  2CRG A;  2ID6 A;  2M8G X;  3ZQH A;  1JUP A;  3VIB A;  1RKT A;  2CUF A;  3NXC A;  4GCL A;  5JLX A;  5IP6 A;  1LFU P;  2UXI A;  2DA3 A;  5IYD J;  4XRM A;  3PO2 J;  1FIP A;  2ZCM A;  3NPI A;  2DTZ A;  4DZJ A;  3COL A;  3LSG A;  3S16 J;  2OF7 A;  2NX4 A;  2DMT A;  4IHY A;  1H88 C;  1TC3 C;  1WI3 A;  2FBQ A;  2NVX J;  4M3E A;  4A3M J;  1JT0 A;  2I10 A;  2RAS A;  1NK3 P;  4MFE A;  2IBD A;  2N8G A;  4JYK A;  1ZR4 A;  2OI8 A;  2QF7 A;  3PAS A;  1R9T J;  5IOZ A;  5D18 A;  5HBU A;  3SJM A;  4D7M A;  1BW5 A;  2LTP A;  3RH2 A;  4W97 A;  2GUH A;  3PM1 A;  2ECC A;  2LK2 A;  5FJ8 J;  4IHV A;  2L9R A;  3G7R A;  5K7F A;  3Q0U A;  3RZD J;  3MVP A;  5AQC A;  5M5X J;  3NAU A;  1S7E A;  1VF9 A;  1W0U A;  3MNL A;  4MK6 A;  3QBM A;  4Y52 J;  3WHB A;  4ABZ A;  9ANT A;  2R7Z J;  3G56 A;  2EZI A;  2W48 A;  2HXO A;  4MLO A;  4DYR A;  1LE8 A;  3M3Y J;  3BJB A;  4XID A;  3G1O A;  3KKC A;  3GTJ J;  1F36 A;  3LSR A;  2MSY A;  5EZG A;  4GFB A;  5K7H A;  1GT0 C;  1FEX A;  2L7F P;  1TWC J;  4A3J J;  2JJ7 A;  3KNW A;  2XB5 A;  1BJZ A;  3G1M A;  3FK6 A;  2R93 J;  2ME6 A;  3GTG J;  3HOY J;  5GP9 A;  3IH4 A;  4M3D A;  2R5Z A;  1BL0 A;  5JLW A;  2LY9 A;  2R5Y B;  2E2J J;  2JA8 J;  3BT9 A;  1Y1W J;  2NVQ J;  1TWH J;  3FKI J;  2MG4 A;  3HGG A;  3JR9 A;  1MSF C;  2G7L A;  2GEN A;  4C3I J;  2DA1 A;  2G0E A;  3BTI A;  2H1K A;  4JL3 A;  4AC6 A;  4C3J J;  4CYC A;  2YU9 J;  3GTP J;  3BNI A;  4GCK A;  3VPR A;  4AF5 A;  4M6V A;  1A6I A;  1MBF A;  2XGD A;  3WHC A;  1ZQ3 P;  1AKH A;  3LWJ A;  1SGM A;  5IP9 J;  2ME0 A;  3BR6 A;  2NS8 A;  5J1Y A;  1MH4 A;  4QTR A;  2DMP A;  1B72 B;  1CQT A;  2DA4 A;  2RHA A;  2UXO A;  3K7A J;  3C07 A;  1T56 A;  1SFO J;  1P7I A;  3JRC A;  2B63 J;  1E3O C;  2OER A;  3JSJ A;  2TCT A;  2EQR A;  4FE7 A;  3IH2 A;  3JRG A;  2DJN A;  1U78 A;  3LOC A;  3GZI A;  3DCF A;  1B8I B;  1MH3 A;  1IG7 A;  3HB9 A;  4A3F J;  3ANG A;  3GBG A;  5BNG A;  2G3B A;  1RPW A;  5C4J J;  1JKR C;  1IRZ A;  2Q24 A;  2YVE A;  5J1U A;  2VKV A;  2QWT A;  2JA5 J;  1HOM A;  2X9D A;  2O7O A;  1IDY A;  1F43 A;  1VFC A;  3VOK A;  2EH3 A;  3BQZ A;  3TED A;  3EUP A;  1OCT C;  1IDZ A;  4A93 J;  2WGB A;  3OSF A;  2JN6 A;  5F04 A;  2DG8 A;  1I3Q J;  2Y9Z A;  2AHQ A;  1HF0 A;  5K58 A;  4EEF G;  3TP3 A;  1G2H A;  2YVH A;  4IHX A;  2E19 A;  4NEL A;  2JA6 J;  2L7M P;  5HSZ A;  2GFN A;  3O8G A;  3BG9 A;  2IU5 A;  4L5E A;  3NI7 A;  1O4X A;  2HDD A;  1OJL A;  3F0C A;  3OSG A;  1JJ8 C;  3HOW J;  3HTH A;  4D7N A;  3ON2 A;  3NAR A;  4GFK A;  3GTO J;  3ON4 A;  5FKN A;  1MNM C;  1JKP C;  4RDU A;  3W6V A;  5IP7 J;  2MW8 A;  4RBO A;  3IV5 A;  2GBY A;  5C4X J;  3VW1 A;  2YUS A;  3ZQC A;  3P9T A;  2HOA A;  2E1O A;  3EGQ A;  2E2H J;  2Y30 A;  3HE0 A;  2XRL A;  1P7J A;  3L1P A;  4ICH A;  3ZOB A;  5C44 J;  1W0T A;  4HNV A;  2IEK A;  5HOD A;  2L0K A;  2K9Q A;  3O8H A;  2PMZ N;  5E3N A;  1A5J A;  3S1R J;  3M4O J;  2QOP A;  2ID3 A;  1Z0X A;  4D5C A;  1Z77 A;  2G7G A;  4QIW N;  3TW7 A;  3S15 J;  3CDL A;  2R5Y A;  3UKG A;  5FKL A;  3LJL A;  1JTX A;  2CQX A;  2ZCN A;  3HTA A;  2ELK A;  2JA7 J;  5F0F A;  4LOC A;  3GTQ J;  1YRN B;  2NS7 A;  4AC0 A;  2F07 A;  1PUF B;  1TWA J;  3PPB A;  3E7Q A;  2KT0 A;  3HEF A;  2HQ5 A;  2AO9 A;  3I4M J;  1OCP A;  5CW8 A;  1D5Y A;  3BR2 A;  3BR3 A;  5EG0 A;  3FIW A;  1MSE C;  1IGN A;  2EZH A;  1DU6 A;  2DMQ A;  2RAE A;  1XS9 A;  3A01 A;  5EZH A;  3VP5 A;  5EYR A;  2O7T A;  3CQZ J;  4A3E J;  3V78 A;  4BBR J;  4BXX J;  4GFL A;  4KWA A;  4X6A J;  5EGO B;  2NVT J;  1EF4 A;  3HOX J;  4B4C A;  1QVU A;  4M3B A;  5E3L A;  1ITY A;  1JJ6 C;  3B6C A;  3BR0 A;  4I76 A;  5F0C A;  3FIS A;  1H8A C;  3HOU J;  4MO7 A;  2HYJ A;  3A03 A;  4HKU A;  3TW6 A;  1U9N A;  4MFD A;  3TP0 A;  1WH5 A;  3PO3 J;  1ENH A;  5GPC A;  4V2F A;  3Q3S A;  4JX5 A;  1ETW A;  4J19 A;  5M5W J;  3JRD A;  4B1R A;  1HDP A;  1TWG J;  3B81 A;  2LLK A;  2CQQ A;  5FKK A;  1MBH A;  4DYC A;  2LP0 A;  2Y2Z A;  3HTJ A;  5J1R A;  3DPJ A;  2OPT A;  2XB0 X;  3BR1 A;  5FLM J;  5FGL A;  3LHQ A;  1GUU A;  2L7Z A;  2Y31 A;  3CCY A;  2FQ4 A;  1GV5 A;  2CJJ A;  1X2N A;  4CGR A;  4UUT A;  4V2G A;  2M9H A;  2EZL A;  2FD5 A;  1JTY A;  1JKO C;  2EBI A;  3BRU A;  2QTQ A;  3HTI A;  4NN1 A;  4JX6 A;  1IC8 A;  4UUS A;  2XSD C;  3BG3 A;  1HCR A;  1ETQ A;  4JNN A;  2MGQ A;  5FLV A;  5EEA A;  1FTT A;  5E3O A;  5M5Y J;  2DA6 A;  4MIM A;  3BQY A;  5F1J A;  4W1U A;  2HYT A;  3O60 A;  3CJD A;  1MBE A;  1QVT A;  2DMN A;  2R5Z B;  3CWR A;  3VW2 A;  3RKQ A;  4IHW A;  2UXH A;  5F27 A;  2NP5 A;  5FMP A;  3HBL A;  1FIA A;  2XGC A;  1GV2 A;  3QQA A;  5EFY A;  1IV6 A;  3GTK J;  3S1M J;  3DEW A;  4I6Z A;  4FE4 A;  2NOG A;  3E7L A;  2XDN A;  2O8K A;  3S1N J;  1WCM J;  2K9S A;  3GEU A;  5GPA A;  4CYC B;  3H0G J;  3JRA A;  5F0H A;  2D5V A;  2EZK A;  1MBG A;  2NP3 A;  2H8R A;  3Q0V A;  1AKH B;  5IYC J;  2HOS A;  3QKX A;  2K40 A;  4BBS J;  4L62 A;  5HAW A;  2DA7 A;  4XIC A;  3ZQF A;  4A3G J;  1XG1 A;  2GM4 A;  1ETX A;  1JUS A;  3HOV J;  3VVZ A;  1GDT A;  1JT6 A;  3IUV A;  1RET A;  4FTH A;  5D1R A;  1POG A;  1U9O A;  3GTL J;  4XRS A;  2M2E A;  4XRS G;  4BKX A;  1ZK8 A;  2KDZ A;  4A3C J;  4X1E A;  5EF6 A;  1X2M A;  1RKW A;  1IUF A;  1VND A;  5DAJ A;  1ORK A;  1IJW C;  2R92 J;  1X58 A;  3HOZ J;  2UXU A;  1SAN A;  1VI0 A;  1FJL A;  2M34 A;  4UDS A;  5FKM A;  2R0Q C;  1HDD C;  1UI5 A;  4A3D J;  3A02 A;  3HKZ N;  2DG7 A;  1WH7 A;  3Q0W A;  4S0H B;  2HOT A;  1K61 A;  1K83 J;  2XGE A;  2ECB A;  1GVD A;  2JK3 A;  4NDL A;  5EDN A;  2COB A;  3S2D J;  4ACI A;  1QRY A;  5C4Y A;  2PBX A;  3FK7 A;  2JWT A;  1ETY A;  1ZGW A;  3IH3 A;  3KZ9 A;  1APL C;  5K7Z A;  3HDD A;  1ETK A;  3BHQ A;  2WUI A;  4GCT A;  2V57 A;  3S5R A;  2D6Y A;  1ZR2 A;  2TRT A;  1U8B A;  3KKD A;  2NVY J;  3S14 J;  3BG5 A;  3CRJ A;  3BTL A;  5H9T A;  2O9L A;  4A3B J;  3VVY A;  1B72 A;  1TWF J;  5D19 A;  2WB1 N;  1RR7 A;  3ZQI A;  1WPK A;  4JKZ A;  3JRH A;  1RES A;  1ETV A;  3BTC A;  4JX4 A;  3D1N I;  1NK2 P;  1QPI A;  3NRG A;  3SDG A;  3FRQ A;  1LFB A;  2FX0 A;  3JRE A;  2JMW A;  1ZKG A;  2QIB A;  1UG2 A;  3ZQG A;  4AUX A;  5IOY A;  3QPS A;  1Y1V J;  2P81 A;  2VPR A;  3OOU A;  1B8I A;  3AQS A;  2LVS A;  5F08 A;  1DU0 A;  1I6H J;  2VI6 A;  2LKX A;  3BCG A;  2UXP A;  3F1B A;  5IPA A;  1WGX A;  1FTZ A;  2VUM J;  3G1L A;  4D5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...