5F2PA

Crystal structure of the brd9 bromodomain in complex with compound 3.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRD9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f2pA00
5EICA 4RVRA 4QSQA 3JVKA 5I88A 5HFQA 4TT6A 3JVMA 5FB0A 3SVGA 3QZVA 4C66A 4YYIA 5CY9A 4A9IA 5IG6A 4Z1QA 4O7FA 3O33A 2G4AA 5EWWA 3S92A 5L8TA 4LR6A 4QBMA 5C85A 4YBSA 5H1UA 5JWMA 5E9LA 5CQ4A 2GRCA 5D7XA 4NS5A 4BW2A 5I80A 5DY7A 5LKZA 4OGIA 3K2JA 4TYLA 5D3TA 5G4RA 4TZ2A 4QY4A 4CUQA 2YQDA 5L99A 5A5SA 5EPSA 3DAIA 1N72A 2DVSA 4QZSA 4NR4A 5DYUA 4HXPA 4MR4A 2WP2A 4Z6IA 4HXLA 5AD2A 4QR3A 5L96A 4QC1A 4XYAA 4A9HA 3U5MA 2R0YA 5KHMA 3HMEA 4J0SA 2YYNA 4CUPA 2WP1A 2OO1A 4HBXA 4XUAA 5ENBA 5CZGA 4NR9A 4CURA 5F25A 4PCEA 2RNXA 1WUMA 2DVRA 3SVHA 2LSPB 4YH3A 4UYGA 3U5OA 4MENA 3DWYA 4F3IA 4YYKA 3JVLA 3RCWA 5II2A 3TLPA 4MR5A 5C4QA 3O34A 4Q0OA 5EP7A 5FG6A 5HENA 5KTUA 2DVVA 5FFYA 2E7OA 4KV4A 5AD3A 2H60A 1X0JA 4QB3A 4UIZA 4O70A 4YC9A 5BT5A 5DFDA 5ETDA 4MR3A 4O7AA 5FFVA 3P1CA 5DKDA 3U5PA 5DKCA 5I86A 5DFBA 3Q2EA 5LUUA 5A81A 5A5PA 5E9IA 5LKUA 5EWVA 5A5QA 5E9VA 5D3PA 4YATA 3I3JA 3UV2A 3UW9A 2E7NA 5FE9A 5HQ6A 5CUGA 3LQJA 4YADA 4LC2A 5A5OA 2RI7A 4X2IA 5EPBA 4BW4A 3LJWA 4NYWA 4YYGA 5F1LA 3MUKA 5EI4A 5E9MA 4QEWA 4A9OA 4YK0A 4LRGA 4A9LA 4ZC9A 4LZSA 3MB3A 5LJ0A 5FE2A 4NRBA 5FFWA 4IORA 4NUDA 3P1DA 3D7CA 3O37A 5CUAA 5DX4A 4WHUA 4BJXA 5IGKA 4UIUA 4J0RA 4TZ8A 5DKHA 5EM3A 4QSPA 4CUSA 5FG4A 5HEMA 4HXNA 5C8GA 5L8UA 3UVDA 4A9KA 3U5JA 4A9NA 2RO1A 4QSVA 1EQFA 5EWCA 5JI8A 5CU8A 4IR4A 5KO4A 4MEPA 4XY9A 5HFRA 5F62A 4QYLA 3SVFA 5FE5A 2DVQA 4NR5A 3NXBA 4HBYA 4NRAA 5G4SA 5BT3A 5ENEA 2OUOA 5E3DA 5LVQA 4KCXA 4IOOA 4TT4A 5FE3A 4QSWA 3U5LA 2MJVB 2RS9B 5I7XA 5IGLA 4GPJA 4N4IA 4PKLA 5II1A 2RNWA 5EV9A 5I29A 5CP5A 5CQ5A 1ZS5A 2KTBB 4QR4A 5EQ1A 4XY8A 5TCMA 5EGUA 2RNYA 3IU5A 5I7YA 2N9GA 4O76A 4QSRA 5EWHA 2E3KA 4BW1A 5J0DA 4UIWA 4MR6A 4OUFA 4UITA 4QSSA 4O7BA 2L5EA 4LYSA 5CFWA 4ALGA 5FH6A 4LZ2A 4QEVA 4WIVA 5ENCA 3U5KA 5CQ6A 4O71A 5F36A 3G0JA 4OGJA 4A9MA 4LYIA 5I1QA 1JM4B 4LZRA 5HJCA 4N4GA 4NUCA 5DFCA 4UYDA 4NYVA 4UYEA 5D3SA 5A7CA 5KTWA 2RFJA 3MULA 5E73A 5F5ZA 4IR6A 5D3JA 4YYDA 5F60A 5TB6A 4PS5A 4AKNA 5D0CA 3UVXA 5CRMA 5CRZA 5DLZA 5ENFA 4CUUA 5E9YA 5CQTA 4YBTA 5ENIA 5DW2A 2DKWA 4N3WA 4O77A 5LJ1A 2D82A 4QUTA 5A82A 5ACYA 4HXKA 5F2PA 5DYAA 4NR6A 2OSSA 5FE6A 5EK9A 5ENGA 5CQ8A 5HQ7A 4UIYA 3FKMX 4QEUA 4QSTA 5HRXA 1F68A 2YW5A 5CTLA 4TT2A 5I40A 3O36A 5D24A 4O75A 4PTBA 5A83A 4UIXA 5IGMA 3ZYUA 4NYXA 5D26A 2R0VA 4UYFA 4QYDA 5H85A 2L84A 2R10A 4HBWA 2F6NA 5HLSA 5C87A 5HM0A 4A9FA 2F6JA 4IR5A 5H1TA 3Q2FA 5FB1A 5LKTA 4YH4A 3GG3A 5EPRA 5DBMA 4UIVA 3UV5A 4HXOA 5D25A 4QSXA 5C7NA 4NR8A 5E3GA 5C89A 3UV4A 4C67A 2FSAA 4NRCA 5ENJA 1E6IA 2YDWA 2NXBA 5F1HA 5FG5A 4O7EA 5CUCA 2YEKA 1JSPB 5FH7A 5F3AA 5EISA 5LKXA 4NR7A 4J3IA 5CQ7A 3JVJA 4TQNA 4KV1A 4QNSA 5L97A 5HCLA 3UVYA 5IBNA 5CS8A 4BHWA 4A9EA 4CUTA 4UYFB 4HXSA 5FH8A 5A5RA 5E0RA 5D3NA 5IIDA 4TS8A 4Q0NA 5CQAA 4DONA 4N4HA 2YELA 4HXMA 5K29A 4O74A 5CUBA 5F61A 4HBVA 4O72A 5H1VA 4QUUA 4XUBA 4Z6HA 4NUEA 4TU6A 5LJ2A 5DW1A 3P5OA 4CL9A 4BW3A 2D9EA 3MXFA 5HELA 4ALHA 4A9JA 3AADA 3P1EA 5D3HA 5ETBA 5DYCA 3O35A 4YYHA 2I7KA 5CUDA 5A5NA 3LQIA 4QC3A 4NXJA 4QR5A 3G0LA 4J1PA 4CLBA 4YYJA 3MB4A 2YEMA 3S91A 5CQ3A 5EA1A 3QZTA 2DWWA 5FE0A 4IOQA 2R0SA 4QSUA 5EVAA 4CFKA 4YYMA 3ONIA 5E7DA 4MEQA 5IGNA 3IU6A 4O7CA 4LYWA 4ZW1A 3AQAA 4Z93A 5EWDA 5DYXA 4Y03A 4WHWA 5LVRA 5CPEA 4Z1SA 4E96A 4PY6A 4YAXA 5E74A 5COIA 4NQMA 4O78A 5D3LA 5FE1A 5E9KA 5HRVA 2L85A 5D3RA 5KU3A 5AMEA 4MEOA 3LXJA 5I89A 4YBMA 5AMFA 5HQ5A 4LDFA 4NQNA 3HMFA 3UVWA 5ENHA 4TTEA 5CUEA 4FLPA 2DATA 2I8NA 4YY4A 5FE8A 5I83A 4HXRA 3QZSA 3HMHA 4PCIA 4UYHA 5F63A 3U5NA 4IR3A 5HRWA 4CFLA 5FBXA 5BT4A 3MQMA 3LQHA 5FDZA 5FE4A 5EU1A 5L98A 4YABA 4YY6A 4ZQLA 4YYNA 5FE7A 4TU4A 3P1FA 5A85A 5CGPA 5KTXA 4N4FA 1WUGA 5DLXA
chains in the Genus database with same CATH superfamily
5EICA 4RVRA 4QSQA 3JVKA 5I88A 5HFQA 4TT6A 3JVMA 5FB0A 3SVGA 3QZVA 4C66A 4YYIA 2EJNA 5CY9A 4A9IA 5IG6A 4Z1QA 4O7FA 3O33A 2G4AA 5EWWA 3S92A 5L8TA 4LR6A 4QBMA 5C85A 4YBSA 5H1UA 5JWMA 5E9LA 5CQ4A 2GRCA 5D7XA 4NS5A 4BW2A 5I80A 5DY7A 5LKZA 4OGIA 3K2JA 4TYLA 4AKGA 5D3TA 5G4RA 4TZ2A 4QY4A 4CUQA 2YQDA 5L99A 5A5SA 5EPSA 3DAIA 1N72A 2DVSA 4QZSA 4NR4A 5DYUA 4HXPA 4MR4A 2WP2A 4Z6IA 4HXLA 5AD2A 4QR3A 5L96A 4QC1A 4XYAA 4A9HA 3U5MA 2R0YA 5KHMA 3HMEA 4J0SA 2YYNA 4CUPA 2WP1A 2OO1A 4HBXA 4XUAA 5ENBA 5CZGA 4NR9A 4CURA 5F25A 4PCEA 2RNXA 1WUMA 2DVRA 3SVHA 2LSPB 4YH3A 4UYGA 3U5OA 4MENA 1ZKRA 3DWYA 4F3IA 4YYKA 3JVLA 3RCWA 5II2A 3TLPA 4MR5A 5C4QA 3O34A 4Q0OA 5EP7A 5FG6A 5HENA 5KTUA 2DVVA 5FFYA 2E7OA 4KV4A 5AD3A 2H60A 1X0JA 4QB3A 4UIZA 4O70A 4YC9A 5BT5A 5DFDA 5ETDA 4MR3A 4O7AA 5FFVA 3P1CA 5DKDA 3U5PA 5DKCA 5I86A 5DFBA 3Q2EA 5LUUA 5A81A 5A5PA 5E9IA 5LKUA 5EWVA 5A5QA 5E9VA 5D3PA 4YATA 3I3JA 3UV2A 3UW9A 2E7NA 5FE9A 5HQ6A 5CUGA 3LQJA 4YADA 4LC2A 5A5OA 2RI7A 4X2IA 5EPBA 4BW4A 3LJWA 4NYWA 4YYGA 5F1LA 3MUKA 5EI4A 5E9MA 4QEWA 4A9OA 4YK0A 4LRGA 4A9LA 4ZC9A 4LZSA 3MB3A 5LJ0A 5FE2A 4NRBA 5FFWA 4IORA 4NUDA 3P1DA 3D7CA 3O37A 5CUAA 5DX4A 4WHUA 4BJXA 5IGKA 4UIUA 4J0RA 4TZ8A 5DKHA 5EM3A 4QSPA 4CUSA 5FG4A 5HEMA 4HXNA 5C8GA 5L8UA 3UVDA 4A9KA 3U5JA 4A9NA 2RO1A 4QSVA 1EQFA 5EWCA 5JI8A 5CU8A 4IR4A 5KO4A 4MEPA 4XY9A 5HFRA 5F62A 4QYLA 3SVFA 5FE5A 2DVQA 4NR5A 3NXBA 4HBYA 4AI6A 4NRAA 5G4SA 4AKIA 5BT3A 5ENEA 2OUOA 5E3DA 5LVQA 4KCXA 4IOOA 4TT4A 3D1BA 5FE3A 4QSWA 3U5LA 2MJVB 2RS9B 5I7XA 5IGLA 4GPJA 4N4IA 4PKLA 5II1A 2RNWA 5EV9A 5I29A 5CP5A 5CQ5A 3VKHA 1ZS5A 2KTBB 4QR4A 5EQ1A 4XY8A 5TCMA 5EGUA 2RNYA 3IU5A 5I7YA 2N9GA 4O76A 4QSRA 5EWHA 2E3KA 4BW1A 5J0DA 4UIWA 4MR6A 4AKHA 4OUFA 4UITA 4QSSA 4O7BA 2L5EA 4LYSA 5CFWA 4ALGA 5FH6A 4LZ2A 4QEVA 4WIVA 5ENCA 3U5KA 5CQ6A 4O71A 5F36A 3G0JA 4OGJA 4A9MA 4LYIA 5I1QA 1JM4B 4LZRA 5HJCA 4N4GA 4NUCA 5DFCA 4UYDA 4NYVA 4UYEA 5D3SA 5A7CA 5KTWA 2RFJA 3MULA 5E73A 5F5ZA 4IR6A 5D3JA 4YYDA 5F60A 5TB6A 4PS5A 4AKNA 5D0CA 3UVXA 5CRMA 5CRZA 5DLZA 5ENFA 4CUUA 5E9YA 5CQTA 4YBTA 5ENIA 5DW2A 2DKWA 4N3WA 4O77A 5LJ1A 2D82A 4QUTA 5A82A 5ACYA 4HXKA 5F2PA 5DYAA 4NR6A 2OSSA 5FE6A 5EK9A 5ENGA 5CQ8A 5HQ7A 4UIYA 3FKMX 4QEUA 4QSTA 5HRXA 1F68A 2YW5A 5CTLA 4TT2A 5I40A 3O36A 5D24A 4O75A 4PTBA 5A83A 4UIXA 5IGMA 3ZYUA 4NYXA 5D26A 2R0VA 4UYFA 4QYDA 5H85A 2L84A 2R10A 4HBWA 2F6NA 5HLSA 5C87A 3ERRA 5HM0A 4A9FA 2F6JA 4IR5A 5H1TA 3Q2FA 5FB1A 5LKTA 4YH4A 3GG3A 5EPRA 4UIVA 5DBMA 3UV5A 4HXOA 5D25A 4QSXA 5C7NA 4NR8A 5E3GA 5C89A 3UV4A 4C67A 2FSAA 4NRCA 5ENJA 1E6IA 2YDWA 2NXBA 5F1HA 5FG5A 4O7EA 5CUCA 2YEKA 1JSPB 5FH7A 5F3AA 5EISA 5LKXA 3VKGA 4NR7A 4J3IA 5CQ7A 3JVJA 4TQNA 4KV1A 4QNSA 5L97A 5HCLA 3UVYA 5IBNA 5CS8A 4BHWA 4A9EA 4CUTA 4UYFB 4HXSA 5FH8A 5A5RA 5E0RA 5D3NA 5IIDA 4TS8A 4Q0NA 5CQAA 4DONA 4N4HA 2YELA 4HXMA 5K29A 4O74A 3D1DA 5CUBA 5F61A 4HBVA 4O72A 5H1VA 4QUUA 4XUBA 1PUOA 4Z6HA 4NUEA 4TU6A 5LJ2A 5DW1A 3P5OA 4CL9A 4BW3A 2D9EA 3MXFA 5HELA 4ALHA 4A9JA 3AADA 3P1EA 5D3HA 5ETBA 5DYCA 3O35A 4YYHA 2I7KA 5CUDA 5A5NA 3LQIA 4QC3A 4NXJA 4QR5A 3G0LA 4J1PA 4CLBA 4YYJA 3MB4A 2YEMA 3S91A 5CQ3A 5EA1A 3QZTA 2DWWA 5FE0A 4IOQA 2R0SA 4QSUA 5EVAA 4CFKA 4YYMA 3ONIA 5E7DA 4MEQA 5IGNA 3IU6A 4O7CA 4LYWA 4ZW1A 3AQAA 4Z93A 5EWDA 5DYXA 4Y03A 4WHWA 5LVRA 5CPEA 4Z1SA 4E96A 4PY6A 4YAXA 5E74A 5COIA 4NQMA 4O78A 5D3LA 5FE1A 5E9KA 5HRVA 2L85A 5D3RA 5KU3A 5AMEA 4MEOA 3LXJA 5I89A 4YBMA 5AMFA 5HQ5A 4LDFA 4NQNA 3HMFA 3UVWA 5ENHA 4TTEA 5CUEA 4FLPA 2DATA 2I8NA 4YY4A 5FE8A 5I83A 4HXRA 3QZSA 3HMHA 4PCIA 4UYHA 5F63A 3U5NA 4IR3A 5HRWA 4CFLA 5FBXA 5BT4A 3MQMA 3LQHA 5FDZA 5FE4A 5EU1A 5L98A 4YABA 4YY6A 4ZQLA 4YYNA 5FE7A 4TU4A 3P1FA 5A85A 5CGPA 5KTXA 4N4FA 1WUGA 5DLXA
chains in the Genus database with same CATH topology
5EICA 4RVRA 4QSQA 3JVKA 5I88A 5HFQA 4TT6A 3JVMA 5FB0A 3SVGA 3QZVA 4C66A 4YYIA 5CY9A 4A9IA 5IG6A 4Z1QA 4O7FA 3O33A 2G4AA 5EWWA 3S92A 5L8TA 4LR6A 4QBMA 5C85A 4YBSA 5H1UA 5JWMA 5E9LA 5CQ4A 2GRCA 5D7XA 4NS5A 4BW2A 5I80A 5DY7A 5LKZA 4OGIA 3K2JA 4TYLA 5D3TA 5G4RA 4TZ2A 4QY4A 4CUQA 2YQDA 5L99A 5A5SA 5EPSA 3DAIA 1N72A 2DVSA 4QZSA 4NR4A 5DYUA 4HXPA 4MR4A 2WP2A 4Z6IA 4HXLA 5AD2A 4QR3A 5L96A 4QC1A 4XYAA 4A9HA 3U5MA 2R0YA 5KHMA 3HMEA 4J0SA 2YYNA 4CUPA 2WP1A 2OO1A 4HBXA 4XUAA 5ENBA 5CZGA 4NR9A 4CURA 5F25A 4PCEA 2RNXA 1WUMA 2DVRA 3SVHA 2LSPB 4YH3A 4UYGA 3U5OA 4MENA 3DWYA 4F3IA 4YYKA 3JVLA 3RCWA 5II2A 3TLPA 4MR5A 5C4QA 3O34A 4Q0OA 5EP7A 5FG6A 5HENA 5KTUA 2DVVA 5FFYA 2E7OA 4KV4A 5AD3A 2H60A 1X0JA 4QB3A 4UIZA 4O70A 4YC9A 5BT5A 5DFDA 5ETDA 4MR3A 4O7AA 5FFVA 3P1CA 5DKDA 3U5PA 5DKCA 5I86A 5DFBA 3Q2EA 5LUUA 5A81A 5A5PA 5E9IA 5LKUA 5EWVA 5A5QA 5E9VA 5D3PA 4YATA 3I3JA 3UV2A 3UW9A 2E7NA 5FE9A 5HQ6A 5CUGA 3LQJA 4YADA 4LC2A 5A5OA 2RI7A 4X2IA 5EPBA 4BW4A 3LJWA 4NYWA 4YYGA 5F1LA 3MUKA 5EI4A 5E9MA 4QEWA 4A9OA 4YK0A 4LRGA 4A9LA 4ZC9A 4LZSA 3MB3A 5LJ0A 5FE2A 4NRBA 5FFWA 4IORA 4NUDA 3P1DA 3D7CA 3O37A 5CUAA 5DX4A 4WHUA 4BJXA 5IGKA 4UIUA 4J0RA 4TZ8A 5DKHA 5EM3A 4QSPA 4CUSA 5FG4A 5HEMA 4HXNA 5C8GA 5L8UA 3UVDA 4A9KA 3U5JA 4A9NA 2RO1A 4QSVA 1EQFA 5EWCA 5JI8A 5CU8A 4IR4A 5KO4A 4MEPA 4XY9A 5HFRA 5F62A 4QYLA 3SVFA 5FE5A 2DVQA 4NR5A 3NXBA 4HBYA 4NRAA 5G4SA 5BT3A 5ENEA 2OUOA 5E3DA 5LVQA 4KCXA 4IOOA 4TT4A 5FE3A 4QSWA 3U5LA 2MJVB 2RS9B 5I7XA 5IGLA 4GPJA 4N4IA 4PKLA 5II1A 2RNWA 5EV9A 5I29A 5CP5A 5CQ5A 1ZS5A 2KTBB 4QR4A 5EQ1A 4XY8A 5TCMA 5EGUA 2RNYA 3IU5A 5I7YA 2N9GA 4O76A 4QSRA 5EWHA 2E3KA 4BW1A 5J0DA 4UIWA 4MR6A 4OUFA 4UITA 4QSSA 4O7BA 2L5EA 4LYSA 5CFWA 4ALGA 5FH6A 4LZ2A 4QEVA 4WIVA 5ENCA 3U5KA 5CQ6A 4O71A 5F36A 3G0JA 4OGJA 4A9MA 4LYIA 5I1QA 1JM4B 4LZRA 5HJCA 4N4GA 4NUCA 5DFCA 4UYDA 4NYVA 4UYEA 5D3SA 5A7CA 5KTWA 2RFJA 3MULA 5E73A 5F5ZA 4IR6A 5D3JA 4YYDA 5F60A 5TB6A 4PS5A 4AKNA 5D0CA 3UVXA 5CRMA 5CRZA 5DLZA 5ENFA 4CUUA 5E9YA 5CQTA 4YBTA 5ENIA 5DW2A 2DKWA 4N3WA 4O77A 5LJ1A 2D82A 4QUTA 5A82A 5ACYA 4HXKA 5F2PA 5DYAA 4NR6A 2OSSA 5FE6A 5EK9A 5ENGA 5CQ8A 5HQ7A 4UIYA 3FKMX 4QEUA 4QSTA 5HRXA 1F68A 2YW5A 5CTLA 4TT2A 5I40A 3O36A 5D24A 4O75A 4PTBA 5A83A 4UIXA 5IGMA 3ZYUA 4NYXA 5D26A 2R0VA 4UYFA 4QYDA 5H85A 2L84A 2R10A 4HBWA 2F6NA 5HLSA 5C87A 5HM0A 4A9FA 2F6JA 4IR5A 5H1TA 3Q2FA 5FB1A 5LKTA 4YH4A 3GG3A 5EPRA 5DBMA 4UIVA 3UV5A 4HXOA 5D25A 4QSXA 5C7NA 4NR8A 5E3GA 5C89A 3UV4A 4C67A 2FSAA 4NRCA 5ENJA 1E6IA 2YDWA 2NXBA 5F1HA 5FG5A 4O7EA 5CUCA 2YEKA 1JSPB 5FH7A 5F3AA 5EISA 5LKXA 4NR7A 4J3IA 5CQ7A 3JVJA 4TQNA 4KV1A 4QNSA 5L97A 5HCLA 3UVYA 5IBNA 5CS8A 4BHWA 4A9EA 4CUTA 4UYFB 4HXSA 5FH8A 5A5RA 5E0RA 5D3NA 5IIDA 4TS8A 4Q0NA 5CQAA 4DONA 4N4HA 2YELA 4HXMA 5K29A 4O74A 5CUBA 5F61A 4HBVA 4O72A 5H1VA 4QUUA 4XUBA 4Z6HA 4NUEA 4TU6A 5LJ2A 5DW1A 3P5OA 4CL9A 4BW3A 2D9EA 3MXFA 5HELA 4ALHA 4A9JA 3AADA 3P1EA 5D3HA 5ETBA 5DYCA 3O35A 4YYHA 2I7KA 5CUDA 5A5NA 3LQIA 4QC3A 4NXJA 4QR5A 3G0LA 4J1PA 4CLBA 4YYJA 3MB4A 2YEMA 3S91A 5CQ3A 5EA1A 3QZTA 2DWWA 5FE0A 4IOQA 2R0SA 4QSUA 5EVAA 4CFKA 4YYMA 3ONIA 5E7DA 4MEQA 5IGNA 3IU6A 4O7CA 4LYWA 4ZW1A 3AQAA 4Z93A 5EWDA 5DYXA 4Y03A 4WHWA 5LVRA 5CPEA 4Z1SA 4E96A 4PY6A 4YAXA 5E74A 5COIA 4NQMA 4O78A 5D3LA 5FE1A 5E9KA 5HRVA 2L85A 5D3RA 5KU3A 5AMEA 4MEOA 3LXJA 5I89A 4YBMA 5AMFA 5HQ5A 4LDFA 4NQNA 3HMFA 3UVWA 5ENHA 4TTEA 5CUEA 4FLPA 2DATA 2I8NA 4YY4A 5FE8A 5I83A 4HXRA 3QZSA 3HMHA 4PCIA 4UYHA 5F63A 3U5NA 4IR3A 5HRWA 4CFLA 5FBXA 5BT4A 3MQMA 3LQHA 5FDZA 5FE4A 5EU1A 5L98A 4YABA 4YY6A 4ZQLA 4YYNA 5FE7A 4TU4A 3P1FA 5A85A 5CGPA 5KTXA 4N4FA 1WUGA 5DLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EIC A;  4RVR A;  4QSQ A;  3JVK A;  5I88 A;  5HFQ A;  4TT6 A;  3JVM A;  5FB0 A;  3SVG A;  3QZV A;  4C66 A;  4YYI A;  5CY9 A;  4A9I A;  5IG6 A;  4Z1Q A;  4O7F A;  3O33 A;  2G4A A;  5EWW A;  3S92 A;  5L8T A;  4LR6 A;  4QBM A;  5C85 A;  4YBS A;  5H1U A;  5JWM A;  5E9L A;  5CQ4 A;  2GRC A;  5D7X A;  4NS5 A;  4BW2 A;  5I80 A;  5DY7 A;  5LKZ A;  4OGI A;  3K2J A;  4TYL A;  5D3T A;  5G4R A;  4TZ2 A;  4QY4 A;  4CUQ A;  2YQD A;  5L99 A;  5A5S A;  5EPS A;  3DAI A;  1N72 A;  2DVS A;  4QZS A;  4NR4 A;  5DYU A;  4HXP A;  4MR4 A;  2WP2 A;  4Z6I A;  4HXL A;  5AD2 A;  4QR3 A;  5L96 A;  4QC1 A;  4XYA A;  4A9H A;  3U5M A;  2R0Y A;  5KHM A;  3HME A;  4J0S A;  2YYN A;  4CUP A;  2WP1 A;  2OO1 A;  4HBX A;  4XUA A;  5ENB A;  5CZG A;  4NR9 A;  4CUR A;  5F25 A;  4PCE A;  2RNX A;  1WUM A;  2DVR A;  3SVH A;  2LSP B;  4YH3 A;  4UYG A;  3U5O A;  4MEN A;  3DWY A;  4F3I A;  4YYK A;  3JVL A;  3RCW A;  5II2 A;  3TLP A;  4MR5 A;  5C4Q A;  3O34 A;  4Q0O A;  5EP7 A;  5FG6 A;  5HEN A;  5KTU A;  2DVV A;  5FFY A;  2E7O A;  4KV4 A;  5AD3 A;  2H60 A;  1X0J A;  4QB3 A;  4UIZ A;  4O70 A;  4YC9 A;  5BT5 A;  5DFD A;  5ETD A;  4MR3 A;  4O7A A;  5FFV A;  3P1C A;  5DKD A;  3U5P A;  5DKC A;  5I86 A;  5DFB A;  3Q2E A;  5LUU A;  5A81 A;  5A5P A;  5E9I A;  5LKU A;  5EWV A;  5A5Q A;  5E9V A;  5D3P A;  4YAT A;  3I3J A;  3UV2 A;  3UW9 A;  2E7N A;  5FE9 A;  5HQ6 A;  5CUG A;  3LQJ A;  4YAD A;  4LC2 A;  5A5O A;  2RI7 A;  4X2I A;  5EPB A;  4BW4 A;  3LJW A;  4NYW A;  4YYG A;  5F1L A;  3MUK A;  5EI4 A;  5E9M A;  4QEW A;  4A9O A;  4YK0 A;  4LRG A;  4A9L A;  4ZC9 A;  4LZS A;  3MB3 A;  5LJ0 A;  5FE2 A;  4NRB A;  5FFW A;  4IOR A;  4NUD A;  3P1D A;  3D7C A;  3O37 A;  5CUA A;  5DX4 A;  4WHU A;  4BJX A;  5IGK A;  4UIU A;  4J0R A;  4TZ8 A;  5DKH A;  5EM3 A;  4QSP A;  4CUS A;  5FG4 A;  5HEM A;  4HXN A;  5C8G A;  5L8U A;  3UVD A;  4A9K A;  3U5J A;  4A9N A;  2RO1 A;  4QSV A;  1EQF A;  5EWC A;  5JI8 A;  5CU8 A;  4IR4 A;  5KO4 A;  4MEP A;  4XY9 A;  5HFR A;  5F62 A;  4QYL A;  3SVF A;  5FE5 A;  2DVQ A;  4NR5 A;  3NXB A;  4HBY A;  4NRA A;  5G4S A;  5BT3 A;  5ENE A;  2OUO A;  5E3D A;  5LVQ A;  4KCX A;  4IOO A;  4TT4 A;  5FE3 A;  4QSW A;  3U5L A;  2MJV B;  2RS9 B;  5I7X A;  5IGL A;  4GPJ A;  4N4I A;  4PKL A;  5II1 A;  2RNW A;  5EV9 A;  5I29 A;  5CP5 A;  5CQ5 A;  1ZS5 A;  2KTB B;  4QR4 A;  5EQ1 A;  4XY8 A;  5TCM A;  5EGU A;  2RNY A;  3IU5 A;  5I7Y A;  2N9G A;  4O76 A;  4QSR A;  5EWH A;  2E3K A;  4BW1 A;  5J0D A;  4UIW A;  4MR6 A;  4OUF A;  4UIT A;  4QSS A;  4O7B A;  2L5E A;  4LYS A;  5CFW A;  4ALG A;  5FH6 A;  4LZ2 A;  4QEV A;  4WIV A;  5ENC A;  3U5K A;  5CQ6 A;  4O71 A;  5F36 A;  3G0J A;  4OGJ A;  4A9M A;  4LYI A;  5I1Q A;  1JM4 B;  4LZR A;  5HJC A;  4N4G A;  4NUC A;  5DFC A;  4UYD A;  4NYV A;  4UYE A;  5D3S A;  5A7C A;  5KTW A;  2RFJ A;  3MUL A;  5E73 A;  5F5Z A;  4IR6 A;  5D3J A;  4YYD A;  5F60 A;  5TB6 A;  4PS5 A;  4AKN A;  5D0C A;  3UVX A;  5CRM A;  5CRZ A;  5DLZ A;  5ENF A;  4CUU A;  5E9Y A;  5CQT A;  4YBT A;  5ENI A;  5DW2 A;  2DKW A;  4N3W A;  4O77 A;  5LJ1 A;  2D82 A;  4QUT A;  5A82 A;  5ACY A;  4HXK A;  5F2P A;  5DYA A;  4NR6 A;  2OSS A;  5FE6 A;  5EK9 A;  5ENG A;  5CQ8 A;  5HQ7 A;  4UIY A;  3FKM X;  4QEU A;  4QST A;  5HRX A;  1F68 A;  2YW5 A;  5CTL A;  4TT2 A;  5I40 A;  3O36 A;  5D24 A;  4O75 A;  4PTB A;  5A83 A;  4UIX A;  5IGM A;  3ZYU A;  4NYX A;  5D26 A;  2R0V A;  4UYF A;  4QYD A;  5H85 A;  2L84 A;  2R10 A;  4HBW A;  2F6N A;  5HLS A;  5C87 A;  5HM0 A;  4A9F A;  2F6J A;  4IR5 A;  5H1T A;  3Q2F A;  5FB1 A;  5LKT A;  4YH4 A;  3GG3 A;  5EPR A;  5DBM A;  4UIV A;  3UV5 A;  4HXO A;  5D25 A;  4QSX A;  5C7N A;  4NR8 A;  5E3G A;  5C89 A;  3UV4 A;  4C67 A;  2FSA A;  4NRC A;  5ENJ A;  1E6I A;  2YDW A;  2NXB A;  5F1H A;  5FG5 A;  4O7E A;  5CUC A;  2YEK A;  1JSP B;  5FH7 A;  5F3A A;  5EIS A;  5LKX A;  4NR7 A;  4J3I A;  5CQ7 A;  3JVJ A;  4TQN A;  4KV1 A;  4QNS A;  5L97 A;  5HCL A;  3UVY A;  5IBN A;  5CS8 A;  4BHW A;  4A9E A;  4CUT A;  4UYF B;  4HXS A;  5FH8 A;  5A5R A;  5E0R A;  5D3N A;  5IID A;  4TS8 A;  4Q0N A;  5CQA A;  4DON A;  4N4H A;  2YEL A;  4HXM A;  5K29 A;  4O74 A;  5CUB A;  5F61 A;  4HBV A;  4O72 A;  5H1V A;  4QUU A;  4XUB A;  4Z6H A;  4NUE A;  4TU6 A;  5LJ2 A;  5DW1 A;  3P5O A;  4CL9 A;  4BW3 A;  2D9E A;  3MXF A;  5HEL A;  4ALH A;  4A9J A;  3AAD A;  3P1E A;  5D3H A;  5ETB A;  5DYC A;  3O35 A;  4YYH A;  2I7K A;  5CUD A;  5A5N A;  3LQI A;  4QC3 A;  4NXJ A;  4QR5 A;  3G0L A;  4J1P A;  4CLB A;  4YYJ A;  3MB4 A;  2YEM A;  3S91 A;  5CQ3 A;  5EA1 A;  3QZT A;  2DWW A;  5FE0 A;  4IOQ A;  2R0S A;  4QSU A;  5EVA A;  4CFK A;  4YYM A;  3ONI A;  5E7D A;  4MEQ A;  5IGN A;  3IU6 A;  4O7C A;  4LYW A;  4ZW1 A;  3AQA A;  4Z93 A;  5EWD A;  5DYX A;  4Y03 A;  4WHW A;  5LVR A;  5CPE A;  4Z1S A;  4E96 A;  4PY6 A;  4YAX A;  5E74 A;  5COI A;  4NQM A;  4O78 A;  5D3L A;  5FE1 A;  5E9K A;  5HRV A;  2L85 A;  5D3R A;  5KU3 A;  5AME A;  4MEO A;  3LXJ A;  5I89 A;  4YBM A;  5AMF A;  5HQ5 A;  4LDF A;  4NQN A;  3HMF A;  3UVW A;  5ENH A;  4TTE A;  5CUE A;  4FLP A;  2DAT A;  2I8N A;  4YY4 A;  5FE8 A;  5I83 A;  4HXR A;  3QZS A;  3HMH A;  4PCI A;  4UYH A;  5F63 A;  3U5N A;  4IR3 A;  5HRW A;  4CFL A;  5FBX A;  5BT4 A;  3MQM A;  3LQH A;  5FDZ A;  5FE4 A;  5EU1 A;  5L98 A;  4YAB A;  4YY6 A;  4ZQL A;  4YYN A;  5FE7 A;  4TU4 A;  3P1F A;  5A85 A;  5CGP A;  5KTX A;  4N4F A;  1WUG A;  5DLX A; 
#chains in the Genus database with same CATH topology
 5EIC A;  4RVR A;  4QSQ A;  3JVK A;  5I88 A;  5HFQ A;  4TT6 A;  3JVM A;  5FB0 A;  3SVG A;  3QZV A;  4C66 A;  4YYI A;  2EJN A;  5CY9 A;  4A9I A;  5IG6 A;  4Z1Q A;  4O7F A;  3O33 A;  2G4A A;  5EWW A;  3S92 A;  5L8T A;  4LR6 A;  4QBM A;  5C85 A;  4YBS A;  5H1U A;  5JWM A;  5E9L A;  5CQ4 A;  2GRC A;  5D7X A;  4NS5 A;  4BW2 A;  5I80 A;  5DY7 A;  5LKZ A;  4OGI A;  3K2J A;  4TYL A;  4AKG A;  5D3T A;  5G4R A;  4TZ2 A;  4QY4 A;  4CUQ A;  2YQD A;  5L99 A;  5A5S A;  5EPS A;  3DAI A;  1N72 A;  2DVS A;  4QZS A;  4NR4 A;  5DYU A;  4HXP A;  4MR4 A;  2WP2 A;  4Z6I A;  4HXL A;  5AD2 A;  4QR3 A;  5L96 A;  4QC1 A;  4XYA A;  4A9H A;  3U5M A;  2R0Y A;  5KHM A;  3HME A;  4J0S A;  2YYN A;  4CUP A;  2WP1 A;  2OO1 A;  4HBX A;  4XUA A;  5ENB A;  5CZG A;  4NR9 A;  4CUR A;  5F25 A;  4PCE A;  2RNX A;  1WUM A;  2DVR A;  3SVH A;  2LSP B;  4YH3 A;  4UYG A;  3U5O A;  4MEN A;  1ZKR A;  3DWY A;  4F3I A;  4YYK A;  3JVL A;  3RCW A;  5II2 A;  3TLP A;  4MR5 A;  5C4Q A;  3O34 A;  4Q0O A;  5EP7 A;  5FG6 A;  5HEN A;  5KTU A;  2DVV A;  5FFY A;  2E7O A;  4KV4 A;  5AD3 A;  2H60 A;  1X0J A;  4QB3 A;  4UIZ A;  4O70 A;  4YC9 A;  5BT5 A;  5DFD A;  5ETD A;  4MR3 A;  4O7A A;  5FFV A;  3P1C A;  5DKD A;  3U5P A;  5DKC A;  5I86 A;  5DFB A;  3Q2E A;  5LUU A;  5A81 A;  5A5P A;  5E9I A;  5LKU A;  5EWV A;  5A5Q A;  5E9V A;  5D3P A;  4YAT A;  3I3J A;  3UV2 A;  3UW9 A;  2E7N A;  5FE9 A;  5HQ6 A;  5CUG A;  3LQJ A;  4YAD A;  4LC2 A;  5A5O A;  2RI7 A;  4X2I A;  5EPB A;  4BW4 A;  3LJW A;  4NYW A;  4YYG A;  5F1L A;  3MUK A;  5EI4 A;  5E9M A;  4QEW A;  4A9O A;  4YK0 A;  4LRG A;  4A9L A;  4ZC9 A;  4LZS A;  3MB3 A;  5LJ0 A;  5FE2 A;  4NRB A;  5FFW A;  4IOR A;  4NUD A;  3P1D A;  3D7C A;  3O37 A;  5CUA A;  5DX4 A;  4WHU A;  4BJX A;  5IGK A;  4UIU A;  4J0R A;  4TZ8 A;  5DKH A;  5EM3 A;  4QSP A;  4CUS A;  5FG4 A;  5HEM A;  4HXN A;  5C8G A;  5L8U A;  3UVD A;  4A9K A;  3U5J A;  4A9N A;  2RO1 A;  4QSV A;  1EQF A;  5EWC A;  5JI8 A;  5CU8 A;  4IR4 A;  5KO4 A;  4MEP A;  4XY9 A;  5HFR A;  5F62 A;  4QYL A;  3SVF A;  5FE5 A;  2DVQ A;  4NR5 A;  3NXB A;  4HBY A;  4AI6 A;  4NRA A;  5G4S A;  4AKI A;  5BT3 A;  5ENE A;  2OUO A;  5E3D A;  5LVQ A;  4KCX A;  4IOO A;  4TT4 A;  3D1B A;  5FE3 A;  4QSW A;  3U5L A;  2MJV B;  2RS9 B;  5I7X A;  5IGL A;  4GPJ A;  4N4I A;  4PKL A;  5II1 A;  2RNW A;  5EV9 A;  5I29 A;  5CP5 A;  5CQ5 A;  3VKH A;  1ZS5 A;  2KTB B;  4QR4 A;  5EQ1 A;  4XY8 A;  5TCM A;  5EGU A;  2RNY A;  3IU5 A;  5I7Y A;  2N9G A;  4O76 A;  4QSR A;  5EWH A;  2E3K A;  4BW1 A;  5J0D A;  4UIW A;  4MR6 A;  4AKH A;  4OUF A;  4UIT A;  4QSS A;  4O7B A;  2L5E A;  4LYS A;  5CFW A;  4ALG A;  5FH6 A;  4LZ2 A;  4QEV A;  4WIV A;  5ENC A;  3U5K A;  5CQ6 A;  4O71 A;  5F36 A;  3G0J A;  4OGJ A;  4A9M A;  4LYI A;  5I1Q A;  1JM4 B;  4LZR A;  5HJC A;  4N4G A;  4NUC A;  5DFC A;  4UYD A;  4NYV A;  4UYE A;  5D3S A;  5A7C A;  5KTW A;  2RFJ A;  3MUL A;  5E73 A;  5F5Z A;  4IR6 A;  5D3J A;  4YYD A;  5F60 A;  5TB6 A;  4PS5 A;  4AKN A;  5D0C A;  3UVX A;  5CRM A;  5CRZ A;  5DLZ A;  5ENF A;  4CUU A;  5E9Y A;  5CQT A;  4YBT A;  5ENI A;  5DW2 A;  2DKW A;  4N3W A;  4O77 A;  5LJ1 A;  2D82 A;  4QUT A;  5A82 A;  5ACY A;  4HXK A;  5F2P A;  5DYA A;  4NR6 A;  2OSS A;  5FE6 A;  5EK9 A;  5ENG A;  5CQ8 A;  5HQ7 A;  4UIY A;  3FKM X;  4QEU A;  4QST A;  5HRX A;  1F68 A;  2YW5 A;  5CTL A;  4TT2 A;  5I40 A;  3O36 A;  5D24 A;  4O75 A;  4PTB A;  5A83 A;  4UIX A;  5IGM A;  3ZYU A;  4NYX A;  5D26 A;  2R0V A;  4UYF A;  4QYD A;  5H85 A;  2L84 A;  2R10 A;  4HBW A;  2F6N A;  5HLS A;  5C87 A;  3ERR A;  5HM0 A;  4A9F A;  2F6J A;  4IR5 A;  5H1T A;  3Q2F A;  5FB1 A;  5LKT A;  4YH4 A;  3GG3 A;  5EPR A;  4UIV A;  5DBM A;  3UV5 A;  4HXO A;  5D25 A;  4QSX A;  5C7N A;  4NR8 A;  5E3G A;  5C89 A;  3UV4 A;  4C67 A;  2FSA A;  4NRC A;  5ENJ A;  1E6I A;  2YDW A;  2NXB A;  5F1H A;  5FG5 A;  4O7E A;  5CUC A;  2YEK A;  1JSP B;  5FH7 A;  5F3A A;  5EIS A;  5LKX A;  3VKG A;  4NR7 A;  4J3I A;  5CQ7 A;  3JVJ A;  4TQN A;  4KV1 A;  4QNS A;  5L97 A;  5HCL A;  3UVY A;  5IBN A;  5CS8 A;  4BHW A;  4A9E A;  4CUT A;  4UYF B;  4HXS A;  5FH8 A;  5A5R A;  5E0R A;  5D3N A;  5IID A;  4TS8 A;  4Q0N A;  5CQA A;  4DON A;  4N4H A;  2YEL A;  4HXM A;  5K29 A;  4O74 A;  3D1D A;  5CUB A;  5F61 A;  4HBV A;  4O72 A;  5H1V A;  4QUU A;  4XUB A;  1PUO A;  4Z6H A;  4NUE A;  4TU6 A;  5LJ2 A;  5DW1 A;  3P5O A;  4CL9 A;  4BW3 A;  2D9E A;  3MXF A;  5HEL A;  4ALH A;  4A9J A;  3AAD A;  3P1E A;  5D3H A;  5ETB A;  5DYC A;  3O35 A;  4YYH A;  2I7K A;  5CUD A;  5A5N A;  3LQI A;  4QC3 A;  4NXJ A;  4QR5 A;  3G0L A;  4J1P A;  4CLB A;  4YYJ A;  3MB4 A;  2YEM A;  3S91 A;  5CQ3 A;  5EA1 A;  3QZT A;  2DWW A;  5FE0 A;  4IOQ A;  2R0S A;  4QSU A;  5EVA A;  4CFK A;  4YYM A;  3ONI A;  5E7D A;  4MEQ A;  5IGN A;  3IU6 A;  4O7C A;  4LYW A;  4ZW1 A;  3AQA A;  4Z93 A;  5EWD A;  5DYX A;  4Y03 A;  4WHW A;  5LVR A;  5CPE A;  4Z1S A;  4E96 A;  4PY6 A;  4YAX A;  5E74 A;  5COI A;  4NQM A;  4O78 A;  5D3L A;  5FE1 A;  5E9K A;  5HRV A;  2L85 A;  5D3R A;  5KU3 A;  5AME A;  4MEO A;  3LXJ A;  5I89 A;  4YBM A;  5AMF A;  5HQ5 A;  4LDF A;  4NQN A;  3HMF A;  3UVW A;  5ENH A;  4TTE A;  5CUE A;  4FLP A;  2DAT A;  2I8N A;  4YY4 A;  5FE8 A;  5I83 A;  4HXR A;  3QZS A;  3HMH A;  4PCI A;  4UYH A;  5F63 A;  3U5N A;  4IR3 A;  5HRW A;  4CFL A;  5FBX A;  5BT4 A;  3MQM A;  3LQH A;  5FDZ A;  5FE4 A;  5EU1 A;  5L98 A;  4YAB A;  4YY6 A;  4ZQL A;  4YYN A;  5FE7 A;  4TU4 A;  3P1F A;  5A85 A;  5CGP A;  5KTX A;  4N4F A;  1WUG A;  5DLX A; 
#chains in the Genus database with same CATH homology
 5EIC A;  4RVR A;  4QSQ A;  3JVK A;  5I88 A;  5HFQ A;  4TT6 A;  3JVM A;  5FB0 A;  3SVG A;  3QZV A;  4C66 A;  4YYI A;  5CY9 A;  4A9I A;  5IG6 A;  4Z1Q A;  4O7F A;  3O33 A;  2G4A A;  5EWW A;  3S92 A;  5L8T A;  4LR6 A;  4QBM A;  5C85 A;  4YBS A;  5H1U A;  5JWM A;  5E9L A;  5CQ4 A;  2GRC A;  5D7X A;  4NS5 A;  4BW2 A;  5I80 A;  5DY7 A;  5LKZ A;  4OGI A;  3K2J A;  4TYL A;  5D3T A;  5G4R A;  4TZ2 A;  4QY4 A;  4CUQ A;  2YQD A;  5L99 A;  5A5S A;  5EPS A;  3DAI A;  1N72 A;  2DVS A;  4QZS A;  4NR4 A;  5DYU A;  4HXP A;  4MR4 A;  2WP2 A;  4Z6I A;  4HXL A;  5AD2 A;  4QR3 A;  5L96 A;  4QC1 A;  4XYA A;  4A9H A;  3U5M A;  2R0Y A;  5KHM A;  3HME A;  4J0S A;  2YYN A;  4CUP A;  2WP1 A;  2OO1 A;  4HBX A;  4XUA A;  5ENB A;  5CZG A;  4NR9 A;  4CUR A;  5F25 A;  4PCE A;  2RNX A;  1WUM A;  2DVR A;  3SVH A;  2LSP B;  4YH3 A;  4UYG A;  3U5O A;  4MEN A;  3DWY A;  4F3I A;  4YYK A;  3JVL A;  3RCW A;  5II2 A;  3TLP A;  4MR5 A;  5C4Q A;  3O34 A;  4Q0O A;  5EP7 A;  5FG6 A;  5HEN A;  5KTU A;  2DVV A;  5FFY A;  2E7O A;  4KV4 A;  5AD3 A;  2H60 A;  1X0J A;  4QB3 A;  4UIZ A;  4O70 A;  4YC9 A;  5BT5 A;  5DFD A;  5ETD A;  4MR3 A;  4O7A A;  5FFV A;  3P1C A;  5DKD A;  3U5P A;  5DKC A;  5I86 A;  5DFB A;  3Q2E A;  5LUU A;  5A81 A;  5A5P A;  5E9I A;  5LKU A;  5EWV A;  5A5Q A;  5E9V A;  5D3P A;  4YAT A;  3I3J A;  3UV2 A;  3UW9 A;  2E7N A;  5FE9 A;  5HQ6 A;  5CUG A;  3LQJ A;  4YAD A;  4LC2 A;  5A5O A;  2RI7 A;  4X2I A;  5EPB A;  4BW4 A;  3LJW A;  4NYW A;  4YYG A;  5F1L A;  3MUK A;  5EI4 A;  5E9M A;  4QEW A;  4A9O A;  4YK0 A;  4LRG A;  4A9L A;  4ZC9 A;  4LZS A;  3MB3 A;  5LJ0 A;  5FE2 A;  4NRB A;  5FFW A;  4IOR A;  4NUD A;  3P1D A;  3D7C A;  3O37 A;  5CUA A;  5DX4 A;  4WHU A;  4BJX A;  5IGK A;  4UIU A;  4J0R A;  4TZ8 A;  5DKH A;  5EM3 A;  4QSP A;  4CUS A;  5FG4 A;  5HEM A;  4HXN A;  5C8G A;  5L8U A;  3UVD A;  4A9K A;  3U5J A;  4A9N A;  2RO1 A;  4QSV A;  1EQF A;  5EWC A;  5JI8 A;  5CU8 A;  4IR4 A;  5KO4 A;  4MEP A;  4XY9 A;  5HFR A;  5F62 A;  4QYL A;  3SVF A;  5FE5 A;  2DVQ A;  4NR5 A;  3NXB A;  4HBY A;  4NRA A;  5G4S A;  5BT3 A;  5ENE A;  2OUO A;  5E3D A;  5LVQ A;  4KCX A;  4IOO A;  4TT4 A;  5FE3 A;  4QSW A;  3U5L A;  2MJV B;  2RS9 B;  5I7X A;  5IGL A;  4GPJ A;  4N4I A;  4PKL A;  5II1 A;  2RNW A;  5EV9 A;  5I29 A;  5CP5 A;  5CQ5 A;  1ZS5 A;  2KTB B;  4QR4 A;  5EQ1 A;  4XY8 A;  5TCM A;  5EGU A;  2RNY A;  3IU5 A;  5I7Y A;  2N9G A;  4O76 A;  4QSR A;  5EWH A;  2E3K A;  4BW1 A;  5J0D A;  4UIW A;  4MR6 A;  4OUF A;  4UIT A;  4QSS A;  4O7B A;  2L5E A;  4LYS A;  5CFW A;  4ALG A;  5FH6 A;  4LZ2 A;  4QEV A;  4WIV A;  5ENC A;  3U5K A;  5CQ6 A;  4O71 A;  5F36 A;  3G0J A;  4OGJ A;  4A9M A;  4LYI A;  5I1Q A;  1JM4 B;  4LZR A;  5HJC A;  4N4G A;  4NUC A;  5DFC A;  4UYD A;  4NYV A;  4UYE A;  5D3S A;  5A7C A;  5KTW A;  2RFJ A;  3MUL A;  5E73 A;  5F5Z A;  4IR6 A;  5D3J A;  4YYD A;  5F60 A;  5TB6 A;  4PS5 A;  4AKN A;  5D0C A;  3UVX A;  5CRM A;  5CRZ A;  5DLZ A;  5ENF A;  4CUU A;  5E9Y A;  5CQT A;  4YBT A;  5ENI A;  5DW2 A;  2DKW A;  4N3W A;  4O77 A;  5LJ1 A;  2D82 A;  4QUT A;  5A82 A;  5ACY A;  4HXK A;  5F2P A;  5DYA A;  4NR6 A;  2OSS A;  5FE6 A;  5EK9 A;  5ENG A;  5CQ8 A;  5HQ7 A;  4UIY A;  3FKM X;  4QEU A;  4QST A;  5HRX A;  1F68 A;  2YW5 A;  5CTL A;  4TT2 A;  5I40 A;  3O36 A;  5D24 A;  4O75 A;  4PTB A;  5A83 A;  4UIX A;  5IGM A;  3ZYU A;  4NYX A;  5D26 A;  2R0V A;  4UYF A;  4QYD A;  5H85 A;  2L84 A;  2R10 A;  4HBW A;  2F6N A;  5HLS A;  5C87 A;  5HM0 A;  4A9F A;  2F6J A;  4IR5 A;  5H1T A;  3Q2F A;  5FB1 A;  5LKT A;  4YH4 A;  3GG3 A;  5EPR A;  5DBM A;  4UIV A;  3UV5 A;  4HXO A;  5D25 A;  4QSX A;  5C7N A;  4NR8 A;  5E3G A;  5C89 A;  3UV4 A;  4C67 A;  2FSA A;  4NRC A;  5ENJ A;  1E6I A;  2YDW A;  2NXB A;  5F1H A;  5FG5 A;  4O7E A;  5CUC A;  2YEK A;  1JSP B;  5FH7 A;  5F3A A;  5EIS A;  5LKX A;  4NR7 A;  4J3I A;  5CQ7 A;  3JVJ A;  4TQN A;  4KV1 A;  4QNS A;  5L97 A;  5HCL A;  3UVY A;  5IBN A;  5CS8 A;  4BHW A;  4A9E A;  4CUT A;  4UYF B;  4HXS A;  5FH8 A;  5A5R A;  5E0R A;  5D3N A;  5IID A;  4TS8 A;  4Q0N A;  5CQA A;  4DON A;  4N4H A;  2YEL A;  4HXM A;  5K29 A;  4O74 A;  5CUB A;  5F61 A;  4HBV A;  4O72 A;  5H1V A;  4QUU A;  4XUB A;  4Z6H A;  4NUE A;  4TU6 A;  5LJ2 A;  5DW1 A;  3P5O A;  4CL9 A;  4BW3 A;  2D9E A;  3MXF A;  5HEL A;  4ALH A;  4A9J A;  3AAD A;  3P1E A;  5D3H A;  5ETB A;  5DYC A;  3O35 A;  4YYH A;  2I7K A;  5CUD A;  5A5N A;  3LQI A;  4QC3 A;  4NXJ A;  4QR5 A;  3G0L A;  4J1P A;  4CLB A;  4YYJ A;  3MB4 A;  2YEM A;  3S91 A;  5CQ3 A;  5EA1 A;  3QZT A;  2DWW A;  5FE0 A;  4IOQ A;  2R0S A;  4QSU A;  5EVA A;  4CFK A;  4YYM A;  3ONI A;  5E7D A;  4MEQ A;  5IGN A;  3IU6 A;  4O7C A;  4LYW A;  4ZW1 A;  3AQA A;  4Z93 A;  5EWD A;  5DYX A;  4Y03 A;  4WHW A;  5LVR A;  5CPE A;  4Z1S A;  4E96 A;  4PY6 A;  4YAX A;  5E74 A;  5COI A;  4NQM A;  4O78 A;  5D3L A;  5FE1 A;  5E9K A;  5HRV A;  2L85 A;  5D3R A;  5KU3 A;  5AME A;  4MEO A;  3LXJ A;  5I89 A;  4YBM A;  5AMF A;  5HQ5 A;  4LDF A;  4NQN A;  3HMF A;  3UVW A;  5ENH A;  4TTE A;  5CUE A;  4FLP A;  2DAT A;  2I8N A;  4YY4 A;  5FE8 A;  5I83 A;  4HXR A;  3QZS A;  3HMH A;  4PCI A;  4UYH A;  5F63 A;  3U5N A;  4IR3 A;  5HRW A;  4CFL A;  5FBX A;  5BT4 A;  3MQM A;  3LQH A;  5FDZ A;  5FE4 A;  5EU1 A;  5L98 A;  4YAB A;  4YY6 A;  4ZQL A;  4YYN A;  5FE7 A;  4TU4 A;  3P1F A;  5A85 A;  5CGP A;  5KTX A;  4N4F A;  1WUG A;  5DLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...