5F2SA

Crystal structure of human kdm4a in complex with compound 15
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
342
Chain Sequence
NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 106
structure length 342
sequence length 346
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f2sA01
5FP9A 5FV3A 5FYZA 2YU1A 5E6HA 3N9LA 4CCOA 4DIQA 5FUPA 5FXWA 5A1LA 5FJKA 5FZ8A 5FYBA 3K3NA 5FY7A 3N9QA 4IGPA 4EZ4A 2OT7A 3PU8A 5FXVA 5F3IA 5FYCA 5FZIA 3N9OA 4CCMA 4LIVA 4Y4RA 5FZ4A 4TN7A 4ASKA 5FZ7A 2P5BA 4EYUA 5F3CA 5FPLA 2YBPA 5LY2A 3N9PA 4GAZA 5FXZA 4C8DA 4BISA 5FPVA 5FP7A 5FZEA 5F2SA 5A7PA 5F2WA 3PURA 4XDOA 4GJYA 3PU3A 5FZHA 5CEHA 5A7SA 4Y3OA 4AI9A 5FZ3A 5IVFA 5FZAA 5LY1A 3OPWA 5IWFA 3U4SA 5LWBA 5FP8A 4IGQA 5A1FA 5IVJA 3KV4A 3DXTA 4CCNA 5FZMA 5FPAA 3AVSA 5F5CA 2XMLA 5FZ6A 5FYYA 5FXXA 4CCKA 5FZ9A 5FY1A 4Y33A 5A7OA 2OQ7A 5ISLA 5K4LA 2GP3A 4EZHA 2W2IA 2OQ6A 5F5IA 4QX8A 5FZBA 4UF0A 5FY0A 5IVYA 4URAA 5FZLA 4QXCA 5FBJA 4BU2A 3U78A 5FWJA 4HONA 4UF0B 4D6QA 5FYSA 5FYIA 5FZGA 5IW0A 5A3WA 4D6RA 5FPUA 5FZDA 2Q8CA 3UYJA 4AAPA 4D6SA 2YPDA 5FYMA 5A7WB 5FWEA 5FJHA 3ZLIA 2YBKA 4XDPA 3LD8A 5IVVA 2WWJA 3AL5A 4NUBA 4QXBA 5FYTA 3N9MA 5A7WA 5FZ1A 5FPBA 3PUSA 4HOOA 5FZOB 2OS2A 5ANQA 5A7NA 3PUAA 4LIUA 5FZCA 5IVBA 5F5AA 5F3EA 3NJYA 3OPTA 2YBSA 3KV5A 3PTRB 5FY9A 5A3PA 5IVEA 4QU1A 4V2VA 3KV6A 4LITA 2WWUA 2VD7A 4CSWA 5KR7A 5IVCA 5FY5A 3PUQA 4IGOA 4QWNA 1VRBA 3RVHA 5FUNA 3AL6A 4V2WA 5FZOA 5LW9A 5FYHA 2OX0A 3LDBA 4DO0A 4QX7A 3N9NA 4QXHA 5F37A 4CCJA 3AVRA 5A3TA 5FYVA 5FP3A 5F3GA 2Q8DA 4CCLA 5F32A 3PDQA 3K2OA 5F39A 5FY4A 5A3NA 5FY8A 4GD4A 4GJZA 5FYUA 5FZKA 3K3OA 3KV9A 5FZFA 4CUGA 2XXZA 2XDVA 4BXFA 3DXUA 2GP5A 4E4HA 5A7QA 2YU2A 3KVAA 5FP4A 2PXJA 5FZ0A 2Q8EA 2XUEA 4LXLA 3KVBA 5A80A 3ZPOA
chains in the Genus database with same CATH superfamily
3V65A 2ZA9A 5DDJ1 3B7MA 4ZXKA 1Y9GA 3QACA 2YU1A 5BY5A 1QNWA 5E6HA 5T55A 2DYCA 3RZLA 3UKNA 4NHXA 2D93A 5FZ8A 1UF2C 5FOJB 4E4ZA 3K51A 4HKOA 1EYBA 2J1TA 1SDDB 2DUPA 5KHIA 4MXWA 2C4XA 2WS93 3LDRA 2O14A 4B4PA 4C1WA 3NMBA 3MLLA 1AR82 4IQPA 1W6QA 4B8EA 3AKQA 4AF9A 4YVSC 3OSDA 1VBA3 2V5DA 2WFF2 4HN1A 5F2SA 3WNMA 1TQ5A 2I07B 4LLOA 1QJU2 4WM7A 1OA4A 4YGCA 1B35B 1XSRA 2XG3A 3AX4A 4O7XA 3I59B 2UURA 1O3TA 4H2AA 1W39A 2EXJA 3J26N 4XUOA 3IMMA 4EE2A 5FZ3A 3BIEA 3SH5A 1CONA 4M01A 1FYUA 1LHUA 4OQ9A 4COZA 4QHZA 1ND2B 1RUI2 4LHLA 1SDWA 3ZXKA 1NX9A 4AW7A 3BN6A 5FYYA 4N43C 3OGVA 2PAMA 3OGRA 4AAXA 4ORFA 4D69A 1PIV1 5A7OA 2WLPA 1YFWA 2E63A 2HWC1 2W1WA 1FMD3 4JAAA 2OQ6A 3IDAA 3LFMA 3AKSA 1LGBA 2VTXA 2D6PA 4IE6A 4AEJA 1ENRA 1RUI1 2CYFA 2D97A 3NV3A 4OYUA 4XJZA 1JZ6A 4QPIA 4E2SA 2D5HA 4QXCA 2CGOA 5IATA 4AI0A 1VPHA 2MEV1 2RR11 4PLMA 4MGTA 4QQ2A 3A0NA 4Y1YA 1LHNA 4AVBA 3ZO0B 1SBEA 4GWNA 2BV4A 2FQPA 2FDFA 5EPAA 3AYAA 2ZKLA 2OUJA 5JDBA 4URTA 5LA2A 4DS0A 1PGW1 3E97A 2VE1A 4QKNA 3WY6A 4HKLA 3SNMA 3I2HA 1FAYA 4UWDA 2WAOA 1UIKA 5CKMA 1NZIA 4YFZA 4FPYA 1Q8QA 4HVRA 4QB6A 3ZFFB 1MACA 5DG2A 1Y43B 2XONA 1W2AX 3OPZA 3ZSKA 2YBSA 1UOJA 3PTRB 5CFDA 5DXDA 5IVEA 5I0SA 1ODMA 3BU0A 5SV8A 1F8VA 3SCGA 4CYDA 1UOBA 2WS91 3ZIWA 2PAKA 3ETQA 1PMJX 3SQOA 2NN8A 1N3PA 2QTWB 2VZSA 4MOAA 1OOPA 4C90A 4CU8A 1MS5A 4H55A 1I5ZA 3THTA 5K0UA 5C33A 3TAYA 1GP5A 1H6YA 3DKWA 1RGSA 1AYM1 1J1TA 2RS31 1GNHA 4K3UA 1OOPB 4Z82A 1OLMA 1W2TA 4H3WA 5F6KA 5A3NA 2E26A 4N7UA 5K8SA 4LQRA 2FDJA 3BTYA 2PHUA 2GC2A 4JZRA 3VD4A 4E4HA 2HWE2 2YU2A 1AR73 5FP4A 1XNAA 3HN1A 1UCXA 3VKLA 1X82A 1VMJA 2RM21 3KGLA 3ZN4A 2GMPA 4BQYA 5F6LB 3TN93 2WO3A 1R093 1S2KA 5FYZA 4AXOA 4UXAA 1YLLA 4YWAA 1OQDA 4PF1A 4TXWA 3VZOA 3WXPA 2AYHA 1A3KA 2Y33A 2C6SA 4AFBA 5HV4A 1MS9A 5DAPA 5D8AA 1DFQA 2DU1A 3HD8B 2W52A 1OPOA 3N9QA 4R4XA 4Q1PA 4DEQA 5L9VA 2RM22 4CU6A 1AVBA 2WN3A 3LIHA 4I02A 4F7ZA 1T2XA 4DXSA 2RR13 2CGPA 3FE5A 3JUUA 2L9LA 4DRVA 1TMF2 3WW3A 1YJKA 2DWRA 5IFTA 3GF6A 1XU1A 1DDLA 4Y4YA 1UQXA 5FPVA 1H1AA 3M4FA 1SACA 2DFBA 3DL3A 5CFCA 2VJXA 1EV13 1DQ2A 3KT7A 4EQVA 5FZHA 5KXCA 2LS6A 2IXCA 2B4KA 1BVVA 3C7FA 4QT6A 1XU2A 4HANA 4C0BA 1DLCA 4QPGC 5A6ZA 1LGCA 2R1DA 4NPRA 1X9TA 3KCXA 5FDBA 3DPRB 3FUOA 2H0VA 4IGQA 1PGL1 1EV12 2YMZA 2QQVA 1I9RA 5C9AC 4FOVA 5F5CA 2XMLA 1JYCA 5T5OA 1OFSA 1NA1C 3ECQA 4LO6B 3BIWE 3S0MA 2B7YA 3T2TA 2XJPA 1US2A 4BA6A 1RINA 2D44A 4M3CB 3TEZA 4CP1A 3D82A 5A1AA 1RUC1 4I2OA 2GC3A 1UU5A 3HQRA 2P2KA 1IS3A 1C5HA 4OHZA 1WWYA 2AC1A 2XR4A 4X6QB 1D4VB 4LA2A 4LKSA 4XZPA 2C24A 1BLZA 1RMU3 4YGBA 2RHPA 1W2NA 3FJSA 4EWDA 1MZFA 1SLTA 3HMYA 5H9RA 3IPVB 2VZOA 2RM23 2YUEA 5L73A 3RWNA 5JI7A 3PJYA 4CDQB 5KBFA 1W0PA 1H8TC 1NCRB 2HWD3 4QKFA 2YBKA 3FLPA 1LOGA 4NVPA 4H14A 4NIAA 1TME1 5G04L 4Y20A 5FPBA 4CXWA 5CIRA 4K8FA 3VB9A 4KH9A 1GQGA 5GJ6A 4LIUA 4ARXA 5IVBA 2V4VA 3O1TA 3NJYA 2D6OX 3HNMA 4Y20B 3UNPA 2BGCA 2E51A 2VZVA 2R041 2ZXQA 2WC2A 5FLJA 4IE5A 4PI2A 5JZGC 3AYEA 4CUAA 3AYCA 5I93A 2IZWA 2QNKA 2A73B 3RNSA 4ASLA 1FOD2 1QDOA 3GGLA 3LQCA 2ARBA 3UKVA 2BRTA 3NNFA 1IG0A 1L7QA 2XJQA 2R062 5DDJ3 3PTYA 5F3GA 3NVCA 4JGZB 3HN3A 4LO5B 4C0HA 1OXCA 2XHKA 4EWEA 4IEQA 2HBTA 2LUWA 3L2HA 4INDA 5JXIA 4E9KA 3LDKA 2XLFA 3VHPA 1T6BX 1UNBA 3NNJA 2Q8EA 3ZYRA 5CA6A 4IW3A 2VCAA 2ZJCA 4XXAA 2WINB 5CG8A 1AJOA 2ZMKA 1VB4A 1DZRA 3CLPA 5L9RA 4QKBA 5DPNA 1IPKA 1JU4A 2P17A 2WIIB 3B69A 5FXWA 4HLTA 1AR91 4M3CE 2ZZJA 1SCRA 3WHUA 4ES8A 1SHWB 4U2AA 5DAQA 2D6MA 1O5LA 1ONAA 4RHV1 1UMHA 3D6EA 3MICA 4YG0A 5EHDA 3T4HB 1APNA 1ULCA 3U4XA 4B7EA 2HLEA 4COYA 4LTAA 1UYPA 4LOSA 1RUG1 4GJYA 4LOTA 1JZ3A 1WKYA 3IAPA 4MV2A 3WCSA 2W92A 4AHXA 1SLAA 3VBUC 2D6LX 5C8WA 1GANA 4BXSV 4IE7A 2JECA 1S55A 2Y64A 4OVEA 1AHSA 4B29A 2WA4A 1FI2A 1NAEA 1YHFA 2BOJA 2G1MA 4P9WA 1QIQA 4KWLA 5FZ6A 3RI9A 1S1AA 2VUDA 4XJ9A 4GMP0 3AMHA 3UJOA 1SBDA 2P4EA 2D7FA 2EIEA 1OI6A 4XE9A 2V5YA 5FLHA 3KM5A 1A8MA 3PVNA 4Q0QA 2VMHA 5HCBA 4URAA 3IZOA 5FZLA 2LRPA 5FBJA 5AVAA 3BTXA 3QLQA 4PIYA 4DINB 3IT8A 4HONA 1W3XA 1OKQA 1R091 3O1OA 4AOCA 4XJWA 1AR83 4G3YC 4BM8A 5T3NA 1O91A 2NMNA 4DXRA 3U10A 4UFKA 1AYN2 4JGYA 1F5FA 4D6SA 2YPDA 2PHWA 5A32B 1UU6A 2HH9A 2Y6JA 4DNYA 4N53B 4XAAA 4LR4A 1LU2A 3SCFA 5K7PA 1O4YA 1JYWA 1N1SA 4MXWB 1RB8G 1KXGA 5EV7A 2B39A 3A0KA 2WNUC 1W0NA 4UI9L 4HOOA 1GBGA 4S2FA 1UU4A 1GWKA 2ZCWA 5F5AA 3LOIA 2VQ0A 3ZR6A 1FPN2 1EAH2 4UFIA 5HCFA 4QU1A 4FAHA 3POBA 4D7SA 3DYPA 3E5XA 2P3YA 2VQUA 3O1MA 2ZGNA 2GAUA 1ULEA 5FUNA 3AL6A 3DEMA 3J8F1 1DU3D 5C4WB 4R9CA 1J59A 3N9NA 3Q9OA 1KDMA 1QKQA 2ZHMA 3ES4A 4GMP1 3VBOB 5CFCC 5FYVA 5ABJB 2Q1ZB 4S2GA 3H8RA 3DPRC 4QX2A 1C8M1 4ZS3A 3VBOA 2W08A 5ABJA 1R083 1G9BA 2C26A 4W8JA 1UX7A 4A4AA 1PGSA 5C71A 1YUDA 4FFFA 2WLQA 4Q4V1 5KHHA 1NY72 4ZXEA 4DMIA 1DGWX 1RVF1 4SBVA 4BK4A 2VGDA 4CE8A 1JYVA 2DBNA 1IGOA 2GZWA 2Y26A 3WP4A 5I0UA 3KHCA 4BIFA 1GP6A 2WFPA 2N7GA 4YW5A 3I49A 1V70A 5A1LA 1V6OA 4FPEA 1QJFA 4F83A 1UN1A 5BNOC 2ZACA 1S2BA 4Z07A 3ZXGA 4TSVA 2ADEA 5HCHA 3MEPA 4AHWA 1XE0A 5FXVA 4PI0A 1EY2A 3A22A 3FL7A 3TOJA 4OI2A 2R32A 1AXKA 1OVSA 2GNMA 1V9U3 4QGMA 1CAWA 1V9U2 2DUQA 3KT1A 4FFHA 4K8RB 2Q4SA 5GLVA 1YQ2A 4OFGA 1ENSA 1O3SA 2WSVA 4IEOA 3POIA 5DABA 3BI3A 2PTMA 1OQ1A 3HT1A 2RJKA 4XQDA 3I2DA 3WW2A 4PF5A 3R4DB 3JB4C 5JMCA 2TEPA 5IVFA 1WW7A 2QDRA 5LA9A 4IV3B 3AMPA 2SBAA 2IVJA 2VU9A 4FQZA 2BFUS 3GJBA 1BYHA 4Q2FA 5E16A 4B1LA 1GV9A 5JSOA 1DIWA 1OKOA 3H3ZA 4AWDA 4E2QA 1QOTA 3J7MA 3FLRA 2OZJA 1W8FA 5DN2A 2AR6A 4PDWC 3GBFA 2PAEA 3JD71 3FUQA 1Y7BA 4ZU7A 5C3SA 2Q1MA 5FZBA 4Q27A 3W9AA 3FN9A 4CP9B 3OBZA 4LBNA 3MO4A 4HVQA 3IB3A 1QJZA 4Q0SA 4R8HA 4NIDA 4BU2A 1ZM1A 1US3A 2A1XA 2R0FA 3LA7A 3USUB 4N7IA 2VCBA 2WZ8A 3AZVA 4LBOA 2X8KA 2QQMA 4PBPA 1JMUB 1V00A 1ZVFA 1BBT3 5D8AB 1QY4A 1R1A2 1W9FA 4LBJA 3VBRB 3ZYJB 2VMDA 1EAH3 2IWGB 1HRV1 2D6NA 1RUH3 4KGGA 1ENQA 2VNVA 3KQ4B 3N7LA 4XBQA 1RHI1 3ACFA 2NQYA 1PZ8A 2VH9A 4AFAA 2RMU2 2VW1A 3KLSA 1V6JA 1RUNA 3GXUA 1JXNA 4BQ3A 2A6XA 3FLTA 1AR92 4CU9A 2RS32 1A34A 3SITA 5FO8B 1F15A 2C1FA 2X10A 5ANNA 4YVSB 5H9QA 2RG4A 2DBIA 1PO13 1G9FA 1GWMA 2HWD1 4LBLA 4XF3A 3R05A 4QQOA 1AL0G 3GYDA 1S0DA 1OA3A 3UJQA 1O59A 2YYOA 1EPWA 1Q8PA 2YFZA 2J22A 1NE6A 3AZWA 4OUMA 3S6PA 4AFCA 5FOBB 5CISA 4E8CA 1AR63 3WOGA 1J58A 4FVVA 4AHZA 1CN1A 2WN2A 1UZYA 1ASJ3 2BGPA 2A5ZA 2VW0A 2WRAA 2PLV3 4KBZA 3HT2A 1W9SA 1VIWB 5FZKA 1W2UA 1EP0A 1AL22 2V73A 3OGJA 4CCDA 2XXZA 1CAVA 2CAVA 4A3ZA 4KWKA 1GSLA 4XUPA 1C4RA 3EB7A 3SC7X 1CAVB 1QNYA 3B02A 4L0PA 3WHTA 2WT0A 1TZOA 4HBNA 4J1WA 1YQ6A 2GMEA 3RPQA 5C5TA 4UAPA 4CEWC 5A3MA 2VZUA 1NUKA 1NXD1 4XTMA 1XSQA 5KC6A 2VZRA 4WVVA 2A3WA 4BCUA 3GZUC 1A78A 3C8XA 3HNYM 1J3RA 3ZYIB 2WAAA 2RE9A 2VG9A 1AXZA 1W6NA 4XZUG 5FZIA 4CCMA 5F8PA 1HRI2 1R092 1R081 1BVP1 3MV01 3VD3A 3WNOA 5JLVA 3WUDA 1X8MA 4LHNA 3ZDSA 3F2ZA 2HWE3 2JDKA 3NJVA 3H1MA 2WZPP 2X09A 2A6ZA 3T09A 3PMEA 1DZQA 4FOQA 1JYTA 1D0HA 5L7OB 4PIXA 2H0BA 2K0GA 1WA6X 3WNLA 1WCDJ 5C5UA 4XBLA 1W6PA 3R4SA 1G6NA 4LK7A 5I0DA 5LY1A 1PM4A 4GA9A 5BPXA 5KHJA 5LWBA 4K9SA 1RYYA 1QDCA 1XNKA 3JCIA 5JVVA 3NV2A 5IVJA 5JZGA 2R49A 2W91A 3DXTA 4ZY9A 3IAQA 5JPMB 1JZ4A 2E33A 4NIHA 1PZ7A 2UWCA 4FTEA 3T2QA 3ROUA 1K45A 1J1LA 1UAIA 5CFDB 4AQTA 3OEAA 2ZGRA 3O0XA 1MR5A 4YW1A 4LKEA 2EIGA 3AC0A 2VXJA 1ENXA 4HPKB 1JN2P 3H3LA 3V0BB 5C6CA 1CD3G 3KMHA 3BKZA 4GB31 4DUWA 4MHRA 3CF6E 3UGGA 5FYSA 3K48A 1W04A 2UYAA 5FPUA 1CJDA 2VPVA 2YFUA 4RS5A 2R071 4UW5A 4NROA 2WFF1 3WF1A 2XVGA 1LR5A 2KD7A 4RS5B 1BMV1 2WR9A 3LIGA 4NIIA 3ZFFC 3ZLIA 3LD8A 4GB32 2ZGTA 4BYYA 2F6BA 1V6NA 3N9MA 4L11A 3S7IA 1MEC1 2B5HA 3LA2A 4XFFA 3WP6A 3H8UA 3PUAA 2BEOA 4JRAA 5DZGA 1JOPA 4AQ6A 1O6UA 4PQQA 4JV4A 3L9JT 3ZYBA 1VAKA 2VD7A 4QKDA 3VBFC 2C0ZA 1UY2A 1F5JA 4K1ZA 3BUCA 1YYNA 1CESA 1V6KA 1MEC2 3ZVXA 1S4CA 1VAVA 2GNTA 4OMDA 1H2NA 4V2WA 4ET7A 5FUIA 4ZZ8A 2Y34A 4DOUA 3CDZB 1YIFA 4QXHA 5F37A 3AXDA 1YFXA 2BGOA 5FKCA 5F32A 1H30A 2CHHA 3ZFGA 1OUSA 3E1F1 5CFCB 1ZX5A 4RHV3 2BPA2 3MUY1 4L92A 3ZN6A 1IKQA 5JXJA 2OXBA 3RYRA 2H6BA 3SMHA 3LEMA 3C7EA 2WSUA 3M3OA 3UT0A 4Q4X1 3ZPOA 3GZTB 3ZN6B 4BDVB 3E5UA 5BYNA 4YM2A 1UD1A 5IJRA 3VZMA 2QQPA 4LKDA 3BU7A 2YROA 4YG3A 4HL0A 2HWC3 4KWUA 1UMZA 5FO7B 1S0IA 2W1QA 4B7KA 4OHYA 2W3JA 4UFMA 1KEXA 2QCSB 5FY7A 2XPJA 4N90A 2ZEWA 4JGYB 3PU8A 3AB0A 1GNYA 5JAXA 3C3VA 4HK8A 1CZTA 1SQ4A 1RJ8A 4N53A 4QMAA 3RQ0A 4RR3B 3N9OA 1RUH2 1L7RA 2E53A 3AZYA 2TNFA 3J7LA 4MGQA 5LATA 4CDQC 5K9YA 1Q3EA 2YBPA 4YZ4A 1ZYBA 4GAZA 3AKPA 5LRSA 2ORXA 5IK4A 2A6YA 4AYUA 3TEYA 4COWA 1XQNA 4R9DA 4NN0A 4NRPA 5D2AA 1C8NA 3JBG2 4QX0A 3KQRA 4UW3A 3ZSEA 2Y0IA 4DXTA 3IPVA 4CDQA 2E7AA 1DYOA 1F4HA 3WDTA 5FZAA 5HV0A 3U07A 4RYDA 3NWKA 5FP8A 5C4WA 1WCUA 5E8AA 2EALA 1W8WA 1QHDA 3DYOA 4AE2A 3JBG1 2ZTNA 2W9XA 3KT4A 3H42B 3NKGA 4ARYA 5AFEA 4IEXA 2W39A 5ACA3 1VJ2A 4P08A 3O1PA 4CCEA 5LB6A 1SPPA 3LEIA 4CUBA 1GLHA 1W2OA 2I2SA 4XUQA 3UKTA 2ZX0A 1ZBA2 5DZFA 1W9WA 1SLCA 2VZPA 2JDZA 5J09A 1ZZ8A 1SPPB 1HRI1 1VRH2 3MIBA 1AL21 1ZBE2 4JGZA 5FYIA 1RUF1 2J1UA 5J96B 3O0WA 5EJZB 2NPIA 3PVBB 4WVMB 5LEJA 3POJA 3UGHA 1WBLA 1K3IA 2JICA 2JB8A 1GZ9A 3JB8A 2AH2A 5FYMA 1MQTC 3NV4A 2G19A 4Q8KA 1JW6A 1UY0A 4FPOB 4COVA 5IVVA 3VBHB 4TLGA 1UL9A 4TTGA 2OYZA 2BBVA 2XWJB 4BQ1A 4PIZA 5FYTA 5CVRA 4L97A 1ZBE1 4MVTA 1S0CA 4I3GA 4Q4W3 3ZYHA 3LAGA 3LCPA 3LSEA 2VW2A 3QH6A 4LMFA 4BLJA 2W1SA 2VUCA 5FR3A 4AVAA 1IKPA 2VR4A 4NE9A 1I6XA 1UY4A 1I1EA 4CXYA 2VOWA 3HOBA 1XE7A 1XE8A 4XFAA 5FZOA 1DQ5A 4GWJA 1JOJA 4FT8A 1VB2A 2ERFA 4UBHA 1M06G 2X5IA 1RUC2 2QBXA 1H0BA 4WZCA 1G9CA 1SG3A 2GC1A 5FYUA 4KQ7A 5JPNB 2JE8A 5C3RA 3CQOA 4B4RA 2VECA 5EP9A 1PHMA 4QM9A 2DVDA 1NZCA 2W87A 4CPBD 2FDKA 4FOWA 5CKQA 3RS6A 3WCRA 1OSGA 1DZTA 4O61A 1LU1A 1N1TA 1XYNA 4IXLA 1G8WA 1VMFA 3N9LA 3USUA 1CIYA 3VBRC 1QXRA 2AGSA 2B9UA 4HT1T 1FV3A 1FPN3 1D7PM 1JTZX 2XL7A 4JQTA 5LBEA 1SEFA 1BMV2 3LSDA 1DGWA 1CPMA 5IAXA 4IE4A 4CEWB 4FQ4A 2W1UA 5DUWA 2J7MA 3WG4A 1QJU1 5H9PA 4EWAA 2BQPA 3DYMA 3ZXEA 1Q43A 1FXZA 4CEWA 2RS52 4D7YA 2VZQA 2PHRA 3V64A 2C9KA 1LOEA 2D5FA 4IESA 4RS5C 4WM7C 1RUD2 2NMOA 4CXXA 3VBFA 1UYZA 1NLSA 3R4UA 1JU3A 1SMVA 3OCPA 3ZMNA 1SCSA 3PURA 2ZGOA 3RZGA 3AMQA 3H9AA 4X6RB 4YVSA 3ILRA 1NCQC 1K12A 4E27A 1GR3A 3Q8EA 2RS51 2BVBA 4KMQA 1WCSA 3MUZ1 3JD72 3ZFGC 2FMDA 2EF6A 4UW6A 1PK6A 2P1BA 1OUXA 4OULA 1UKRA 4KNCA 1URXA 4D3WA 2ZKNA 2ATFA 2RDSA 3AVSA 1W6OB 1Q8OA 2MEV2 1PK6C 5GLUA 1WLWA 5D1IA 3IDBB 5FZ9A 1MS1A 4RN5A 5FMOS 2VTXJ 3T08A 4DUVA 1MVEA 2G9GA 2ZAAA 5F5IA 1DQ6A 4SLIA 3D5OA 1R1A1 5B2GB 3RZJA 1HIXA 2YC4A 1VBE3 3A21A 4O9EA 1YEWA 2V72A 4CCCA 1PMHX 4QX5A 3D4KA 2ARXA 5GALA 1IHMA 4QD2A 3ZX7A 3TN91 4I0AA 1N1VA 2BP6A 1DQ0A 4C1XA 4XQ4A 4CEYB 1GNZA 1XNCA 4UBGA 1C57A 4I3PA 2HEYF 1CX1A 4I01A 2Y6LA 5GZCA 5FRAA 1E5HA 1HDKA 2WNUB 4PCRA 2ZX1A 1XB9A 3P1IA 2A70A 2JKXA 4NUBA 4QXBA 4OCTA 1UZZA 2HJIA 2LW8A 4NHLA 4XF0A 3WG1A 1D4M3 3M3QA 4XCBA 5CZKA 5GM0A 4DEVA 2VL4A 1YJLA 4MG2A 1VBC3 4MH0E 3H7YA 4FBFA 5K0UC 2DTYA 1QJY3 5C4WC 5FY5A 2CY6A 3J7HA 3A4UA 1WLDA 5BNQA 3OD4A 3RI8A 1CWPA 4Q4W2 1X7NA 2IUWA 4FOYA 1VAMA 4QX7A 4CTEA 1LENA 5CFDC 4CCJA 4P9YA 1CAWB 4UT5A 1JI6A 4KU7A 3GDBA 2ZPXA 2FBEA 1X50A 5FY8A 2BBAA 3VHRA 3PUIA 1OOPC 3EQEA 4XETA 2CTVA 5DMYA 2XJSA 3MPBA 4EN6B 5IK7A 1Z7S3 5I0TA 3POSA 3LOBA 1ZRDA 3KWVA 1RUJ3 1YQCA 3O1SA 1S0BA 2FCVA 1HRV3 2Y0OA 3WP5A 3W20A 2DCZA 3O12A 5GLWA 3SEEA 4ZHNA 1W9TA 1WMDA 1CJPA 1PO23 1ST8A 3OBTA 1GKBA 1JZ5A 1HKDA 1YCIA 1PZ9A 1QU0A 2AZ5A 3T30A 2A75A 1GMMA 3O5SA 1PO11 3B5LB 4S2DA 4H7MA 5JXGA 3PMSA 3NJZA 3TNQA 2WT1A 5LRRA 1GFF2 1JUHA 5L9BA 2Q8OA 4F8AA 5LK5A 1RUF2 3J8F2 4LE3A 4HETA 4QPYA 4XF9A 4CUCA 3U0ZA 4IEUA 1V6IA 3CJXA 3HR9A 3I3MA 5CU1A 2WNEA 5IK5A 1O3QA 4NJ4A 1Q8SA 3SKJE 4DXZA 5IK8A 5C3PA 4LBMA 4BIOA 3VHOA 4QX1A 5EZWA 2A3XA 3NNGA 4U36A 5ACA1 1OFNA 2QFEA 4AI8A 1GP4A 3OGGA 4GKXA 4BK5A 4CZSA 3OB8A 4CP0A 4Q4V2 2BVVA 3O1UA 4M3CF 3BYWA 3T0BA 1RUE2 3VZJA 2VAUA 1LODA 1WBFA 3S5AA 4K7JA 2QQKA 4NWVA 3MIDA 1JYXA 2OQ7A 3OBAA 2ET1A 2HWF1 2CDPA 3C7GA 4RGKA 5K4LA 3T4VA 3PLQA 4CA9A 1S0EA 4QDRA 3VD9A 3AP7A 2A7AA 3HIFA 1OC1A 2QQUA 1KQRA 3DPRA 1BEV1 4HXCA 5JCTA 1GU3A 4UF0A 4XC9A 2CU5A 5IVYA 2D6KA 1NE4A 1D2QA 1OD5A 1QH6A 3N35A 3VZKA 2YGMA 3WF2A 5BV6A 1P8JA 5GZFA 4LNVA 1E5SA 1WW5A 1ULOA 2JG8C 1W8ZA 2Y6HA 4UF0B 4A7ZA 1PIV2 2KM2A 4OZXA 2HWF2 2ZGPA 4GWIA 2UY9A 1HXS3 4PJYA 5DUUA 3KF5A 5A3WA 4V1PA 4PBOA 4QB2A 2NLRA 2W68A 4LEJA 3UYJA 1E57A 3VBSC 1VBB2 5A6XA 1QEXA 1KRIA 3ME2A 2J1RA 1LESA 4WM8B 1RL3A 2BTVC 4LE4A 2RR12 4XPVA 5F1RA 4RR3A 3AL5A 5FK7A 2Y6KA 3AZXA 3IKWA 1PM7A 4OMCA 4A6SA 3PIGA 2VM9A 5JI9A 4WM8C 2JX9A 2OS2A 2WDBA 5A3PA 3EXUA 2B46X 2XWBB 3N4MA 2PN5A 2J1EA 2K2SA 2JDNA 4V2VA 4XACA 4BJ0A 4D0QA 2F4LA 1NCRA 4NPMA 4XXPA 4A6OA 2DCJA 2IXHA 1ZZCA 2DVAA 3VL9A 3ZFEC 3ZSLA 4GWMA 2JE9A 1G9AA 5B4NA 1H6XA 3H1WA 2AEYA 4DO0A 2GN3A 3I2IA 2BNNA 2BNOA 2XOMA 4XIKA 1BHGA 4R9AA 2UWBA 5FPZA 5A3TA 1GWLA 2W47A 2OZ6A 3ILFA 4FPKA 4GB33 4Z2WA 4ZU5A 5DZEA 4CUGA 1WW6A 1PO22 3AKTA 1DQ1A 3RGBA 4XUNA 5J7MA 2LALA 2WKKA 1FT9A 3ATGA 3T2PA 1K5JA 1X36A 2O0OA 1AYM2 4N43B 4QAWA 2KA3A 1W6PB 2VZTA 3UK9A 5F3CA 1K42A 2CDOA 1HRV2 2QKDA 1W06A 2VZ1A 1MZEA 4YZ5A 4YVWA 2FMYA 1XJAA 4Q0PA 2EAKA 2BWCA 3EJKA 3AJYA 2VOTA 3P5BA 3POWA 1NKGA 3THCA 1VALA 3I2FA 3VZLA 3WZ1A 4D8MA 4UW4A 1DQ4A 2JIJA 1COV3 2VOXA 3ZYGA 4WVMA 3I8TA 1YI9A 4QU2A 4RQPC 4EYUA 1NYWA 2VY0A 3GCXA 5BNPC 1UOFA 4CEYC 5BUVA 2CNAA 3M70A 2JE7A 5DQ0A 3SXWA 1S0FA 4A7KA 1O8PA 4HN0A 1H1IA 5C7GA 2PHXA 1UY1A 4ASKA 1ZRIA 5FZ7A 3V0BA 4YW3A 4AHYA 1HLCA 2BUKA 4C8DA 1WMFA 2XGXA 1SLLA 4MADA 1REFA 1RVF3 2AREA 3ITQA 1RITA 2JDYA 3IDCB 3OF1A 5H9SA 2PYTA 3D0JA 3AZZA 3HAGA 3NV1A 1ZRRA 3WDUA 4DQAA 4IV1B 3M3CA 1AF9A 1W0OA 1MS0A 3FBMA 2DURA 4RA0A 3WT3A 1NCQB 5JIUA 1LOBA 3URFA 3CKHA 1FMD2 2OUHA 3PNAA 4A7YA 1PNGA 5FZMA 5HI0A 4AG4A 4CDXB 4FPLA 2BNMA 1LCLA 1VBD1 2WABA 1F2NA 1W90A 2DTWA 2X5IC 3CNAA 4W50A 4GULA 4UFHA 1UXZA 2E9QA 4P5HA 4C91A 5A70A 1OLQA 3WP3A 3MIHA 4Q4W1 2Z79A 1ZA4A 4AI2A 3LZZA 4DRRA 4XABA 2D98A 3DF0A 4GKYA 2PLV1 3WNXA 3BTZA 2P3KA 2GMMA 4D6QA 2HWB1 4QXKA 2FDGA 1ZZBA 1TMF1 3OYWA 3MW3A 1ZZ7A 3UGFA 3HBKA 1D4M1 1TNFA 3WDXA 2Q8CA 4TZDA 1XXNA 5EYYA 1QXJA 1PX4A 1SBFA 2EVXA 4XTPA 2PLV2 3X29B 1ASJ2 2AENA 2BW8A 3GM8A 4Q29A 2HKXA 2PMWB 2VBBA 4P9LA 3JD73 3IBMA 1XNDA 4L9BA 1UMIA 2G4IA 3QH7A 5GZDA 5I0RA 2DFCA 2VOVA 3WW4A 1QJEA 4NPLA 1O4ZA 1YFUA 1H4GA 4YZ3A 5A33A 5FO9B 3MF9A 4XQWA 1A6CA 1PO12 3T0DA 3BPZA 2FZ1A 2LROA 4IGOA 1V6LA 5JIAA 2WQ4A 1BK1A 3OJBA 2VULA 4PQ9A 2O8QA 1CAUA 4Q4V3 1DHKB 4XF4A 5APAA 1VBA1 2Y6FA 1AR93 1PK6B 4L99A 4ONUA 2G9FA 3HJRA 1CIWA 2QQOA 1IS5A 2OA2A 2R042 1LOFC 2XQRA 4IE0A 4ES9A 3WX5A 2EXIA 3AP4A 4IL7A 2ILMA 2Q1FA 3AMMA 1R1A3 2XDVA 3JZVA 1T6GC 4BPZA 4FTBA 4AK3A 3J8F3 3KVAA 3SHRA 1GZTA 1PVC2 3I2OA 4EROA 3D3AA 4WV8A 4KWJA 1Y9MA 5AFBA 4NIGA 3I3BA 1HQNA 1QH7A 1CR7A 1QOOA 1BCXA 4QX3A 4NRMA 5AC92 1HW5A 4PLNA 2IFRA 3ACGA 3JU9A 3KZ4C 3K3NA 3DUIA 1O4TA 1OURA 3ZXFA 5J37A 2RDQA 1Z7S1 1W9YA 2QDNA 5FYCA 3WF4A 3LB9A 4Q8LA 5J1XA 1W99A 4M4PA 4CP2A 5C3QA 4YW6A 3Q8FA 5FZ4A 5T52A 3W21A 2FDHA 1G9DA 4Q0UA 1SFPA 3VKNA 1RHI3 1H8TB 5JMOA 4NRQA 2ZBJA 4LULA 1G7YA 3VBHC 1Z7S2 1IS6A 2PHDA 4AVVA 5HBAA 2D3PA 4JTNA 5KHGA 1H8TA 2OPKA 3PU3A 4OHXA 1YRZA 5IYYA 2D3RA 1QGLA 1WGPA 1MS4A 3POFA 4FPHA 5IFPA 2XKOA 1POV0 3U4SA 3NL1A 3WUCA 3C7OA 3SH3A 2R7EB 4AGGA 2WUHA 4QQPA 3J4UH 5DG1A 4LBQB 4A45A 5A1FA 5CAZA 4AZZA 2YGLA 4OZOA 4FFGA 2ES3A 2P3IA 4W6WA 5LBFA 3OEBA 1QJY2 5FMCA 1OMIA 3E6DA 1DYKA 1VBC2 1N1YA 2OVUA 2ZGKA 2WA3A 3B94A 4IV3A 4Y24A 1HV0A 2B9VA 3BPSA 4BMBA 4AQ2A 1Q5OA 2J42A 3SCHA 4NHYA 1MQTA 5CB7A 2WO7A 5EQUA 1QJY1 1RTVA 5JSRA 2W94A 1RHI2 2ZMLA 4S2HA 4ZPIA 3CMGA 3D8CA 1VR3A 4QQLA 1LGNA 5G05L 4AAPA 3W5NA 5AVPA 4FXGB 5I91A 4MGIE 1RUG2 3RDIA 3OUJA 4XDPA 4Y1ZA 1XOYA 2HYKA 2R16A 4J1XA 3VZNA 2P34A 3GZEA 4YG6A 3GNEA 2EA7A 3C2UA 1LTEA 2ET7A 5EFUA 5JOYA 3FC0A 1KGYA 1EPZA 2AEZA 4OLLA 3AK0A 3M2MA 5T5JA 2WT2A 3WDWA 3MIGA 5KC5A 2D43A 4MGKE 1C1FA 1OT5A 3KV6A 5C9AA 1ZZ9A 2MEV3 4NHMA 4P14A 1HJFA 2VTFA 4WZFA 3VUOA 1NQJA 2VQTA 2WJSA 2P3JA 3WDYA 3DCQA 5C9AB 2GN7A 4OI1A 1WD4A 5FMDA 1UWWA 2ZHLA 4P9IA 3VL8A 2WNOA 3EYPA 2ZGLA 3MPPG 4FPJA 5FY4A 2AACA 4JDOA 1FX5A 1LB2A 1W28A 3ZDVA 2RS12 1VLNA 3MBWA 1LOAA 4NO4A 3ZKYA 2QUOA 3UETA 4EN9B 5FK8A 5DUXA 5BNNC 4NMIA 2XH6A 1FMD1 3S57A 1VMHA 1FNZA 2GNBA 2VVFA 4OI0A 2WYSA 4P9JA 3ZR5A 3RZKA 4TLFA 3E6BA 3OTFA 4BH9A 3WQ1A 4XEZA 1ASJ1 3E5QA 3QCWA 1LKNA 4DIQA 3O7OA 2MNGA 3MGUA 5JWPA 1M4WA 4P00B 4KG8A 4R9BA 3BTAA 3CL1A 5E88A 5FYBA 4A42A 3MW2A 3MZHA 2VNRA 4FPGA 1IZ3A 4IGPA 2ZX4A 2FCTA 2OT7A 1UXXX 3CIHA 1NY71 3H0OA 1N47A 4DB5A 1B09A 4M4RA 1B35A 2JD4A 4ISQA 4W6YA 3I59A 4X8PA 3K4ZA 3WNKA 2HWB2 4TN7A 2IFWA 2XL9A 4FP3A 4Y26A 3ZFEA 4COUA 4B1MA 2JDHA 3APBA 3RG0A 3GCWA 5FZEA 1QXPA 1COV1 3FFZA 2ZEZA 5BXXA 4Q4X3 1DCSA 1KJLA 1UPSA 2ZGMA 3ZFEB 2VVEA 4XDOA 3WQBA 4CEYA 4KL1A 1YQ8A 3WD5A 4GIQA 4Z2AA 1C8M3 2CWSA 3LFIA 5CEHA 3FX3A 2WNUA 2X53S 4XJ8A 4E8DA 3WSOA 2ZABA 4GH4B 2RJ2A 4F3JA 1RJ7A 3RJ2X 2Z2SB 3KV4A 4Q4Y2 5JR2A 3M7AA 4CCNA 1RVF2 1FNYA 5L7OA 1TVGA 4BB3A 2FZ2A 4JX0A 4ATEA 2BERA 5JSPA 3THPA 1LEDA 4H7LA 1ZNPA 4EZHA 1CAXB 2W2IA 3AP9A 3NAPC 1F9KA 2QQIA 4YZ1A 1SFNA 4N43A 1QJX3 1HB1A 1VBB1 4IEZA 3ORJA 3WQ0A 3VN4A 4YZ2A 3H3UA 4YW4A 3CZJA 1J3QA 3NAPB 1GOHA 5GLZA 4UFJA 1MZ6A 3I4IA 4HG6B 5IW0A 1BXHA 3ENRA 3ZFFA 1GUIA 1RUD1 4E4DX 5LBBA 2FDIA 1PVC1 1ALYA 1RXFA 1AX0A 3KSCA 2EAAA 4Y5TA 2ZGUA 1HX6A 2YV8A 1YO8A 2JEMA 1IS4A 4DY3A 4NR1A 4PT6A 5IHRA 1AUYA 1LHVA 4MGSA 2VMCA 3IIAA 3C7HA 5T5LA 1MVQA 1FOD1 3CO2A 1LJ7A 5T54A 3O1RA 3VGIA 3LGRA 4HK9A 1AJKA 1V0AA 1R1ZA 2Y6GA 4XHXA 1J84A 2F17A 2H6CA 4LITA 5C70A 5KR7A 1Q8VA 4ISRA 4CVUA 1KITA 3PUQA 1IOAA 3KGZA 3BB6A 2VZ3A 1NT0A 5I8TA 1W8OA 4RGAA 1NCQA 4JDMA 3B9IA 1HN0A 2A6VA 4LORA 1O5UA 4Z8BA 4TWTA 2GH8A 5CYYA 4R52A 4HSLA 2E7TA 3KB5A 1LNSA 2HWD2 2XVLA 3JBG3 3K3OA 2HEVF 4DUXA 1HXS1 4BXFA 1ZREA 2GALA 3J9SA 1BBT1 4KGQA 1LOCA 5T5PA 3WW1A 2XJUA 4AQSA 1JYIA 2C9AA 3VD7A 4FPCA 3VDBA 3RZMA 2NYYA 2JENA 3AJZA 1NOVA 3CHXA 3LE0A 2HWB3 3CJIB 2D3SA 5LA1A 3BOWA 4UYBA 1BQPA 2B45X 4XCAA 1H8VA 4E2GA 2ZMNA 3SEPA 3RZZA 1HXS2 2YG0A 5FMBA 3ZXAC 3NW4A 4MXVA 3ES1A 5J48A 5LCWL 3P3PA 1HB4A 5L19A 1GZWA 5CKNA 1VBB3 1H2MA 1AR62 5FQ0A 3MIFA 1H9WA 2PFWA 5D8AC 2ZGSA 1GZWB 1WCQA 2GSYA 1VP6A 3A23A 3EBRA 4JGYC 4LIVA 2P5BA 5C8CB 1JZ2A 1PIV3 5KWRA 4QQHA 4XFCA 2A71A 5FPLA 5LY2A 2ZAHA 5FP7A 5C8CC 5F2WA 4CPBA 3IIIA 4RSUA 3F95A 1OF3A 4P9GA 4OUEA 3TBDA 2RS13 1O8SA 1GYKA 5A7SA 4IEWA 2KXLA 1REEA 4M3CA 5C3OA 1IQAA 3OPWA 1CAUB 1NA1A 2VMEA 3MFCA 2IXIA 3VKFC 2DVBA 4Z92B 4HKWA 1CPNA 1RUE3 1NLQA 4XYXA 2RJLA 1W8TA 2QZ2A 5FPAA 4NAOA 2VVDA 1PX3A 3WNNA 3DECA 2OW4A 2WBKA 2QQNA 2XBO2 1X33A 1PMIA 1RUF3 5FMOL 5ISLA 2GP3A 2QQJA 5A3UA 1AR71 1BKZA 5FCCA 5I8SA 1W05A 4XIOA 2UWAA 3DGTA 4M00A 3P6BA 4AR2A 4OHVA 1HN1A 2V09A 3OOXA 1BK0A 1IPSA 1DGRN 3USSA 3MIEA 2A6WA 3ZXLA 4ZONA 5T50A 3EMRA 1TME3 5JXHA 5GZGA 2QQWA 2XBO1 4YM0A 3SH4A 2XUMA 4AVSA 4B3NA 1AR72 3PHMA 4D6RA 3I3EA 2JXAA 2QQLA 2QJVA 2WO2A 2HYXA 1FPN1 4XILA 2VXRA 3QD6A 4META 2WQZC 5FWEA 3KCYA 4JHZA 5E89A 2E6VA 2LTNA 2WWJA 4Q1RA 3POGA 4LO4B 3TB0A 4I30A 4OUSA 4AGVA 4RFT0 1JS9A 5F3EA 2Z42A 1WLCA 1REDA 3DN7A 3LKJA 3OPTA 5A3LA 3ON7A 1LRHA 3TEXA 4Y22B 1POV1 2MHFA 2WWUA 4CSWA 3VBHA 5HXMA 5DUVA 3FFQA 5FREA 1AR81 1VRBA 3V0AA 1JHJA 4Z1VA 5L7OC 1K5MB 2A3YA 2V4AA 3HWJA 1UYXA 4IV1C 3H8XA 3AVRA 3M1HA 4CDWB 5GLTA 5IUQA 3TEWA 3V0AB 1IQDC 1MZ5A 3AMNA 4YARA 3I97A 3VDCA 1NLRA 1QQP2 2RDNA 2JJ6A 1Y9QA 3B93A 3G7DA 4XFHA 1HV1A 3S7EA 3AFGA 3WINE 4BHPA 3KV9A 3TWIA 3ACIA 3FHAA 3N7KA 4M0NA 1KJRA 4L2NA 2VMIA 4HVOA 1YNAA 2BZDA 4CDXC 4YM1A 4PLOA 1UIJA 4LA3A 4IV1A 4XMIA 2X5IB 4Q4Y1 4LXLA 3RVHA 1YC61 3ILNA 3FWEA 1HRI3 1WW4A 2OIIA 5FV3A 2WWSA 4N8MA 1JHNA 3I2KA 4K6BA 4JTOA 3O14A 4RQPB 5FUPA 4HFSA 3ST7A 1TE1B 4NOTA 3HQUA 2BDRA 1SFYA 2XKPA 2X29A 3FMGA 4YVWC 3TRSB 4BQ5A 4XF1A 4EZ4A 4XMAA 2XVKA 3RZHA 1ZZ6A 3NNMA 2G9ZA 4Q4X2 3U1XA 4IUGA 4B4QA 5AC93 4MHUA 1ULGA 2YB7A 3VBUA 1ULFA 1POQA 2IXKA 4G4FA 4DY5A 1F31A 3UL2A 1KS4A 2ETEA 3IN9A 4NAMA 2VUAA 3JQWA 4MSVA 1VBE2 1JBCA 1DLLA 3OYWB 3LF7A 1PGW2 3G6JB 5ERLA 1OLME 3VDDA 4GQ7A 5HXVA 1QJU3 1VBC1 4I0WB 2RMU1 3BGAA 3ZSJA 1PO21 1JZ8A 5CG9A 4PHZA 4N9HA 5IWFA 2WZR3 2Z4FA 4JRLA 1RIRA 1ZA7A 3HBZA 5EJ1B 3U14A 3VBFB 5KXEA 1DG6A 1FV2A 4JKKA 4BLIA 3AKRA 2XHNA 3MHZA 4GH4C 1UW8A 2E31A 2WS92 1JH5A 4BE3A 1W8HA 1CQ9A 5FY1A 4Y33A 5JOZA 1RUD3 2XLGA 1ULPA 5A33B 1YI7A 4JHTA 2RS53 2SLIA 4AEDC 2WZR2 3N7JA 3NNLA 5FY0A 1W6QB 3OY8A 3POEA 3ZN5A 1W6OA 4CRQA 1KD7A 5FWJA 4ATFA 1LAJA 4ZS2A 4EN7B 3ACHA 4XFGA 3RSJA 4W6XA 1BBT2 3B9CA 1N3QA 2TBVA 3Q8AA 4CDUA 1F4AA 2XB6C 1ND3A 5A7WB 3B3QE 2EICA 3NSTA 4J25A 1UZVA 2VMFA 1ND3B 5A7WA 1ND2A 2JDUA 3AM2A 3HEIA 2J1VA 1GOFA 1AX1A 1B35C 3OG2A 1WMEA 2DU0A 3W59A 3OD0A 1RUG3 3WDVA 3ELNA 1SLBA 1YQ5A 1UZ0A 1U5IA 3NJXA 2RV9A 2W95A 2VCCA 1GOGA 2ZOEB 3H7JA 2JG9A 1VBD2 2HBUA 2IXLA 5EIYB 3A7QA 1CX4A 2RS11 4RGGA 2PA7A 1KDKA 1AZDA 2ZEYA 3K4DA 4ZZ5A 3QBQA 5CADA 5A6YA 4QPIB 4W4ZA 2OX0A 1RUJ1 2D40A 2JG9C 1SZBA 4CU7A 2Z69A 1EAH1 2E32A 3MV11 3MI8A 3RMXA 3WG3A 1X9PA 3KHBA 2DVGA 5F9TA 1QQP3 2O1QA 4MLOA 2VBDA 3B00A 5CNAA 1QJX1 3ZMOA 2NP0A 3FZ3A 1PGL2 3TNPB 1Z78A 3KVBA 1CZSA 4YGEA 5FP9A 5DAVA 5BNOA 3GZAA 3NAPA 2PELA 3OUHA 4FXKB 4CCOA 4MZUA 5M0TA 2PQSA 1ZBE3 5FJKA 1DP0A 3H50A 3EHKA 4LUMA 1OH4A 2GH2A 4ZKTB 4W65A 4QGNA 1COV2 1YXWA 3NKTA 2XJVA 4JDNA 3K77A 1MS8A 1Q56A 1NQDA 2JKBA 2R063 5DDJ2 1W6MA 3BOPA 2CSGA 3AYDA 3CU7A 1U5YA 3I54A 1LULA 1FOD3 4BMEA 5FKBA 3RWKX 5ACA2 1E5IA 1VRH3 1JYNA 1MQTB 4RD7A 1UO9A 1W6MB 3AXEA 4QGLA 1CZVA 2R072 3N9PA 4XJAA 5F7UA 2XJRA 2GU9A 4LBQD 1UOGA 4FAGA 3T2OA 1S0JA 1OF4A 4LO8A 3R6SA 3T1MA 4A3XA 2NM1A 4LK6A 1H2KA 2WZEA 1TME2 1S0GA 2DVFA 4LPLA 4XOGA 1XYOA 4Y1VA 5LZ6A 1V9U1 3AP6A 3LPGA 3U11A 4DPNA 2OKXA 2YY1A 4ITCA 2ID4A 4CP9A 2VOKA 4NWWA 2P37A 1ZRCA 2OPWA 1PVC3 1QMJA 2PQQA 2VQAA 3FBYA 3J7NA 2I45A 4XFBA 3KD4A 2XBO3 3DKQA 1JZ7A 3JXSA 1H9PA 2W5FA 3QOPA 4O65A 3VLBB 1UY3A 1IPJA 1RMU2 2JDMA 3PVOA 4JQRA 3IM0A 4JVAA 4Q5OA 2Y38A 1V6MA 3CJIC 4A2UA 2JG8A 1U5XA 1LOFA 1NXMA 5LEKA 2XLAA 3ACLA 2ZS6B 4Y1UA 1W8NA 2IXJA 4XVHA 3CJIA 1WUVA 2PHLA 5FPXA 2XJTA 2HWC2 2YHJA 3W5MA 2ORZA 4KBBA 3NRUA 1AYN3 4YNIA 5FZDA 3VV1A 1QOSA 3T3YA 2R1BA 3T0AA 3M3EA 2JIGA 4L8QA 5L36A 1EUTA 3HNBM 2YPJA 5FQ0B 3VHNA 4J6GA 4Y1XA 2JB4A 2B8MA 2J1SA 4MGYE 4QPGA 3LA3A 1NCRC 3H8OA 1I3HA 5LA0A 2UY8A 5HPOA 3RYPA 5FY9A 4QPGB 1VE0A 1WLTA 2FCUA 3FHQA 4QDQA 4WM7B 3VKMA 4ASMB 4WM8A 2Y60A 1C3HA 2VMGA 4BQ2A 4OI4A 3Q8CA 3CEWA 4KU8A 1RUH1 4XW3A 1L7LA 2P6CA 4RHV2 4A44A 1TMF3 3HVDA 1MS3A 2E7QA 4DZGA 1FATA 4RL7A 1NA1B 1C1LA 2K46A 4UFLA 4YFWA 2WZR1 3ZYFA 5BNNA 1VBE1 3T1LA 5JUVA 2WL1A 5FP3A 3VDDC 4O9GA 4UOJA 4CCLA 3AP5A 2GC0A 4QHBA 1POV3 5BNNB 3VD5A 2XQXA 1MEC3 2WNVA 3GHMA 3LEGA 4CDWC 3L2YA 4CDUB 3GHNA 5JOXA 1BEV3 4A41A 1HQWA 4JGZC 3V56A 2DCYA 3RRDA 3IMNA 2F4PA 3SLIA 4AI3A 2PHTA 1XNBA 3OGSA 2PXJA 2WNVB 2WO1A 3R0RA 5FZ0A 4GH4A 3UV9A 1TNRA 4BOWA 5FAXA 1AR61 2R30A 4AEDB 1W6NB 1LEMA 2VC9A 5KXDA 1DGLA 2BJSA 4K40A 3HPNA 4FTSA 1HB3A 2HEWF 4XBNA 4YW2A 2ZHKA 4AEDA 5D21A 1AX2A 4I0BA 3AFKA 4IEVA 1XNTA 3S5QA 5J98B 3ZYPA 1PNFA 4Y5SA 3N7MA 1CAXA 5F3IA 1ZBA1 2EXKA 2QE3A 5FLIA 3I3DA 4YVWB 1PVXA 3NO8A 3WG2A 4Y4RA 3DV8A 5IAVA 4EV0A 4MYEA 2P6HA 3ZPYA 5BNPB 3WR0A 5FBZA 4TYSA 3M8LA 1GQHA 1RUJ2 3TYJA 3ZSMA 4FP2A 2BU9A 3N36A 1ND3C 1XBFA 3MDPA 4MGZE 5JZGB 4GMP3 5BNPA 1NG0A 1BZWA 3B01A 1UYYA 1J3PA 1YIPA 3GALA 2MPFA 2JDAA 5IT6A 3PVEA 1F35A 1ND2C 4R4ZA 3RFRA 4AI9A 1CGPA 5SV5A 4BZ4A 1U12A 1DF0A 1QJX2 3I2GA 5K0UB 3O0VA 4EN8B 1W8UA 5J3UA 4HPKA 3ZXJA 2CL2A 5EWSA 4WBBA 1G86A 1WD3A 4P5YA 1AYM3 1Z0HA 4QPIC 2X05A 1ZRFA 1RC6A 1OLRA 5FXXA 4CCKA 1UPIA 2DV9A 1VRH1 2DCTA 2RDRA 2BOIA 4LHKA 3ZM8A 5JR7B 1ODNA 4Q4Y3 3ZIXA 1D4M2 2JD9A 3W58A 2W46A 4QX8A 4LUKA 2FHRA 3K75B 1YWKA 2BYVE 3O1VA 3N3HA 2C5DA 4OHWA 4QPWA 3D0SA 1ULDA 4CDXA 2YC0A 4HMZA 3U78A 1C8M2 4YPJA 3RJRA 2Q5TA 4JKMA 2Q30A 4WVZA 1O3RA 1DYPA 2ZX3A 4GALA 4D94A 4JKLA 2IC1A 4FFIA 1XYPA 4XJUA 1IG3A 3PUHA 4XHBA 3ZXDA 4HSJA 1BEV2 3I2JA 1GQPA 4K20A 5FJHA 2BWAA 1RUI3 5EYXA 2JDPA 1QWRA 1XRUA 1X8EA 2TUNA 2W0XA 2JWPA 4HZFA 1C5IA 2VUJA 3K46A 4AFDA 2UU8A 1A8DA 3P3NA 5FZ1A 3IDEA 5A7NA 5FZCA 4X8NA 5J36A 4AGRA 4N9IA 1OVPA 3KV5A 3KF3A 1RUE1 4I09A 4BQWA 3GBGA 1MPXA 4Y5Z0 3KCCA 3ZFGB 1QQP1 1LECA 1UKGA 2O8OA 1D0GA 2FD8A 2ZGQA 3LEKA 4MX3A 4XFIA 1AL23 2CV6A 2ARCA 2HWF3 1RMU1 4QWNA 4KI5M 1GZCA 2NZ9A 5FYHA 1ACCA 3GBWA 3LDBA 5LBCA 4BWOA 1OHFA 5C8CA 1UZWA 3BODA 3MYXA 4NHKA 2UYBA 2YZ4A 1OH3A 2YDEA 1W3VA 3WNPA 3PDQA 3U37A 1OD3A 4E4SA 4GJZA 2VCMA 5AC91 1O7FA 1C28A 4GXLA 4K21A 3WF3A 3ETPA 4MUVA 5A32A 1RXGA 2GNDA 2VNOA 3KS7A 2ENRA 2EIDA 1GICA 3MW4A 2GP5A 3PJQA 4IERA 5DAXA 5F5QA 1AXYA 5A7QA 4AEMA 4JC1A 4YLZA 2R061 3E6CC 3H1YA 4QDSA 5A80A 5JOWA 2RS33 3OY8B 2R6QA 4AEKA 1J83A 2WYFA 4QHOA 3WLUA 4D7TA 2RMU3 3ABZA 4N53C 1U5ZA 3K4AA 3UESA 1HQLA 1CVNA 3CZUA 1I5PA 3BALA 4RR3C 3WF0A 4Q26A 4QM8A 4XDQA 1H1MA 1KS5A 1N3OA 1Y4WA 2EXHA 3IWZA 2CAUA 2ZZQA 1Y3TA 3TN92 1DBNA 3ASIA 4Q0VA 3VBSB 3S30A 3MFAA 5LASA 5FFOC 2ZEXA 3MLKA 1LHWA 2YXSA 3POYA 1R64A 2Q0AA 5FXZA 5GKAC 4BISA 5A7PA 2DDUA 2QZ3A 3EO6A 4XUTA 1KFXL 3OUIA 1E5RA 2BFUL 3VBSA 1WZXA 4BQXA 4BQ4A 2JG9B 3I3QA 3OBRA 5B4XA 2Y8KA 4Y3OA 5EXOA 3BCWA 3VBOC 5ABJC 5LK7B 4RFRB 4GZ9A 1RUC3 2CGNA 1JOBA 2ZHNA 2R073 3WEZA 4IDZA 3ZOIA 4YSFA 2VBPA 3CBNA 1BJQA 3HQXA 4MO3M 5A3OA 1K5MC 4IV3C 2LM3A 3SISA 1JUIA 3INAA 4LO7A 4WVWA 5I8YA 1DGRA 1OBNA 4ZU4A 2I74A 4IEPA 5FTTC 3I7DA 4YW7A 5GZEA 4Y22A 4DFSA 4EJRA 1H2LA 4FPFA 4AI1A 2Z5WA 2ARAA 3RYKA 3BVCA 2DUOA 4LBQA 4LHSA 4LBKA 2RVAA 4PDWB 3PIJA 5KXBA 1K5MA 3PL0A 3MF6A 1OPMA 4JCKA 4G9SB 4P02B 3FHIB 1STMA 3SKVA 5BNOB 2WNVC 1KFUL 4CDWA 1TEIA 4P9XA 4PDWA 1LHOA 4YYOA 5A6QA 5FZGA 2GDFA 4LLFA 4AFMA 2HWE1 2QVSB 1OQEA 5DAWA 3RMYA 2EIBA 4YM3A 4IETA 3GJAA 5E1RA 3ALQA 2IVIB 5FIXA 3M3IA 2CWMA 1WCKA 3VKOA 1ZBA3 4XURA 1YFYA 3PUSA 4KG0A 5EJ3A 2YC2A 2WQ8A 5FZOB 5TSWA 3WQ7A 2B42B 4AL9A 1HJGA 4FO9A 5ANQA 3U75A 1HB2A 1AYN1 1WMXA 4RQPA 1L3JA 3JQXA 1S2EA 1EV11 4LKFA 3WVJA 1QF3A 5CBLA 1EUUA 1OA2A 1U0AA 1D2SA 4LT5A 1VBD3 5IVCA 2VNGA 1H4HA 4FCAA 3ZKUA 4YGDA 1JODA 1R082 2R0HA 3LWCA 3THDA 4LJHA 4YRDA 4M0HA 3LPFA 4AVTA 1W03A 1UX6A 5LW9A 4K1YA 2ZX2A 2K9ZA 2AUYA 2DCKA 3VBUB 4FI9A 2ADDA 1SLIA 2KR2A 4QB1A 4AVCA 1WA4A 4FSJA 2Q8DA 3WV6A 5HCAA 2DF7A 3K2OA 5F39A 4GD4A 3MLJA 1TG7A 1XPWA 2J1AA 4XAEA 2R043 2VO5A 5FZFA 3VBRA 4OQ8A 3NQHA 3VDDB 3Q8BA 3DXUA 4EN0A 2PHFA 1VBA2 2WFF3 3VDAA 5KHKA 2JG8B 1RUOA 2XUEA 4IEYA 4CDUC 1XC6A
chains in the Genus database with same CATH topology
5FP9A 5FV3A 5FYZA 2YU1A 5E6HA 3N9LA 4CCOA 4DIQA 5FUPA 5FXWA 5A1LA 5FJKA 5FZ8A 5FYBA 3K3NA 5FY7A 3N9QA 4IGPA 4EZ4A 2OT7A 3PU8A 5FXVA 5F3IA 5FYCA 5FZIA 3N9OA 4CCMA 4LIVA 4Y4RA 5FZ4A 4TN7A 4ASKA 5FZ7A 2P5BA 4EYUA 5F3CA 5FPLA 2YBPA 5LY2A 3N9PA 4GAZA 5FXZA 4C8DA 4BISA 5FPVA 5FP7A 5FZEA 5F2SA 5A7PA 5F2WA 3PURA 4XDOA 4GJYA 3PU3A 5FZHA 5CEHA 5A7SA 4Y3OA 4AI9A 5FZ3A 5IVFA 5FZAA 5LY1A 3OPWA 5IWFA 3U4SA 5LWBA 5FP8A 4IGQA 5A1FA 5IVJA 3KV4A 3DXTA 4CCNA 5FZMA 5FPAA 3AVSA 5F5CA 2XMLA 5FZ6A 5FYYA 5FXXA 4CCKA 5FZ9A 5FY1A 4Y33A 5A7OA 2OQ7A 5ISLA 5K4LA 2GP3A 4EZHA 2W2IA 2OQ6A 5F5IA 4QX8A 5FZBA 4UF0A 5FY0A 5IVYA 4URAA 5FZLA 4QXCA 5FBJA 4BU2A 3U78A 5FWJA 4HONA 4UF0B 4D6QA 5FYSA 5FYIA 5FZGA 5IW0A 5A3WA 4D6RA 5FPUA 5FZDA 2Q8CA 3UYJA 4AAPA 4D6SA 2YPDA 5FYMA 5A7WB 5FWEA 5FJHA 3ZLIA 2YBKA 4XDPA 3LD8A 5IVVA 2WWJA 3AL5A 4NUBA 4QXBA 5FYTA 3N9MA 5A7WA 5FZ1A 5FPBA 3PUSA 4HOOA 5FZOB 2OS2A 5ANQA 5A7NA 3PUAA 4LIUA 5FZCA 5IVBA 5F5AA 5F3EA 3NJYA 3OPTA 2YBSA 3KV5A 3PTRB 5FY9A 5A3PA 5IVEA 4QU1A 4V2VA 3KV6A 4LITA 2WWUA 2VD7A 4CSWA 5KR7A 5IVCA 5FY5A 3PUQA 4IGOA 4QWNA 1VRBA 3RVHA 5FUNA 3AL6A 4V2WA 5FZOA 5LW9A 5FYHA 2OX0A 3LDBA 4DO0A 4QX7A 3N9NA 4QXHA 5F37A 4CCJA 3AVRA 5A3TA 5FYVA 5FP3A 5F3GA 2Q8DA 4CCLA 5F32A 3PDQA 3K2OA 5F39A 5FY4A 5A3NA 5FY8A 4GD4A 4GJZA 5FYUA 5FZKA 3K3OA 3KV9A 5FZFA 4CUGA 2XXZA 2XDVA 4BXFA 3DXUA 2GP5A 4E4HA 5A7QA 2YU2A 3KVAA 5FP4A 2PXJA 5FZ0A 2Q8EA 2XUEA 4LXLA 3KVBA 5A80A 3ZPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FP9 A;  5FV3 A;  5FYZ A;  2YU1 A;  5E6H A;  3N9L A;  4CCO A;  4DIQ A;  5FUP A;  5FXW A;  5A1L A;  5FJK A;  5FZ8 A;  5FYB A;  3K3N A;  5FY7 A;  3N9Q A;  4IGP A;  4EZ4 A;  2OT7 A;  3PU8 A;  5FXV A;  5F3I A;  5FYC A;  5FZI A;  3N9O A;  4CCM A;  4LIV A;  4Y4R A;  5FZ4 A;  4TN7 A;  4ASK A;  5FZ7 A;  2P5B A;  4EYU A;  5F3C A;  5FPL A;  2YBP A;  5LY2 A;  3N9P A;  4GAZ A;  5FXZ A;  4C8D A;  4BIS A;  5FPV A;  5FP7 A;  5FZE A;  5F2S A;  5A7P A;  5F2W A;  3PUR A;  4XDO A;  4GJY A;  3PU3 A;  5FZH A;  5CEH A;  5A7S A;  4Y3O A;  4AI9 A;  5FZ3 A;  5IVF A;  5FZA A;  5LY1 A;  3OPW A;  5IWF A;  3U4S A;  5LWB A;  5FP8 A;  4IGQ A;  5A1F A;  5IVJ A;  3KV4 A;  3DXT A;  4CCN A;  5FZM A;  5FPA A;  3AVS A;  5F5C A;  2XML A;  5FZ6 A;  5FYY A;  5FXX A;  4CCK A;  5FZ9 A;  5FY1 A;  4Y33 A;  5A7O A;  2OQ7 A;  5ISL A;  5K4L A;  2GP3 A;  4EZH A;  2W2I A;  2OQ6 A;  5F5I A;  4QX8 A;  5FZB A;  4UF0 A;  5FY0 A;  5IVY A;  4URA A;  5FZL A;  4QXC A;  5FBJ A;  4BU2 A;  3U78 A;  5FWJ A;  4HON A;  4UF0 B;  4D6Q A;  5FYS A;  5FYI A;  5FZG A;  5IW0 A;  5A3W A;  4D6R A;  5FPU A;  5FZD A;  2Q8C A;  3UYJ A;  4AAP A;  4D6S A;  2YPD A;  5FYM A;  5A7W B;  5FWE A;  5FJH A;  3ZLI A;  2YBK A;  4XDP A;  3LD8 A;  5IVV A;  2WWJ A;  3AL5 A;  4NUB A;  4QXB A;  5FYT A;  3N9M A;  5A7W A;  5FZ1 A;  5FPB A;  3PUS A;  4HOO A;  5FZO B;  2OS2 A;  5ANQ A;  5A7N A;  3PUA A;  4LIU A;  5FZC A;  5IVB A;  5F5A A;  5F3E A;  3NJY A;  3OPT A;  2YBS A;  3KV5 A;  3PTR B;  5FY9 A;  5A3P A;  5IVE A;  4QU1 A;  4V2V A;  3KV6 A;  4LIT A;  2WWU A;  2VD7 A;  4CSW A;  5KR7 A;  5IVC A;  5FY5 A;  3PUQ A;  4IGO A;  4QWN A;  1VRB A;  3RVH A;  5FUN A;  3AL6 A;  4V2W A;  5FZO A;  5LW9 A;  5FYH A;  2OX0 A;  3LDB A;  4DO0 A;  4QX7 A;  3N9N A;  4QXH A;  5F37 A;  4CCJ A;  3AVR A;  5A3T A;  5FYV A;  5FP3 A;  5F3G A;  2Q8D A;  4CCL A;  5F32 A;  3PDQ A;  3K2O A;  5F39 A;  5FY4 A;  5A3N A;  5FY8 A;  4GD4 A;  4GJZ A;  5FYU A;  5FZK A;  3K3O A;  3KV9 A;  5FZF A;  4CUG A;  2XXZ A;  2XDV A;  4BXF A;  3DXU A;  2GP5 A;  4E4H A;  5A7Q A;  2YU2 A;  3KVA A;  5FP4 A;  2PXJ A;  5FZ0 A;  2Q8E A;  2XUE A;  4LXL A;  3KVB A;  5A80 A;  3ZPO A; 
#chains in the Genus database with same CATH topology
 3V65 A;  2ZA9 A;  5DDJ 1;  3B7M A;  4ZXK A;  1Y9G A;  3QAC A;  2YU1 A;  5BY5 A;  1QNW A;  5E6H A;  5T55 A;  2DYC A;  3RZL A;  3UKN A;  4NHX A;  2D93 A;  5FZ8 A;  1UF2 C;  5FOJ B;  4E4Z A;  3K51 A;  4HKO A;  1EYB A;  2J1T A;  1SDD B;  2DUP A;  5KHI A;  4MXW A;  2C4X A;  2WS9 3;  3LDR A;  2O14 A;  4B4P A;  4C1W A;  3NMB A;  3MLL A;  1AR8 2;  4IQP A;  1W6Q A;  4B8E A;  3AKQ A;  4AF9 A;  4YVS C;  3OSD A;  1VBA 3;  2V5D A;  2WFF 2;  4HN1 A;  5F2S A;  3WNM A;  1TQ5 A;  2I07 B;  4LLO A;  1QJU 2;  4WM7 A;  1OA4 A;  4YGC A;  1B35 B;  1XSR A;  2XG3 A;  3AX4 A;  4O7X A;  3I59 B;  2UUR A;  1O3T A;  4H2A A;  1W39 A;  2EXJ A;  3J26 N;  4XUO A;  3IMM A;  4EE2 A;  5FZ3 A;  3BIE A;  3SH5 A;  1CON A;  4M01 A;  1FYU A;  1LHU A;  4OQ9 A;  4COZ A;  4QHZ A;  1ND2 B;  1RUI 2;  4LHL A;  1SDW A;  3ZXK A;  1NX9 A;  4AW7 A;  3BN6 A;  5FYY A;  4N43 C;  3OGV A;  2PAM A;  3OGR A;  4AAX A;  4ORF A;  4D69 A;  1PIV 1;  5A7O A;  2WLP A;  1YFW A;  2E63 A;  2HWC 1;  2W1W A;  1FMD 3;  4JAA A;  2OQ6 A;  3IDA A;  3LFM A;  3AKS A;  1LGB A;  2VTX A;  2D6P A;  4IE6 A;  4AEJ A;  1ENR A;  1RUI 1;  2CYF A;  2D97 A;  3NV3 A;  4OYU A;  4XJZ A;  1JZ6 A;  4QPI A;  4E2S A;  2D5H A;  4QXC A;  2CGO A;  5IAT A;  4AI0 A;  1VPH A;  2MEV 1;  2RR1 1;  4PLM A;  4MGT A;  4QQ2 A;  3A0N A;  4Y1Y A;  1LHN A;  4AVB A;  3ZO0 B;  1SBE A;  4GWN A;  2BV4 A;  2FQP A;  2FDF A;  5EPA A;  3AYA A;  2ZKL A;  2OUJ A;  5JDB A;  4URT A;  5LA2 A;  4DS0 A;  1PGW 1;  3E97 A;  2VE1 A;  4QKN A;  3WY6 A;  4HKL A;  3SNM A;  3I2H A;  1FAY A;  4UWD A;  2WAO A;  1UIK A;  5CKM A;  1NZI A;  4YFZ A;  4FPY A;  1Q8Q A;  4HVR A;  4QB6 A;  3ZFF B;  1MAC A;  5DG2 A;  1Y43 B;  2XON A;  1W2A X;  3OPZ A;  3ZSK A;  2YBS A;  1UOJ A;  3PTR B;  5CFD A;  5DXD A;  5IVE A;  5I0S A;  1ODM A;  3BU0 A;  5SV8 A;  1F8V A;  3SCG A;  4CYD A;  1UOB A;  2WS9 1;  3ZIW A;  2PAK A;  3ETQ A;  1PMJ X;  3SQO A;  2NN8 A;  1N3P A;  2QTW B;  2VZS A;  4MOA A;  1OOP A;  4C90 A;  4CU8 A;  1MS5 A;  4H55 A;  1I5Z A;  3THT A;  5K0U A;  5C33 A;  3TAY A;  1GP5 A;  1H6Y A;  3DKW A;  1RGS A;  1AYM 1;  1J1T A;  2RS3 1;  1GNH A;  4K3U A;  1OOP B;  4Z82 A;  1OLM A;  1W2T A;  4H3W A;  5F6K A;  5A3N A;  2E26 A;  4N7U A;  5K8S A;  4LQR A;  2FDJ A;  3BTY A;  2PHU A;  2GC2 A;  4JZR A;  3VD4 A;  4E4H A;  2HWE 2;  2YU2 A;  1AR7 3;  5FP4 A;  1XNA A;  3HN1 A;  1UCX A;  3VKL A;  1X82 A;  1VMJ A;  2RM2 1;  3KGL A;  3ZN4 A;  2GMP A;  4BQY A;  5F6L B;  3TN9 3;  2WO3 A;  1R09 3;  1S2K A;  5FYZ A;  4AXO A;  4UXA A;  1YLL A;  4YWA A;  1OQD A;  4PF1 A;  4TXW A;  3VZO A;  3WXP A;  2AYH A;  1A3K A;  2Y33 A;  2C6S A;  4AFB A;  5HV4 A;  1MS9 A;  5DAP A;  5D8A A;  1DFQ A;  2DU1 A;  3HD8 B;  2W52 A;  1OPO A;  3N9Q A;  4R4X A;  4Q1P A;  4DEQ A;  5L9V A;  2RM2 2;  4CU6 A;  1AVB A;  2WN3 A;  3LIH A;  4I02 A;  4F7Z A;  1T2X A;  4DXS A;  2RR1 3;  2CGP A;  3FE5 A;  3JUU A;  2L9L A;  4DRV A;  1TMF 2;  3WW3 A;  1YJK A;  2DWR A;  5IFT A;  3GF6 A;  1XU1 A;  1DDL A;  4Y4Y A;  1UQX A;  5FPV A;  1H1A A;  3M4F A;  1SAC A;  2DFB A;  3DL3 A;  5CFC A;  2VJX A;  1EV1 3;  1DQ2 A;  3KT7 A;  4EQV A;  5FZH A;  5KXC A;  2LS6 A;  2IXC A;  2B4K A;  1BVV A;  3C7F A;  4QT6 A;  1XU2 A;  4HAN A;  4C0B A;  1DLC A;  4QPG C;  5A6Z A;  1LGC A;  2R1D A;  4NPR A;  1X9T A;  3KCX A;  5FDB A;  3DPR B;  3FUO A;  2H0V A;  4IGQ A;  1PGL 1;  1EV1 2;  2YMZ A;  2QQV A;  1I9R A;  5C9A C;  4FOV A;  5F5C A;  2XML A;  1JYC A;  5T5O A;  1OFS A;  1NA1 C;  3ECQ A;  4LO6 B;  3BIW E;  3S0M A;  2B7Y A;  3T2T A;  2XJP A;  1US2 A;  4BA6 A;  1RIN A;  2D44 A;  4M3C B;  3TEZ A;  4CP1 A;  3D82 A;  5A1A A;  1RUC 1;  4I2O A;  2GC3 A;  1UU5 A;  3HQR A;  2P2K A;  1IS3 A;  1C5H A;  4OHZ A;  1WWY A;  2AC1 A;  2XR4 A;  4X6Q B;  1D4V B;  4LA2 A;  4LKS A;  4XZP A;  2C24 A;  1BLZ A;  1RMU 3;  4YGB A;  2RHP A;  1W2N A;  3FJS A;  4EWD A;  1MZF A;  1SLT A;  3HMY A;  5H9R A;  3IPV B;  2VZO A;  2RM2 3;  2YUE A;  5L73 A;  3RWN A;  5JI7 A;  3PJY A;  4CDQ B;  5KBF A;  1W0P A;  1H8T C;  1NCR B;  2HWD 3;  4QKF A;  2YBK A;  3FLP A;  1LOG A;  4NVP A;  4H14 A;  4NIA A;  1TME 1;  5G04 L;  4Y20 A;  5FPB A;  4CXW A;  5CIR A;  4K8F A;  3VB9 A;  4KH9 A;  1GQG A;  5GJ6 A;  4LIU A;  4ARX A;  5IVB A;  2V4V A;  3O1T A;  3NJY A;  2D6O X;  3HNM A;  4Y20 B;  3UNP A;  2BGC A;  2E51 A;  2VZV A;  2R04 1;  2ZXQ A;  2WC2 A;  5FLJ A;  4IE5 A;  4PI2 A;  5JZG C;  3AYE A;  4CUA A;  3AYC A;  5I93 A;  2IZW A;  2QNK A;  2A73 B;  3RNS A;  4ASL A;  1FOD 2;  1QDO A;  3GGL A;  3LQC A;  2ARB A;  3UKV A;  2BRT A;  3NNF A;  1IG0 A;  1L7Q A;  2XJQ A;  2R06 2;  5DDJ 3;  3PTY A;  5F3G A;  3NVC A;  4JGZ B;  3HN3 A;  4LO5 B;  4C0H A;  1OXC A;  2XHK A;  4EWE A;  4IEQ A;  2HBT A;  2LUW A;  3L2H A;  4IND A;  5JXI A;  4E9K A;  3LDK A;  2XLF A;  3VHP A;  1T6B X;  1UNB A;  3NNJ A;  2Q8E A;  3ZYR A;  5CA6 A;  4IW3 A;  2VCA A;  2ZJC A;  4XXA A;  2WIN B;  5CG8 A;  1AJO A;  2ZMK A;  1VB4 A;  1DZR A;  3CLP A;  5L9R A;  4QKB A;  5DPN A;  1IPK A;  1JU4 A;  2P17 A;  2WII B;  3B69 A;  5FXW A;  4HLT A;  1AR9 1;  4M3C E;  2ZZJ A;  1SCR A;  3WHU A;  4ES8 A;  1SHW B;  4U2A A;  5DAQ A;  2D6M A;  1O5L A;  1ONA A;  4RHV 1;  1UMH A;  3D6E A;  3MIC A;  4YG0 A;  5EHD A;  3T4H B;  1APN A;  1ULC A;  3U4X A;  4B7E A;  2HLE A;  4COY A;  4LTA A;  1UYP A;  4LOS A;  1RUG 1;  4GJY A;  4LOT A;  1JZ3 A;  1WKY A;  3IAP A;  4MV2 A;  3WCS A;  2W92 A;  4AHX A;  1SLA A;  3VBU C;  2D6L X;  5C8W A;  1GAN A;  4BXS V;  4IE7 A;  2JEC A;  1S55 A;  2Y64 A;  4OVE A;  1AHS A;  4B29 A;  2WA4 A;  1FI2 A;  1NAE A;  1YHF A;  2BOJ A;  2G1M A;  4P9W A;  1QIQ A;  4KWL A;  5FZ6 A;  3RI9 A;  1S1A A;  2VUD A;  4XJ9 A;  4GMP 0;  3AMH A;  3UJO A;  1SBD A;  2P4E A;  2D7F A;  2EIE A;  1OI6 A;  4XE9 A;  2V5Y A;  5FLH A;  3KM5 A;  1A8M A;  3PVN A;  4Q0Q A;  2VMH A;  5HCB A;  4URA A;  3IZO A;  5FZL A;  2LRP A;  5FBJ A;  5AVA A;  3BTX A;  3QLQ A;  4PIY A;  4DIN B;  3IT8 A;  4HON A;  1W3X A;  1OKQ A;  1R09 1;  3O1O A;  4AOC A;  4XJW A;  1AR8 3;  4G3Y C;  4BM8 A;  5T3N A;  1O91 A;  2NMN A;  4DXR A;  3U10 A;  4UFK A;  1AYN 2;  4JGY A;  1F5F A;  4D6S A;  2YPD A;  2PHW A;  5A32 B;  1UU6 A;  2HH9 A;  2Y6J A;  4DNY A;  4N53 B;  4XAA A;  4LR4 A;  1LU2 A;  3SCF A;  5K7P A;  1O4Y A;  1JYW A;  1N1S A;  4MXW B;  1RB8 G;  1KXG A;  5EV7 A;  2B39 A;  3A0K A;  2WNU C;  1W0N A;  4UI9 L;  4HOO A;  1GBG A;  4S2F A;  1UU4 A;  1GWK A;  2ZCW A;  5F5A A;  3LOI A;  2VQ0 A;  3ZR6 A;  1FPN 2;  1EAH 2;  4UFI A;  5HCF A;  4QU1 A;  4FAH A;  3POB A;  4D7S A;  3DYP A;  3E5X A;  2P3Y A;  2VQU A;  3O1M A;  2ZGN A;  2GAU A;  1ULE A;  5FUN A;  3AL6 A;  3DEM A;  3J8F 1;  1DU3 D;  5C4W B;  4R9C A;  1J59 A;  3N9N A;  3Q9O A;  1KDM A;  1QKQ A;  2ZHM A;  3ES4 A;  4GMP 1;  3VBO B;  5CFC C;  5FYV A;  5ABJ B;  2Q1Z B;  4S2G A;  3H8R A;  3DPR C;  4QX2 A;  1C8M 1;  4ZS3 A;  3VBO A;  2W08 A;  5ABJ A;  1R08 3;  1G9B A;  2C26 A;  4W8J A;  1UX7 A;  4A4A A;  1PGS A;  5C71 A;  1YUD A;  4FFF A;  2WLQ A;  4Q4V 1;  5KHH A;  1NY7 2;  4ZXE A;  4DMI A;  1DGW X;  1RVF 1;  4SBV A;  4BK4 A;  2VGD A;  4CE8 A;  1JYV A;  2DBN A;  1IGO A;  2GZW A;  2Y26 A;  3WP4 A;  5I0U A;  3KHC A;  4BIF A;  1GP6 A;  2WFP A;  2N7G A;  4YW5 A;  3I49 A;  1V70 A;  5A1L A;  1V6O A;  4FPE A;  1QJF A;  4F83 A;  1UN1 A;  5BNO C;  2ZAC A;  1S2B A;  4Z07 A;  3ZXG A;  4TSV A;  2ADE A;  5HCH A;  3MEP A;  4AHW A;  1XE0 A;  5FXV A;  4PI0 A;  1EY2 A;  3A22 A;  3FL7 A;  3TOJ A;  4OI2 A;  2R32 A;  1AXK A;  1OVS A;  2GNM A;  1V9U 3;  4QGM A;  1CAW A;  1V9U 2;  2DUQ A;  3KT1 A;  4FFH A;  4K8R B;  2Q4S A;  5GLV A;  1YQ2 A;  4OFG A;  1ENS A;  1O3S A;  2WSV A;  4IEO A;  3POI A;  5DAB A;  3BI3 A;  2PTM A;  1OQ1 A;  3HT1 A;  2RJK A;  4XQD A;  3I2D A;  3WW2 A;  4PF5 A;  3R4D B;  3JB4 C;  5JMC A;  2TEP A;  5IVF A;  1WW7 A;  2QDR A;  5LA9 A;  4IV3 B;  3AMP A;  2SBA A;  2IVJ A;  2VU9 A;  4FQZ A;  2BFU S;  3GJB A;  1BYH A;  4Q2F A;  5E16 A;  4B1L A;  1GV9 A;  5JSO A;  1DIW A;  1OKO A;  3H3Z A;  4AWD A;  4E2Q A;  1QOT A;  3J7M A;  3FLR A;  2OZJ A;  1W8F A;  5DN2 A;  2AR6 A;  4PDW C;  3GBF A;  2PAE A;  3JD7 1;  3FUQ A;  1Y7B A;  4ZU7 A;  5C3S A;  2Q1M A;  5FZB A;  4Q27 A;  3W9A A;  3FN9 A;  4CP9 B;  3OBZ A;  4LBN A;  3MO4 A;  4HVQ A;  3IB3 A;  1QJZ A;  4Q0S A;  4R8H A;  4NID A;  4BU2 A;  1ZM1 A;  1US3 A;  2A1X A;  2R0F A;  3LA7 A;  3USU B;  4N7I A;  2VCB A;  2WZ8 A;  3AZV A;  4LBO A;  2X8K A;  2QQM A;  4PBP A;  1JMU B;  1V00 A;  1ZVF A;  1BBT 3;  5D8A B;  1QY4 A;  1R1A 2;  1W9F A;  4LBJ A;  3VBR B;  3ZYJ B;  2VMD A;  1EAH 3;  2IWG B;  1HRV 1;  2D6N A;  1RUH 3;  4KGG A;  1ENQ A;  2VNV A;  3KQ4 B;  3N7L A;  4XBQ A;  1RHI 1;  3ACF A;  2NQY A;  1PZ8 A;  2VH9 A;  4AFA A;  2RMU 2;  2VW1 A;  3KLS A;  1V6J A;  1RUN A;  3GXU A;  1JXN A;  4BQ3 A;  2A6X A;  3FLT A;  1AR9 2;  4CU9 A;  2RS3 2;  1A34 A;  3SIT A;  5FO8 B;  1F15 A;  2C1F A;  2X10 A;  5ANN A;  4YVS B;  5H9Q A;  2RG4 A;  2DBI A;  1PO1 3;  1G9F A;  1GWM A;  2HWD 1;  4LBL A;  4XF3 A;  3R05 A;  4QQO A;  1AL0 G;  3GYD A;  1S0D A;  1OA3 A;  3UJQ A;  1O59 A;  2YYO A;  1EPW A;  1Q8P A;  2YFZ A;  2J22 A;  1NE6 A;  3AZW A;  4OUM A;  3S6P A;  4AFC A;  5FOB B;  5CIS A;  4E8C A;  1AR6 3;  3WOG A;  1J58 A;  4FVV A;  4AHZ A;  1CN1 A;  2WN2 A;  1UZY A;  1ASJ 3;  2BGP A;  2A5Z A;  2VW0 A;  2WRA A;  2PLV 3;  4KBZ A;  3HT2 A;  1W9S A;  1VIW B;  5FZK A;  1W2U A;  1EP0 A;  1AL2 2;  2V73 A;  3OGJ A;  4CCD A;  2XXZ A;  1CAV A;  2CAV A;  4A3Z A;  4KWK A;  1GSL A;  4XUP A;  1C4R A;  3EB7 A;  3SC7 X;  1CAV B;  1QNY A;  3B02 A;  4L0P A;  3WHT A;  2WT0 A;  1TZO A;  4HBN A;  4J1W A;  1YQ6 A;  2GME A;  3RPQ A;  5C5T A;  4UAP A;  4CEW C;  5A3M A;  2VZU A;  1NUK A;  1NXD 1;  4XTM A;  1XSQ A;  5KC6 A;  2VZR A;  4WVV A;  2A3W A;  4BCU A;  3GZU C;  1A78 A;  3C8X A;  3HNY M;  1J3R A;  3ZYI B;  2WAA A;  2RE9 A;  2VG9 A;  1AXZ A;  1W6N A;  4XZU G;  5FZI A;  4CCM A;  5F8P A;  1HRI 2;  1R09 2;  1R08 1;  1BVP 1;  3MV0 1;  3VD3 A;  3WNO A;  5JLV A;  3WUD A;  1X8M A;  4LHN A;  3ZDS A;  3F2Z A;  2HWE 3;  2JDK A;  3NJV A;  3H1M A;  2WZP P;  2X09 A;  2A6Z A;  3T09 A;  3PME A;  1DZQ A;  4FOQ A;  1JYT A;  1D0H A;  5L7O B;  4PIX A;  2H0B A;  2K0G A;  1WA6 X;  3WNL A;  1WCD J;  5C5U A;  4XBL A;  1W6P A;  3R4S A;  1G6N A;  4LK7 A;  5I0D A;  5LY1 A;  1PM4 A;  4GA9 A;  5BPX A;  5KHJ A;  5LWB A;  4K9S A;  1RYY A;  1QDC A;  1XNK A;  3JCI A;  5JVV A;  3NV2 A;  5IVJ A;  5JZG A;  2R49 A;  2W91 A;  3DXT A;  4ZY9 A;  3IAQ A;  5JPM B;  1JZ4 A;  2E33 A;  4NIH A;  1PZ7 A;  2UWC A;  4FTE A;  3T2Q A;  3ROU A;  1K45 A;  1J1L A;  1UAI A;  5CFD B;  4AQT A;  3OEA A;  2ZGR A;  3O0X A;  1MR5 A;  4YW1 A;  4LKE A;  2EIG A;  3AC0 A;  2VXJ A;  1ENX A;  4HPK B;  1JN2 P;  3H3L A;  3V0B B;  5C6C A;  1CD3 G;  3KMH A;  3BKZ A;  4GB3 1;  4DUW A;  4MHR A;  3CF6 E;  3UGG A;  5FYS A;  3K48 A;  1W04 A;  2UYA A;  5FPU A;  1CJD A;  2VPV A;  2YFU A;  4RS5 A;  2R07 1;  4UW5 A;  4NRO A;  2WFF 1;  3WF1 A;  2XVG A;  1LR5 A;  2KD7 A;  4RS5 B;  1BMV 1;  2WR9 A;  3LIG A;  4NII A;  3ZFF C;  3ZLI A;  3LD8 A;  4GB3 2;  2ZGT A;  4BYY A;  2F6B A;  1V6N A;  3N9M A;  4L11 A;  3S7I A;  1MEC 1;  2B5H A;  3LA2 A;  4XFF A;  3WP6 A;  3H8U A;  3PUA A;  2BEO A;  4JRA A;  5DZG A;  1JOP A;  4AQ6 A;  1O6U A;  4PQQ A;  4JV4 A;  3L9J T;  3ZYB A;  1VAK A;  2VD7 A;  4QKD A;  3VBF C;  2C0Z A;  1UY2 A;  1F5J A;  4K1Z A;  3BUC A;  1YYN A;  1CES A;  1V6K A;  1MEC 2;  3ZVX A;  1S4C A;  1VAV A;  2GNT A;  4OMD A;  1H2N A;  4V2W A;  4ET7 A;  5FUI A;  4ZZ8 A;  2Y34 A;  4DOU A;  3CDZ B;  1YIF A;  4QXH A;  5F37 A;  3AXD A;  1YFX A;  2BGO A;  5FKC A;  5F32 A;  1H30 A;  2CHH A;  3ZFG A;  1OUS A;  3E1F 1;  5CFC B;  1ZX5 A;  4RHV 3;  2BPA 2;  3MUY 1;  4L92 A;  3ZN6 A;  1IKQ A;  5JXJ A;  2OXB A;  3RYR A;  2H6B A;  3SMH A;  3LEM A;  3C7E A;  2WSU A;  3M3O A;  3UT0 A;  4Q4X 1;  3ZPO A;  3GZT B;  3ZN6 B;  4BDV B;  3E5U A;  5BYN A;  4YM2 A;  1UD1 A;  5IJR A;  3VZM A;  2QQP A;  4LKD A;  3BU7 A;  2YRO A;  4YG3 A;  4HL0 A;  2HWC 3;  4KWU A;  1UMZ A;  5FO7 B;  1S0I A;  2W1Q A;  4B7K A;  4OHY A;  2W3J A;  4UFM A;  1KEX A;  2QCS B;  5FY7 A;  2XPJ A;  4N90 A;  2ZEW A;  4JGY B;  3PU8 A;  3AB0 A;  1GNY A;  5JAX A;  3C3V A;  4HK8 A;  1CZT A;  1SQ4 A;  1RJ8 A;  4N53 A;  4QMA A;  3RQ0 A;  4RR3 B;  3N9O A;  1RUH 2;  1L7R A;  2E53 A;  3AZY A;  2TNF A;  3J7L A;  4MGQ A;  5LAT A;  4CDQ C;  5K9Y A;  1Q3E A;  2YBP A;  4YZ4 A;  1ZYB A;  4GAZ A;  3AKP A;  5LRS A;  2ORX A;  5IK4 A;  2A6Y A;  4AYU A;  3TEY A;  4COW A;  1XQN A;  4R9D A;  4NN0 A;  4NRP A;  5D2A A;  1C8N A;  3JBG 2;  4QX0 A;  3KQR A;  4UW3 A;  3ZSE A;  2Y0I A;  4DXT A;  3IPV A;  4CDQ A;  2E7A A;  1DYO A;  1F4H A;  3WDT A;  5FZA A;  5HV0 A;  3U07 A;  4RYD A;  3NWK A;  5FP8 A;  5C4W A;  1WCU A;  5E8A A;  2EAL A;  1W8W A;  1QHD A;  3DYO A;  4AE2 A;  3JBG 1;  2ZTN A;  2W9X A;  3KT4 A;  3H42 B;  3NKG A;  4ARY A;  5AFE A;  4IEX A;  2W39 A;  5ACA 3;  1VJ2 A;  4P08 A;  3O1P A;  4CCE A;  5LB6 A;  1SPP A;  3LEI A;  4CUB A;  1GLH A;  1W2O A;  2I2S A;  4XUQ A;  3UKT A;  2ZX0 A;  1ZBA 2;  5DZF A;  1W9W A;  1SLC A;  2VZP A;  2JDZ A;  5J09 A;  1ZZ8 A;  1SPP B;  1HRI 1;  1VRH 2;  3MIB A;  1AL2 1;  1ZBE 2;  4JGZ A;  5FYI A;  1RUF 1;  2J1U A;  5J96 B;  3O0W A;  5EJZ B;  2NPI A;  3PVB B;  4WVM B;  5LEJ A;  3POJ A;  3UGH A;  1WBL A;  1K3I A;  2JIC A;  2JB8 A;  1GZ9 A;  3JB8 A;  2AH2 A;  5FYM A;  1MQT C;  3NV4 A;  2G19 A;  4Q8K A;  1JW6 A;  1UY0 A;  4FPO B;  4COV A;  5IVV A;  3VBH B;  4TLG A;  1UL9 A;  4TTG A;  2OYZ A;  2BBV A;  2XWJ B;  4BQ1 A;  4PIZ A;  5FYT A;  5CVR A;  4L97 A;  1ZBE 1;  4MVT A;  1S0C A;  4I3G A;  4Q4W 3;  3ZYH A;  3LAG A;  3LCP A;  3LSE A;  2VW2 A;  3QH6 A;  4LMF A;  4BLJ A;  2W1S A;  2VUC A;  5FR3 A;  4AVA A;  1IKP A;  2VR4 A;  4NE9 A;  1I6X A;  1UY4 A;  1I1E A;  4CXY A;  2VOW A;  3HOB A;  1XE7 A;  1XE8 A;  4XFA A;  5FZO A;  1DQ5 A;  4GWJ A;  1JOJ A;  4FT8 A;  1VB2 A;  2ERF A;  4UBH A;  1M06 G;  2X5I A;  1RUC 2;  2QBX A;  1H0B A;  4WZC A;  1G9C A;  1SG3 A;  2GC1 A;  5FYU A;  4KQ7 A;  5JPN B;  2JE8 A;  5C3R A;  3CQO A;  4B4R A;  2VEC A;  5EP9 A;  1PHM A;  4QM9 A;  2DVD A;  1NZC A;  2W87 A;  4CPB D;  2FDK A;  4FOW A;  5CKQ A;  3RS6 A;  3WCR A;  1OSG A;  1DZT A;  4O61 A;  1LU1 A;  1N1T A;  1XYN A;  4IXL A;  1G8W A;  1VMF A;  3N9L A;  3USU A;  1CIY A;  3VBR C;  1QXR A;  2AGS A;  2B9U A;  4HT1 T;  1FV3 A;  1FPN 3;  1D7P M;  1JTZ X;  2XL7 A;  4JQT A;  5LBE A;  1SEF A;  1BMV 2;  3LSD A;  1DGW A;  1CPM A;  5IAX A;  4IE4 A;  4CEW B;  4FQ4 A;  2W1U A;  5DUW A;  2J7M A;  3WG4 A;  1QJU 1;  5H9P A;  4EWA A;  2BQP A;  3DYM A;  3ZXE A;  1Q43 A;  1FXZ A;  4CEW A;  2RS5 2;  4D7Y A;  2VZQ A;  2PHR A;  3V64 A;  2C9K A;  1LOE A;  2D5F A;  4IES A;  4RS5 C;  4WM7 C;  1RUD 2;  2NMO A;  4CXX A;  3VBF A;  1UYZ A;  1NLS A;  3R4U A;  1JU3 A;  1SMV A;  3OCP A;  3ZMN A;  1SCS A;  3PUR A;  2ZGO A;  3RZG A;  3AMQ A;  3H9A A;  4X6R B;  4YVS A;  3ILR A;  1NCQ C;  1K12 A;  4E27 A;  1GR3 A;  3Q8E A;  2RS5 1;  2BVB A;  4KMQ A;  1WCS A;  3MUZ 1;  3JD7 2;  3ZFG C;  2FMD A;  2EF6 A;  4UW6 A;  1PK6 A;  2P1B A;  1OUX A;  4OUL A;  1UKR A;  4KNC A;  1URX A;  4D3W A;  2ZKN A;  2ATF A;  2RDS A;  3AVS A;  1W6O B;  1Q8O A;  2MEV 2;  1PK6 C;  5GLU A;  1WLW A;  5D1I A;  3IDB B;  5FZ9 A;  1MS1 A;  4RN5 A;  5FMO S;  2VTX J;  3T08 A;  4DUV A;  1MVE A;  2G9G A;  2ZAA A;  5F5I A;  1DQ6 A;  4SLI A;  3D5O A;  1R1A 1;  5B2G B;  3RZJ A;  1HIX A;  2YC4 A;  1VBE 3;  3A21 A;  4O9E A;  1YEW A;  2V72 A;  4CCC A;  1PMH X;  4QX5 A;  3D4K A;  2ARX A;  5GAL A;  1IHM A;  4QD2 A;  3ZX7 A;  3TN9 1;  4I0A A;  1N1V A;  2BP6 A;  1DQ0 A;  4C1X A;  4XQ4 A;  4CEY B;  1GNZ A;  1XNC A;  4UBG A;  1C57 A;  4I3P A;  2HEY F;  1CX1 A;  4I01 A;  2Y6L A;  5GZC A;  5FRA A;  1E5H A;  1HDK A;  2WNU B;  4PCR A;  2ZX1 A;  1XB9 A;  3P1I A;  2A70 A;  2JKX A;  4NUB A;  4QXB A;  4OCT A;  1UZZ A;  2HJI A;  2LW8 A;  4NHL A;  4XF0 A;  3WG1 A;  1D4M 3;  3M3Q A;  4XCB A;  5CZK A;  5GM0 A;  4DEV A;  2VL4 A;  1YJL A;  4MG2 A;  1VBC 3;  4MH0 E;  3H7Y A;  4FBF A;  5K0U C;  2DTY A;  1QJY 3;  5C4W C;  5FY5 A;  2CY6 A;  3J7H A;  3A4U A;  1WLD A;  5BNQ A;  3OD4 A;  3RI8 A;  1CWP A;  4Q4W 2;  1X7N A;  2IUW A;  4FOY A;  1VAM A;  4QX7 A;  4CTE A;  1LEN A;  5CFD C;  4CCJ A;  4P9Y A;  1CAW B;  4UT5 A;  1JI6 A;  4KU7 A;  3GDB A;  2ZPX A;  2FBE A;  1X50 A;  5FY8 A;  2BBA A;  3VHR A;  3PUI A;  1OOP C;  3EQE A;  4XET A;  2CTV A;  5DMY A;  2XJS A;  3MPB A;  4EN6 B;  5IK7 A;  1Z7S 3;  5I0T A;  3POS A;  3LOB A;  1ZRD A;  3KWV A;  1RUJ 3;  1YQC A;  3O1S A;  1S0B A;  2FCV A;  1HRV 3;  2Y0O A;  3WP5 A;  3W20 A;  2DCZ A;  3O12 A;  5GLW A;  3SEE A;  4ZHN A;  1W9T A;  1WMD A;  1CJP A;  1PO2 3;  1ST8 A;  3OBT A;  1GKB A;  1JZ5 A;  1HKD A;  1YCI A;  1PZ9 A;  1QU0 A;  2AZ5 A;  3T30 A;  2A75 A;  1GMM A;  3O5S A;  1PO1 1;  3B5L B;  4S2D A;  4H7M A;  5JXG A;  3PMS A;  3NJZ A;  3TNQ A;  2WT1 A;  5LRR A;  1GFF 2;  1JUH A;  5L9B A;  2Q8O A;  4F8A A;  5LK5 A;  1RUF 2;  3J8F 2;  4LE3 A;  4HET A;  4QPY A;  4XF9 A;  4CUC A;  3U0Z A;  4IEU A;  1V6I A;  3CJX A;  3HR9 A;  3I3M A;  5CU1 A;  2WNE A;  5IK5 A;  1O3Q A;  4NJ4 A;  1Q8S A;  3SKJ E;  4DXZ A;  5IK8 A;  5C3P A;  4LBM A;  4BIO A;  3VHO A;  4QX1 A;  5EZW A;  2A3X A;  3NNG A;  4U36 A;  5ACA 1;  1OFN A;  2QFE A;  4AI8 A;  1GP4 A;  3OGG A;  4GKX A;  4BK5 A;  4CZS A;  3OB8 A;  4CP0 A;  4Q4V 2;  2BVV A;  3O1U A;  4M3C F;  3BYW A;  3T0B A;  1RUE 2;  3VZJ A;  2VAU A;  1LOD A;  1WBF A;  3S5A A;  4K7J A;  2QQK A;  4NWV A;  3MID A;  1JYX A;  2OQ7 A;  3OBA A;  2ET1 A;  2HWF 1;  2CDP A;  3C7G A;  4RGK A;  5K4L A;  3T4V A;  3PLQ A;  4CA9 A;  1S0E A;  4QDR A;  3VD9 A;  3AP7 A;  2A7A A;  3HIF A;  1OC1 A;  2QQU A;  1KQR A;  3DPR A;  1BEV 1;  4HXC A;  5JCT A;  1GU3 A;  4UF0 A;  4XC9 A;  2CU5 A;  5IVY A;  2D6K A;  1NE4 A;  1D2Q A;  1OD5 A;  1QH6 A;  3N35 A;  3VZK A;  2YGM A;  3WF2 A;  5BV6 A;  1P8J A;  5GZF A;  4LNV A;  1E5S A;  1WW5 A;  1ULO A;  2JG8 C;  1W8Z A;  2Y6H A;  4UF0 B;  4A7Z A;  1PIV 2;  2KM2 A;  4OZX A;  2HWF 2;  2ZGP A;  4GWI A;  2UY9 A;  1HXS 3;  4PJY A;  5DUU A;  3KF5 A;  5A3W A;  4V1P A;  4PBO A;  4QB2 A;  2NLR A;  2W68 A;  4LEJ A;  3UYJ A;  1E57 A;  3VBS C;  1VBB 2;  5A6X A;  1QEX A;  1KRI A;  3ME2 A;  2J1R A;  1LES A;  4WM8 B;  1RL3 A;  2BTV C;  4LE4 A;  2RR1 2;  4XPV A;  5F1R A;  4RR3 A;  3AL5 A;  5FK7 A;  2Y6K A;  3AZX A;  3IKW A;  1PM7 A;  4OMC A;  4A6S A;  3PIG A;  2VM9 A;  5JI9 A;  4WM8 C;  2JX9 A;  2OS2 A;  2WDB A;  5A3P A;  3EXU A;  2B46 X;  2XWB B;  3N4M A;  2PN5 A;  2J1E A;  2K2S A;  2JDN A;  4V2V A;  4XAC A;  4BJ0 A;  4D0Q A;  2F4L A;  1NCR A;  4NPM A;  4XXP A;  4A6O A;  2DCJ A;  2IXH A;  1ZZC A;  2DVA A;  3VL9 A;  3ZFE C;  3ZSL A;  4GWM A;  2JE9 A;  1G9A A;  5B4N A;  1H6X A;  3H1W A;  2AEY A;  4DO0 A;  2GN3 A;  3I2I A;  2BNN A;  2BNO A;  2XOM A;  4XIK A;  1BHG A;  4R9A A;  2UWB A;  5FPZ A;  5A3T A;  1GWL A;  2W47 A;  2OZ6 A;  3ILF A;  4FPK A;  4GB3 3;  4Z2W A;  4ZU5 A;  5DZE A;  4CUG A;  1WW6 A;  1PO2 2;  3AKT A;  1DQ1 A;  3RGB A;  4XUN A;  5J7M A;  2LAL A;  2WKK A;  1FT9 A;  3ATG A;  3T2P A;  1K5J A;  1X36 A;  2O0O A;  1AYM 2;  4N43 B;  4QAW A;  2KA3 A;  1W6P B;  2VZT A;  3UK9 A;  5F3C A;  1K42 A;  2CDO A;  1HRV 2;  2QKD A;  1W06 A;  2VZ1 A;  1MZE A;  4YZ5 A;  4YVW A;  2FMY A;  1XJA A;  4Q0P A;  2EAK A;  2BWC A;  3EJK A;  3AJY A;  2VOT A;  3P5B A;  3POW A;  1NKG A;  3THC A;  1VAL A;  3I2F A;  3VZL A;  3WZ1 A;  4D8M A;  4UW4 A;  1DQ4 A;  2JIJ A;  1COV 3;  2VOX A;  3ZYG A;  4WVM A;  3I8T A;  1YI9 A;  4QU2 A;  4RQP C;  4EYU A;  1NYW A;  2VY0 A;  3GCX A;  5BNP C;  1UOF A;  4CEY C;  5BUV A;  2CNA A;  3M70 A;  2JE7 A;  5DQ0 A;  3SXW A;  1S0F A;  4A7K A;  1O8P A;  4HN0 A;  1H1I A;  5C7G A;  2PHX A;  1UY1 A;  4ASK A;  1ZRI A;  5FZ7 A;  3V0B A;  4YW3 A;  4AHY A;  1HLC A;  2BUK A;  4C8D A;  1WMF A;  2XGX A;  1SLL A;  4MAD A;  1REF A;  1RVF 3;  2ARE A;  3ITQ A;  1RIT A;  2JDY A;  3IDC B;  3OF1 A;  5H9S A;  2PYT A;  3D0J A;  3AZZ A;  3HAG A;  3NV1 A;  1ZRR A;  3WDU A;  4DQA A;  4IV1 B;  3M3C A;  1AF9 A;  1W0O A;  1MS0 A;  3FBM A;  2DUR A;  4RA0 A;  3WT3 A;  1NCQ B;  5JIU A;  1LOB A;  3URF A;  3CKH A;  1FMD 2;  2OUH A;  3PNA A;  4A7Y A;  1PNG A;  5FZM A;  5HI0 A;  4AG4 A;  4CDX B;  4FPL A;  2BNM A;  1LCL A;  1VBD 1;  2WAB A;  1F2N A;  1W90 A;  2DTW A;  2X5I C;  3CNA A;  4W50 A;  4GUL A;  4UFH A;  1UXZ A;  2E9Q A;  4P5H A;  4C91 A;  5A70 A;  1OLQ A;  3WP3 A;  3MIH A;  4Q4W 1;  2Z79 A;  1ZA4 A;  4AI2 A;  3LZZ A;  4DRR A;  4XAB A;  2D98 A;  3DF0 A;  4GKY A;  2PLV 1;  3WNX A;  3BTZ A;  2P3K A;  2GMM A;  4D6Q A;  2HWB 1;  4QXK A;  2FDG A;  1ZZB A;  1TMF 1;  3OYW A;  3MW3 A;  1ZZ7 A;  3UGF A;  3HBK A;  1D4M 1;  1TNF A;  3WDX A;  2Q8C A;  4TZD A;  1XXN A;  5EYY A;  1QXJ A;  1PX4 A;  1SBF A;  2EVX A;  4XTP A;  2PLV 2;  3X29 B;  1ASJ 2;  2AEN A;  2BW8 A;  3GM8 A;  4Q29 A;  2HKX A;  2PMW B;  2VBB A;  4P9L A;  3JD7 3;  3IBM A;  1XND A;  4L9B A;  1UMI A;  2G4I A;  3QH7 A;  5GZD A;  5I0R A;  2DFC A;  2VOV A;  3WW4 A;  1QJE A;  4NPL A;  1O4Z A;  1YFU A;  1H4G A;  4YZ3 A;  5A33 A;  5FO9 B;  3MF9 A;  4XQW A;  1A6C A;  1PO1 2;  3T0D A;  3BPZ A;  2FZ1 A;  2LRO A;  4IGO A;  1V6L A;  5JIA A;  2WQ4 A;  1BK1 A;  3OJB A;  2VUL A;  4PQ9 A;  2O8Q A;  1CAU A;  4Q4V 3;  1DHK B;  4XF4 A;  5APA A;  1VBA 1;  2Y6F A;  1AR9 3;  1PK6 B;  4L99 A;  4ONU A;  2G9F A;  3HJR A;  1CIW A;  2QQO A;  1IS5 A;  2OA2 A;  2R04 2;  1LOF C;  2XQR A;  4IE0 A;  4ES9 A;  3WX5 A;  2EXI A;  3AP4 A;  4IL7 A;  2ILM A;  2Q1F A;  3AMM A;  1R1A 3;  2XDV A;  3JZV A;  1T6G C;  4BPZ A;  4FTB A;  4AK3 A;  3J8F 3;  3KVA A;  3SHR A;  1GZT A;  1PVC 2;  3I2O A;  4ERO A;  3D3A A;  4WV8 A;  4KWJ A;  1Y9M A;  5AFB A;  4NIG A;  3I3B A;  1HQN A;  1QH7 A;  1CR7 A;  1QOO A;  1BCX A;  4QX3 A;  4NRM A;  5AC9 2;  1HW5 A;  4PLN A;  2IFR A;  3ACG A;  3JU9 A;  3KZ4 C;  3K3N A;  3DUI A;  1O4T A;  1OUR A;  3ZXF A;  5J37 A;  2RDQ A;  1Z7S 1;  1W9Y A;  2QDN A;  5FYC A;  3WF4 A;  3LB9 A;  4Q8L A;  5J1X A;  1W99 A;  4M4P A;  4CP2 A;  5C3Q A;  4YW6 A;  3Q8F A;  5FZ4 A;  5T52 A;  3W21 A;  2FDH A;  1G9D A;  4Q0U A;  1SFP A;  3VKN A;  1RHI 3;  1H8T B;  5JMO A;  4NRQ A;  2ZBJ A;  4LUL A;  1G7Y A;  3VBH C;  1Z7S 2;  1IS6 A;  2PHD A;  4AVV A;  5HBA A;  2D3P A;  4JTN A;  5KHG A;  1H8T A;  2OPK A;  3PU3 A;  4OHX A;  1YRZ A;  5IYY A;  2D3R A;  1QGL A;  1WGP A;  1MS4 A;  3POF A;  4FPH A;  5IFP A;  2XKO A;  1POV 0;  3U4S A;  3NL1 A;  3WUC A;  3C7O A;  3SH3 A;  2R7E B;  4AGG A;  2WUH A;  4QQP A;  3J4U H;  5DG1 A;  4LBQ B;  4A45 A;  5A1F A;  5CAZ A;  4AZZ A;  2YGL A;  4OZO A;  4FFG A;  2ES3 A;  2P3I A;  4W6W A;  5LBF A;  3OEB A;  1QJY 2;  5FMC A;  1OMI A;  3E6D A;  1DYK A;  1VBC 2;  1N1Y A;  2OVU A;  2ZGK A;  2WA3 A;  3B94 A;  4IV3 A;  4Y24 A;  1HV0 A;  2B9V A;  3BPS A;  4BMB A;  4AQ2 A;  1Q5O A;  2J42 A;  3SCH A;  4NHY A;  1MQT A;  5CB7 A;  2WO7 A;  5EQU A;  1QJY 1;  1RTV A;  5JSR A;  2W94 A;  1RHI 2;  2ZML A;  4S2H A;  4ZPI A;  3CMG A;  3D8C A;  1VR3 A;  4QQL A;  1LGN A;  5G05 L;  4AAP A;  3W5N A;  5AVP A;  4FXG B;  5I91 A;  4MGI E;  1RUG 2;  3RDI A;  3OUJ A;  4XDP A;  4Y1Z A;  1XOY A;  2HYK A;  2R16 A;  4J1X A;  3VZN A;  2P34 A;  3GZE A;  4YG6 A;  3GNE A;  2EA7 A;  3C2U A;  1LTE A;  2ET7 A;  5EFU A;  5JOY A;  3FC0 A;  1KGY A;  1EPZ A;  2AEZ A;  4OLL A;  3AK0 A;  3M2M A;  5T5J A;  2WT2 A;  3WDW A;  3MIG A;  5KC5 A;  2D43 A;  4MGK E;  1C1F A;  1OT5 A;  3KV6 A;  5C9A A;  1ZZ9 A;  2MEV 3;  4NHM A;  4P14 A;  1HJF A;  2VTF A;  4WZF A;  3VUO A;  1NQJ A;  2VQT A;  2WJS A;  2P3J A;  3WDY A;  3DCQ A;  5C9A B;  2GN7 A;  4OI1 A;  1WD4 A;  5FMD A;  1UWW A;  2ZHL A;  4P9I A;  3VL8 A;  2WNO A;  3EYP A;  2ZGL A;  3MPP G;  4FPJ A;  5FY4 A;  2AAC A;  4JDO A;  1FX5 A;  1LB2 A;  1W28 A;  3ZDV A;  2RS1 2;  1VLN A;  3MBW A;  1LOA A;  4NO4 A;  3ZKY A;  2QUO A;  3UET A;  4EN9 B;  5FK8 A;  5DUX A;  5BNN C;  4NMI A;  2XH6 A;  1FMD 1;  3S57 A;  1VMH A;  1FNZ A;  2GNB A;  2VVF A;  4OI0 A;  2WYS A;  4P9J A;  3ZR5 A;  3RZK A;  4TLF A;  3E6B A;  3OTF A;  4BH9 A;  3WQ1 A;  4XEZ A;  1ASJ 1;  3E5Q A;  3QCW A;  1LKN A;  4DIQ A;  3O7O A;  2MNG A;  3MGU A;  5JWP A;  1M4W A;  4P00 B;  4KG8 A;  4R9B A;  3BTA A;  3CL1 A;  5E88 A;  5FYB A;  4A42 A;  3MW2 A;  3MZH A;  2VNR A;  4FPG A;  1IZ3 A;  4IGP A;  2ZX4 A;  2FCT A;  2OT7 A;  1UXX X;  3CIH A;  1NY7 1;  3H0O A;  1N47 A;  4DB5 A;  1B09 A;  4M4R A;  1B35 A;  2JD4 A;  4ISQ A;  4W6Y A;  3I59 A;  4X8P A;  3K4Z A;  3WNK A;  2HWB 2;  4TN7 A;  2IFW A;  2XL9 A;  4FP3 A;  4Y26 A;  3ZFE A;  4COU A;  4B1M A;  2JDH A;  3APB A;  3RG0 A;  3GCW A;  5FZE A;  1QXP A;  1COV 1;  3FFZ A;  2ZEZ A;  5BXX A;  4Q4X 3;  1DCS A;  1KJL A;  1UPS A;  2ZGM A;  3ZFE B;  2VVE A;  4XDO A;  3WQB A;  4CEY A;  4KL1 A;  1YQ8 A;  3WD5 A;  4GIQ A;  4Z2A A;  1C8M 3;  2CWS A;  3LFI A;  5CEH A;  3FX3 A;  2WNU A;  2X53 S;  4XJ8 A;  4E8D A;  3WSO A;  2ZAB A;  4GH4 B;  2RJ2 A;  4F3J A;  1RJ7 A;  3RJ2 X;  2Z2S B;  3KV4 A;  4Q4Y 2;  5JR2 A;  3M7A A;  4CCN A;  1RVF 2;  1FNY A;  5L7O A;  1TVG A;  4BB3 A;  2FZ2 A;  4JX0 A;  4ATE A;  2BER A;  5JSP A;  3THP A;  1LED A;  4H7L A;  1ZNP A;  4EZH A;  1CAX B;  2W2I A;  3AP9 A;  3NAP C;  1F9K A;  2QQI A;  4YZ1 A;  1SFN A;  4N43 A;  1QJX 3;  1HB1 A;  1VBB 1;  4IEZ A;  3ORJ A;  3WQ0 A;  3VN4 A;  4YZ2 A;  3H3U A;  4YW4 A;  3CZJ A;  1J3Q A;  3NAP B;  1GOH A;  5GLZ A;  4UFJ A;  1MZ6 A;  3I4I A;  4HG6 B;  5IW0 A;  1BXH A;  3ENR A;  3ZFF A;  1GUI A;  1RUD 1;  4E4D X;  5LBB A;  2FDI A;  1PVC 1;  1ALY A;  1RXF A;  1AX0 A;  3KSC A;  2EAA A;  4Y5T A;  2ZGU A;  1HX6 A;  2YV8 A;  1YO8 A;  2JEM A;  1IS4 A;  4DY3 A;  4NR1 A;  4PT6 A;  5IHR A;  1AUY A;  1LHV A;  4MGS A;  2VMC A;  3IIA A;  3C7H A;  5T5L A;  1MVQ A;  1FOD 1;  3CO2 A;  1LJ7 A;  5T54 A;  3O1R A;  3VGI A;  3LGR A;  4HK9 A;  1AJK A;  1V0A A;  1R1Z A;  2Y6G A;  4XHX A;  1J84 A;  2F17 A;  2H6C A;  4LIT A;  5C70 A;  5KR7 A;  1Q8V A;  4ISR A;  4CVU A;  1KIT A;  3PUQ A;  1IOA A;  3KGZ A;  3BB6 A;  2VZ3 A;  1NT0 A;  5I8T A;  1W8O A;  4RGA A;  1NCQ A;  4JDM A;  3B9I A;  1HN0 A;  2A6V A;  4LOR A;  1O5U A;  4Z8B A;  4TWT A;  2GH8 A;  5CYY A;  4R52 A;  4HSL A;  2E7T A;  3KB5 A;  1LNS A;  2HWD 2;  2XVL A;  3JBG 3;  3K3O A;  2HEV F;  4DUX A;  1HXS 1;  4BXF A;  1ZRE A;  2GAL A;  3J9S A;  1BBT 1;  4KGQ A;  1LOC A;  5T5P A;  3WW1 A;  2XJU A;  4AQS A;  1JYI A;  2C9A A;  3VD7 A;  4FPC A;  3VDB A;  3RZM A;  2NYY A;  2JEN A;  3AJZ A;  1NOV A;  3CHX A;  3LE0 A;  2HWB 3;  3CJI B;  2D3S A;  5LA1 A;  3BOW A;  4UYB A;  1BQP A;  2B45 X;  4XCA A;  1H8V A;  4E2G A;  2ZMN A;  3SEP A;  3RZZ A;  1HXS 2;  2YG0 A;  5FMB A;  3ZXA C;  3NW4 A;  4MXV A;  3ES1 A;  5J48 A;  5LCW L;  3P3P A;  1HB4 A;  5L19 A;  1GZW A;  5CKN A;  1VBB 3;  1H2M A;  1AR6 2;  5FQ0 A;  3MIF A;  1H9W A;  2PFW A;  5D8A C;  2ZGS A;  1GZW B;  1WCQ A;  2GSY A;  1VP6 A;  3A23 A;  3EBR A;  4JGY C;  4LIV A;  2P5B A;  5C8C B;  1JZ2 A;  1PIV 3;  5KWR A;  4QQH A;  4XFC A;  2A71 A;  5FPL A;  5LY2 A;  2ZAH A;  5FP7 A;  5C8C C;  5F2W A;  4CPB A;  3III A;  4RSU A;  3F95 A;  1OF3 A;  4P9G A;  4OUE A;  3TBD A;  2RS1 3;  1O8S A;  1GYK A;  5A7S A;  4IEW A;  2KXL A;  1REE A;  4M3C A;  5C3O A;  1IQA A;  3OPW A;  1CAU B;  1NA1 A;  2VME A;  3MFC A;  2IXI A;  3VKF C;  2DVB A;  4Z92 B;  4HKW A;  1CPN A;  1RUE 3;  1NLQ A;  4XYX A;  2RJL A;  1W8T A;  2QZ2 A;  5FPA A;  4NAO A;  2VVD A;  1PX3 A;  3WNN A;  3DEC A;  2OW4 A;  2WBK A;  2QQN A;  2XBO 2;  1X33 A;  1PMI A;  1RUF 3;  5FMO L;  5ISL A;  2GP3 A;  2QQJ A;  5A3U A;  1AR7 1;  1BKZ A;  5FCC A;  5I8S A;  1W05 A;  4XIO A;  2UWA A;  3DGT A;  4M00 A;  3P6B A;  4AR2 A;  4OHV A;  1HN1 A;  2V09 A;  3OOX A;  1BK0 A;  1IPS A;  1DGR N;  3USS A;  3MIE A;  2A6W A;  3ZXL A;  4ZON A;  5T50 A;  3EMR A;  1TME 3;  5JXH A;  5GZG A;  2QQW A;  2XBO 1;  4YM0 A;  3SH4 A;  2XUM A;  4AVS A;  4B3N A;  1AR7 2;  3PHM A;  4D6R A;  3I3E A;  2JXA A;  2QQL A;  2QJV A;  2WO2 A;  2HYX A;  1FPN 1;  4XIL A;  2VXR A;  3QD6 A;  4MET A;  2WQZ C;  5FWE A;  3KCY A;  4JHZ A;  5E89 A;  2E6V A;  2LTN A;  2WWJ A;  4Q1R A;  3POG A;  4LO4 B;  3TB0 A;  4I30 A;  4OUS A;  4AGV A;  4RFT 0;  1JS9 A;  5F3E A;  2Z42 A;  1WLC A;  1RED A;  3DN7 A;  3LKJ A;  3OPT A;  5A3L A;  3ON7 A;  1LRH A;  3TEX A;  4Y22 B;  1POV 1;  2MHF A;  2WWU A;  4CSW A;  3VBH A;  5HXM A;  5DUV A;  3FFQ A;  5FRE A;  1AR8 1;  1VRB A;  3V0A A;  1JHJ A;  4Z1V A;  5L7O C;  1K5M B;  2A3Y A;  2V4A A;  3HWJ A;  1UYX A;  4IV1 C;  3H8X A;  3AVR A;  3M1H A;  4CDW B;  5GLT A;  5IUQ A;  3TEW A;  3V0A B;  1IQD C;  1MZ5 A;  3AMN A;  4YAR A;  3I97 A;  3VDC A;  1NLR A;  1QQP 2;  2RDN A;  2JJ6 A;  1Y9Q A;  3B93 A;  3G7D A;  4XFH A;  1HV1 A;  3S7E A;  3AFG A;  3WIN E;  4BHP A;  3KV9 A;  3TWI A;  3ACI A;  3FHA A;  3N7K A;  4M0N A;  1KJR A;  4L2N A;  2VMI A;  4HVO A;  1YNA A;  2BZD A;  4CDX C;  4YM1 A;  4PLO A;  1UIJ A;  4LA3 A;  4IV1 A;  4XMI A;  2X5I B;  4Q4Y 1;  4LXL A;  3RVH A;  1YC6 1;  3ILN A;  3FWE A;  1HRI 3;  1WW4 A;  2OII A;  5FV3 A;  2WWS A;  4N8M A;  1JHN A;  3I2K A;  4K6B A;  4JTO A;  3O14 A;  4RQP B;  5FUP A;  4HFS A;  3ST7 A;  1TE1 B;  4NOT A;  3HQU A;  2BDR A;  1SFY A;  2XKP A;  2X29 A;  3FMG A;  4YVW C;  3TRS B;  4BQ5 A;  4XF1 A;  4EZ4 A;  4XMA A;  2XVK A;  3RZH A;  1ZZ6 A;  3NNM A;  2G9Z A;  4Q4X 2;  3U1X A;  4IUG A;  4B4Q A;  5AC9 3;  4MHU A;  1ULG A;  2YB7 A;  3VBU A;  1ULF A;  1POQ A;  2IXK A;  4G4F A;  4DY5 A;  1F31 A;  3UL2 A;  1KS4 A;  2ETE A;  3IN9 A;  4NAM A;  2VUA A;  3JQW A;  4MSV A;  1VBE 2;  1JBC A;  1DLL A;  3OYW B;  3LF7 A;  1PGW 2;  3G6J B;  5ERL A;  1OLM E;  3VDD A;  4GQ7 A;  5HXV A;  1QJU 3;  1VBC 1;  4I0W B;  2RMU 1;  3BGA A;  3ZSJ A;  1PO2 1;  1JZ8 A;  5CG9 A;  4PHZ A;  4N9H A;  5IWF A;  2WZR 3;  2Z4F A;  4JRL A;  1RIR A;  1ZA7 A;  3HBZ A;  5EJ1 B;  3U14 A;  3VBF B;  5KXE A;  1DG6 A;  1FV2 A;  4JKK A;  4BLI A;  3AKR A;  2XHN A;  3MHZ A;  4GH4 C;  1UW8 A;  2E31 A;  2WS9 2;  1JH5 A;  4BE3 A;  1W8H A;  1CQ9 A;  5FY1 A;  4Y33 A;  5JOZ A;  1RUD 3;  2XLG A;  1ULP A;  5A33 B;  1YI7 A;  4JHT A;  2RS5 3;  2SLI A;  4AED C;  2WZR 2;  3N7J A;  3NNL A;  5FY0 A;  1W6Q B;  3OY8 A;  3POE A;  3ZN5 A;  1W6O A;  4CRQ A;  1KD7 A;  5FWJ A;  4ATF A;  1LAJ A;  4ZS2 A;  4EN7 B;  3ACH A;  4XFG A;  3RSJ A;  4W6X A;  1BBT 2;  3B9C A;  1N3Q A;  2TBV A;  3Q8A A;  4CDU A;  1F4A A;  2XB6 C;  1ND3 A;  5A7W B;  3B3Q E;  2EIC A;  3NST A;  4J25 A;  1UZV A;  2VMF A;  1ND3 B;  5A7W A;  1ND2 A;  2JDU A;  3AM2 A;  3HEI A;  2J1V A;  1GOF A;  1AX1 A;  1B35 C;  3OG2 A;  1WME A;  2DU0 A;  3W59 A;  3OD0 A;  1RUG 3;  3WDV A;  3ELN A;  1SLB A;  1YQ5 A;  1UZ0 A;  1U5I A;  3NJX A;  2RV9 A;  2W95 A;  2VCC A;  1GOG A;  2ZOE B;  3H7J A;  2JG9 A;  1VBD 2;  2HBU A;  2IXL A;  5EIY B;  3A7Q A;  1CX4 A;  2RS1 1;  4RGG A;  2PA7 A;  1KDK A;  1AZD A;  2ZEY A;  3K4D A;  4ZZ5 A;  3QBQ A;  5CAD A;  5A6Y A;  4QPI B;  4W4Z A;  2OX0 A;  1RUJ 1;  2D40 A;  2JG9 C;  1SZB A;  4CU7 A;  2Z69 A;  1EAH 1;  2E32 A;  3MV1 1;  3MI8 A;  3RMX A;  3WG3 A;  1X9P A;  3KHB A;  2DVG A;  5F9T A;  1QQP 3;  2O1Q A;  4MLO A;  2VBD A;  3B00 A;  5CNA A;  1QJX 1;  3ZMO A;  2NP0 A;  3FZ3 A;  1PGL 2;  3TNP B;  1Z78 A;  3KVB A;  1CZS A;  4YGE A;  5FP9 A;  5DAV A;  5BNO A;  3GZA A;  3NAP A;  2PEL A;  3OUH A;  4FXK B;  4CCO A;  4MZU A;  5M0T A;  2PQS A;  1ZBE 3;  5FJK A;  1DP0 A;  3H50 A;  3EHK A;  4LUM A;  1OH4 A;  2GH2 A;  4ZKT B;  4W65 A;  4QGN A;  1COV 2;  1YXW A;  3NKT A;  2XJV A;  4JDN A;  3K77 A;  1MS8 A;  1Q56 A;  1NQD A;  2JKB A;  2R06 3;  5DDJ 2;  1W6M A;  3BOP A;  2CSG A;  3AYD A;  3CU7 A;  1U5Y A;  3I54 A;  1LUL A;  1FOD 3;  4BME A;  5FKB A;  3RWK X;  5ACA 2;  1E5I A;  1VRH 3;  1JYN A;  1MQT B;  4RD7 A;  1UO9 A;  1W6M B;  3AXE A;  4QGL A;  1CZV A;  2R07 2;  3N9P A;  4XJA A;  5F7U A;  2XJR A;  2GU9 A;  4LBQ D;  1UOG A;  4FAG A;  3T2O A;  1S0J A;  1OF4 A;  4LO8 A;  3R6S A;  3T1M A;  4A3X A;  2NM1 A;  4LK6 A;  1H2K A;  2WZE A;  1TME 2;  1S0G A;  2DVF A;  4LPL A;  4XOG A;  1XYO A;  4Y1V A;  5LZ6 A;  1V9U 1;  3AP6 A;  3LPG A;  3U11 A;  4DPN A;  2OKX A;  2YY1 A;  4ITC A;  2ID4 A;  4CP9 A;  2VOK A;  4NWW A;  2P37 A;  1ZRC A;  2OPW A;  1PVC 3;  1QMJ A;  2PQQ A;  2VQA A;  3FBY A;  3J7N A;  2I45 A;  4XFB A;  3KD4 A;  2XBO 3;  3DKQ A;  1JZ7 A;  3JXS A;  1H9P A;  2W5F A;  3QOP A;  4O65 A;  3VLB B;  1UY3 A;  1IPJ A;  1RMU 2;  2JDM A;  3PVO A;  4JQR A;  3IM0 A;  4JVA A;  4Q5O A;  2Y38 A;  1V6M A;  3CJI C;  4A2U A;  2JG8 A;  1U5X A;  1LOF A;  1NXM A;  5LEK A;  2XLA A;  3ACL A;  2ZS6 B;  4Y1U A;  1W8N A;  2IXJ A;  4XVH A;  3CJI A;  1WUV A;  2PHL A;  5FPX A;  2XJT A;  2HWC 2;  2YHJ A;  3W5M A;  2ORZ A;  4KBB A;  3NRU A;  1AYN 3;  4YNI A;  5FZD A;  3VV1 A;  1QOS A;  3T3Y A;  2R1B A;  3T0A A;  3M3E A;  2JIG A;  4L8Q A;  5L36 A;  1EUT A;  3HNB M;  2YPJ A;  5FQ0 B;  3VHN A;  4J6G A;  4Y1X A;  2JB4 A;  2B8M A;  2J1S A;  4MGY E;  4QPG A;  3LA3 A;  1NCR C;  3H8O A;  1I3H A;  5LA0 A;  2UY8 A;  5HPO A;  3RYP A;  5FY9 A;  4QPG B;  1VE0 A;  1WLT A;  2FCU A;  3FHQ A;  4QDQ A;  4WM7 B;  3VKM A;  4ASM B;  4WM8 A;  2Y60 A;  1C3H A;  2VMG A;  4BQ2 A;  4OI4 A;  3Q8C A;  3CEW A;  4KU8 A;  1RUH 1;  4XW3 A;  1L7L A;  2P6C A;  4RHV 2;  4A44 A;  1TMF 3;  3HVD A;  1MS3 A;  2E7Q A;  4DZG A;  1FAT A;  4RL7 A;  1NA1 B;  1C1L A;  2K46 A;  4UFL A;  4YFW A;  2WZR 1;  3ZYF A;  5BNN A;  1VBE 1;  3T1L A;  5JUV A;  2WL1 A;  5FP3 A;  3VDD C;  4O9G A;  4UOJ A;  4CCL A;  3AP5 A;  2GC0 A;  4QHB A;  1POV 3;  5BNN B;  3VD5 A;  2XQX A;  1MEC 3;  2WNV A;  3GHM A;  3LEG A;  4CDW C;  3L2Y A;  4CDU B;  3GHN A;  5JOX A;  1BEV 3;  4A41 A;  1HQW A;  4JGZ C;  3V56 A;  2DCY A;  3RRD A;  3IMN A;  2F4P A;  3SLI A;  4AI3 A;  2PHT A;  1XNB A;  3OGS A;  2PXJ A;  2WNV B;  2WO1 A;  3R0R A;  5FZ0 A;  4GH4 A;  3UV9 A;  1TNR A;  4BOW A;  5FAX A;  1AR6 1;  2R30 A;  4AED B;  1W6N B;  1LEM A;  2VC9 A;  5KXD A;  1DGL A;  2BJS A;  4K40 A;  3HPN A;  4FTS A;  1HB3 A;  2HEW F;  4XBN A;  4YW2 A;  2ZHK A;  4AED A;  5D21 A;  1AX2 A;  4I0B A;  3AFK A;  4IEV A;  1XNT A;  3S5Q A;  5J98 B;  3ZYP A;  1PNF A;  4Y5S A;  3N7M A;  1CAX A;  5F3I A;  1ZBA 1;  2EXK A;  2QE3 A;  5FLI A;  3I3D A;  4YVW B;  1PVX A;  3NO8 A;  3WG2 A;  4Y4R A;  3DV8 A;  5IAV A;  4EV0 A;  4MYE A;  2P6H A;  3ZPY A;  5BNP B;  3WR0 A;  5FBZ A;  4TYS A;  3M8L A;  1GQH A;  1RUJ 2;  3TYJ A;  3ZSM A;  4FP2 A;  2BU9 A;  3N36 A;  1ND3 C;  1XBF A;  3MDP A;  4MGZ E;  5JZG B;  4GMP 3;  5BNP A;  1NG0 A;  1BZW A;  3B01 A;  1UYY A;  1J3P A;  1YIP A;  3GAL A;  2MPF A;  2JDA A;  5IT6 A;  3PVE A;  1F35 A;  1ND2 C;  4R4Z A;  3RFR A;  4AI9 A;  1CGP A;  5SV5 A;  4BZ4 A;  1U12 A;  1DF0 A;  1QJX 2;  3I2G A;  5K0U B;  3O0V A;  4EN8 B;  1W8U A;  5J3U A;  4HPK A;  3ZXJ A;  2CL2 A;  5EWS A;  4WBB A;  1G86 A;  1WD3 A;  4P5Y A;  1AYM 3;  1Z0H A;  4QPI C;  2X05 A;  1ZRF A;  1RC6 A;  1OLR A;  5FXX A;  4CCK A;  1UPI A;  2DV9 A;  1VRH 1;  2DCT A;  2RDR A;  2BOI A;  4LHK A;  3ZM8 A;  5JR7 B;  1ODN A;  4Q4Y 3;  3ZIX A;  1D4M 2;  2JD9 A;  3W58 A;  2W46 A;  4QX8 A;  4LUK A;  2FHR A;  3K75 B;  1YWK A;  2BYV E;  3O1V A;  3N3H A;  2C5D A;  4OHW A;  4QPW A;  3D0S A;  1ULD A;  4CDX A;  2YC0 A;  4HMZ A;  3U78 A;  1C8M 2;  4YPJ A;  3RJR A;  2Q5T A;  4JKM A;  2Q30 A;  4WVZ A;  1O3R A;  1DYP A;  2ZX3 A;  4GAL A;  4D94 A;  4JKL A;  2IC1 A;  4FFI A;  1XYP A;  4XJU A;  1IG3 A;  3PUH A;  4XHB A;  3ZXD A;  4HSJ A;  1BEV 2;  3I2J A;  1GQP A;  4K20 A;  5FJH A;  2BWA A;  1RUI 3;  5EYX A;  2JDP A;  1QWR A;  1XRU A;  1X8E A;  2TUN A;  2W0X A;  2JWP A;  4HZF A;  1C5I A;  2VUJ A;  3K46 A;  4AFD A;  2UU8 A;  1A8D A;  3P3N A;  5FZ1 A;  3IDE A;  5A7N A;  5FZC A;  4X8N A;  5J36 A;  4AGR A;  4N9I A;  1OVP A;  3KV5 A;  3KF3 A;  1RUE 1;  4I09 A;  4BQW A;  3GBG A;  1MPX A;  4Y5Z 0;  3KCC A;  3ZFG B;  1QQP 1;  1LEC A;  1UKG A;  2O8O A;  1D0G A;  2FD8 A;  2ZGQ A;  3LEK A;  4MX3 A;  4XFI A;  1AL2 3;  2CV6 A;  2ARC A;  2HWF 3;  1RMU 1;  4QWN A;  4KI5 M;  1GZC A;  2NZ9 A;  5FYH A;  1ACC A;  3GBW A;  3LDB A;  5LBC A;  4BWO A;  1OHF A;  5C8C A;  1UZW A;  3BOD A;  3MYX A;  4NHK A;  2UYB A;  2YZ4 A;  1OH3 A;  2YDE A;  1W3V A;  3WNP A;  3PDQ A;  3U37 A;  1OD3 A;  4E4S A;  4GJZ A;  2VCM A;  5AC9 1;  1O7F A;  1C28 A;  4GXL A;  4K21 A;  3WF3 A;  3ETP A;  4MUV A;  5A32 A;  1RXG A;  2GND A;  2VNO A;  3KS7 A;  2ENR A;  2EID A;  1GIC A;  3MW4 A;  2GP5 A;  3PJQ A;  4IER A;  5DAX A;  5F5Q A;  1AXY A;  5A7Q A;  4AEM A;  4JC1 A;  4YLZ A;  2R06 1;  3E6C C;  3H1Y A;  4QDS A;  5A80 A;  5JOW A;  2RS3 3;  3OY8 B;  2R6Q A;  4AEK A;  1J83 A;  2WYF A;  4QHO A;  3WLU A;  4D7T A;  2RMU 3;  3ABZ A;  4N53 C;  1U5Z A;  3K4A A;  3UES A;  1HQL A;  1CVN A;  3CZU A;  1I5P A;  3BAL A;  4RR3 C;  3WF0 A;  4Q26 A;  4QM8 A;  4XDQ A;  1H1M A;  1KS5 A;  1N3O A;  1Y4W A;  2EXH A;  3IWZ A;  2CAU A;  2ZZQ A;  1Y3T A;  3TN9 2;  1DBN A;  3ASI A;  4Q0V A;  3VBS B;  3S30 A;  3MFA A;  5LAS A;  5FFO C;  2ZEX A;  3MLK A;  1LHW A;  2YXS A;  3POY A;  1R64 A;  2Q0A A;  5FXZ A;  5GKA C;  4BIS A;  5A7P A;  2DDU A;  2QZ3 A;  3EO6 A;  4XUT A;  1KFX L;  3OUI A;  1E5R A;  2BFU L;  3VBS A;  1WZX A;  4BQX A;  4BQ4 A;  2JG9 B;  3I3Q A;  3OBR A;  5B4X A;  2Y8K A;  4Y3O A;  5EXO A;  3BCW A;  3VBO C;  5ABJ C;  5LK7 B;  4RFR B;  4GZ9 A;  1RUC 3;  2CGN A;  1JOB A;  2ZHN A;  2R07 3;  3WEZ A;  4IDZ A;  3ZOI A;  4YSF A;  2VBP A;  3CBN A;  1BJQ A;  3HQX A;  4MO3 M;  5A3O A;  1K5M C;  4IV3 C;  2LM3 A;  3SIS A;  1JUI A;  3INA A;  4LO7 A;  4WVW A;  5I8Y A;  1DGR A;  1OBN A;  4ZU4 A;  2I74 A;  4IEP A;  5FTT C;  3I7D A;  4YW7 A;  5GZE A;  4Y22 A;  4DFS A;  4EJR A;  1H2L A;  4FPF A;  4AI1 A;  2Z5W A;  2ARA A;  3RYK A;  3BVC A;  2DUO A;  4LBQ A;  4LHS A;  4LBK A;  2RVA A;  4PDW B;  3PIJ A;  5KXB A;  1K5M A;  3PL0 A;  3MF6 A;  1OPM A;  4JCK A;  4G9S B;  4P02 B;  3FHI B;  1STM A;  3SKV A;  5BNO B;  2WNV C;  1KFU L;  4CDW A;  1TEI A;  4P9X A;  4PDW A;  1LHO A;  4YYO A;  5A6Q A;  5FZG A;  2GDF A;  4LLF A;  4AFM A;  2HWE 1;  2QVS B;  1OQE A;  5DAW A;  3RMY A;  2EIB A;  4YM3 A;  4IET A;  3GJA A;  5E1R A;  3ALQ A;  2IVI B;  5FIX A;  3M3I A;  2CWM A;  1WCK A;  3VKO A;  1ZBA 3;  4XUR A;  1YFY A;  3PUS A;  4KG0 A;  5EJ3 A;  2YC2 A;  2WQ8 A;  5FZO B;  5TSW A;  3WQ7 A;  2B42 B;  4AL9 A;  1HJG A;  4FO9 A;  5ANQ A;  3U75 A;  1HB2 A;  1AYN 1;  1WMX A;  4RQP A;  1L3J A;  3JQX A;  1S2E A;  1EV1 1;  4LKF A;  3WVJ A;  1QF3 A;  5CBL A;  1EUU A;  1OA2 A;  1U0A A;  1D2S A;  4LT5 A;  1VBD 3;  5IVC A;  2VNG A;  1H4H A;  4FCA A;  3ZKU A;  4YGD A;  1JOD A;  1R08 2;  2R0H A;  3LWC A;  3THD A;  4LJH A;  4YRD A;  4M0H A;  3LPF A;  4AVT A;  1W03 A;  1UX6 A;  5LW9 A;  4K1Y A;  2ZX2 A;  2K9Z A;  2AUY A;  2DCK A;  3VBU B;  4FI9 A;  2ADD A;  1SLI A;  2KR2 A;  4QB1 A;  4AVC A;  1WA4 A;  4FSJ A;  2Q8D A;  3WV6 A;  5HCA A;  2DF7 A;  3K2O A;  5F39 A;  4GD4 A;  3MLJ A;  1TG7 A;  1XPW A;  2J1A A;  4XAE A;  2R04 3;  2VO5 A;  5FZF A;  3VBR A;  4OQ8 A;  3NQH A;  3VDD B;  3Q8B A;  3DXU A;  4EN0 A;  2PHF A;  1VBA 2;  2WFF 3;  3VDA A;  5KHK A;  2JG8 B;  1RUO A;  2XUE A;  4IEY A;  4CDU C;  1XC6 A; 
#chains in the Genus database with same CATH homology
 5FP9 A;  5FV3 A;  5FYZ A;  2YU1 A;  5E6H A;  3N9L A;  4CCO A;  4DIQ A;  5FUP A;  5FXW A;  5A1L A;  5FJK A;  5FZ8 A;  5FYB A;  3K3N A;  5FY7 A;  3N9Q A;  4IGP A;  4EZ4 A;  2OT7 A;  3PU8 A;  5FXV A;  5F3I A;  5FYC A;  5FZI A;  3N9O A;  4CCM A;  4LIV A;  4Y4R A;  5FZ4 A;  4TN7 A;  4ASK A;  5FZ7 A;  2P5B A;  4EYU A;  5F3C A;  5FPL A;  2YBP A;  5LY2 A;  3N9P A;  4GAZ A;  5FXZ A;  4C8D A;  4BIS A;  5FPV A;  5FP7 A;  5FZE A;  5F2S A;  5A7P A;  5F2W A;  3PUR A;  4XDO A;  4GJY A;  3PU3 A;  5FZH A;  5CEH A;  5A7S A;  4Y3O A;  4AI9 A;  5FZ3 A;  5IVF A;  5FZA A;  5LY1 A;  3OPW A;  5IWF A;  3U4S A;  5LWB A;  5FP8 A;  4IGQ A;  5A1F A;  5IVJ A;  3KV4 A;  3DXT A;  4CCN A;  5FZM A;  5FPA A;  3AVS A;  5F5C A;  2XML A;  5FZ6 A;  5FYY A;  5FXX A;  4CCK A;  5FZ9 A;  5FY1 A;  4Y33 A;  5A7O A;  2OQ7 A;  5ISL A;  5K4L A;  2GP3 A;  4EZH A;  2W2I A;  2OQ6 A;  5F5I A;  4QX8 A;  5FZB A;  4UF0 A;  5FY0 A;  5IVY A;  4URA A;  5FZL A;  4QXC A;  5FBJ A;  4BU2 A;  3U78 A;  5FWJ A;  4HON A;  4UF0 B;  4D6Q A;  5FYS A;  5FYI A;  5FZG A;  5IW0 A;  5A3W A;  4D6R A;  5FPU A;  5FZD A;  2Q8C A;  3UYJ A;  4AAP A;  4D6S A;  2YPD A;  5FYM A;  5A7W B;  5FWE A;  5FJH A;  3ZLI A;  2YBK A;  4XDP A;  3LD8 A;  5IVV A;  2WWJ A;  3AL5 A;  4NUB A;  4QXB A;  5FYT A;  3N9M A;  5A7W A;  5FZ1 A;  5FPB A;  3PUS A;  4HOO A;  5FZO B;  2OS2 A;  5ANQ A;  5A7N A;  3PUA A;  4LIU A;  5FZC A;  5IVB A;  5F5A A;  5F3E A;  3NJY A;  3OPT A;  2YBS A;  3KV5 A;  3PTR B;  5FY9 A;  5A3P A;  5IVE A;  4QU1 A;  4V2V A;  3KV6 A;  4LIT A;  2WWU A;  2VD7 A;  4CSW A;  5KR7 A;  5IVC A;  5FY5 A;  3PUQ A;  4IGO A;  4QWN A;  1VRB A;  3RVH A;  5FUN A;  3AL6 A;  4V2W A;  5FZO A;  5LW9 A;  5FYH A;  2OX0 A;  3LDB A;  4DO0 A;  4QX7 A;  3N9N A;  4QXH A;  5F37 A;  4CCJ A;  3AVR A;  5A3T A;  5FYV A;  5FP3 A;  5F3G A;  2Q8D A;  4CCL A;  5F32 A;  3PDQ A;  3K2O A;  5F39 A;  5FY4 A;  5A3N A;  5FY8 A;  4GD4 A;  4GJZ A;  5FYU A;  5FZK A;  3K3O A;  3KV9 A;  5FZF A;  4CUG A;  2XXZ A;  2XDV A;  4BXF A;  3DXU A;  2GP5 A;  4E4H A;  5A7Q A;  2YU2 A;  3KVA A;  5FP4 A;  2PXJ A;  5FZ0 A;  2Q8E A;  2XUE A;  4LXL A;  3KVB A;  5A80 A;  3ZPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...