5F2SA

Crystal structure of human kdm4a in complex with compound 15
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
342
Chain Sequence
b'NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 342
sequence length 346
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f2sA01
5FZAA 3KVBA 5FZMA 5FJHA 5A7NA 5FY1A 2P5BA 4V2VA 5FWJA 2VD7A 4EZHA 5KR7A 2YPDA 3UYJA 5FYVA 4TN7A 3N9MA 4XDPA 5FZ4A 5FZOA 5FY5A 4QU1A 3N9PA 3AL5A 3LD8A 5IW0A 4QXBA 5A7OA 4QXHA 5FZCA 4GAZA 3ZLIA 5A1LA 4CUGA 4LIUA 5FP9A 5FZKA 4URAA 5FYMA 5LW9A 5F39A 5F2SA 5FBJA 5FZ0A 2WWJA 4XDOA 4AI9A 5E6HA 3AVRA 2XMLA 3AL6A 3N9NA 4LXLA 5FUPA 2Q8EA 5FZ6A 5FY0A 5FYBA 5FZBA 5A7PA 5FP7A 5IVBA 4Y3OA 5A3NA 4EZ4A 5FYIA 5IVYA 5FZ8A 2OT7A 4C8DA 4AAPA 5F3EA 4GJYA 5FP8A 3K3OA 4QX7A 4GD4A 3KV9A 5FJKA 4BXFA 5FZOB 3KV6A 3PURA 5F2WA 5FPAA 4UF0A 5A7SA 3KV5A 5FYTA 5FZIA 2XDVA 2XXZA 2OQ6A 4DIQA 5FXXA 2W2IA 5FZFA 5A7WA 5FV3A 2OX0A 4IGQA 4LIVA 4IGOA 3K2OA 4HOOA 5F32A 5FZHA 3NJYA 5FP4A 5FZ7A 3DXTA 3PUSA 5IVJA 3AVSA 4HONA 5F37A 4V2WA 5LY2A 3N9OA 5FWEA 5FY8A 5A3TA 3DXUA 5FUNA 4Y33A 5FPUA 5FZLA 4NUBA 3OPTA 5IWFA 5FYCA 5FY4A 5LWBA 1VRBA 3U4SA 5FZ9A 4DO0A 4UF0B 2OS2A 4D6SA 2OQ7A 5FXWA 4LITA 3KVAA 4QX8A 4E4HA 5IVVA 3RVHA 5A7WB 3LDBA 4Y4RA 4GJZA 5FY7A 4EYUA 4BISA 4CSWA 2XUEA 5FPVA 5A3WA 3PTRB 2Q8DA 4QXCA 4CCLA 5F5AA 3U78A 4CCOA 5A3PA 5ISLA 2PXJA 5CEHA 4CCJA 2YBSA 2YU1A 2YBPA 5F5IA 5FPBA 5FZDA 3ZPOA 5F3CA 3KV4A 5IVCA 4BU2A 5FYSA 2GP5A 3OPWA 5FYUA 5A80A 3PUAA 2YBKA 3PU3A 5FY9A 5FZ3A 4CCNA 5F3GA 5FYHA 2GP3A 5FXZA 5K4LA 2WWUA 3PDQA 4D6RA 5FZ1A 3N9LA 4IGPA 4D6QA 5FP3A 4ASKA 2Q8CA 2YU2A 3N9QA 5FPLA 5F3IA 5IVEA 3PUQA 4QWNA 3K3NA 5ANQA 5IVFA 4CCMA 3PU8A 5FZGA 5LY1A 5FYYA 5F5CA 4CCKA 5FXVA 5A7QA 5A1FA 5FZEA 5FYZA
chains in the Genus database with same CATH superfamily
1W9YA 4YFZA 1ND3B 4MO3M 1PGL2 2P5BA 4PIXA 1JTZX 3I2GA 4A42A 5FO9B 5FDBA 5L9BA 2JE8A 1RUF3 3WQ0A 2DVAA 1O4TA 2ZABA 3T1MA 2HEYF 1UMIA 3WEZA 4EE2A 4RN5A 3NMBA 1SLIA 2BTVC 3AYAA 4Q1PA 1GOGA 4URAA 1OOPC 1RUC1 1ODMA 2WS92 4N7IA 4XJ8A 2AEZA 1QJY1 4XDOA 2XWBB 2WZR2 4XUNA 2BW8A 1DGRN 1H2KA 2G19A 1XC6A 2DVBA 3CDZB 3NSTA 4OHWA 4ASLA 3GCWA 5KC5A 3ZXGA 1G86A 4GH4A 2QJVA 1ENSA 5FZ8A 1DGWA 3I8TA 3GZUC 4HSJA 2Y33A 2Y6FA 1W9TA 1Q8OA 3LZZA 1YFYA 3TRSB 4LR4A 1AR72 2WNVC 2VQ0A 3VBHA 2C6SA 3I3QA 3O7OA 4YGEA 2XLAA 2RM23 1HLCA 5F32A 2YXSA 3HOBA 2H0VA 2HH9A 3VUOA 2W87A 2DV9A 2IXKA 4RD7A 1ASJ3 5DPNA 4TSVA 1FPN3 2J1EA 4FPCA 1OOPA 4OHVA 4GH4B 2QQPA 2VZRA 1AR61 3ZYFA 1WLDA 5G05L 1HKDA 3AYEA 3FUQA 5FPUA 1OT5A 3VDDC 1JYIA 1PVC3 5JUVA 3LE0A 4NWWA 3SMHA 3MICA 2QQWA 2E51A 5J96B 5FYCA 1ZA4A 2D93A 3MIDA 3WW3A 3VBHB 4K8FA 1M4WA 2QQNA 4P9IA 3OG2A 2ZHNA 2E63A 3E5UA 3SH5A 1IQAA 2MNGA 4R52A 1H8VA 1LB2A 2PAKA 2WNVA 4CP0A 2GMPA 1Y7BA 2XB6C 1DBNA 2JDPA 2WQZC 3ZMNA 2GNDA 1K42A 1SDWA 3WW4A 5FREA 5C3SA 1LJ7A 1YFWA 1PO11 2BERA 4QXCA 1OOPB 2PTMA 3J7LA 3WD5A 4BJ0A 1OUSA 3CO2A 3SKJE 5JMOA 2ZGUA 1B09A 2CTVA 5F5IA 1TE1B 1DGWX 4BE3A 3B69A 2JIJA 4IUGA 1XNTA 4AVSA 2VZ3A 1V9U1 1J84A 2G9ZA 5FZ3A 2BRTA 2XG3A 1NXD1 2GC1A 1NLSA 5L19A 1AR71 3MDPA 1VRH1 1YQ6A 3BPSA 2WNVB 3OGRA 3T4HB 2YC0A 2TEPA 1QIQA 4OUEA 4IGPA 3SNMA 2PLV1 3OY8A 3VBSC 4LBLA 4QHOA 1ACCA 3MLKA 5A3LA 1N1SA 2EICA 1URXA 3USSA 4N7UA 3MF9A 1OF3A 2NM1A 3R4UA 4NIHA 1W6MA 1JUIA 5A3MA 4RGAA 4BIFA 1BYHA 4OI2A 1O7FA 3ITQA 3ZX7A 5KHGA 4ES9A 3KVBA 5JCTA 5FY1A 2RS51 3DECA 2VD7A 4EZHA 3VDDB 4FCAA 1CIWA 4FOWA 4QX0A 3M3OA 3FBYA 3WUDA 1RUE2 3WLUA 1YHFA 2G9FA 3I2IA 1YEWA 3N36A 3T4VA 3THDA 4QXBA 3OY8B 4Q4Y2 4K1YA 5JXGA 2XPJA 4QGNA 3OB8A 5FFOC 5JOZA 1AR92 1S2BA 5FZKA 4HKLA 4QPWA 3CJXA 4K6BA 1EV11 2JDKA 3RSJA 3VHPA 4CA9A 1W6MB 3AB0A 3VBSA 2G4IA 5K0UC 3FFZA 1OXCA 2CWSA 1SQ4A 4YW6A 3HR9A 3ZN5A 2PHLA 4I3PA 4Y22A 3V0BA 1YWKA 4UW4A 4OMCA 3AMNA 3K3OA 3GDBA 4RL7A 1VJ2A 3POFA 5ACA2 2HWC3 1TME2 1OVPA 5T5OA 1CJPA 4JKKA 1LOAA 3PVEA 3MYXA 2ZGKA 2V5YA 1I6XA 1QOOA 1YQ8A 4QDQA 4JZRA 1YI9A 2O8QA 1ZM1A 4YGDA 1OMIA 4SLIA 5FZFA 4AZZA 2FDGA 5FZHA 4K21A 2VZUA 2ZXQA 1VBD2 3VBSB 2VH9A 1AR83 3T2PA 3H3UA 5LZ6A 1O8PA 3AK0A 3CJIC 3VKLA 4BM8A 2WO7A 3LPGA 3MW3A 2ZGRA 4Y1XA 4A7KA 3MLJA 3H3LA 4Y22B 3V0BB 3DN7A 4AVTA 1UX7A 2BVBA 2XKOA 3ES1A 4XE9A 2VMFA 3O1UA 2CAUA 5FRAA 4BB3A 5C9AC 2Z4FA 1XNKA 4ZU7A 2OS2A 3T09A 2VOVA 3KVAA 2R041 2CDPA 1I5ZA 5HXVA 3TN93 4DUWA 4I0AA 2W47A 1WMEA 3VZJA 3JB4C 3O1SA 3WCSA 4AAXA 1OA4A 4CSWA 1VE0A 2KM2A 3P5BA 2VVFA 1AR91 2QTWB 3OEBA 3ZPYA 5IAVA 3ETPA 2WFF3 4KG8A 3T08A 5D1IA 1GWMA 2YBPA 3OBZA 4JDNA 2D43A 1F4AA 5EFUA 3CJIA 3HJRA 5A33A 4XFHA 4IERA 4HFSA 4Q29A 1Z7S3 1Q8VA 1ULCA 2QDRA 2JIGA 3HT1A 4XPVA 4NAOA 1TME1 2VNGA 5F3GA 3L9JT 1WCQA 3WCRA 5C9AA 1XOYA 5D8AC 1RUG1 2P6CA 1HRV3 1MR5A 5FPLA 4TLFA 1TEIA 1D4M1 3MFCA 4MUVA 3RNSA 1UYPA 1VAVA 3K3NA 1QJX3 3L2YA 1RHI3 1XSRA 4XJAA 2VQAA 4CYDA 1S0JA 1LTEA 1VBD1 4YZ3A 3AP6A 1GYKA 5FYYA 1LNSA 1OA3A 1SBFA 1QDCA 1YO8A 1W6OA 4YWAA 2D6LX 3CJIB 3KSCA 4P9XA 4YM2A 3JQXA 1XBFA 1Q8PA 2UYAA 2Y38A 3HIFA 2P3JA 3Q8CA 1MS9A 4Z1VA 2A6WA 3B94A 2GNTA 5I8YA 2WYFA 3KGZA 1GZWA 1HB4A 1JYCA 2VOKA 3KCYA 2SBAA 1AJOA 4GZ9A 1CAXB 5C9AB 2HWB3 3NNJA 3VKFC 1S0CA 2XL9A 3KS7A 3EHKA 4DY3A 4OVEA 1RITA 2VG9A 3JD73 1OLME 1DLCA 5DDJ3 1S4CA 4NHMA 4HN1A 5D8AA 5J3UA 1WCDJ 3RI9A 4GULA 1HRI1 2XJSA 1DZQA 2GSYA 4XACA 5FYBA 5FP7A 4GALA 3M2MA 4Y3OA 2P17A 5A3NA 4LBJA 3GBWA 1H30A 3GM8A 4Z2WA 1GLHA 1NZCA 4JKLA 1Q3EA 2WZEA 2TUNA 3X29B 1ZVFA 1UZVA 1XYNA 1ZRRA 2XBO1 3PMSA 4P9WA 5I0TA 2OPWA 2VAUA 2NQYA 3WP6A 1GZWB 1JS9A 3KV6A 4KWLA 2Q8OA 3PUHA 2HWE3 3VKNA 3WDTA 5CKMA 3U4XA 3ZSJA 5T54A 3UKTA 3VL9A 5GALA 3M3IA 4NPMA 4QQOA 2R1DA 3WF2A 1S55A 4LT5A 4XJUA 2K46A 4HOOA 4KL1A 5D8AB 5IVJA 3INAA 3BTZA 1RUC3 5E89A 2NN8A 1QJY3 1WLCA 4ONUA 4LQRA 2J1UA 5LY2A 2EIDA 1A78A 4NJ4A 4S2FA 3O12A 5H9SA 5I93A 1UAIA 5GLUA 2P2KA 2AYHA 1OHFA 2X8KA 5G04L 2XJPA 4FOYA 2A3XA 1RUI2 4FFHA 4Q4V1 3VD4A 2EVXA 1RUD2 4C90A 3WZ1A 2XLGA 3WDVA 4AVVA 2D3PA 1GICA 4JKMA 3KF5A 4QX8A 4Y1UA 2VZ1A 4C0HA 2DWRA 2GC2A 4XOGA 3NNMA 2RS12 4Y4RA 1HDKA 1F9KA 4O65A 2Q1MA 4E8CA 1KGYA 1FOD2 4UFIA 3PTRB 4NHYA 5IK4A 3LOIA 2FQPA 1CJDA 2XJUA 1W6PA 2UYBA 2VUCA 5FMDA 5F9TA 4XJWA 2EAKA 4WZCA 4GQ7A 2PFWA 5EPAA 1AX1A 4E4DX 2RJKA 1COV2 3W5MA 1RJ8A 1AR63 5CFCA 4LO7A 5LASA 5FPZA 4I30A 5FYSA 2ZGNA 5FYUA 4Q8LA 3NV1A 1W8TA 5D2AA 1TQ5A 4AF9A 3SQOA 5BNPC 4UYBA 5K4LA 4FI9A 2EAAA 1W9FA 4FTBA 2JG8C 5DAPA 1UXXX 2PQSA 4QB6A 5LATA 1C8M2 3UJQA 4Q4X3 5IT6A 2PA7A 4WVZA 1WMDA 1W6PB 2V72A 3BCWA 3HAGA 2ZHLA 1QWRA 3WG3A 5BNOC 3IDEA 4OULA 1PO13 2ZEXA 2RVAA 5A7QA 3RYKA 4ZZ5A 5HCHA 4AYUA 4AR2A 3MIBA 1DG6A 1JOPA 2ARAA 4IEOA 3WQBA 1ULFA 4LMFA 3HNYM 4PIYA 5FYVA 4MGTA 3U0ZA 1D2QA 1YJKA 1RUI1 2DDUA 2R32A 3I3EA 4N53A 1A34A 2VCBA 4CE8A 1V9U3 1UCXA 1SBDA 4XDQA 4LHNA 5E88A 5A7OA 4NPRA 1UIKA 2W1QA 1VRH3 1QHDA 2C4XA 5BNPA 4AGVA 4I0WB 4WVMA 3KMHA 5E16A 2PLV3 2RS11 3NWKA 2RR12 2JG8A 4Y1VA 5CA6A 4FPLA 2D6PA 3KLSA 4QPIC 4NIAA 3WDYA 1HIXA 4E2SA 1FOD1 3TOJA 3OSDA 1NA1C 4LHKA 1U0AA 1WKYA 3AKTA 2WN2A 1SPPB 2R1BA 2ZHMA 3O0XA 4UFMA 3WF4A 5EYXA 5GZFA 3TEXA 2BZDA 5BNOA 4L8QA 4UOJA 1COV1 1TG7A 3U07A 4X8PA 2C1FA 2RS53 2VNRA 3H7YA 3E5XA 5FPAA 4AWDA 3AXEA 4J25A 3IPVA 2B46X 3EQEA 3UV9A 1ST8A 1ZBA2 5BNPB 4WVMB 2DVDA 4LIVA 4RGKA 5AVAA 3AJYA 2JG8B 1PX4A 4QX2A 4Z82A 2FD8A 5I91A 4BMEA 4D7YA 5J7MA 1EV13 2Z69A 5JIAA 4D7TA 3HN3A 3WF0A 5FUNA 4QPIA 1LKNA 5BNOB 4M0NA 4QGLA 4YG6A 4A6OA 1YFXA 1JZ6A 3I2HA 1NA1A 4OI4A 5EP9A 3AZZA 5FY4A 1O3RA 1UOJA 3HD8B 1XXNA 2LS6A 3LSEA 4B1LA 2RS32 2DU1A 3IPVB 3NL1A 2OQ7A 1GSLA 3SEEA 1AF9A 5HCFA 2DF7A 2B9VA 2ID4A 3SCGA 1YI7A 3ZXKA 1KEXA 4F3JA 5A1AA 3LA7A 4AE2A 2XOMA 4C1XA 4QMAA 4IEUA 1OA2A 5FPVA 4DXRA 2Q8DA 5FOJB 3DF0A 5F5AA 4A4AA 4DEQA 1UIJA 2V73A 4DOUA 2ZJCA 3JB8A 1D2SA 4MVTA 4QPIB 4XFIA 3WDUA 4IV3C 1T2XA 2ZGSA 2W95A 3O1MA 2Y6GA 4CPBA 1NA1B 1ZZ9A 2CSGA 1QJU2 1G8WA 2GP5A 2HEVF 3BI3A 1QOTA 3C7FA 3WINE 4HT1T 4CU7A 2DVFA 1Y4WA 2IXLA 1VBC2 1LAJA 1BBT2 4H3WA 1RVF3 3C7HA 4LTAA 2R043 4GKYA 3CQOA 3I59A 3PVBB 2VZVA 2AGSA 2Y60A 3V64A 2XLFA 1F8VA 4GWIA 4DFSA 1REDA 1X33A 1N3OA 5LY1A 1RXGA 1YLLA 2JE7A 3RZHA 1UX6A 2P37A 3JBG2 1YRZA 1K5JA 1QXRA 3AP7A 3DYMA 5A7NA 2WO3A 3AXDA 3AFKA 2I2SA 1IKPA 3NJXA 5FK7A 4IV3A 1G9FA 1SMVA 3G7DA 4YFWA 3SH3A 3WW1A 5FZOA 1A8DA 4GXLA 4KU7A 3C7OA 1RXFA 3VBUC 4HZFA 5T50A 1TME3 4FFIA 2GMMA 5A6XA 4QQ2A 1GQPA 1NLRA 2IVIB 2VUAA 5FP9A 5T5JA 3ZSEA 1RUG3 3M1HA 4DQAA 4XEZA 3PJYA 5DUXA 4XW3A 2BWAA 1GP6A 1D4M3 4EN0A 3GBGA 5DG1A 3L2HA 4MZUA 1W9WA 1E5SA 4JTOA 3S5AA 1JHNA 1HB1A 1H9PA 1WA6X 1SCRA 1W28A 1VBD3 2RMU1 2J22A 4XXAA 3MBWA 4LLFA 3ILRA 4O9GA 3WNNA 4YZ5A 5LK5A 5LEKA 4IV3B 3BU7A 2VTFA 1EPZA 1JYXA 5FZOB 4XILA 1QJU1 2HEWF 3SH4A 4N8MA 4YZ4A 4Z07A 3KZ4C 1U5ZA 4EWDA 2HWF2 2VTXA 5A6ZA 5FZIA 2QQUA 4HMZA 2WA4A 1HN1A 4LJHA 1PIV2 5KXEA 2W2IA 4QQPA 3LQCA 4DXSA 2OX0A 1SACA 2V5DA 3VBRC 1VBC1 1BBT1 3NJYA 1QQP2 4JDOA 4QAWA 2VW2A 5FLJA 1GP5A 3VBUA 1PZ9A 5AC92 1IS3A 2WQ4A 3SKVA 3DL3A 4P08A 1SLBA 2DFCA 4V2WA 3IMMA 3WVJA 3O0VA 2IC1A 4FTEA 2OPKA 1HRI3 4P5YA 4PDWC 4TYSA 3VD3A 4AHWA 1BLZA 1AVBA 4LA3A 5IWFA 3GZTB 2DUQA 3U4SA 2ZGTA 1W2NA 2XBO3 1AL21 4JDMA 3I54A 4Y24A 2VCCA 3CL1A 3ETQA 3OCPA 4YPJA 4BWOA 3VBFC 1KRIA 5DAVA 2YY1A 4M3CA 3RVHA 1FNYA 2ZA9A 4PF1A 4URTA 4ATFA 4COYA 4EYUA 3RZMA 3VBUB 2HYXA 2VU9A 3IIIA 5JXJA 4AFAA 3R05A 4U2AA 3U78A 2MPFA 4KGGA 4CCOA 2VNOA 3VD9A 2FDHA 3VBRA 5CEHA 4XUQA 3HQUA 2E6VA 5DUWA 4AG4A 1WCKA 3FUOA 3BODA 4Q0VA 1UKRA 1WWYA 3ASIA 2BFUL 4XUTA 3RDIA 2QQOA 4BK5A 5KHHA 1MVQA 1U5IA 3I3BA 3ZN6A 2QNKA 4LA2A 4Q4V3 1JYVA 2ZS6B 2VW0A 3AX4A 4Q0QA 4M3CB 3FFQA 3PDQA 3BKZA 4Q0SA 2BP6A 4D6QA 4IL7A 4AHYA 4X6QB 1ZRCA 1MS1A 3H1YA 3VBFA 2B42B 1FX5A 4AW7A 1BVP1 4XBQA 1DHKB 1QQP1 2VQTA 2Y6JA 2Z79A 3DKWA 5T3NA 3VBRB 2XONA 3FL7A 1FV3A 4P00B 4RHV1 2C0ZA 2BDRA 5DQ0A 1S2EA 3UGFA 4YGBA 1CN1A 3BVCA 3C7GA 1UY0A 4R4XA 2OZ6A 3SLIA 4HVRA 4PQQA 4PDWB 1AUYA 2J7MA 4AFDA 1UYZA 3OGJA 4MHUA 2RJLA 5BUVA 4ARYA 4QX5A 3OGSA 2VOTA 2ERFA 5JZGC 1DP0A 1GP4A 3VBFB 4S2DA 4Y20A 4AVBA 1X8EA 4DINB 1O4ZA 2GAUA 4PCRA 4NR1A 2UY9A 4AHXA 1NQJA 3ZN4A 1GFF2 4UFHA 1CR7A 3V65A 4D94A 4HN0A 2ADEA 3DKQA 1JI6A 2OVUA 2E7AA 1J83A 3VBHC 4GJYA 1RUH2 1JOBA 1ULEA 4YW7A 4E2GA 3ILNA 4LK7A 4YSFA 2VC9A 1FT9A 1IZ3A 5C6CA 1UZYA 2IXJA 2WN3A 4XTPA 5FYTA 3J4UH 4Q0UA 4YYOA 5F6KA 1XNCA 1R081 1PGSA 1S0BA 3MW2A 3SXWA 4C91A 1W0OA 4Y20B 4B3NA 1HV1A 1XJAA 1X9TA 2QBXA 1KS4A 3K2OA 4R8HA 5APAA 4ZY9A 4GWNA 2AR6A 2R072 4UW6A 3ZDVA 3ZKYA 2BBAA 5JZGA 1W3XA 5K9YA 3VD7A 2MEV2 2PHFA 3U75A 1D7PM 4CP2A 3I49A 5CADA 3GHMA 1DGLA 2Q1FA 1FOD3 3ELNA 4FTSA 1POV1 3IWZA 5GLVA 3CU7A 3GXUA 2QQVA 1UOGA 4NRPA 3UL2A 4YM0A 4DO0A 1E5HA 1LGCA 3KHBA 3I3MA 1COV3 3E5QA 2HBTA 4CUBA 2VCAA 2WWSA 4XZUG 4M3CF 4H14A 1PHMA 5T5LA 5JSPA 3O0WA 1FYUA 2J1TA 1O6UA 2V09A 1LEDA 2SLIA 1C8NA 2GH8A 4OYUA 2XUEA 3WHTA 2XR4A 5JZGB 1J59A 1S0DA 2CU5A 4PQ9A 4COUA 5ABJC 2KXLA 4NIDA 3CF6E 3W9AA 1OI6A 5EJ1B 4BQYA 4HVOA 2YBSA 4M4RA 1AYN2 5F8PA 4QDSA 1XU1A 4GMP0 1UN1A 1ZZ7A 3N4MA 2A6YA 2JD4A 3UKVA 1NQDA 2BVVA 3S5QA 4D69A 1XE0A 3H1WA 2JG9A 3FHIB 3OJBA 3PU3A 3H42B 3ACLA 4QM9A 3PHMA 1PGL1 1DIWA 1DQ0A 2QQLA 1VB2A 2PQQA 2D97A 5FXZA 4QHBA 4I3GA 1WMFA 2JXAA 4B7EA 4NIGA 2GMEA 2E32A 1CQ9A 2CWMA 4QT6A 4XF4A 2GDFA 2OKXA 2I74A 2YU2A 3USUA 4B1MA 5F3IA 1LOGA 2ZAAA 4G9SB 2WZPP 2WR9A 1E5IA 2A6ZA 4A45A 4LNVA 2FCTA 1G7YA 2Z2SB 4ES8A 5JSRA 1GWKA 2D6MA 2WS91 2R071 5FZGA 4E4SA 2OUJA 1QOSA 2WZR1 2QCSB 2MEV1 2NPIA 1LULA 4EWAA 5ABJA 3FLTA 3H1MA 3UGGA 4JCKA 2Y34A 1BKZA 3OPZA 5FWJA 2R30A 1U5XA 1Y9GA 5CB7A 4CXXA 1HQNA 1PGW2 1RL3A 1IGOA 4BMBA 2RV9A 2D6OX 1RGSA 3ECQA 1TZOA 4F7ZA 2YZ4A 4CXYA 1GZTA 4D7SA 1RUOA 3Q8AA 1L3JA 1GZCA 4LBQA 3OEAA 3USUB 1CVNA 1L7RA 1T6GC 1XNBA 4GAZA 5HCAA 4E2QA 1PZ7A 1H1MA 1UF2C 5LW9A 5J98B 1HW5A 1JZ8A 3AL6A 2BOIA 1X9PA 4FPEA 5FZ6A 4GIQA 5JLVA 4XCBA 1QEXA 2XUMA 2XVLA 3B9IA 1PM7A 1VAKA 3LEMA 2JECA 5ABJB 5IVBA 3VHNA 4OI0A 2ZCWA 1RJ7A 4KBZA 1QXPA 3R4SA 3IKWA 5CKNA 2XH6A 4QQHA 4XFAA 2R6QA 3WNMA 3ZXFA 2OZJA 2RHPA 2Z42A 2IVJA 4JGZC 3RYRA 4A7ZA 5JPMB 1QH6A 4LBQB 3LGRA 4LPLA 4CXWA 1QJZA 2BBVA 1YQCA 1FMD3 1W9SA 2XJVA 4E4ZA 1IG3A 5L73A 3IDCB 2QDNA 4LEJA 1OURA 1JYTA 4AFBA 2FDJA 3G6JB 3OD0A 5J1XA 2A6XA 2E7TA 3LA3A 3DGTA 5FWEA 3VZNA 5FOBB 1WA4A 3SCFA 2JWPA 3P1IA 1L7LA 4XQWA 1BCXA 4UBGA 2QQJA 4FP2A 3ON7A 3QD6A 5CNAA 5CBLA 3ACFA 4DNYA 1O59A 2RMU3 2PELA 1C5IA 4YGCA 2DTYA 1LOEA 3IBMA 3OOXA 3WNKA 1MZFA 3ZM8A 4D6SA 2CL2A 2ENRA 1F5JA 4LITA 2QQMA 3EMRA 4LK6A 1F35A 1QJU3 4CCCA 4FBFA 1JBCA 4M0HA 1V6NA 2EXKA 2O1QA 2YHJA 4JGZA 4PLNA 5F6LB 3KF3A 4A7YA 5BV6A 2WT2A 5GLZA 4FFFA 4HK8A 5C5TA 4UBHA 1EAH2 2AH2A 4QU2A 1SG3A 3NW4A 4CCJA 5TSWA 2IZWA 1ZRFA 1DLLA 2BEOA 2DUPA 2E33A 4W6XA 4MSVA 4QD2A 3IZOA 5DXDA 2W3JA 2VY0A 4KBBA 1GOHA 5ERLA 2FZ1A 1I3HA 4IEQA 4IEXA 1GOFA 4BQ1A 4GWMA 1LESA 2GP3A 2WDBA 4RA0A 3JXSA 3BU0A 3THCA 2A7AA 1AL23 2EXJA 5EQUA 1RUE1 4JGZB 3IIAA 1PK6C 4BDVB 2D5FA 3KB5A 4LBMA 3ZR5A 1HXS2 2Q0AA 4OQ9A 2RDQA 3W59A 3URFA 4XC9A 4Q4Y1 2JDYA 4CCMA 5J37A 3BGAA 2DBIA 4BH9A 4DUXA 1LOCA 5DG2A 3FHQA 3GZEA 1WW7A 5FXVA 2FBEA 5DABA 2VO5A 1N1VA 3ZOIA 1LU2A 4OQ8A 3LEIA 4LO8A 2QFEA 1NYWA 5BNQA 3M4FA 4PI2A 1VMHA 2D40A 2ZX1A 4XJ9A 3N9MA 2WRAA 4UWDA 1GMMA 5ACA1 3N9PA 3POWA 3VN4A 2D6KA 2E9QA 4AVAA 1BEV2 1T6BX 3NV2A 2ZKNA 4I01A 2W91A 5DZGA 5A1LA 2Y8KA 1RMU3 4AI1A 3AP9A 3J9SA 4MHRA 4QKNA 1AJKA 4HXCA 4J1XA 1PK6A 2GNMA 1CPNA 2HWD2 4GWJA 2WNEA 5GKAC 4XQ4A 2RG4A 5IVYA 4TTGA 4PLMA 1EAH1 4JRLA 3M8LA 1MS4A 4A3XA 4RHV3 4AAPA 4BQ4A 1DF0A 2ZX3A 5DAWA 3N7MA 4KI5M 2HBUA 4MYEA 5DAXA 3J7NA 3VZMA 5A33B 1ZBE2 4GD4A 2ZGQA 5C33A 2YV8A 3GJBA 1OQEA 1XB9A 1VALA 2DUOA 3ZIXA 5C4WC 3J7HA 4L99A 4IETA 5FMCA 2WT1A 2Q4SA 3U10A 4ASMB 4BXSV 5E8AA 3RG0A 3LOBA 2BPA2 1QNYA 4RQPC 3TEWA 3I2JA 3EB7A 1PK6B 2CGOA 4IEWA 2JDNA 1QJFA 3D5OA 4JAAA 2JENA 1ZZBA 3RGBA 2IXIA 1W6OB 4NN0A 2DCTA 1EYBA 4CTEA 1H8TC 5LBCA 2V4AA 1X7NA 2W52A 3ZYBA 3PIGA 1PO22 1UY1A 3OUJA 4XF3A 3JZVA 2O0OA 1BZWA 1DCSA 1DYOA 1DQ4A 3TNPB 3ATGA 2X10A 1XYOA 1LHOA 5C3QA 4E8DA 1LGNA 4M00A 4BPZA 4XAAA 4K9SA 5IVVA 5T55A 3BB6A 4ORFA 4YARA 1UYXA 2LW8A 4HBNA 1W0PA 1BK0A 4OUMA 1CESA 1XPWA 3MV01 5JWPA 5C4WA 4BISA 2MHFA 1CD3G 1KFUL 1NLQA 1R083 1UO9A 4XABA 2VMEA 5A6YA 3B5LB 4ISRA 1R092 1BXHA 4NMIA 3T0DA 1A6CA 1PX3A 5C3RA 4RQPA 1WLTA 5CFCC 5FLHA 2HWD1 5T5PA 3LF7A 2VBBA 2WABA 4CRQA 3I2OA 3ZPOA 3RJRA 3AMHA 1BJQA 1HB2A 1JZ7A 1POV3 1CAVA 5A80A 2YBKA 5I0DA 1LOFC 2FDIA 1UPSA 2UWAA 4J6GA 1H8TA 2BU9A 2EIBA 2WAAA 1CWPA 2D5HA 2W1SA 3J8F2 3MW4A 1VBB2 2VPVA 3KT7A 3CLPA 4B4PA 5C4WB 1V6MA 3PUQA 4C0BA 5ANQA 3T2OA 2LM3A 2ZZJA 3PU8A 3PJQA 4RQPB 2CGPA 1IS6A 1VBE2 4CCKA 1MZ6A 4XZPA 1RUF2 4R9BA 4COVA 1YNAA 2ZAHA 3ORJA 4AFMA 4YZ2A 4DRVA 4N53C 2QQKA 1CAVB 3BTAA 1REFA 2VUJA 2JD9A 1QXJA 4QM8A 1H8TB 3P3NA 4PHZA 2YFZA 4TN7A 5JR2A 4QU1A 4FFGA 3E6CC 2ZEYA 3MGUA 2AUYA 1LOFA 3DCQA 4Q5OA 3ZYJB 3POJA 4FOQA 1HQLA 4OLLA 3RZLA 3NAPC 3ZMOA 2R7EB 4OI1A 4XIKA 2L9LA 3ACHA 5E6HA 5B4NA 4CUCA 1OF4A 4P9GA 4B4QA 5FY0A 3TEZA 3WUCA 5I8SA 4LKDA 1K3IA 4KH9A 2WS93 5FYIA 2R073 4ITCA 4YVSC 2WZR3 5CFCB 2MEV3 1WZXA 1KJRA 2VOWA 4W6WA 5C7GA 4XYXA 4YLZA 2VZPA 2BUKA 4QB2A 1UU5A 4BXFA 5HV4A 2DCYA 4JV4A 1UMZA 3P6BA 3ZYRA 5C71A 1K12A 3I2KA 3QH7A 3VKOA 2BWCA 1RUD1 1ASJ2 3DUIA 1CZVA 3LB9A 3MV11 3OBAA 1FPN2 1K45A 3AYDA 3QH6A 5CG9A 1AR73 1XNAA 2DBNA 3PVNA 4IEZA 5LBBA 4DY5A 5JDBA 1ZRIA 3DXTA 4FP3A 4AI2A 1F4HA 3NAPA 4KQ7A 1W8WA 3GJAA 4HSLA 3POYA 4LKEA 4K40A 1VBE1 2Y64A 4QQLA 1RUF1 2WNUC 4W6YA 1YJLA 1QF3A 4IEVA 4D8MA 4E27A 1VRBA 4H7LA 5A3UA 2E7QA 3K4ZA 1JZ4A 4RS5C 2XJQA 4N53B 4Y5SA 5ANNA 4CU9A 1NZIA 2E31A 4YVSA 3LFMA 1MZ5A 2VE1A 5GM0A 1UZ0A 2OUHA 3LFIA 3POIA 4NPLA 4ZKTB 4QX1A 4Q4W2 3DYPA 3VL8A 4BA6A 2Q30A 5A3WA 3NAPB 4UT5A 1C8M1 2NYYA 3NJZA 1QDOA 4JGYC 1N1YA 2VMHA 4KU8A 4R9CA 4JRAA 4AEDC 2P3IA 4B8EA 2ZMNA 3B02A 5EZWA 3WP3A 4BQ2A 4H2AA 3MEPA 4PI0A 3W5NA 3GGLA 1IG0A 1CZSA 1ZZ8A 2GH2A 4YVSB 1EY2A 1NE4A 4EV0A 3V0AA 1Q43A 1W2AX 2JDHA 3C3VA 3ZFEA 3M70A 3BIWE 2WNUA 2WWUA 3NNGA 5FZ1A 2VJXA 4LORA 1UNBA 4KMQA 3S7EA 2UU8A 3H0OA 3VHRA 4RS5A 2ZZQA 4ASKA 4IE5A 4I09A 3LSDA 2Q5TA 4DXZA 5IVEA 2WYSA 4AEMA 2E26A 1AL0G 1H2NA 3AC0A 5AFEA 1PZ8A 5F5QA 3LPFA 3SCHA 1RB8G 4IQPA 2J1AA 1EUUA 3LA2A 1SDDB 2RR11 3AMQA 1BK1A 2QE3A 5GZGA 2BFUS 2D3SA 2ZOEB 3A22A 3GYDA 1PNFA 2C9AA 1AXKA 2WL1A 3I4IA 5FZEA 3VZOA 1S0FA 1A8MA 2OXBA 3AMMA 3MLLA 4JGYA 2DTWA 4V2VA 4AEDA 1HJGA 2XL7A 3LDKA 3GZAA 4XDPA 2OA2A 3POBA 2WNUB 1WUVA 3U11A 1BQPA 4V1PA 3ZXEA 3CIHA 2YDEA 3E6DA 3AL5A 2RE9A 2ZGLA 1DQ1A 4RS5B 3S57A 1ZRDA 1SLAA 1CZTA 2EXIA 3FLRA 4HPKA 1MZEA 4CPBD 1H1IA 4AEJA 1RUE3 1UY2A 1WBLA 2C9KA 3P3PA 1ZBA1 3C7EA 4ISQA 4Q4W1 1JU3A 4FXKB 4TZDA 2XMLA 5FUPA 2WLPA 3ZVXA 3ZFFC 2YGMA 4Q4Y3 4AXOA 1UW8A 1JZ5A 5FO8B 1AR93 1LHNA 4LE3A 5AFBA 1MEC2 4FPHA 5J36A 1OUXA 4AQ6A 2OT7A 2P1BA 3B3QE 1B35C 4JGYB 5T52A 4AEDB 1Q5OA 5F3EA 5B4XA 5FP8A 3ST7A 4OHYA 4OZXA 2G1MA 3IMNA 1DQ2A 3TAYA 4YG3A 5KHIA 5FUIA 1QY4A 2GNBA 4CDXC 1REEA 4CDWC 5AVPA 3BTXA 4K3UA 2G9GA 4HPKB 3WG1A 4XFCA 1OKQA 2RS31 5ACA3 2Y26A 4IGQA 4IGOA 3I59B 1D4VB 4MGZE 1H0BA 4LBNA 2CV6A 3FWEA 2OIIA 5IK7A 1VPHA 3AZVA 3BPZA 5JR7B 5EXOA 3PNAA 4MH0E 2N7GA 4AQSA 4YW5A 1NY72 4FPFA 4KNCA 4U36A 5FMOL 3TN92 3ZFFA 4RSUA 2XGXA 2XQXA 5LWBA 1XE7A 1ZA7A 3K48A 5C8CC 3WT3A 2VNVA 1DFQA 3ACIA 1B35A 5L7OC 2BGPA 5FXWA 4ZXEA 2ZACA 2WQ8A 1H9WA 4CDXA 4L0PA 4CDWA 2FMDA 4R9AA 5DZEA 5M0TA 2BNNA 4EQVA 4XBLA 1ND2C 1YCIA 2ES3A 2K2SA 2X09A 3FHAA 4RR3A 4M01A 5ISLA 3HNMA 2A70A 2ZX4A 1Z7S2 4XFFA 1I5PA 1W6NA 1WD4A 3AKPA 4YW2A 1W6QA 5FPBA 1HN0A 1PM4A 1E5RA 3ZFFB 5SV5A 1MEC1 3JBG1 3I3DA 1HRV2 4LKSA 1B35B 1R1A2 1DQ6A 1FATA 2WO1A 1KJLA 3OGGA 1SLLA 1QJX2 3KQRA 3TYJA 4AVCA 4EWEA 5EIYB 4D6RA 4R4ZA 5C8CA 4P9JA 4OUSA 4CDXB 2PHDA 5H9PA 4CDWB 5CAZA 3NVCA 2JB8A 5L7OA 1UMHA 1FI2A 1V6KA 4Q8KA 2XHKA 2HJIA 1JZ3A 4Z92B 1CX1A 2X53S 1GANA 2JDZA 5L36A 3OUHA 4HK9A 4CZSA 2AC1A 3BYWA 4JQTA 2YUEA 1W6QB 2H6CA 3NNLA 3TWIA 3WQ1A 3I7DA 2CNAA 1F2NA 5FZAA 2YC4A 4YRDA 1ND2A 1C4RA 2VW1A 3T0AA 2HWD3 2H6BA 2DCKA 4BLIA 1KDKA 3C2UA 3CEWA 3TN91 1UOFA 2VCMA 3JD72 1LODA 2FMYA 1POQA 5DDJ2 1QGLA 5DN2A 5CISA 4AL9A 3APBA 4B7KA 1UPIA 4YW4A 5C8CB 1AX0A 3NKGA 1MVEA 3EBRA 4ZU5A 5L7OB 3ZLIA 1MQTC 5IUQA 5C8WA 1KD7A 2GN3A 4DS0A 2HWF1 4Y5TA 1JMUB 2NP0A 1DZRA 3ZSMA 3FMGA 1PIV1 3WDWA 3MHZA 4LXLA 2RDSA 4IE6A 1GNYA 2BGCA 4PBPA 3S30A 5AC91 2HWE2 1ZYBA 2ETEA 1ND2B 3HMYA 3B00A 5CYYA 3EXUA 1RUJ2 2VBPA 1J1LA 4FXGB 3FLPA 4LHLA 1O91A 4PT6A 1PMJX 3KQ4B 3KHCA 1Z78A 3KT4A 3ZN6B 1ODNA 2YPJA 3PURA 5LA1A 3WV6A 2D98A 1HRV1 5A7SA 5B2GB 5HI0A 1R1A1 1RUC2 1S0EA 2V4VA 2O8OA 2VZOA 4B29A 2WJSA 2XXZA 2ZBJA 1QJY2 1YC61 1QJX1 2A1XA 2ORXA 3KCXA 4FQ4A 1PVXA 3IDAA 2BOJA 3IAPA 4S2HA 4XCAA 4QGMA 4WVVA 4LULA 5HV0A 1MQTA 1KITA 5BNNC 3AM2A 3AJZA 3W58A 3M3EA 1J3RA 3OUIA 4H7MA 4XETA 3WSOA 5KC6A 1G9AA 2AEYA 1UZWA 4P02B 4K7JA 4ATEA 5JI9A 3RI8A 2DYCA 4QDRA 3OPTA 1TMF2 1J58A 1JODA 1GV9A 2D6NA 4O61A 5GLTA 3O1RA 3ENRA 1OFNA 3LKJA 1MS0A 3IAQA 2I07B 1SZBA 3T2TA 2LUWA 1OSGA 1H2MA 1XU2A 4FPJA 3JD71 4EN6B 5GLWA 1AYM2 4NWVA 2ZEZA 5DDJ1 2VXRA 4IEPA 1RUI3 3LDBA 1RUD3 2ZKLA 4NROA 1LECA 2CHHA 1VMJA 4MADA 5DMYA 2VVEA 4Q1RA 1DZTA 1H6XA 3HN1A 1MQTB 1V6IA 4XMIA 1AR62 1JXNA 1UD1A 4NHLA 2VZQA 1C28A 2JKBA 4YNIA 1XSQA 2RS13 2VXJA 4MGQA 2D44A 3AYCA 3NV4A 3RJ2X 2WKKA 3THPA 2VR4A 2JG9C 4MGYE 4NVPA 5FZDA 3ABZA 3O14A 5BXXA 1KQRA 5BNNA 5BY5A 2HWE1 2J1SA 1F5FA 4HG6B 1I1EA 1VBE3 1OPMA 2XJTA 1RUJ1 3O1PA 5GJ6A 5FY9A 4Q4X2 1E57A 3E6BA 5KBFA 2VL4A 4KWJA 4AI8A 3ZIWA 1W8OA 2B45X 2A3WA 5IK5A 4KWKA 5JMCA 2F6BA 1PO12 5LRRA 3IN9A 3OD4A 1OPOA 4ARXA 1IKQA 4XURA 4UW5A 4OZOA 4LKFA 2LTNA 3SEPA 1SHWB 1OQDA 3M3CA 4P5HA 2JB4A 3R6SA 5I0UA 1C8M3 1N1TA 2BV4A 1LHVA 5A1FA 5BNNB 1WCUA 1V9U2 1GUIA 1CAWA 3CNAA 3BOPA 2XWJB 5FJHA 4LE4A 3W21A 1VRH2 2FHRA 1KFXL 2VTXJ 2IFWA 2I45A 2XVKA 1ENXA 3CBNA 4KG0A 2JJ6A 2ZGMA 3T1LA 2CYFA 3CKHA 1TMF1 1SLTA 1V6LA 3RS6A 2PLV2 1RUH1 5J48A 1ZZCA 2QZ2A 2UWCA 3RYPA 4I2OA 2ZX2A 3QLQA 1RIRA 3C8XA 4AOCA 4EN8B 1LGBA 1AYM1 2WO2A 4WV8A 3ROUA 4MXWA 1O3TA 2WWJA 3R4DB 2ZMLA 3BTYA 1J3PA 3ZFEC 3N9NA 1HB3A 3PLQA 5CU1A 3D0JA 3K51A 2RS52 3HQXA 3HT2A 1CAWB 4NRMA 3QOPA 2A3YA 4ZPIA 2RR13 4C8DA 4UFKA 2JG9B 1X50A 3LCPA 2VOXA 3ZYIB 1QNWA 3TBDA 4FPOB 1QJEA 5IFTA 3M7AA 1ZREA 3KV5A 4DEVA 4Q4X1 2DCJA 1XE8A 3DPRC 4YG0A 1EV12 1Q56A 1GNZA 1V6JA 4QXKA 3HBZA 3S0MA 2ZTNA 4MXWB 2VMCA 4FPKA 2YYOA 1NCQC 3J26N 5EJZB 4CDUC 3A23A 5FP4A 2P6HA 1ZNPA 3PUSA 3FBMA 5C70A 1CONA 4XUPA 1ZBA3 4Q4W3 1LEMA 3N9OA 1IQDC 1UY4A 2W39A 4N90A 4JTNA 4K8RB 4P14A 5IJRA 1H2LA 4LBQD 4UI9L 4W65A 2P3YA 4XHXA 3T2QA 3ZXLA 4XMAA 3KT1A 3UNPA 1AYN1 3LAGA 4L11A 1YUDA 2ORZA 4JQRA 5FZ9A 3VDDA 1RUNA 4FAHA 4QKBA 5H9QA 5H9RA 4P9YA 2ZHKA 4NIIA 3ZSKA 4R9DA 1VBA2 5IHRA 1HV0A 3RZJA 2A5ZA 2Q1ZB 4S2GA 1S0GA 2ZEWA 5FY7A 2XKPA 3WNOA 2RS33 1X82A 3DPRA 3OBRA 4CCLA 4OCTA 1BHGA 3WP4A 3OTFA 3FJSA 5EYYA 1NCQA 2WSUA 3PTYA 4A44A 3ZFEB 4CDUA 3OGVA 2WA3A 3IDBB 3H8UA 3N35A 1VAMA 2GALA 4G4FA 4HL0A 4SBVA 5IVCA 4BIOA 1RVF2 3OPWA 1TNRA 4Q26A 3T3YA 2R042 5GZCA 4TXWA 4CDQC 1IOAA 4EN9B 1W04A 3POGA 2R062 5FYHA 1ZX5A 3UGHA 1LOBA 1OVSA 2IXCA 1PGW1 5FP3A 4IEYA 3DPRB 2IWGB 4AGGA 5K7PA 2YMZA 3JU9A 3KGLA 1JW6A 2W08A 3LIGA 4I0BA 5EHDA 2UY8A 3UT0A 1O3QA 2ET1A 4OHXA 2F17A 1NCQB 4RFT0 1VBC3 2JX9A 1BBT3 3A0NA 4CDUB 1W3VA 4AI0A 2Y6HA 3S6PA 1V00A 3ACGA 4XUOA 5JIUA 4AFCA 2ARCA 3AZXA 5DUVA 4F8AA 3QCWA 2E53A 3ZSLA 1JHJA 2NMNA 3GF6A 1H1AA 2YPDA 3UYJA 1LU1A 1C1LA 3EYPA 1MEC3 3OYWA 1GR3A 1GNHA 1RUG2 4LLOA 3A7QA 3JBG3 5FY5A 5BPXA 5JOXA 1J3QA 3LD8A 1D4M2 3WNXA 2RDRA 4BLJA 3T0BA 4CEYC 2R16A 1CAUA 1MACA 2WLQA 4O7XA 3AKSA 4QXHA 5FZCA 4CDQA 1VBA1 1UL9A 2PYTA 5EV7A 3MZHA 4C1WA 5F39A 5D21A 3F95A 5CVRA 5JPNB 2Y0OA 3ZYHA 1NCRC 1JH5A 1NT0A 1GWLA 4XF0A 2BJSA 3TNQA 4EZ4A 5IFPA 4INDA 5K0UA 3H3ZA 2VULA 1FXZA 1O4YA 3BN6A 2W1UA 1CIYA 4RGGA 2HYKA 3MI8A 2GZWA 3K75B 3OYWB 2VMGA 2Z5WA 3K77A 3RQ0A 2P3KA 4W50A 1W99A 1RVF1 3WP5A 4DB5A 3B93A 4LO6B 3ZYGA 2W92A 1OFSA 1CAUB 4CDQB 3JQWA 2ZGPA 1SLCA 2R061 4MGIE 1HQWA 2VECA 3LEGA 3LEKA 4XBNA 1W03A 1STMA 1HRI2 1WW4A 2UWBA 3VDCA 4WZFA 2VQUA 2QZ3A 5FZ7A 4HETA 3JUUA 5GZDA 3UJOA 4CEYA 3H8RA 1GZ9A 2HWF3 3HBKA 1PIV3 2UURA 4IW3A 3HEIA 5FY8A 2XBO2 1OKOA 1Y3TA 5K0UB 4UW3A 4Y33A 5CIRA 2W9XA 1QQP3 4MX3A 1NCRA 3E1F1 3UESA 4EROA 5AC93 4NUBA 3O5SA 3ES4A 3N7JA 4CU6A 3BUCA 4ZS2A 4COWA 2CY6A 2W46A 2WFPA 3AZYA 4XXPA 4ZS3A 3AMPA 4GB32 1CAXA 1DDLA 3O1OA 4FPGA 4AQTA 5FAXA 1VB4A 1R1A3 3WNPA 1G9CA 4FT8A 3N3HA 4IV1C 1VP6A 1WW6A 2EXHA 4D3WA 4CEYB 1HX6A 4MG2A 3WF3A 3H8OA 4A41A 4XJZA 4L92A 1U5YA 4RFRB 1HXS1 5L9RA 4AK3A 3ZO0B 3WG2A 1FNZA 4QKDA 4Q4V2 5HCBA 5JI7A 3RZKA 1NCRB 2P4EA 2FDFA 2PHTA 2WUHA 1YYNA 2BNOA 1YQ2A 1Y9QA 3VDAA 3VDBA 3O1VA 4JX0A 3D0SA 1DQ5A 2BYVE 3H8XA 2CAVA 4M3CE 2C26A 5FK8A 5LK7B 3MPBA 4AGRA 2W1WA 4QX3A 4EN7B 3TB0A 1NUKA 2YB7A 1ZZ6A 5EWSA 4DRRA 3N9LA 2WINB 1LENA 2Q8CA 3N9QA 5FKCA 4NHXA 1TNFA 1PNGA 3MUZ1 4Q27A 1BEV1 2HKXA 1YXWA 4MXVA 4XIOA 5A32A 5DAQA 2A6VA 1OH4A 3NNFA 4GKXA 2PHRA 4IV1A 1OLQA 3F2ZA 5F5CA 1MPXA 3KCCA 1DGRA 2WBKA 1UYYA 4BHPA 5JVVA 5FYZA 3THTA 3WDXA 1JZ2A 3FZ3A 3FE5A 1JU4A 4JHZA 1GBGA 3HPNA 3PUIA 1Q8SA 4IESA 1JN2P 4RYDA 2BQPA 5FZ4A 3WOGA 1RUJ3 2VMDA 2F4PA 4PF5A 1ZBE1 1V0AA 3E97A 5IW0A 2QKDA 1ENRA 4WM8C 2YROA 2DCZA 3GCXA 4YVWC 4BK4A 3WQ7A 1OQ1A 4CUGA 4GB31 4M4PA 4LIUA 4CVUA 1JYWA 1QH7A 5F2SA 5A32B 1QMJA 4AI9A 2R0HA 1U12A 3AVRA 2Q8EA 1XQNA 5A3OA 4IV1B 4MV2A 5F7UA 1W8UA 4OFGA 3OF1A 1V6OA 5A7PA 5EJ3A 4HKOA 3MF6A 4P9LA 5FPXA 3WXPA 3R0RA 3AFGA 1W2OA 4XF9A 2ZX0A 1O8SA 4LOTA 4LUMA 4YW1A 4EJRA 3RPQA 4FQZA 1BMV2 2VGDA 4NO4A 3POSA 4QX7A 4HVQA 3H9AA 5LA0A 3MIGA 1PO21 5FTTC 4E9KA 4XQDA 3I2FA 4UF0A 5FLIA 3VHOA 3ZXAC 2VBDA 5IK8A 5IYYA 2P34A 5JSOA 2YGLA 1TMF3 3LDRA 4K20A 2XDVA 4L9BA 2OQ6A 1RUH3 4DIQA 1VLNA 5FO7B 1W8FA 5A7WA 1NXMA 4PJYA 2FCVA 2O14A 2VM9A 2GN7A 4Y5Z0 1AYM3 4WM8A 3AVSA 4YW3A 4YVWA 5F37A 1DYKA 1S2KA 5KHJA 1A3KA 3HNBM 1ULOA 2XQRA 1X8MA 3AP5A 3T30A 5A3TA 4H55A 4XFGA 1R091 4LO5B 2DFBA 4X8NA 5FZLA 4GMP1 1QKQA 3UETA 1W90A 3I97A 4NOTA 2X5IC 4DPNA 2JEMA 2HLEA 2RM22 4LOSA 4XFBA 2PN5A 4UF0B 2EALA 1WGPA 3MIHA 3BOWA 4JC1A 2C24A 4UXAA 4I02A 3WR0A 1UU6A 1WW5A 5JXHA 3U14A 5A7WB 3GBFA 4CCEA 4LUKA 1Q8QA 1FAYA 2A71A 1NX9A 4A3ZA 3J8F1 2AZ5A 4WM8B 4HLTA 1VBB1 4YVWB 4YM1A 1PVC2 2YFUA 3Q8EA 4BOWA 1OC1A 3VBOC 2Y0IA 2TNFA 5FMOS 5I8TA 2WNOA 1POV0 3WNLA 3IM0A 1SPPA 2LROA 2YU1A 2ZMKA 1WCSA 4Q2FA 3WG4A 3H50A 1WLWA 3RMXA 2YG0A 2ZPXA 3D6EA 3H7JA 4FOVA 4BU2A 2B5HA 3HWJA 4UAPA 5KXBA 1BMV1 1IS4A 4D0QA 1KS5A 1AX2A 1RYYA 2X29A 1AYN3 4CU8A 2B39A 3GALA 2K0GA 3POEA 2X5IA 1J1TA 1AXZA 2B7YA 5FBZA 1W8ZA 5GZEA 1KXGA 4HKWA 3TEYA 1IS5A 3VV1A 5IVFA 1JYNA 5IATA 4QKFA 1LHWA 3RFRA 4CP1A 5CZKA 3BALA 3MPPG 4ZXKA 2PHXA 2ATFA 4N9IA 5LBEA 2D7FA 5FZMA 5KXDA 3ZFGC 3VBOA 1LR5A 1MS8A 1UQXA 2B9UA 1G6NA 3K46A 4MOAA 4N43C 5C5UA 3DEMA 3NJVA 5FBJA 4ZZ8A 2RM21 2X5IB 1S0IA 5L9VA 2Y6KA 3KD4A 3AP4A 4FSJA 4W8JA 2A73B 3UK9A 3CHXA 4ET7A 3W20A 2H0BA 4BQ5A 3BIEA 3NRUA 2AACA 3MFAA 3U1XA 1ASJ1 3FN9A 5FYMA 1EP0A 2Y6LA 1FPN1 5FZ0A 3B9CA 1LRHA 3K4DA 4BCUA 2WC2A 2IXHA 3HQRA 3SITA 4AHZA 1CPMA 5E1RA 5C3OA 1M06G 4A6SA 2DU0A 1IPSA 2F4LA 4IDZA 5C3PA 5FZBA 1IHMA 1SFYA 4MGSA 1PVC1 4MLOA 3RWKX 1I9RA 5CG8A 4WVWA 1SFNA 4DXTA 3CZUA 1W0NA 3NQHA 3VBOB 1W2TA 2WSVA 2PAMA 4JHTA 4N9HA 3JCIA 4TWTA 2KA3A 1FMD2 1YIPA 3A21A 4FPYA 2W0XA 2XVGA 5FJKA 5LA2A 3ZKUA 4J1WA 3V0AB 5F2WA 3NV3A 4F83A 3J7MA 2FZ2A 1O5LA 3ZFGA 5FQ0A 1XNDA 2ET7A 2FCUA 5LBFA 5FXXA 2QQIA 2B8MA 4N43A 2W5FA 5FV3A 4CEWC 4QHZA 1O5UA 3VGIA 1W8NA 4COZA 1UU4A 1VBA3 4HONA 3MUY1 4Y1YA 2KD7A 4CCDA 2RMU2 1W8HA 1N47A 3MIFA 2DURA 2HWC2 2OW4A 3Q8BA 4MGKE 1ALYA 5A6QA 3CZJA 1GQGA 1W05A 3FC0A 3I2DA 1VMFA 1NAEA 1EPWA 2ILMA 1UZZA 2NMOA 3NKTA 3AZWA 1WBFA 3ZFGB 5FQ0B 1SFPA 4YZ1A 3MIEA 3U37A 3QBQA 1UWWA 2VMIA 3Q8FA 4DMIA 1JOJA 1AR82 1N3PA 2NLRA 4N43B 3RZGA 4XTMA 2BNMA 3UKNA 5IAXA 1OH3A 1RINA 2R063 2WIIB 4RR3C 4BYYA 2B4KA 4K1ZA 5F1RA 1GKBA 3MO4A 2R49A 2EA7A 1F31A 1W39A 2AREA 4QPGC 3V56A 4CEWA 3GNEA 4XVHA 1F15A 5LB6A 1UY3A 1AXYA 4KWUA 1DYPA 4A2UA 1N3QA 2QVSB 2J1VA 4Y26A 1S1AA 1GU3A 3SISA 1OLRA 3KV4A 4BQ3A 5F3CA 1AL22 3RMYA 4AEKA 1NOVA 1Z0HA 1EAH3 2XJRA 1H4HA 1FMD1 5FMBA 5JAXA 1Y9MA 4PBOA 3VD5A 3ALQA 1X36A 2C5DA 5JOWA 3GHNA 3PIJA 4Y1ZA 1G9BA 1C1FA 1WMXA 3IB3A 2GC0A 2WFF2 3WF1A 2WT0A 1VIWB 1NE6A 4WM7C 1SBEA 4UFJA 4BQWA 4FAGA 4GA9A 4Z8BA 3QACA 3DYOA 1L7QA 4CEWB 2JDMA 2RDNA 5LA9A 3O1TA 4KGQA 3IT8A 2WAOA 5SV8A 2CDOA 1KDMA 1PMHX 1CX4A 3WX5A 3WHUA 1W06A 5DZFA 4G3YC 1HXS3 3PL0A 3SHRA 1JUHA 4Z2AA 2HWC1 5FR3A 3D8CA 4QPGA 4XHBA 4DZGA 5KXCA 3N7LA 2VZTA 2GU9A 5JOYA 4DUVA 2D3RA 1RMU2 4Y4YA 5KR7A 1ULDA 3D4KA 1SEFA 4XF1A 1APNA 4UFLA 1H6YA 2ARBA 1ONAA 2CGNA 2PHUA 4L97A 1PMIA 5CFDC 2NZ9A 1RHI2 3LWCA 1IPKA 1WD3A 1UXZA 2YC2A 4BZ4A 1AR81 2ZGOA 5FIXA 2TBVA 3M3QA 1C3HA 3S7IA 4RHV2 2A75A 4QPYA 1BEV3 3OBTA 3VKMA 3SC7X 4RR3B 4WM7A 1OLMA 2VZSA 1W6NB 3CMGA 3D3AA 3EO6A 1MS5A 2JDUA 4QPGB 1QU0A 3PMEA 5A70A 1K5MC 2RJ2A 2HWB2 4NHKA 1US3A 4O9EA 2K9ZA 2DVGA 3B7MA 1NY71 2PAEA 2LALA 3KV9A 5I0RA 3LIHA 1IPJA 1DU3D 5I0SA 5FCCA 4PIZA 3VLBB 1D0HA 3KM5A 4IE4A 3VZLA 4BQXA 4NE9A 5JXIA 4HANA 1YIFA 1OD3A 3RRDA 4OMDA 2ADDA 4CP9A 2IUWA 2IFRA 1SCSA 2PMWB 1Y43B 1LCLA 1ZBE3 3KWVA 3PVOA 3RWNA 5CFDA 2J42A 1ENQA 2WFF1 4GB33 5DUUA 4IE0A 4IE7A 3A0KA 1MS3A 1AZDA 4L2NA 4WM7B 4FVVA 3Q9OA 1ND3C 4OHZA 2WZ8A 1EUTA 3EJKA 2BGOA 3DXUA 1XRUA 3AKRA 4FO9A 1H4GA 3ILFA 1ULPA 3FX3A 2OYZA 4Q0PA 4AI3A 2R0FA 1P8JA 1US2A 1NKGA 2KR2A 4PLOA 4XAEA 1Z7S1 4IXLA 4ZHNA 2LRPA 3RZZA 4PDWA 5KHKA 1BVVA 1D0GA 1UKGA 1R082 1K5MA 1OBNA 1RMU1 3AKQA 2JKXA 1GQHA 4W4ZA 1RTVA 1XYPA 3K4AA 4CP9B 4E4HA 5HXMA 1PO23 5HPOA 2EF6A 3ZYPA 3ZR6A 5HBAA 4GJZA 5J09A 1C57A 5CFDB 1RHI1 2VVDA 1LHUA 5FKBA 3VB9A 3WY6A 4CUAA 5K8SA 1CGPA 2JE9A 1O3SA 3NO8A 3VZKA 1AHSA 3D82A 4QB1A 5A3PA 1C5HA 1TVGA 2PXJA 5BYNA 5CKQA 2AENA 4ZONA 4META 2VUDA 1R093 4WBBA 1ND3A 1W2UA 4NRQA 5LEJA 4LHSA 2ARXA 3PUAA 4X6RB 4ZU4A 3ZXJA 3N7KA 3DV8A 4GMP3 1K5MB 1VR3A 3B01A 2HWB1 4CCNA 4B4RA 4LBKA 2XHNA 3WW2A 1UOBA 3ZDSA 5LRSA 2JDAA 3ZXDA 3HVDA 1R64A 1ULGA 3A4UA 5KWRA 4TLGA 1R1ZA 1G9DA 1FV2A 1NG0A 1V70A 4GH4C 4QWNA 1HJFA 1YFUA 2J1RA 4LO4B 2EIEA 2W94A 2FDKA 2GC3A 4NAMA 2QUOA 3J8F3 4LBOA 2EIGA 3ME2A 1VBB3 4JVAA 4AQ2A 1OD5A 1RC6A 1YQ5A 2W68A 2X05A 2JICA 4YM3A 5LCWL 2PHWA
chains in the Genus database with same CATH topology
5FZAA 3KVBA 5FZMA 5FJHA 5A7NA 5FY1A 2P5BA 4V2VA 5FWJA 2VD7A 4EZHA 5KR7A 2YPDA 3UYJA 5FYVA 4TN7A 3N9MA 4XDPA 5FZ4A 5FZOA 5FY5A 4QU1A 3N9PA 3AL5A 3LD8A 5IW0A 4QXBA 5A7OA 4QXHA 5FZCA 4GAZA 3ZLIA 5A1LA 4CUGA 4LIUA 5FP9A 5FZKA 4URAA 5FYMA 5LW9A 5F39A 5F2SA 5FBJA 5FZ0A 2WWJA 4XDOA 4AI9A 5E6HA 3AVRA 2XMLA 3AL6A 3N9NA 4LXLA 5FUPA 2Q8EA 5FZ6A 5FY0A 5FYBA 5FZBA 5A7PA 5FP7A 5IVBA 4Y3OA 5A3NA 4EZ4A 5FYIA 5IVYA 5FZ8A 2OT7A 4C8DA 4AAPA 5F3EA 4GJYA 5FP8A 3K3OA 4QX7A 4GD4A 3KV9A 5FJKA 4BXFA 5FZOB 3KV6A 3PURA 5F2WA 5FPAA 4UF0A 5A7SA 3KV5A 5FYTA 5FZIA 2XDVA 2XXZA 2OQ6A 4DIQA 5FXXA 2W2IA 5FZFA 5A7WA 5FV3A 2OX0A 4IGQA 4LIVA 4IGOA 3K2OA 4HOOA 5F32A 5FZHA 3NJYA 5FP4A 5FZ7A 3DXTA 3PUSA 5IVJA 3AVSA 4HONA 5F37A 4V2WA 5LY2A 3N9OA 5FWEA 5FY8A 5A3TA 3DXUA 5FUNA 4Y33A 5FPUA 5FZLA 4NUBA 3OPTA 5IWFA 5FYCA 5FY4A 5LWBA 1VRBA 3U4SA 5FZ9A 4DO0A 4UF0B 2OS2A 4D6SA 2OQ7A 5FXWA 4LITA 3KVAA 4QX8A 4E4HA 5IVVA 3RVHA 5A7WB 3LDBA 4Y4RA 4GJZA 5FY7A 4EYUA 4BISA 4CSWA 2XUEA 5FPVA 5A3WA 3PTRB 2Q8DA 4QXCA 4CCLA 5F5AA 3U78A 4CCOA 5A3PA 5ISLA 2PXJA 5CEHA 4CCJA 2YBSA 2YU1A 2YBPA 5F5IA 5FPBA 5FZDA 3ZPOA 5F3CA 3KV4A 5IVCA 4BU2A 5FYSA 2GP5A 3OPWA 5FYUA 5A80A 3PUAA 2YBKA 3PU3A 5FY9A 5FZ3A 4CCNA 5F3GA 5FYHA 2GP3A 5FXZA 5K4LA 2WWUA 3PDQA 4D6RA 5FZ1A 3N9LA 4IGPA 4D6QA 5FP3A 4ASKA 2Q8CA 2YU2A 3N9QA 5FPLA 5F3IA 5IVEA 3PUQA 4QWNA 3K3NA 5ANQA 5IVFA 4CCMA 3PU8A 5FZGA 5LY1A 5FYYA 5F5CA 4CCKA 5FXVA 5A7QA 5A1FA 5FZEA 5FYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZA A;  3KVB A;  5FZM A;  5FJH A;  5A7N A;  5FY1 A;  2P5B A;  4V2V A;  5FWJ A;  2VD7 A;  4EZH A;  5KR7 A;  2YPD A;  3UYJ A;  5FYV A;  4TN7 A;  3N9M A;  4XDP A;  5FZ4 A;  5FZO A;  5FY5 A;  4QU1 A;  3N9P A;  3AL5 A;  3LD8 A;  5IW0 A;  4QXB A;  5A7O A;  4QXH A;  5FZC A;  4GAZ A;  3ZLI A;  5A1L A;  4CUG A;  4LIU A;  5FP9 A;  5FZK A;  4URA A;  5FYM A;  5LW9 A;  5F39 A;  5F2S A;  5FBJ A;  5FZ0 A;  2WWJ A;  4XDO A;  4AI9 A;  5E6H A;  3AVR A;  2XML A;  3AL6 A;  3N9N A;  4LXL A;  5FUP A;  2Q8E A;  5FZ6 A;  5FY0 A;  5FYB A;  5FZB A;  5A7P A;  5FP7 A;  5IVB A;  4Y3O A;  5A3N A;  4EZ4 A;  5FYI A;  5IVY A;  5FZ8 A;  2OT7 A;  4C8D A;  4AAP A;  5F3E A;  4GJY A;  5FP8 A;  3K3O A;  4QX7 A;  4GD4 A;  3KV9 A;  5FJK A;  4BXF A;  5FZO B;  3KV6 A;  3PUR A;  5F2W A;  5FPA A;  4UF0 A;  5A7S A;  3KV5 A;  5FYT A;  5FZI A;  2XDV A;  2XXZ A;  2OQ6 A;  4DIQ A;  5FXX A;  2W2I A;  5FZF A;  5A7W A;  5FV3 A;  2OX0 A;  4IGQ A;  4LIV A;  4IGO A;  3K2O A;  4HOO A;  5F32 A;  5FZH A;  3NJY A;  5FP4 A;  5FZ7 A;  3DXT A;  3PUS A;  5IVJ A;  3AVS A;  4HON A;  5F37 A;  4V2W A;  5LY2 A;  3N9O A;  5FWE A;  5FY8 A;  5A3T A;  3DXU A;  5FUN A;  4Y33 A;  5FPU A;  5FZL A;  4NUB A;  3OPT A;  5IWF A;  5FYC A;  5FY4 A;  5LWB A;  1VRB A;  3U4S A;  5FZ9 A;  4DO0 A;  4UF0 B;  2OS2 A;  4D6S A;  2OQ7 A;  5FXW A;  4LIT A;  3KVA A;  4QX8 A;  4E4H A;  5IVV A;  3RVH A;  5A7W B;  3LDB A;  4Y4R A;  4GJZ A;  5FY7 A;  4EYU A;  4BIS A;  4CSW A;  2XUE A;  5FPV A;  5A3W A;  3PTR B;  2Q8D A;  4QXC A;  4CCL A;  5F5A A;  3U78 A;  4CCO A;  5A3P A;  5ISL A;  2PXJ A;  5CEH A;  4CCJ A;  2YBS A;  2YU1 A;  2YBP A;  5F5I A;  5FPB A;  5FZD A;  3ZPO A;  5F3C A;  3KV4 A;  5IVC A;  4BU2 A;  5FYS A;  2GP5 A;  3OPW A;  5FYU A;  5A80 A;  3PUA A;  2YBK A;  3PU3 A;  5FY9 A;  5FZ3 A;  4CCN A;  5F3G A;  5FYH A;  2GP3 A;  5FXZ A;  5K4L A;  2WWU A;  3PDQ A;  4D6R A;  5FZ1 A;  3N9L A;  4IGP A;  4D6Q A;  5FP3 A;  4ASK A;  2Q8C A;  2YU2 A;  3N9Q A;  5FPL A;  5F3I A;  5IVE A;  3PUQ A;  4QWN A;  3K3N A;  5ANQ A;  5IVF A;  4CCM A;  3PU8 A;  5FZG A;  5LY1 A;  5FYY A;  5F5C A;  4CCK A;  5FXV A;  5A7Q A;  5A1F A;  5FZE A;  5FYZ A; 
#chains in the Genus database with same CATH topology
 1W9Y A;  4YFZ A;  1ND3 B;  4MO3 M;  1PGL 2;  2P5B A;  4PIX A;  1JTZ X;  3I2G A;  4A42 A;  5FO9 B;  5FDB A;  5L9B A;  2JE8 A;  1RUF 3;  3WQ0 A;  2DVA A;  1O4T A;  2ZAB A;  3T1M A;  2HEY F;  1UMI A;  3WEZ A;  4EE2 A;  4RN5 A;  3NMB A;  1SLI A;  2BTV C;  3AYA A;  4Q1P A;  1GOG A;  4URA A;  1OOP C;  1RUC 1;  1ODM A;  2WS9 2;  4N7I A;  4XJ8 A;  2AEZ A;  1QJY 1;  4XDO A;  2XWB B;  2WZR 2;  4XUN A;  2BW8 A;  1DGR N;  1H2K A;  2G19 A;  1XC6 A;  2DVB A;  3CDZ B;  3NST A;  4OHW A;  4ASL A;  3GCW A;  5KC5 A;  3ZXG A;  1G86 A;  4GH4 A;  2QJV A;  1ENS A;  5FZ8 A;  1DGW A;  3I8T A;  3GZU C;  4HSJ A;  2Y33 A;  2Y6F A;  1W9T A;  1Q8O A;  3LZZ A;  1YFY A;  3TRS B;  4LR4 A;  1AR7 2;  2WNV C;  2VQ0 A;  3VBH A;  2C6S A;  3I3Q A;  3O7O A;  4YGE A;  2XLA A;  2RM2 3;  1HLC A;  5F32 A;  2YXS A;  3HOB A;  2H0V A;  2HH9 A;  3VUO A;  2W87 A;  2DV9 A;  2IXK A;  4RD7 A;  1ASJ 3;  5DPN A;  4TSV A;  1FPN 3;  2J1E A;  4FPC A;  1OOP A;  4OHV A;  4GH4 B;  2QQP A;  2VZR A;  1AR6 1;  3ZYF A;  1WLD A;  5G05 L;  1HKD A;  3AYE A;  3FUQ A;  5FPU A;  1OT5 A;  3VDD C;  1JYI A;  1PVC 3;  5JUV A;  3LE0 A;  4NWW A;  3SMH A;  3MIC A;  2QQW A;  2E51 A;  5J96 B;  5FYC A;  1ZA4 A;  2D93 A;  3MID A;  3WW3 A;  3VBH B;  4K8F A;  1M4W A;  2QQN A;  4P9I A;  3OG2 A;  2ZHN A;  2E63 A;  3E5U A;  3SH5 A;  1IQA A;  2MNG A;  4R52 A;  1H8V A;  1LB2 A;  2PAK A;  2WNV A;  4CP0 A;  2GMP A;  1Y7B A;  2XB6 C;  1DBN A;  2JDP A;  2WQZ C;  3ZMN A;  2GND A;  1K42 A;  1SDW A;  3WW4 A;  5FRE A;  5C3S A;  1LJ7 A;  1YFW A;  1PO1 1;  2BER A;  4QXC A;  1OOP B;  2PTM A;  3J7L A;  3WD5 A;  4BJ0 A;  1OUS A;  3CO2 A;  3SKJ E;  5JMO A;  2ZGU A;  1B09 A;  2CTV A;  5F5I A;  1TE1 B;  1DGW X;  4BE3 A;  3B69 A;  2JIJ A;  4IUG A;  1XNT A;  4AVS A;  2VZ3 A;  1V9U 1;  1J84 A;  2G9Z A;  5FZ3 A;  2BRT A;  2XG3 A;  1NXD 1;  2GC1 A;  1NLS A;  5L19 A;  1AR7 1;  3MDP A;  1VRH 1;  1YQ6 A;  3BPS A;  2WNV B;  3OGR A;  3T4H B;  2YC0 A;  2TEP A;  1QIQ A;  4OUE A;  4IGP A;  3SNM A;  2PLV 1;  3OY8 A;  3VBS C;  4LBL A;  4QHO A;  1ACC A;  3MLK A;  5A3L A;  1N1S A;  2EIC A;  1URX A;  3USS A;  4N7U A;  3MF9 A;  1OF3 A;  2NM1 A;  3R4U A;  4NIH A;  1W6M A;  1JUI A;  5A3M A;  4RGA A;  4BIF A;  1BYH A;  4OI2 A;  1O7F A;  3ITQ A;  3ZX7 A;  5KHG A;  4ES9 A;  3KVB A;  5JCT A;  5FY1 A;  2RS5 1;  3DEC A;  2VD7 A;  4EZH A;  3VDD B;  4FCA A;  1CIW A;  4FOW A;  4QX0 A;  3M3O A;  3FBY A;  3WUD A;  1RUE 2;  3WLU A;  1YHF A;  2G9F A;  3I2I A;  1YEW A;  3N36 A;  3T4V A;  3THD A;  4QXB A;  3OY8 B;  4Q4Y 2;  4K1Y A;  5JXG A;  2XPJ A;  4QGN A;  3OB8 A;  5FFO C;  5JOZ A;  1AR9 2;  1S2B A;  5FZK A;  4HKL A;  4QPW A;  3CJX A;  4K6B A;  1EV1 1;  2JDK A;  3RSJ A;  3VHP A;  4CA9 A;  1W6M B;  3AB0 A;  3VBS A;  2G4I A;  5K0U C;  3FFZ A;  1OXC A;  2CWS A;  1SQ4 A;  4YW6 A;  3HR9 A;  3ZN5 A;  2PHL A;  4I3P A;  4Y22 A;  3V0B A;  1YWK A;  4UW4 A;  4OMC A;  3AMN A;  3K3O A;  3GDB A;  4RL7 A;  1VJ2 A;  3POF A;  5ACA 2;  2HWC 3;  1TME 2;  1OVP A;  5T5O A;  1CJP A;  4JKK A;  1LOA A;  3PVE A;  3MYX A;  2ZGK A;  2V5Y A;  1I6X A;  1QOO A;  1YQ8 A;  4QDQ A;  4JZR A;  1YI9 A;  2O8Q A;  1ZM1 A;  4YGD A;  1OMI A;  4SLI A;  5FZF A;  4AZZ A;  2FDG A;  5FZH A;  4K21 A;  2VZU A;  2ZXQ A;  1VBD 2;  3VBS B;  2VH9 A;  1AR8 3;  3T2P A;  3H3U A;  5LZ6 A;  1O8P A;  3AK0 A;  3CJI C;  3VKL A;  4BM8 A;  2WO7 A;  3LPG A;  3MW3 A;  2ZGR A;  4Y1X A;  4A7K A;  3MLJ A;  3H3L A;  4Y22 B;  3V0B B;  3DN7 A;  4AVT A;  1UX7 A;  2BVB A;  2XKO A;  3ES1 A;  4XE9 A;  2VMF A;  3O1U A;  2CAU A;  5FRA A;  4BB3 A;  5C9A C;  2Z4F A;  1XNK A;  4ZU7 A;  2OS2 A;  3T09 A;  2VOV A;  3KVA A;  2R04 1;  2CDP A;  1I5Z A;  5HXV A;  3TN9 3;  4DUW A;  4I0A A;  2W47 A;  1WME A;  3VZJ A;  3JB4 C;  3O1S A;  3WCS A;  4AAX A;  1OA4 A;  4CSW A;  1VE0 A;  2KM2 A;  3P5B A;  2VVF A;  1AR9 1;  2QTW B;  3OEB A;  3ZPY A;  5IAV A;  3ETP A;  2WFF 3;  4KG8 A;  3T08 A;  5D1I A;  1GWM A;  2YBP A;  3OBZ A;  4JDN A;  2D43 A;  1F4A A;  5EFU A;  3CJI A;  3HJR A;  5A33 A;  4XFH A;  4IER A;  4HFS A;  4Q29 A;  1Z7S 3;  1Q8V A;  1ULC A;  2QDR A;  2JIG A;  3HT1 A;  4XPV A;  4NAO A;  1TME 1;  2VNG A;  5F3G A;  3L9J T;  1WCQ A;  3WCR A;  5C9A A;  1XOY A;  5D8A C;  1RUG 1;  2P6C A;  1HRV 3;  1MR5 A;  5FPL A;  4TLF A;  1TEI A;  1D4M 1;  3MFC A;  4MUV A;  3RNS A;  1UYP A;  1VAV A;  3K3N A;  1QJX 3;  3L2Y A;  1RHI 3;  1XSR A;  4XJA A;  2VQA A;  4CYD A;  1S0J A;  1LTE A;  1VBD 1;  4YZ3 A;  3AP6 A;  1GYK A;  5FYY A;  1LNS A;  1OA3 A;  1SBF A;  1QDC A;  1YO8 A;  1W6O A;  4YWA A;  2D6L X;  3CJI B;  3KSC A;  4P9X A;  4YM2 A;  3JQX A;  1XBF A;  1Q8P A;  2UYA A;  2Y38 A;  3HIF A;  2P3J A;  3Q8C A;  1MS9 A;  4Z1V A;  2A6W A;  3B94 A;  2GNT A;  5I8Y A;  2WYF A;  3KGZ A;  1GZW A;  1HB4 A;  1JYC A;  2VOK A;  3KCY A;  2SBA A;  1AJO A;  4GZ9 A;  1CAX B;  5C9A B;  2HWB 3;  3NNJ A;  3VKF C;  1S0C A;  2XL9 A;  3KS7 A;  3EHK A;  4DY3 A;  4OVE A;  1RIT A;  2VG9 A;  3JD7 3;  1OLM E;  1DLC A;  5DDJ 3;  1S4C A;  4NHM A;  4HN1 A;  5D8A A;  5J3U A;  1WCD J;  3RI9 A;  4GUL A;  1HRI 1;  2XJS A;  1DZQ A;  2GSY A;  4XAC A;  5FYB A;  5FP7 A;  4GAL A;  3M2M A;  4Y3O A;  2P17 A;  5A3N A;  4LBJ A;  3GBW A;  1H30 A;  3GM8 A;  4Z2W A;  1GLH A;  1NZC A;  4JKL A;  1Q3E A;  2WZE A;  2TUN A;  3X29 B;  1ZVF A;  1UZV A;  1XYN A;  1ZRR A;  2XBO 1;  3PMS A;  4P9W A;  5I0T A;  2OPW A;  2VAU A;  2NQY A;  3WP6 A;  1GZW B;  1JS9 A;  3KV6 A;  4KWL A;  2Q8O A;  3PUH A;  2HWE 3;  3VKN A;  3WDT A;  5CKM A;  3U4X A;  3ZSJ A;  5T54 A;  3UKT A;  3VL9 A;  5GAL A;  3M3I A;  4NPM A;  4QQO A;  2R1D A;  3WF2 A;  1S55 A;  4LT5 A;  4XJU A;  2K46 A;  4HOO A;  4KL1 A;  5D8A B;  5IVJ A;  3INA A;  3BTZ A;  1RUC 3;  5E89 A;  2NN8 A;  1QJY 3;  1WLC A;  4ONU A;  4LQR A;  2J1U A;  5LY2 A;  2EID A;  1A78 A;  4NJ4 A;  4S2F A;  3O12 A;  5H9S A;  5I93 A;  1UAI A;  5GLU A;  2P2K A;  2AYH A;  1OHF A;  2X8K A;  5G04 L;  2XJP A;  4FOY A;  2A3X A;  1RUI 2;  4FFH A;  4Q4V 1;  3VD4 A;  2EVX A;  1RUD 2;  4C90 A;  3WZ1 A;  2XLG A;  3WDV A;  4AVV A;  2D3P A;  1GIC A;  4JKM A;  3KF5 A;  4QX8 A;  4Y1U A;  2VZ1 A;  4C0H A;  2DWR A;  2GC2 A;  4XOG A;  3NNM A;  2RS1 2;  4Y4R A;  1HDK A;  1F9K A;  4O65 A;  2Q1M A;  4E8C A;  1KGY A;  1FOD 2;  4UFI A;  3PTR B;  4NHY A;  5IK4 A;  3LOI A;  2FQP A;  1CJD A;  2XJU A;  1W6P A;  2UYB A;  2VUC A;  5FMD A;  5F9T A;  4XJW A;  2EAK A;  4WZC A;  4GQ7 A;  2PFW A;  5EPA A;  1AX1 A;  4E4D X;  2RJK A;  1COV 2;  3W5M A;  1RJ8 A;  1AR6 3;  5CFC A;  4LO7 A;  5LAS A;  5FPZ A;  4I30 A;  5FYS A;  2ZGN A;  5FYU A;  4Q8L A;  3NV1 A;  1W8T A;  5D2A A;  1TQ5 A;  4AF9 A;  3SQO A;  5BNP C;  4UYB A;  5K4L A;  4FI9 A;  2EAA A;  1W9F A;  4FTB A;  2JG8 C;  5DAP A;  1UXX X;  2PQS A;  4QB6 A;  5LAT A;  1C8M 2;  3UJQ A;  4Q4X 3;  5IT6 A;  2PA7 A;  4WVZ A;  1WMD A;  1W6P B;  2V72 A;  3BCW A;  3HAG A;  2ZHL A;  1QWR A;  3WG3 A;  5BNO C;  3IDE A;  4OUL A;  1PO1 3;  2ZEX A;  2RVA A;  5A7Q A;  3RYK A;  4ZZ5 A;  5HCH A;  4AYU A;  4AR2 A;  3MIB A;  1DG6 A;  1JOP A;  2ARA A;  4IEO A;  3WQB A;  1ULF A;  4LMF A;  3HNY M;  4PIY A;  5FYV A;  4MGT A;  3U0Z A;  1D2Q A;  1YJK A;  1RUI 1;  2DDU A;  2R32 A;  3I3E A;  4N53 A;  1A34 A;  2VCB A;  4CE8 A;  1V9U 3;  1UCX A;  1SBD A;  4XDQ A;  4LHN A;  5E88 A;  5A7O A;  4NPR A;  1UIK A;  2W1Q A;  1VRH 3;  1QHD A;  2C4X A;  5BNP A;  4AGV A;  4I0W B;  4WVM A;  3KMH A;  5E16 A;  2PLV 3;  2RS1 1;  3NWK A;  2RR1 2;  2JG8 A;  4Y1V A;  5CA6 A;  4FPL A;  2D6P A;  3KLS A;  4QPI C;  4NIA A;  3WDY A;  1HIX A;  4E2S A;  1FOD 1;  3TOJ A;  3OSD A;  1NA1 C;  4LHK A;  1U0A A;  1WKY A;  3AKT A;  2WN2 A;  1SPP B;  2R1B A;  2ZHM A;  3O0X A;  4UFM A;  3WF4 A;  5EYX A;  5GZF A;  3TEX A;  2BZD A;  5BNO A;  4L8Q A;  4UOJ A;  1COV 1;  1TG7 A;  3U07 A;  4X8P A;  2C1F A;  2RS5 3;  2VNR A;  3H7Y A;  3E5X A;  5FPA A;  4AWD A;  3AXE A;  4J25 A;  3IPV A;  2B46 X;  3EQE A;  3UV9 A;  1ST8 A;  1ZBA 2;  5BNP B;  4WVM B;  2DVD A;  4LIV A;  4RGK A;  5AVA A;  3AJY A;  2JG8 B;  1PX4 A;  4QX2 A;  4Z82 A;  2FD8 A;  5I91 A;  4BME A;  4D7Y A;  5J7M A;  1EV1 3;  2Z69 A;  5JIA A;  4D7T A;  3HN3 A;  3WF0 A;  5FUN A;  4QPI A;  1LKN A;  5BNO B;  4M0N A;  4QGL A;  4YG6 A;  4A6O A;  1YFX A;  1JZ6 A;  3I2H A;  1NA1 A;  4OI4 A;  5EP9 A;  3AZZ A;  5FY4 A;  1O3R A;  1UOJ A;  3HD8 B;  1XXN A;  2LS6 A;  3LSE A;  4B1L A;  2RS3 2;  2DU1 A;  3IPV B;  3NL1 A;  2OQ7 A;  1GSL A;  3SEE A;  1AF9 A;  5HCF A;  2DF7 A;  2B9V A;  2ID4 A;  3SCG A;  1YI7 A;  3ZXK A;  1KEX A;  4F3J A;  5A1A A;  3LA7 A;  4AE2 A;  2XOM A;  4C1X A;  4QMA A;  4IEU A;  1OA2 A;  5FPV A;  4DXR A;  2Q8D A;  5FOJ B;  3DF0 A;  5F5A A;  4A4A A;  4DEQ A;  1UIJ A;  2V73 A;  4DOU A;  2ZJC A;  3JB8 A;  1D2S A;  4MVT A;  4QPI B;  4XFI A;  3WDU A;  4IV3 C;  1T2X A;  2ZGS A;  2W95 A;  3O1M A;  2Y6G A;  4CPB A;  1NA1 B;  1ZZ9 A;  2CSG A;  1QJU 2;  1G8W A;  2GP5 A;  2HEV F;  3BI3 A;  1QOT A;  3C7F A;  3WIN E;  4HT1 T;  4CU7 A;  2DVF A;  1Y4W A;  2IXL A;  1VBC 2;  1LAJ A;  1BBT 2;  4H3W A;  1RVF 3;  3C7H A;  4LTA A;  2R04 3;  4GKY A;  3CQO A;  3I59 A;  3PVB B;  2VZV A;  2AGS A;  2Y60 A;  3V64 A;  2XLF A;  1F8V A;  4GWI A;  4DFS A;  1RED A;  1X33 A;  1N3O A;  5LY1 A;  1RXG A;  1YLL A;  2JE7 A;  3RZH A;  1UX6 A;  2P37 A;  3JBG 2;  1YRZ A;  1K5J A;  1QXR A;  3AP7 A;  3DYM A;  5A7N A;  2WO3 A;  3AXD A;  3AFK A;  2I2S A;  1IKP A;  3NJX A;  5FK7 A;  4IV3 A;  1G9F A;  1SMV A;  3G7D A;  4YFW A;  3SH3 A;  3WW1 A;  5FZO A;  1A8D A;  4GXL A;  4KU7 A;  3C7O A;  1RXF A;  3VBU C;  4HZF A;  5T50 A;  1TME 3;  4FFI A;  2GMM A;  5A6X A;  4QQ2 A;  1GQP A;  1NLR A;  2IVI B;  2VUA A;  5FP9 A;  5T5J A;  3ZSE A;  1RUG 3;  3M1H A;  4DQA A;  4XEZ A;  3PJY A;  5DUX A;  4XW3 A;  2BWA A;  1GP6 A;  1D4M 3;  4EN0 A;  3GBG A;  5DG1 A;  3L2H A;  4MZU A;  1W9W A;  1E5S A;  4JTO A;  3S5A A;  1JHN A;  1HB1 A;  1H9P A;  1WA6 X;  1SCR A;  1W28 A;  1VBD 3;  2RMU 1;  2J22 A;  4XXA A;  3MBW A;  4LLF A;  3ILR A;  4O9G A;  3WNN A;  4YZ5 A;  5LK5 A;  5LEK A;  4IV3 B;  3BU7 A;  2VTF A;  1EPZ A;  1JYX A;  5FZO B;  4XIL A;  1QJU 1;  2HEW F;  3SH4 A;  4N8M A;  4YZ4 A;  4Z07 A;  3KZ4 C;  1U5Z A;  4EWD A;  2HWF 2;  2VTX A;  5A6Z A;  5FZI A;  2QQU A;  4HMZ A;  2WA4 A;  1HN1 A;  4LJH A;  1PIV 2;  5KXE A;  2W2I A;  4QQP A;  3LQC A;  4DXS A;  2OX0 A;  1SAC A;  2V5D A;  3VBR C;  1VBC 1;  1BBT 1;  3NJY A;  1QQP 2;  4JDO A;  4QAW A;  2VW2 A;  5FLJ A;  1GP5 A;  3VBU A;  1PZ9 A;  5AC9 2;  1IS3 A;  2WQ4 A;  3SKV A;  3DL3 A;  4P08 A;  1SLB A;  2DFC A;  4V2W A;  3IMM A;  3WVJ A;  3O0V A;  2IC1 A;  4FTE A;  2OPK A;  1HRI 3;  4P5Y A;  4PDW C;  4TYS A;  3VD3 A;  4AHW A;  1BLZ A;  1AVB A;  4LA3 A;  5IWF A;  3GZT B;  2DUQ A;  3U4S A;  2ZGT A;  1W2N A;  2XBO 3;  1AL2 1;  4JDM A;  3I54 A;  4Y24 A;  2VCC A;  3CL1 A;  3ETQ A;  3OCP A;  4YPJ A;  4BWO A;  3VBF C;  1KRI A;  5DAV A;  2YY1 A;  4M3C A;  3RVH A;  1FNY A;  2ZA9 A;  4PF1 A;  4URT A;  4ATF A;  4COY A;  4EYU A;  3RZM A;  3VBU B;  2HYX A;  2VU9 A;  3III A;  5JXJ A;  4AFA A;  3R05 A;  4U2A A;  3U78 A;  2MPF A;  4KGG A;  4CCO A;  2VNO A;  3VD9 A;  2FDH A;  3VBR A;  5CEH A;  4XUQ A;  3HQU A;  2E6V A;  5DUW A;  4AG4 A;  1WCK A;  3FUO A;  3BOD A;  4Q0V A;  1UKR A;  1WWY A;  3ASI A;  2BFU L;  4XUT A;  3RDI A;  2QQO A;  4BK5 A;  5KHH A;  1MVQ A;  1U5I A;  3I3B A;  3ZN6 A;  2QNK A;  4LA2 A;  4Q4V 3;  1JYV A;  2ZS6 B;  2VW0 A;  3AX4 A;  4Q0Q A;  4M3C B;  3FFQ A;  3PDQ A;  3BKZ A;  4Q0S A;  2BP6 A;  4D6Q A;  4IL7 A;  4AHY A;  4X6Q B;  1ZRC A;  1MS1 A;  3H1Y A;  3VBF A;  2B42 B;  1FX5 A;  4AW7 A;  1BVP 1;  4XBQ A;  1DHK B;  1QQP 1;  2VQT A;  2Y6J A;  2Z79 A;  3DKW A;  5T3N A;  3VBR B;  2XON A;  3FL7 A;  1FV3 A;  4P00 B;  4RHV 1;  2C0Z A;  2BDR A;  5DQ0 A;  1S2E A;  3UGF A;  4YGB A;  1CN1 A;  3BVC A;  3C7G A;  1UY0 A;  4R4X A;  2OZ6 A;  3SLI A;  4HVR A;  4PQQ A;  4PDW B;  1AUY A;  2J7M A;  4AFD A;  1UYZ A;  3OGJ A;  4MHU A;  2RJL A;  5BUV A;  4ARY A;  4QX5 A;  3OGS A;  2VOT A;  2ERF A;  5JZG C;  1DP0 A;  1GP4 A;  3VBF B;  4S2D A;  4Y20 A;  4AVB A;  1X8E A;  4DIN B;  1O4Z A;  2GAU A;  4PCR A;  4NR1 A;  2UY9 A;  4AHX A;  1NQJ A;  3ZN4 A;  1GFF 2;  4UFH A;  1CR7 A;  3V65 A;  4D94 A;  4HN0 A;  2ADE A;  3DKQ A;  1JI6 A;  2OVU A;  2E7A A;  1J83 A;  3VBH C;  4GJY A;  1RUH 2;  1JOB A;  1ULE A;  4YW7 A;  4E2G A;  3ILN A;  4LK7 A;  4YSF A;  2VC9 A;  1FT9 A;  1IZ3 A;  5C6C A;  1UZY A;  2IXJ A;  2WN3 A;  4XTP A;  5FYT A;  3J4U H;  4Q0U A;  4YYO A;  5F6K A;  1XNC A;  1R08 1;  1PGS A;  1S0B A;  3MW2 A;  3SXW A;  4C91 A;  1W0O A;  4Y20 B;  4B3N A;  1HV1 A;  1XJA A;  1X9T A;  2QBX A;  1KS4 A;  3K2O A;  4R8H A;  5APA A;  4ZY9 A;  4GWN A;  2AR6 A;  2R07 2;  4UW6 A;  3ZDV A;  3ZKY A;  2BBA A;  5JZG A;  1W3X A;  5K9Y A;  3VD7 A;  2MEV 2;  2PHF A;  3U75 A;  1D7P M;  4CP2 A;  3I49 A;  5CAD A;  3GHM A;  1DGL A;  2Q1F A;  1FOD 3;  3ELN A;  4FTS A;  1POV 1;  3IWZ A;  5GLV A;  3CU7 A;  3GXU A;  2QQV A;  1UOG A;  4NRP A;  3UL2 A;  4YM0 A;  4DO0 A;  1E5H A;  1LGC A;  3KHB A;  3I3M A;  1COV 3;  3E5Q A;  2HBT A;  4CUB A;  2VCA A;  2WWS A;  4XZU G;  4M3C F;  4H14 A;  1PHM A;  5T5L A;  5JSP A;  3O0W A;  1FYU A;  2J1T A;  1O6U A;  2V09 A;  1LED A;  2SLI A;  1C8N A;  2GH8 A;  4OYU A;  2XUE A;  3WHT A;  2XR4 A;  5JZG B;  1J59 A;  1S0D A;  2CU5 A;  4PQ9 A;  4COU A;  5ABJ C;  2KXL A;  4NID A;  3CF6 E;  3W9A A;  1OI6 A;  5EJ1 B;  4BQY A;  4HVO A;  2YBS A;  4M4R A;  1AYN 2;  5F8P A;  4QDS A;  1XU1 A;  4GMP 0;  1UN1 A;  1ZZ7 A;  3N4M A;  2A6Y A;  2JD4 A;  3UKV A;  1NQD A;  2BVV A;  3S5Q A;  4D69 A;  1XE0 A;  3H1W A;  2JG9 A;  3FHI B;  3OJB A;  3PU3 A;  3H42 B;  3ACL A;  4QM9 A;  3PHM A;  1PGL 1;  1DIW A;  1DQ0 A;  2QQL A;  1VB2 A;  2PQQ A;  2D97 A;  5FXZ A;  4QHB A;  4I3G A;  1WMF A;  2JXA A;  4B7E A;  4NIG A;  2GME A;  2E32 A;  1CQ9 A;  2CWM A;  4QT6 A;  4XF4 A;  2GDF A;  2OKX A;  2I74 A;  2YU2 A;  3USU A;  4B1M A;  5F3I A;  1LOG A;  2ZAA A;  4G9S B;  2WZP P;  2WR9 A;  1E5I A;  2A6Z A;  4A45 A;  4LNV A;  2FCT A;  1G7Y A;  2Z2S B;  4ES8 A;  5JSR A;  1GWK A;  2D6M A;  2WS9 1;  2R07 1;  5FZG A;  4E4S A;  2OUJ A;  1QOS A;  2WZR 1;  2QCS B;  2MEV 1;  2NPI A;  1LUL A;  4EWA A;  5ABJ A;  3FLT A;  3H1M A;  3UGG A;  4JCK A;  2Y34 A;  1BKZ A;  3OPZ A;  5FWJ A;  2R30 A;  1U5X A;  1Y9G A;  5CB7 A;  4CXX A;  1HQN A;  1PGW 2;  1RL3 A;  1IGO A;  4BMB A;  2RV9 A;  2D6O X;  1RGS A;  3ECQ A;  1TZO A;  4F7Z A;  2YZ4 A;  4CXY A;  1GZT A;  4D7S A;  1RUO A;  3Q8A A;  1L3J A;  1GZC A;  4LBQ A;  3OEA A;  3USU B;  1CVN A;  1L7R A;  1T6G C;  1XNB A;  4GAZ A;  5HCA A;  4E2Q A;  1PZ7 A;  1H1M A;  1UF2 C;  5LW9 A;  5J98 B;  1HW5 A;  1JZ8 A;  3AL6 A;  2BOI A;  1X9P A;  4FPE A;  5FZ6 A;  4GIQ A;  5JLV A;  4XCB A;  1QEX A;  2XUM A;  2XVL A;  3B9I A;  1PM7 A;  1VAK A;  3LEM A;  2JEC A;  5ABJ B;  5IVB A;  3VHN A;  4OI0 A;  2ZCW A;  1RJ7 A;  4KBZ A;  1QXP A;  3R4S A;  3IKW A;  5CKN A;  2XH6 A;  4QQH A;  4XFA A;  2R6Q A;  3WNM A;  3ZXF A;  2OZJ A;  2RHP A;  2Z42 A;  2IVJ A;  4JGZ C;  3RYR A;  4A7Z A;  5JPM B;  1QH6 A;  4LBQ B;  3LGR A;  4LPL A;  4CXW A;  1QJZ A;  2BBV A;  1YQC A;  1FMD 3;  1W9S A;  2XJV A;  4E4Z A;  1IG3 A;  5L73 A;  3IDC B;  2QDN A;  4LEJ A;  1OUR A;  1JYT A;  4AFB A;  2FDJ A;  3G6J B;  3OD0 A;  5J1X A;  2A6X A;  2E7T A;  3LA3 A;  3DGT A;  5FWE A;  3VZN A;  5FOB B;  1WA4 A;  3SCF A;  2JWP A;  3P1I A;  1L7L A;  4XQW A;  1BCX A;  4UBG A;  2QQJ A;  4FP2 A;  3ON7 A;  3QD6 A;  5CNA A;  5CBL A;  3ACF A;  4DNY A;  1O59 A;  2RMU 3;  2PEL A;  1C5I A;  4YGC A;  2DTY A;  1LOE A;  3IBM A;  3OOX A;  3WNK A;  1MZF A;  3ZM8 A;  4D6S A;  2CL2 A;  2ENR A;  1F5J A;  4LIT A;  2QQM A;  3EMR A;  4LK6 A;  1F35 A;  1QJU 3;  4CCC A;  4FBF A;  1JBC A;  4M0H A;  1V6N A;  2EXK A;  2O1Q A;  2YHJ A;  4JGZ A;  4PLN A;  5F6L B;  3KF3 A;  4A7Y A;  5BV6 A;  2WT2 A;  5GLZ A;  4FFF A;  4HK8 A;  5C5T A;  4UBH A;  1EAH 2;  2AH2 A;  4QU2 A;  1SG3 A;  3NW4 A;  4CCJ A;  5TSW A;  2IZW A;  1ZRF A;  1DLL A;  2BEO A;  2DUP A;  2E33 A;  4W6X A;  4MSV A;  4QD2 A;  3IZO A;  5DXD A;  2W3J A;  2VY0 A;  4KBB A;  1GOH A;  5ERL A;  2FZ1 A;  1I3H A;  4IEQ A;  4IEX A;  1GOF A;  4BQ1 A;  4GWM A;  1LES A;  2GP3 A;  2WDB A;  4RA0 A;  3JXS A;  3BU0 A;  3THC A;  2A7A A;  1AL2 3;  2EXJ A;  5EQU A;  1RUE 1;  4JGZ B;  3IIA A;  1PK6 C;  4BDV B;  2D5F A;  3KB5 A;  4LBM A;  3ZR5 A;  1HXS 2;  2Q0A A;  4OQ9 A;  2RDQ A;  3W59 A;  3URF A;  4XC9 A;  4Q4Y 1;  2JDY A;  4CCM A;  5J37 A;  3BGA A;  2DBI A;  4BH9 A;  4DUX A;  1LOC A;  5DG2 A;  3FHQ A;  3GZE A;  1WW7 A;  5FXV A;  2FBE A;  5DAB A;  2VO5 A;  1N1V A;  3ZOI A;  1LU2 A;  4OQ8 A;  3LEI A;  4LO8 A;  2QFE A;  1NYW A;  5BNQ A;  3M4F A;  4PI2 A;  1VMH A;  2D40 A;  2ZX1 A;  4XJ9 A;  3N9M A;  2WRA A;  4UWD A;  1GMM A;  5ACA 1;  3N9P A;  3POW A;  3VN4 A;  2D6K A;  2E9Q A;  4AVA A;  1BEV 2;  1T6B X;  3NV2 A;  2ZKN A;  4I01 A;  2W91 A;  5DZG A;  5A1L A;  2Y8K A;  1RMU 3;  4AI1 A;  3AP9 A;  3J9S A;  4MHR A;  4QKN A;  1AJK A;  4HXC A;  4J1X A;  1PK6 A;  2GNM A;  1CPN A;  2HWD 2;  4GWJ A;  2WNE A;  5GKA C;  4XQ4 A;  2RG4 A;  5IVY A;  4TTG A;  4PLM A;  1EAH 1;  4JRL A;  3M8L A;  1MS4 A;  4A3X A;  4RHV 3;  4AAP A;  4BQ4 A;  1DF0 A;  2ZX3 A;  5DAW A;  3N7M A;  4KI5 M;  2HBU A;  4MYE A;  5DAX A;  3J7N A;  3VZM A;  5A33 B;  1ZBE 2;  4GD4 A;  2ZGQ A;  5C33 A;  2YV8 A;  3GJB A;  1OQE A;  1XB9 A;  1VAL A;  2DUO A;  3ZIX A;  5C4W C;  3J7H A;  4L99 A;  4IET A;  5FMC A;  2WT1 A;  2Q4S A;  3U10 A;  4ASM B;  4BXS V;  5E8A A;  3RG0 A;  3LOB A;  2BPA 2;  1QNY A;  4RQP C;  3TEW A;  3I2J A;  3EB7 A;  1PK6 B;  2CGO A;  4IEW A;  2JDN A;  1QJF A;  3D5O A;  4JAA A;  2JEN A;  1ZZB A;  3RGB A;  2IXI A;  1W6O B;  4NN0 A;  2DCT A;  1EYB A;  4CTE A;  1H8T C;  5LBC A;  2V4A A;  1X7N A;  2W52 A;  3ZYB A;  3PIG A;  1PO2 2;  1UY1 A;  3OUJ A;  4XF3 A;  3JZV A;  2O0O A;  1BZW A;  1DCS A;  1DYO A;  1DQ4 A;  3TNP B;  3ATG A;  2X10 A;  1XYO A;  1LHO A;  5C3Q A;  4E8D A;  1LGN A;  4M00 A;  4BPZ A;  4XAA A;  4K9S A;  5IVV A;  5T55 A;  3BB6 A;  4ORF A;  4YAR A;  1UYX A;  2LW8 A;  4HBN A;  1W0P A;  1BK0 A;  4OUM A;  1CES A;  1XPW A;  3MV0 1;  5JWP A;  5C4W A;  4BIS A;  2MHF A;  1CD3 G;  1KFU L;  1NLQ A;  1R08 3;  1UO9 A;  4XAB A;  2VME A;  5A6Y A;  3B5L B;  4ISR A;  1R09 2;  1BXH A;  4NMI A;  3T0D A;  1A6C A;  1PX3 A;  5C3R A;  4RQP A;  1WLT A;  5CFC C;  5FLH A;  2HWD 1;  5T5P A;  3LF7 A;  2VBB A;  2WAB A;  4CRQ A;  3I2O A;  3ZPO A;  3RJR A;  3AMH A;  1BJQ A;  1HB2 A;  1JZ7 A;  1POV 3;  1CAV A;  5A80 A;  2YBK A;  5I0D A;  1LOF C;  2FDI A;  1UPS A;  2UWA A;  4J6G A;  1H8T A;  2BU9 A;  2EIB A;  2WAA A;  1CWP A;  2D5H A;  2W1S A;  3J8F 2;  3MW4 A;  1VBB 2;  2VPV A;  3KT7 A;  3CLP A;  4B4P A;  5C4W B;  1V6M A;  3PUQ A;  4C0B A;  5ANQ A;  3T2O A;  2LM3 A;  2ZZJ A;  3PU8 A;  3PJQ A;  4RQP B;  2CGP A;  1IS6 A;  1VBE 2;  4CCK A;  1MZ6 A;  4XZP A;  1RUF 2;  4R9B A;  4COV A;  1YNA A;  2ZAH A;  3ORJ A;  4AFM A;  4YZ2 A;  4DRV A;  4N53 C;  2QQK A;  1CAV B;  3BTA A;  1REF A;  2VUJ A;  2JD9 A;  1QXJ A;  4QM8 A;  1H8T B;  3P3N A;  4PHZ A;  2YFZ A;  4TN7 A;  5JR2 A;  4QU1 A;  4FFG A;  3E6C C;  2ZEY A;  3MGU A;  2AUY A;  1LOF A;  3DCQ A;  4Q5O A;  3ZYJ B;  3POJ A;  4FOQ A;  1HQL A;  4OLL A;  3RZL A;  3NAP C;  3ZMO A;  2R7E B;  4OI1 A;  4XIK A;  2L9L A;  3ACH A;  5E6H A;  5B4N A;  4CUC A;  1OF4 A;  4P9G A;  4B4Q A;  5FY0 A;  3TEZ A;  3WUC A;  5I8S A;  4LKD A;  1K3I A;  4KH9 A;  2WS9 3;  5FYI A;  2R07 3;  4ITC A;  4YVS C;  2WZR 3;  5CFC B;  2MEV 3;  1WZX A;  1KJR A;  2VOW A;  4W6W A;  5C7G A;  4XYX A;  4YLZ A;  2VZP A;  2BUK A;  4QB2 A;  1UU5 A;  4BXF A;  5HV4 A;  2DCY A;  4JV4 A;  1UMZ A;  3P6B A;  3ZYR A;  5C71 A;  1K12 A;  3I2K A;  3QH7 A;  3VKO A;  2BWC A;  1RUD 1;  1ASJ 2;  3DUI A;  1CZV A;  3LB9 A;  3MV1 1;  3OBA A;  1FPN 2;  1K45 A;  3AYD A;  3QH6 A;  5CG9 A;  1AR7 3;  1XNA A;  2DBN A;  3PVN A;  4IEZ A;  5LBB A;  4DY5 A;  5JDB A;  1ZRI A;  3DXT A;  4FP3 A;  4AI2 A;  1F4H A;  3NAP A;  4KQ7 A;  1W8W A;  3GJA A;  4HSL A;  3POY A;  4LKE A;  4K40 A;  1VBE 1;  2Y64 A;  4QQL A;  1RUF 1;  2WNU C;  4W6Y A;  1YJL A;  1QF3 A;  4IEV A;  4D8M A;  4E27 A;  1VRB A;  4H7L A;  5A3U A;  2E7Q A;  3K4Z A;  1JZ4 A;  4RS5 C;  2XJQ A;  4N53 B;  4Y5S A;  5ANN A;  4CU9 A;  1NZI A;  2E31 A;  4YVS A;  3LFM A;  1MZ5 A;  2VE1 A;  5GM0 A;  1UZ0 A;  2OUH A;  3LFI A;  3POI A;  4NPL A;  4ZKT B;  4QX1 A;  4Q4W 2;  3DYP A;  3VL8 A;  4BA6 A;  2Q30 A;  5A3W A;  3NAP B;  4UT5 A;  1C8M 1;  2NYY A;  3NJZ A;  1QDO A;  4JGY C;  1N1Y A;  2VMH A;  4KU8 A;  4R9C A;  4JRA A;  4AED C;  2P3I A;  4B8E A;  2ZMN A;  3B02 A;  5EZW A;  3WP3 A;  4BQ2 A;  4H2A A;  3MEP A;  4PI0 A;  3W5N A;  3GGL A;  1IG0 A;  1CZS A;  1ZZ8 A;  2GH2 A;  4YVS B;  1EY2 A;  1NE4 A;  4EV0 A;  3V0A A;  1Q43 A;  1W2A X;  2JDH A;  3C3V A;  3ZFE A;  3M70 A;  3BIW E;  2WNU A;  2WWU A;  3NNG A;  5FZ1 A;  2VJX A;  4LOR A;  1UNB A;  4KMQ A;  3S7E A;  2UU8 A;  3H0O A;  3VHR A;  4RS5 A;  2ZZQ A;  4ASK A;  4IE5 A;  4I09 A;  3LSD A;  2Q5T A;  4DXZ A;  5IVE A;  2WYS A;  4AEM A;  2E26 A;  1AL0 G;  1H2N A;  3AC0 A;  5AFE A;  1PZ8 A;  5F5Q A;  3LPF A;  3SCH A;  1RB8 G;  4IQP A;  2J1A A;  1EUU A;  3LA2 A;  1SDD B;  2RR1 1;  3AMQ A;  1BK1 A;  2QE3 A;  5GZG A;  2BFU S;  2D3S A;  2ZOE B;  3A22 A;  3GYD A;  1PNF A;  2C9A A;  1AXK A;  2WL1 A;  3I4I A;  5FZE A;  3VZO A;  1S0F A;  1A8M A;  2OXB A;  3AMM A;  3MLL A;  4JGY A;  2DTW A;  4V2V A;  4AED A;  1HJG A;  2XL7 A;  3LDK A;  3GZA A;  4XDP A;  2OA2 A;  3POB A;  2WNU B;  1WUV A;  3U11 A;  1BQP A;  4V1P A;  3ZXE A;  3CIH A;  2YDE A;  3E6D A;  3AL5 A;  2RE9 A;  2ZGL A;  1DQ1 A;  4RS5 B;  3S57 A;  1ZRD A;  1SLA A;  1CZT A;  2EXI A;  3FLR A;  4HPK A;  1MZE A;  4CPB D;  1H1I A;  4AEJ A;  1RUE 3;  1UY2 A;  1WBL A;  2C9K A;  3P3P A;  1ZBA 1;  3C7E A;  4ISQ A;  4Q4W 1;  1JU3 A;  4FXK B;  4TZD A;  2XML A;  5FUP A;  2WLP A;  3ZVX A;  3ZFF C;  2YGM A;  4Q4Y 3;  4AXO A;  1UW8 A;  1JZ5 A;  5FO8 B;  1AR9 3;  1LHN A;  4LE3 A;  5AFB A;  1MEC 2;  4FPH A;  5J36 A;  1OUX A;  4AQ6 A;  2OT7 A;  2P1B A;  3B3Q E;  1B35 C;  4JGY B;  5T52 A;  4AED B;  1Q5O A;  5F3E A;  5B4X A;  5FP8 A;  3ST7 A;  4OHY A;  4OZX A;  2G1M A;  3IMN A;  1DQ2 A;  3TAY A;  4YG3 A;  5KHI A;  5FUI A;  1QY4 A;  2GNB A;  4CDX C;  1REE A;  4CDW C;  5AVP A;  3BTX A;  4K3U A;  2G9G A;  4HPK B;  3WG1 A;  4XFC A;  1OKQ A;  2RS3 1;  5ACA 3;  2Y26 A;  4IGQ A;  4IGO A;  3I59 B;  1D4V B;  4MGZ E;  1H0B A;  4LBN A;  2CV6 A;  3FWE A;  2OII A;  5IK7 A;  1VPH A;  3AZV A;  3BPZ A;  5JR7 B;  5EXO A;  3PNA A;  4MH0 E;  2N7G A;  4AQS A;  4YW5 A;  1NY7 2;  4FPF A;  4KNC A;  4U36 A;  5FMO L;  3TN9 2;  3ZFF A;  4RSU A;  2XGX A;  2XQX A;  5LWB A;  1XE7 A;  1ZA7 A;  3K48 A;  5C8C C;  3WT3 A;  2VNV A;  1DFQ A;  3ACI A;  1B35 A;  5L7O C;  2BGP A;  5FXW A;  4ZXE A;  2ZAC A;  2WQ8 A;  1H9W A;  4CDX A;  4L0P A;  4CDW A;  2FMD A;  4R9A A;  5DZE A;  5M0T A;  2BNN A;  4EQV A;  4XBL A;  1ND2 C;  1YCI A;  2ES3 A;  2K2S A;  2X09 A;  3FHA A;  4RR3 A;  4M01 A;  5ISL A;  3HNM A;  2A70 A;  2ZX4 A;  1Z7S 2;  4XFF A;  1I5P A;  1W6N A;  1WD4 A;  3AKP A;  4YW2 A;  1W6Q A;  5FPB A;  1HN0 A;  1PM4 A;  1E5R A;  3ZFF B;  5SV5 A;  1MEC 1;  3JBG 1;  3I3D A;  1HRV 2;  4LKS A;  1B35 B;  1R1A 2;  1DQ6 A;  1FAT A;  2WO1 A;  1KJL A;  3OGG A;  1SLL A;  1QJX 2;  3KQR A;  3TYJ A;  4AVC A;  4EWE A;  5EIY B;  4D6R A;  4R4Z A;  5C8C A;  4P9J A;  4OUS A;  4CDX B;  2PHD A;  5H9P A;  4CDW B;  5CAZ A;  3NVC A;  2JB8 A;  5L7O A;  1UMH A;  1FI2 A;  1V6K A;  4Q8K A;  2XHK A;  2HJI A;  1JZ3 A;  4Z92 B;  1CX1 A;  2X53 S;  1GAN A;  2JDZ A;  5L36 A;  3OUH A;  4HK9 A;  4CZS A;  2AC1 A;  3BYW A;  4JQT A;  2YUE A;  1W6Q B;  2H6C A;  3NNL A;  3TWI A;  3WQ1 A;  3I7D A;  2CNA A;  1F2N A;  5FZA A;  2YC4 A;  4YRD A;  1ND2 A;  1C4R A;  2VW1 A;  3T0A A;  2HWD 3;  2H6B A;  2DCK A;  4BLI A;  1KDK A;  3C2U A;  3CEW A;  3TN9 1;  1UOF A;  2VCM A;  3JD7 2;  1LOD A;  2FMY A;  1POQ A;  5DDJ 2;  1QGL A;  5DN2 A;  5CIS A;  4AL9 A;  3APB A;  4B7K A;  1UPI A;  4YW4 A;  5C8C B;  1AX0 A;  3NKG A;  1MVE A;  3EBR A;  4ZU5 A;  5L7O B;  3ZLI A;  1MQT C;  5IUQ A;  5C8W A;  1KD7 A;  2GN3 A;  4DS0 A;  2HWF 1;  4Y5T A;  1JMU B;  2NP0 A;  1DZR A;  3ZSM A;  3FMG A;  1PIV 1;  3WDW A;  3MHZ A;  4LXL A;  2RDS A;  4IE6 A;  1GNY A;  2BGC A;  4PBP A;  3S30 A;  5AC9 1;  2HWE 2;  1ZYB A;  2ETE A;  1ND2 B;  3HMY A;  3B00 A;  5CYY A;  3EXU A;  1RUJ 2;  2VBP A;  1J1L A;  4FXG B;  3FLP A;  4LHL A;  1O91 A;  4PT6 A;  1PMJ X;  3KQ4 B;  3KHC A;  1Z78 A;  3KT4 A;  3ZN6 B;  1ODN A;  2YPJ A;  3PUR A;  5LA1 A;  3WV6 A;  2D98 A;  1HRV 1;  5A7S A;  5B2G B;  5HI0 A;  1R1A 1;  1RUC 2;  1S0E A;  2V4V A;  2O8O A;  2VZO A;  4B29 A;  2WJS A;  2XXZ A;  2ZBJ A;  1QJY 2;  1YC6 1;  1QJX 1;  2A1X A;  2ORX A;  3KCX A;  4FQ4 A;  1PVX A;  3IDA A;  2BOJ A;  3IAP A;  4S2H A;  4XCA A;  4QGM A;  4WVV A;  4LUL A;  5HV0 A;  1MQT A;  1KIT A;  5BNN C;  3AM2 A;  3AJZ A;  3W58 A;  3M3E A;  1J3R A;  3OUI A;  4H7M A;  4XET A;  3WSO A;  5KC6 A;  1G9A A;  2AEY A;  1UZW A;  4P02 B;  4K7J A;  4ATE A;  5JI9 A;  3RI8 A;  2DYC A;  4QDR A;  3OPT A;  1TMF 2;  1J58 A;  1JOD A;  1GV9 A;  2D6N A;  4O61 A;  5GLT A;  3O1R A;  3ENR A;  1OFN A;  3LKJ A;  1MS0 A;  3IAQ A;  2I07 B;  1SZB A;  3T2T A;  2LUW A;  1OSG A;  1H2M A;  1XU2 A;  4FPJ A;  3JD7 1;  4EN6 B;  5GLW A;  1AYM 2;  4NWV A;  2ZEZ A;  5DDJ 1;  2VXR A;  4IEP A;  1RUI 3;  3LDB A;  1RUD 3;  2ZKL A;  4NRO A;  1LEC A;  2CHH A;  1VMJ A;  4MAD A;  5DMY A;  2VVE A;  4Q1R A;  1DZT A;  1H6X A;  3HN1 A;  1MQT B;  1V6I A;  4XMI A;  1AR6 2;  1JXN A;  1UD1 A;  4NHL A;  2VZQ A;  1C28 A;  2JKB A;  4YNI A;  1XSQ A;  2RS1 3;  2VXJ A;  4MGQ A;  2D44 A;  3AYC A;  3NV4 A;  3RJ2 X;  2WKK A;  3THP A;  2VR4 A;  2JG9 C;  4MGY E;  4NVP A;  5FZD A;  3ABZ A;  3O14 A;  5BXX A;  1KQR A;  5BNN A;  5BY5 A;  2HWE 1;  2J1S A;  1F5F A;  4HG6 B;  1I1E A;  1VBE 3;  1OPM A;  2XJT A;  1RUJ 1;  3O1P A;  5GJ6 A;  5FY9 A;  4Q4X 2;  1E57 A;  3E6B A;  5KBF A;  2VL4 A;  4KWJ A;  4AI8 A;  3ZIW A;  1W8O A;  2B45 X;  2A3W A;  5IK5 A;  4KWK A;  5JMC A;  2F6B A;  1PO1 2;  5LRR A;  3IN9 A;  3OD4 A;  1OPO A;  4ARX A;  1IKQ A;  4XUR A;  4UW5 A;  4OZO A;  4LKF A;  2LTN A;  3SEP A;  1SHW B;  1OQD A;  3M3C A;  4P5H A;  2JB4 A;  3R6S A;  5I0U A;  1C8M 3;  1N1T A;  2BV4 A;  1LHV A;  5A1F A;  5BNN B;  1WCU A;  1V9U 2;  1GUI A;  1CAW A;  3CNA A;  3BOP A;  2XWJ B;  5FJH A;  4LE4 A;  3W21 A;  1VRH 2;  2FHR A;  1KFX L;  2VTX J;  2IFW A;  2I45 A;  2XVK A;  1ENX A;  3CBN A;  4KG0 A;  2JJ6 A;  2ZGM A;  3T1L A;  2CYF A;  3CKH A;  1TMF 1;  1SLT A;  1V6L A;  3RS6 A;  2PLV 2;  1RUH 1;  5J48 A;  1ZZC A;  2QZ2 A;  2UWC A;  3RYP A;  4I2O A;  2ZX2 A;  3QLQ A;  1RIR A;  3C8X A;  4AOC A;  4EN8 B;  1LGB A;  1AYM 1;  2WO2 A;  4WV8 A;  3ROU A;  4MXW A;  1O3T A;  2WWJ A;  3R4D B;  2ZML A;  3BTY A;  1J3P A;  3ZFE C;  3N9N A;  1HB3 A;  3PLQ A;  5CU1 A;  3D0J A;  3K51 A;  2RS5 2;  3HQX A;  3HT2 A;  1CAW B;  4NRM A;  3QOP A;  2A3Y A;  4ZPI A;  2RR1 3;  4C8D A;  4UFK A;  2JG9 B;  1X50 A;  3LCP A;  2VOX A;  3ZYI B;  1QNW A;  3TBD A;  4FPO B;  1QJE A;  5IFT A;  3M7A A;  1ZRE A;  3KV5 A;  4DEV A;  4Q4X 1;  2DCJ A;  1XE8 A;  3DPR C;  4YG0 A;  1EV1 2;  1Q56 A;  1GNZ A;  1V6J A;  4QXK A;  3HBZ A;  3S0M A;  2ZTN A;  4MXW B;  2VMC A;  4FPK A;  2YYO A;  1NCQ C;  3J26 N;  5EJZ B;  4CDU C;  3A23 A;  5FP4 A;  2P6H A;  1ZNP A;  3PUS A;  3FBM A;  5C70 A;  1CON A;  4XUP A;  1ZBA 3;  4Q4W 3;  1LEM A;  3N9O A;  1IQD C;  1UY4 A;  2W39 A;  4N90 A;  4JTN A;  4K8R B;  4P14 A;  5IJR A;  1H2L A;  4LBQ D;  4UI9 L;  4W65 A;  2P3Y A;  4XHX A;  3T2Q A;  3ZXL A;  4XMA A;  3KT1 A;  3UNP A;  1AYN 1;  3LAG A;  4L11 A;  1YUD A;  2ORZ A;  4JQR A;  5FZ9 A;  3VDD A;  1RUN A;  4FAH A;  4QKB A;  5H9Q A;  5H9R A;  4P9Y A;  2ZHK A;  4NII A;  3ZSK A;  4R9D A;  1VBA 2;  5IHR A;  1HV0 A;  3RZJ A;  2A5Z A;  2Q1Z B;  4S2G A;  1S0G A;  2ZEW A;  5FY7 A;  2XKP A;  3WNO A;  2RS3 3;  1X82 A;  3DPR A;  3OBR A;  4CCL A;  4OCT A;  1BHG A;  3WP4 A;  3OTF A;  3FJS A;  5EYY A;  1NCQ A;  2WSU A;  3PTY A;  4A44 A;  3ZFE B;  4CDU A;  3OGV A;  2WA3 A;  3IDB B;  3H8U A;  3N35 A;  1VAM A;  2GAL A;  4G4F A;  4HL0 A;  4SBV A;  5IVC A;  4BIO A;  1RVF 2;  3OPW A;  1TNR A;  4Q26 A;  3T3Y A;  2R04 2;  5GZC A;  4TXW A;  4CDQ C;  1IOA A;  4EN9 B;  1W04 A;  3POG A;  2R06 2;  5FYH A;  1ZX5 A;  3UGH A;  1LOB A;  1OVS A;  2IXC A;  1PGW 1;  5FP3 A;  4IEY A;  3DPR B;  2IWG B;  4AGG A;  5K7P A;  2YMZ A;  3JU9 A;  3KGL A;  1JW6 A;  2W08 A;  3LIG A;  4I0B A;  5EHD A;  2UY8 A;  3UT0 A;  1O3Q A;  2ET1 A;  4OHX A;  2F17 A;  1NCQ B;  4RFT 0;  1VBC 3;  2JX9 A;  1BBT 3;  3A0N A;  4CDU B;  1W3V A;  4AI0 A;  2Y6H A;  3S6P A;  1V00 A;  3ACG A;  4XUO A;  5JIU A;  4AFC A;  2ARC A;  3AZX A;  5DUV A;  4F8A A;  3QCW A;  2E53 A;  3ZSL A;  1JHJ A;  2NMN A;  3GF6 A;  1H1A A;  2YPD A;  3UYJ A;  1LU1 A;  1C1L A;  3EYP A;  1MEC 3;  3OYW A;  1GR3 A;  1GNH A;  1RUG 2;  4LLO A;  3A7Q A;  3JBG 3;  5FY5 A;  5BPX A;  5JOX A;  1J3Q A;  3LD8 A;  1D4M 2;  3WNX A;  2RDR A;  4BLJ A;  3T0B A;  4CEY C;  2R16 A;  1CAU A;  1MAC A;  2WLQ A;  4O7X A;  3AKS A;  4QXH A;  5FZC A;  4CDQ A;  1VBA 1;  1UL9 A;  2PYT A;  5EV7 A;  3MZH A;  4C1W A;  5F39 A;  5D21 A;  3F95 A;  5CVR A;  5JPN B;  2Y0O A;  3ZYH A;  1NCR C;  1JH5 A;  1NT0 A;  1GWL A;  4XF0 A;  2BJS A;  3TNQ A;  4EZ4 A;  5IFP A;  4IND A;  5K0U A;  3H3Z A;  2VUL A;  1FXZ A;  1O4Y A;  3BN6 A;  2W1U A;  1CIY A;  4RGG A;  2HYK A;  3MI8 A;  2GZW A;  3K75 B;  3OYW B;  2VMG A;  2Z5W A;  3K77 A;  3RQ0 A;  2P3K A;  4W50 A;  1W99 A;  1RVF 1;  3WP5 A;  4DB5 A;  3B93 A;  4LO6 B;  3ZYG A;  2W92 A;  1OFS A;  1CAU B;  4CDQ B;  3JQW A;  2ZGP A;  1SLC A;  2R06 1;  4MGI E;  1HQW A;  2VEC A;  3LEG A;  3LEK A;  4XBN A;  1W03 A;  1STM A;  1HRI 2;  1WW4 A;  2UWB A;  3VDC A;  4WZF A;  2VQU A;  2QZ3 A;  5FZ7 A;  4HET A;  3JUU A;  5GZD A;  3UJO A;  4CEY A;  3H8R A;  1GZ9 A;  2HWF 3;  3HBK A;  1PIV 3;  2UUR A;  4IW3 A;  3HEI A;  5FY8 A;  2XBO 2;  1OKO A;  1Y3T A;  5K0U B;  4UW3 A;  4Y33 A;  5CIR A;  2W9X A;  1QQP 3;  4MX3 A;  1NCR A;  3E1F 1;  3UES A;  4ERO A;  5AC9 3;  4NUB A;  3O5S A;  3ES4 A;  3N7J A;  4CU6 A;  3BUC A;  4ZS2 A;  4COW A;  2CY6 A;  2W46 A;  2WFP A;  3AZY A;  4XXP A;  4ZS3 A;  3AMP A;  4GB3 2;  1CAX A;  1DDL A;  3O1O A;  4FPG A;  4AQT A;  5FAX A;  1VB4 A;  1R1A 3;  3WNP A;  1G9C A;  4FT8 A;  3N3H A;  4IV1 C;  1VP6 A;  1WW6 A;  2EXH A;  4D3W A;  4CEY B;  1HX6 A;  4MG2 A;  3WF3 A;  3H8O A;  4A41 A;  4XJZ A;  4L92 A;  1U5Y A;  4RFR B;  1HXS 1;  5L9R A;  4AK3 A;  3ZO0 B;  3WG2 A;  1FNZ A;  4QKD A;  4Q4V 2;  5HCB A;  5JI7 A;  3RZK A;  1NCR B;  2P4E A;  2FDF A;  2PHT A;  2WUH A;  1YYN A;  2BNO A;  1YQ2 A;  1Y9Q A;  3VDA A;  3VDB A;  3O1V A;  4JX0 A;  3D0S A;  1DQ5 A;  2BYV E;  3H8X A;  2CAV A;  4M3C E;  2C26 A;  5FK8 A;  5LK7 B;  3MPB A;  4AGR A;  2W1W A;  4QX3 A;  4EN7 B;  3TB0 A;  1NUK A;  2YB7 A;  1ZZ6 A;  5EWS A;  4DRR A;  3N9L A;  2WIN B;  1LEN A;  2Q8C A;  3N9Q A;  5FKC A;  4NHX A;  1TNF A;  1PNG A;  3MUZ 1;  4Q27 A;  1BEV 1;  2HKX A;  1YXW A;  4MXV A;  4XIO A;  5A32 A;  5DAQ A;  2A6V A;  1OH4 A;  3NNF A;  4GKX A;  2PHR A;  4IV1 A;  1OLQ A;  3F2Z A;  5F5C A;  1MPX A;  3KCC A;  1DGR A;  2WBK A;  1UYY A;  4BHP A;  5JVV A;  5FYZ A;  3THT A;  3WDX A;  1JZ2 A;  3FZ3 A;  3FE5 A;  1JU4 A;  4JHZ A;  1GBG A;  3HPN A;  3PUI A;  1Q8S A;  4IES A;  1JN2 P;  4RYD A;  2BQP A;  5FZ4 A;  3WOG A;  1RUJ 3;  2VMD A;  2F4P A;  4PF5 A;  1ZBE 1;  1V0A A;  3E97 A;  5IW0 A;  2QKD A;  1ENR A;  4WM8 C;  2YRO A;  2DCZ A;  3GCX A;  4YVW C;  4BK4 A;  3WQ7 A;  1OQ1 A;  4CUG A;  4GB3 1;  4M4P A;  4LIU A;  4CVU A;  1JYW A;  1QH7 A;  5F2S A;  5A32 B;  1QMJ A;  4AI9 A;  2R0H A;  1U12 A;  3AVR A;  2Q8E A;  1XQN A;  5A3O A;  4IV1 B;  4MV2 A;  5F7U A;  1W8U A;  4OFG A;  3OF1 A;  1V6O A;  5A7P A;  5EJ3 A;  4HKO A;  3MF6 A;  4P9L A;  5FPX A;  3WXP A;  3R0R A;  3AFG A;  1W2O A;  4XF9 A;  2ZX0 A;  1O8S A;  4LOT A;  4LUM A;  4YW1 A;  4EJR A;  3RPQ A;  4FQZ A;  1BMV 2;  2VGD A;  4NO4 A;  3POS A;  4QX7 A;  4HVQ A;  3H9A A;  5LA0 A;  3MIG A;  1PO2 1;  5FTT C;  4E9K A;  4XQD A;  3I2F A;  4UF0 A;  5FLI A;  3VHO A;  3ZXA C;  2VBD A;  5IK8 A;  5IYY A;  2P34 A;  5JSO A;  2YGL A;  1TMF 3;  3LDR A;  4K20 A;  2XDV A;  4L9B A;  2OQ6 A;  1RUH 3;  4DIQ A;  1VLN A;  5FO7 B;  1W8F A;  5A7W A;  1NXM A;  4PJY A;  2FCV A;  2O14 A;  2VM9 A;  2GN7 A;  4Y5Z 0;  1AYM 3;  4WM8 A;  3AVS A;  4YW3 A;  4YVW A;  5F37 A;  1DYK A;  1S2K A;  5KHJ A;  1A3K A;  3HNB M;  1ULO A;  2XQR A;  1X8M A;  3AP5 A;  3T30 A;  5A3T A;  4H55 A;  4XFG A;  1R09 1;  4LO5 B;  2DFB A;  4X8N A;  5FZL A;  4GMP 1;  1QKQ A;  3UET A;  1W90 A;  3I97 A;  4NOT A;  2X5I C;  4DPN A;  2JEM A;  2HLE A;  2RM2 2;  4LOS A;  4XFB A;  2PN5 A;  4UF0 B;  2EAL A;  1WGP A;  3MIH A;  3BOW A;  4JC1 A;  2C24 A;  4UXA A;  4I02 A;  3WR0 A;  1UU6 A;  1WW5 A;  5JXH A;  3U14 A;  5A7W B;  3GBF A;  4CCE A;  4LUK A;  1Q8Q A;  1FAY A;  2A71 A;  1NX9 A;  4A3Z A;  3J8F 1;  2AZ5 A;  4WM8 B;  4HLT A;  1VBB 1;  4YVW B;  4YM1 A;  1PVC 2;  2YFU A;  3Q8E A;  4BOW A;  1OC1 A;  3VBO C;  2Y0I A;  2TNF A;  5FMO S;  5I8T A;  2WNO A;  1POV 0;  3WNL A;  3IM0 A;  1SPP A;  2LRO A;  2YU1 A;  2ZMK A;  1WCS A;  4Q2F A;  3WG4 A;  3H50 A;  1WLW A;  3RMX A;  2YG0 A;  2ZPX A;  3D6E A;  3H7J A;  4FOV A;  4BU2 A;  2B5H A;  3HWJ A;  4UAP A;  5KXB A;  1BMV 1;  1IS4 A;  4D0Q A;  1KS5 A;  1AX2 A;  1RYY A;  2X29 A;  1AYN 3;  4CU8 A;  2B39 A;  3GAL A;  2K0G A;  3POE A;  2X5I A;  1J1T A;  1AXZ A;  2B7Y A;  5FBZ A;  1W8Z A;  5GZE A;  1KXG A;  4HKW A;  3TEY A;  1IS5 A;  3VV1 A;  5IVF A;  1JYN A;  5IAT A;  4QKF A;  1LHW A;  3RFR A;  4CP1 A;  5CZK A;  3BAL A;  3MPP G;  4ZXK A;  2PHX A;  2ATF A;  4N9I A;  5LBE A;  2D7F A;  5FZM A;  5KXD A;  3ZFG C;  3VBO A;  1LR5 A;  1MS8 A;  1UQX A;  2B9U A;  1G6N A;  3K46 A;  4MOA A;  4N43 C;  5C5U A;  3DEM A;  3NJV A;  5FBJ A;  4ZZ8 A;  2RM2 1;  2X5I B;  1S0I A;  5L9V A;  2Y6K A;  3KD4 A;  3AP4 A;  4FSJ A;  4W8J A;  2A73 B;  3UK9 A;  3CHX A;  4ET7 A;  3W20 A;  2H0B A;  4BQ5 A;  3BIE A;  3NRU A;  2AAC A;  3MFA A;  3U1X A;  1ASJ 1;  3FN9 A;  5FYM A;  1EP0 A;  2Y6L A;  1FPN 1;  5FZ0 A;  3B9C A;  1LRH A;  3K4D A;  4BCU A;  2WC2 A;  2IXH A;  3HQR A;  3SIT A;  4AHZ A;  1CPM A;  5E1R A;  5C3O A;  1M06 G;  4A6S A;  2DU0 A;  1IPS A;  2F4L A;  4IDZ A;  5C3P A;  5FZB A;  1IHM A;  1SFY A;  4MGS A;  1PVC 1;  4MLO A;  3RWK X;  1I9R A;  5CG8 A;  4WVW A;  1SFN A;  4DXT A;  3CZU A;  1W0N A;  3NQH A;  3VBO B;  1W2T A;  2WSV A;  2PAM A;  4JHT A;  4N9H A;  3JCI A;  4TWT A;  2KA3 A;  1FMD 2;  1YIP A;  3A21 A;  4FPY A;  2W0X A;  2XVG A;  5FJK A;  5LA2 A;  3ZKU A;  4J1W A;  3V0A B;  5F2W A;  3NV3 A;  4F83 A;  3J7M A;  2FZ2 A;  1O5L A;  3ZFG A;  5FQ0 A;  1XND A;  2ET7 A;  2FCU A;  5LBF A;  5FXX A;  2QQI A;  2B8M A;  4N43 A;  2W5F A;  5FV3 A;  4CEW C;  4QHZ A;  1O5U A;  3VGI A;  1W8N A;  4COZ A;  1UU4 A;  1VBA 3;  4HON A;  3MUY 1;  4Y1Y A;  2KD7 A;  4CCD A;  2RMU 2;  1W8H A;  1N47 A;  3MIF A;  2DUR A;  2HWC 2;  2OW4 A;  3Q8B A;  4MGK E;  1ALY A;  5A6Q A;  3CZJ A;  1GQG A;  1W05 A;  3FC0 A;  3I2D A;  1VMF A;  1NAE A;  1EPW A;  2ILM A;  1UZZ A;  2NMO A;  3NKT A;  3AZW A;  1WBF A;  3ZFG B;  5FQ0 B;  1SFP A;  4YZ1 A;  3MIE A;  3U37 A;  3QBQ A;  1UWW A;  2VMI A;  3Q8F A;  4DMI A;  1JOJ A;  1AR8 2;  1N3P A;  2NLR A;  4N43 B;  3RZG A;  4XTM A;  2BNM A;  3UKN A;  5IAX A;  1OH3 A;  1RIN A;  2R06 3;  2WII B;  4RR3 C;  4BYY A;  2B4K A;  4K1Z A;  5F1R A;  1GKB A;  3MO4 A;  2R49 A;  2EA7 A;  1F31 A;  1W39 A;  2ARE A;  4QPG C;  3V56 A;  4CEW A;  3GNE A;  4XVH A;  1F15 A;  5LB6 A;  1UY3 A;  1AXY A;  4KWU A;  1DYP A;  4A2U A;  1N3Q A;  2QVS B;  2J1V A;  4Y26 A;  1S1A A;  1GU3 A;  3SIS A;  1OLR A;  3KV4 A;  4BQ3 A;  5F3C A;  1AL2 2;  3RMY A;  4AEK A;  1NOV A;  1Z0H A;  1EAH 3;  2XJR A;  1H4H A;  1FMD 1;  5FMB A;  5JAX A;  1Y9M A;  4PBO A;  3VD5 A;  3ALQ A;  1X36 A;  2C5D A;  5JOW A;  3GHN A;  3PIJ A;  4Y1Z A;  1G9B A;  1C1F A;  1WMX A;  3IB3 A;  2GC0 A;  2WFF 2;  3WF1 A;  2WT0 A;  1VIW B;  1NE6 A;  4WM7 C;  1SBE A;  4UFJ A;  4BQW A;  4FAG A;  4GA9 A;  4Z8B A;  3QAC A;  3DYO A;  1L7Q A;  4CEW B;  2JDM A;  2RDN A;  5LA9 A;  3O1T A;  4KGQ A;  3IT8 A;  2WAO A;  5SV8 A;  2CDO A;  1KDM A;  1PMH X;  1CX4 A;  3WX5 A;  3WHU A;  1W06 A;  5DZF A;  4G3Y C;  1HXS 3;  3PL0 A;  3SHR A;  1JUH A;  4Z2A A;  2HWC 1;  5FR3 A;  3D8C A;  4QPG A;  4XHB A;  4DZG A;  5KXC A;  3N7L A;  2VZT A;  2GU9 A;  5JOY A;  4DUV A;  2D3R A;  1RMU 2;  4Y4Y A;  5KR7 A;  1ULD A;  3D4K A;  1SEF A;  4XF1 A;  1APN A;  4UFL A;  1H6Y A;  2ARB A;  1ONA A;  2CGN A;  2PHU A;  4L97 A;  1PMI A;  5CFD C;  2NZ9 A;  1RHI 2;  3LWC A;  1IPK A;  1WD3 A;  1UXZ A;  2YC2 A;  4BZ4 A;  1AR8 1;  2ZGO A;  5FIX A;  2TBV A;  3M3Q A;  1C3H A;  3S7I A;  4RHV 2;  2A75 A;  4QPY A;  1BEV 3;  3OBT A;  3VKM A;  3SC7 X;  4RR3 B;  4WM7 A;  1OLM A;  2VZS A;  1W6N B;  3CMG A;  3D3A A;  3EO6 A;  1MS5 A;  2JDU A;  4QPG B;  1QU0 A;  3PME A;  5A70 A;  1K5M C;  2RJ2 A;  2HWB 2;  4NHK A;  1US3 A;  4O9E A;  2K9Z A;  2DVG A;  3B7M A;  1NY7 1;  2PAE A;  2LAL A;  3KV9 A;  5I0R A;  3LIH A;  1IPJ A;  1DU3 D;  5I0S A;  5FCC A;  4PIZ A;  3VLB B;  1D0H A;  3KM5 A;  4IE4 A;  3VZL A;  4BQX A;  4NE9 A;  5JXI A;  4HAN A;  1YIF A;  1OD3 A;  3RRD A;  4OMD A;  2ADD A;  4CP9 A;  2IUW A;  2IFR A;  1SCS A;  2PMW B;  1Y43 B;  1LCL A;  1ZBE 3;  3KWV A;  3PVO A;  3RWN A;  5CFD A;  2J42 A;  1ENQ A;  2WFF 1;  4GB3 3;  5DUU A;  4IE0 A;  4IE7 A;  3A0K A;  1MS3 A;  1AZD A;  4L2N A;  4WM7 B;  4FVV A;  3Q9O A;  1ND3 C;  4OHZ A;  2WZ8 A;  1EUT A;  3EJK A;  2BGO A;  3DXU A;  1XRU A;  3AKR A;  4FO9 A;  1H4G A;  3ILF A;  1ULP A;  3FX3 A;  2OYZ A;  4Q0P A;  4AI3 A;  2R0F A;  1P8J A;  1US2 A;  1NKG A;  2KR2 A;  4PLO A;  4XAE A;  1Z7S 1;  4IXL A;  4ZHN A;  2LRP A;  3RZZ A;  4PDW A;  5KHK A;  1BVV A;  1D0G A;  1UKG A;  1R08 2;  1K5M A;  1OBN A;  1RMU 1;  3AKQ A;  2JKX A;  1GQH A;  4W4Z A;  1RTV A;  1XYP A;  3K4A A;  4CP9 B;  4E4H A;  5HXM A;  1PO2 3;  5HPO A;  2EF6 A;  3ZYP A;  3ZR6 A;  5HBA A;  4GJZ A;  5J09 A;  1C57 A;  5CFD B;  1RHI 1;  2VVD A;  1LHU A;  5FKB A;  3VB9 A;  3WY6 A;  4CUA A;  5K8S A;  1CGP A;  2JE9 A;  1O3S A;  3NO8 A;  3VZK A;  1AHS A;  3D82 A;  4QB1 A;  5A3P A;  1C5H A;  1TVG A;  2PXJ A;  5BYN A;  5CKQ A;  2AEN A;  4ZON A;  4MET A;  2VUD A;  1R09 3;  4WBB A;  1ND3 A;  1W2U A;  4NRQ A;  5LEJ A;  4LHS A;  2ARX A;  3PUA A;  4X6R B;  4ZU4 A;  3ZXJ A;  3N7K A;  3DV8 A;  4GMP 3;  1K5M B;  1VR3 A;  3B01 A;  2HWB 1;  4CCN A;  4B4R A;  4LBK A;  2XHN A;  3WW2 A;  1UOB A;  3ZDS A;  5LRS A;  2JDA A;  3ZXD A;  3HVD A;  1R64 A;  1ULG A;  3A4U A;  5KWR A;  4TLG A;  1R1Z A;  1G9D A;  1FV2 A;  1NG0 A;  1V70 A;  4GH4 C;  4QWN A;  1HJF A;  1YFU A;  2J1R A;  4LO4 B;  2EIE A;  2W94 A;  2FDK A;  2GC3 A;  4NAM A;  2QUO A;  3J8F 3;  4LBO A;  2EIG A;  3ME2 A;  1VBB 3;  4JVA A;  4AQ2 A;  1OD5 A;  1RC6 A;  1YQ5 A;  2W68 A;  2X05 A;  2JIC A;  4YM3 A;  5LCW L;  2PHW A; 
#chains in the Genus database with same CATH homology
 5FZA A;  3KVB A;  5FZM A;  5FJH A;  5A7N A;  5FY1 A;  2P5B A;  4V2V A;  5FWJ A;  2VD7 A;  4EZH A;  5KR7 A;  2YPD A;  3UYJ A;  5FYV A;  4TN7 A;  3N9M A;  4XDP A;  5FZ4 A;  5FZO A;  5FY5 A;  4QU1 A;  3N9P A;  3AL5 A;  3LD8 A;  5IW0 A;  4QXB A;  5A7O A;  4QXH A;  5FZC A;  4GAZ A;  3ZLI A;  5A1L A;  4CUG A;  4LIU A;  5FP9 A;  5FZK A;  4URA A;  5FYM A;  5LW9 A;  5F39 A;  5F2S A;  5FBJ A;  5FZ0 A;  2WWJ A;  4XDO A;  4AI9 A;  5E6H A;  3AVR A;  2XML A;  3AL6 A;  3N9N A;  4LXL A;  5FUP A;  2Q8E A;  5FZ6 A;  5FY0 A;  5FYB A;  5FZB A;  5A7P A;  5FP7 A;  5IVB A;  4Y3O A;  5A3N A;  4EZ4 A;  5FYI A;  5IVY A;  5FZ8 A;  2OT7 A;  4C8D A;  4AAP A;  5F3E A;  4GJY A;  5FP8 A;  3K3O A;  4QX7 A;  4GD4 A;  3KV9 A;  5FJK A;  4BXF A;  5FZO B;  3KV6 A;  3PUR A;  5F2W A;  5FPA A;  4UF0 A;  5A7S A;  3KV5 A;  5FYT A;  5FZI A;  2XDV A;  2XXZ A;  2OQ6 A;  4DIQ A;  5FXX A;  2W2I A;  5FZF A;  5A7W A;  5FV3 A;  2OX0 A;  4IGQ A;  4LIV A;  4IGO A;  3K2O A;  4HOO A;  5F32 A;  5FZH A;  3NJY A;  5FP4 A;  5FZ7 A;  3DXT A;  3PUS A;  5IVJ A;  3AVS A;  4HON A;  5F37 A;  4V2W A;  5LY2 A;  3N9O A;  5FWE A;  5FY8 A;  5A3T A;  3DXU A;  5FUN A;  4Y33 A;  5FPU A;  5FZL A;  4NUB A;  3OPT A;  5IWF A;  5FYC A;  5FY4 A;  5LWB A;  1VRB A;  3U4S A;  5FZ9 A;  4DO0 A;  4UF0 B;  2OS2 A;  4D6S A;  2OQ7 A;  5FXW A;  4LIT A;  3KVA A;  4QX8 A;  4E4H A;  5IVV A;  3RVH A;  5A7W B;  3LDB A;  4Y4R A;  4GJZ A;  5FY7 A;  4EYU A;  4BIS A;  4CSW A;  2XUE A;  5FPV A;  5A3W A;  3PTR B;  2Q8D A;  4QXC A;  4CCL A;  5F5A A;  3U78 A;  4CCO A;  5A3P A;  5ISL A;  2PXJ A;  5CEH A;  4CCJ A;  2YBS A;  2YU1 A;  2YBP A;  5F5I A;  5FPB A;  5FZD A;  3ZPO A;  5F3C A;  3KV4 A;  5IVC A;  4BU2 A;  5FYS A;  2GP5 A;  3OPW A;  5FYU A;  5A80 A;  3PUA A;  2YBK A;  3PU3 A;  5FY9 A;  5FZ3 A;  4CCN A;  5F3G A;  5FYH A;  2GP3 A;  5FXZ A;  5K4L A;  2WWU A;  3PDQ A;  4D6R A;  5FZ1 A;  3N9L A;  4IGP A;  4D6Q A;  5FP3 A;  4ASK A;  2Q8C A;  2YU2 A;  3N9Q A;  5FPL A;  5F3I A;  5IVE A;  3PUQ A;  4QWN A;  3K3N A;  5ANQ A;  5IVF A;  4CCM A;  3PU8 A;  5FZG A;  5LY1 A;  5FYY A;  5F5C A;  4CCK A;  5FXV A;  5A7Q A;  5A1F A;  5FZE A;  5FYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...