5F37A

Crystal structure of human kdm4a in complex with compound 58
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
SETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 107
structure length 350
sequence length 350
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f37A01
5IWFA 3KV9A 4E4HA 3N9MA 3PU8A 4QXBA 4CCLA 5LW9A 3KVBA 5F39A 4ASKA 2OX0A 5FJHA 3U4SA 3N9QA 5FPAA 5FY5A 2Q8CA 3ZLIA 4UF0A 5F5CA 2YU1A 5FZ8A 5A3WA 3AVRA 4D6QA 5F3IA 4GJZA 5FP7A 2OQ7A 4CUGA 5FWJA 5FZKA 5A7OA 2YU2A 5FYUA 5FY1A 4UF0B 5A7WB 5A3PA 5ISLA 4Y33A 3N9PA 3PURA 5IVFA 2YPDA 3U78A 5LWBA 4V2WA 5F37A 3OPTA 5FWEA 5FUPA 2OQ6A 5FYTA 5FXWA 5IVYA 3KVAA 5FYYA 4QXCA 5FZGA 5FZOB 5FXZA 3K2OA 2VD7A 5FV3A 5FY8A 3RVHA 2XXZA 3KV6A 4QWNA 4IGQA 3NJYA 5A7NA 2WWJA 2WWUA 2YBSA 4XDPA 2GP3A 4BU2A 2Q8EA 5FYCA 5FZ9A 3PUSA 5A80A 5FJKA 4QXHA 5A1FA 2GP5A 2P5BA 5IVJA 5FXVA 5FZLA 4LIVA 1VRBA 4QX7A 3LDBA 4C8DA 5FP4A 5E6HA 4HOOA 5FPBA 4AI9A 4EZHA 3PUQA 3DXTA 4QX8A 5FUNA 4CCNA 5K4LA 5IVEA 4EYUA 3KV4A 4CCMA 4BXFA 4LITA 3PTRB 5A7SA 5LY1A 3OPWA 5CEHA 5FZ7A 5F2WA 4CCOA 5FZOA 4GJYA 5FY4A 5A1LA 5FY0A 5FZ6A 4HONA 4TN7A 3KV5A 5FYMA 2OS2A 5FPLA 5FYBA 5FZIA 5A7QA 3UYJA 5FZ0A 5FXXA 5FZHA 4CCJA 3LD8A 3AL6A 4QU1A 4LXLA 5KR7A 4Y4RA 4GD4A 2W2IA 3K3OA 5FZFA 5A3TA 3PU3A 5LY2A 5FP9A 5IVBA 5IVCA 4GAZA 5FYSA 5FY7A 5IW0A 5FZBA 5FZ1A 5A7WA 3ZPOA 4DIQA 4URAA 5F3CA 4XDOA 5IVVA 5FPUA 4CSWA 5FZ4A 5F2SA 5F5IA 4IGPA 4LIUA 5FZAA 5FYIA 4NUBA 5FBJA 5F3EA 4EZ4A 2OT7A 5F3GA 5FZEA 2XDVA 5ANQA 3N9NA 5FZCA 5FP8A 4V2VA 5A7PA 5FZMA 3DXUA 5FYVA 3N9OA 4D6RA 5A3NA 4AAPA 2PXJA 4BISA 3AL5A 3K3NA 3N9LA 4D6SA 5FZ3A 5FP3A 5F32A 2YBPA 5FPVA 4DO0A 3AVSA 4IGOA 5FY9A 3PDQA 5FYZA 2Q8DA 4CCKA 5F5AA 5FZDA 5FYHA 3PUAA 2XMLA 4Y3OA 2YBKA 2XUEA
chains in the Genus database with same CATH superfamily
1ZREA 3M3IA 3T2QA 1FX5A 1W8FA 1W8TA 2DFBA 2FDGA 3LE0A 2YB7A 4CU9A 2R042 1HRI3 1F5FA 1MS9A 3OB8A 4BQYA 3VHOA 3NNMA 4SBVA 3DUIA 3TN93 1UYZA 2WZEA 3KLSA 4QPIB 1US3A 1HRI2 1X9PA 5HCFA 4XFAA 3PMSA 4META 1UX7A 1XQNA 5K9YA 2X09A 4UFJA 5FZKA 4U2AA 5A7WB 4JGZA 5A3PA 2WL1A 2HWC2 3P6BA 3PURA 1MZ6A 4BIFA 1G8WA 1Q5OA 1H2MA 1S0BA 4HN0A 2ZHNA 5FZGA 4LBQA 5CA6A 4Y22B 4YZ3A 4KGGA 2EICA 3D3AA 3O0WA 1MVQA 3T09A 3B9IA 3N35A 5A7NA 4O9EA 1H8TA 2CGNA 1RUF2 1O8SA 3HMYA 4HETA 1JW6A 3OUIA 3ZYJB 4BU2A 2G9GA 1BEV3 2A7AA 3BTAA 3Q8EA 3ILFA 4O9GA 4BQ5A 3DECA 4OVEA 3BVCA 4BZ4A 5I8TA 3CIHA 2VULA 4QXHA 5I0TA 3RZGA 3RMXA 1LB2A 4JX0A 1CPMA 4LIVA 1S2EA 1GLHA 3VGIA 1IKPA 1CPNA 2VU9A 4MGSA 4YGEA 4DQAA 3OGRA 1X50A 2ETEA 2VTFA 2VO5A 1W28A 1VB4A 4QX8A 3KV4A 2VZPA 3H1YA 5CFDC 4GH4B 1VBE2 3OTFA 4IV3C 5IATA 4L99A 5KC6A 1JHJA 3QOPA 4QX3A 1GMMA 1VB2A 3RS6A 4CCOA 1C57A 5LBCA 2XUMA 3S0MA 1PNGA 2D5FA 4GMP1 4TN7A 1UZWA 4N9IA 4YW2A 5FYBA 5FZIA 1W3XA 4ONUA 3HWJA 4H7MA 3AKQA 4XTPA 3O7OA 3L9JT 4XFHA 3RYPA 3ZKUA 4HLTA 1UPIA 2ES3A 2VG9A 1VALA 3SH4A 5A3UA 1DLLA 2A70A 3D8CA 4LBOA 3LOIA 1DYOA 3N7MA 4HN1A 3H1WA 3BUCA 3MIDA 3LKJA 3ZFGC 3AKTA 1K3IA 1ST8A 2DCZA 1NE4A 2HJIA 5FYSA 4S2FA 3A21A 4YZ2A 5B2GB 3FFQA 3NWKA 3OY8B 5A7WA 4AE2A 1JUHA 2ZX0A 4Q0PA 5IVVA 4JQRA 3P3PA 4XC9A 1JYVA 4CDWC 2NN8A 4XF0A 1MS1A 4ATFA 4MUVA 5A1AA 1UXZA 2QZ3A 2ZX4A 1I5ZA 2ZJCA 4QGNA 3ZYFA 4CU8A 2WO2A 2IUWA 2V5DA 3B69A 3LIHA 5GJ6A 3HVDA 4AEKA 1JYCA 4N53B 1YYNA 3H8OA 3FJSA 4FOVA 4JGYC 3WW3A 2XJSA 4RS5C 3V56A 1EUTA 2CV6A 2XJQA 3IT8A 5FP3A 1POV1 2DTWA 3PUIA 2XG3A 5HCAA 2YC4A 2BGCA 2F4LA 5FDBA 3B00A 3WG4A 2LS6A 1SFPA 3FHAA 3HPNA 4FOWA 4QHZA 2NMOA 2TUNA 5IK5A 4BLIA 4OHWA 5LW9A 1X9TA 3O12A 5IWFA 3T2TA 3PU8A 1TME3 4Y20A 2PHFA 5CG9A 1RUE3 1V00A 5FJHA 3FLPA 1WLTA 4M3CA 2BOIA 2A3XA 4IV1B 4Q4W1 3TB0A 3VBUB 3ZIWA 4CDWA 1OSGA 3AB0A 4FT8A 2ZEZA 2Y64A 5FZ8A 1PVC3 4JQTA 1LAJA 3EJKA 1R093 4COVA 2JDAA 2VM9A 3C7OA 2YU2A 1AHSA 3VKNA 4UFMA 2EVXA 1OLMA 4LHLA 5J1XA 1S2BA 5C33A 2JDMA 4KNCA 1QJX1 2ZKLA 5F37A 2ATFA 5JXIA 4W65A 4ZXKA 4Y5SA 5FXWA 2FDIA 2AGSA 1D4M3 1ENQA 1ONAA 1VIWB 5LBEA 4LORA 4WVMA 3AMQA 3M4FA 4HG6B 1JS9A 5EIYB 1DCSA 1YWKA 4M3CB 1A3KA 3FLRA 5C9AB 2XVKA 5FZ9A 3PUSA 1F4HA 3M8LA 4IEUA 5IVJA 4GQ7A 3NV1A 4PT6A 4CDUC 4F8AA 1AYM2 4LUMA 4W6WA 2ZMLA 4F3JA 1F35A 1PO11 5JXGA 4IV1A 2R1DA 2EXKA 3PTRB 1PK6C 1AJKA 2K9ZA 1WA6X 2ZZQA 1YQCA 3HQRA 3F2ZA 4I02A 4FVVA 4I01A 2JE7A 1I9RA 3AKRA 3WUDA 2PLV1 2ZGQA 3JUUA 2JENA 5LEKA 1N47A 5FPLA 5A7QA 2H0BA 2PMWB 3I2DA 3C7FA 2XQRA 3H1MA 1E5IA 4GWIA 4N90A 4AQTA 2B9VA 1SDWA 3WSOA 1HDKA 2HWE2 1JXNA 4PCRA 4WM8B 2BFUL 1UKRA 4JDMA 3WF1A 3AYEA 1BZWA 4PDWB 3USUB 2BJSA 3O5SA 4F83A 1HV1A 3O1RA 3NAPC 2W1SA 1L7QA 1ND2A 5C9AA 1GOHA 1WCSA 2F17A 4OZOA 1SQ4A 1JU4A 4Q4X2 3DF0A 1CAWB 2O14A 3SXWA 1UN1A 3NV3A 4D94A 1E57A 5FZ4A 4AQSA 1LCLA 1MEC2 1UMIA 4BMBA 4NIGA 2ZGSA 4RR3C 1UY4A 2E51A 2RR12 4JKMA 4MH0E 1NYWA 4YVWA 1QH7A 1BK1A 1PGW1 1WMEA 2CYFA 2Q30A 2XDVA 2ZAHA 3WDYA 4RGGA 2QQUA 4I3PA 4DZGA 5FOJB 4XVHA 3CJIC 2QJVA 5GZDA 4EE2A 4FCAA 1OF4A 1OUXA 3EMRA 1D0HA 3MFAA 3I3MA 2DTYA 4PI0A 1OOPA 4YLZA 3FBYA 5C5TA 4DO0A 3AVSA 3IIIA 2V73A 3FE5A 3KHBA 2TEPA 4MGQA 1OC1A 2VXRA 2D6KA 4GH4C 4IV3B 5F5QA 4QQOA 4YFZA 3VBHA 2A6XA 1S4CA 4TSVA 4LLFA 1AL21 1AR81 1QJX2 2G4IA 1TG7A 2W91A 2VOWA 5DAWA 3WDUA 2FMYA 2VW2A 1RMU1 5D8AB 2ZACA 3PJQA 4COZA 1O6UA 3J7LA 4JGYA 4JGZB 5IFTA 2HEYF 1OLQA 3RWNA 4AFBA 4BPZA 4A41A 5F9TA 1Q56A 1C4RA 2HH9A 4OUMA 3U07A 4BXSV 4CUGA 5A3OA 2DVGA 5FY1A 4COUA 1S0FA 2WNUB 4HSLA 5T55A 2VPVA 4CUAA 4NIDA 1WBFA 3OGGA 4ARXA 1QJY3 3I2GA 1N1TA 5FUPA 2Q1MA 5FYTA 3OPZA 1ZA7A 2WS91 3ZN4A 5L9BA 4BQ4A 3VKFC 3ZSKA 2I07B 3VD9A 2A3WA 5JCTA 1KXGA 3O0XA 4GALA 2IXKA 4NRQA 4IEYA 4P5HA 2OUHA 1D7PM 1REFA 4MOAA 1WUVA 1OVPA 5GZFA 1YHFA 4MXVA 4NIHA 4E4ZA 4HKOA 2VZ1A 1OXCA 3DYOA 1FPN2 4B4RA 4EZHA 1Q8SA 1UW8A 3CO2A 2OZJA 2ZAAA 1LJ7A 2XBO3 4BLJA 5FK7A 1ZBA1 3KZ4C 3IPVB 4GA9A 1V9U1 2VBPA 3P5BA 2HWB1 3VUOA 3RMYA 1I3HA 4CA9A 4TWTA 3LZZA 5F2WA 1O8PA 4LBKA 1DBNA 2R6QA 4R4ZA 2EXIA 3WF2A 1Q3EA 3JB8A 3DPRB 4Q4X3 5FO8B 1QQP2 1UYYA 2EXHA 3B7MA 5D8AA 4J6GA 4JHTA 1FNZA 4QU1A 1AXKA 4QPGA 2PHLA 5BXXA 3I59A 3UKVA 5F6LB 2WZ8A 4NHMA 4ZS2A 3MLJA 2WINB 1NLRA 4XBQA 2YYOA 1DGRN 3ZDSA 1GZWA 4YG0A 2PHWA 4XJ9A 1PO21 1U5ZA 1VBD2 3PU3A 2XGXA 4RD7A 4XUOA 4P5YA 5DAXA 1VR3A 4LEJA 5IW0A 2EF6A 2GC1A 1ZRFA 1ND3A 1UCXA 1XSRA 1RIRA 2PHRA 3HNYM 2P6CA 3WP4A 1J84A 2VMFA 4QDRA 4HVOA 2I45A 1ZBE2 2P34A 3E6CC 2H6BA 3IAPA 5H9RA 2XJRA 3H7YA 4A7KA 2OPWA 1V6LA 3ES1A 1SBFA 4D7TA 5G04L 2QQIA 5GZCA 4LIUA 5ANNA 2FZ1A 3P3NA 3ELNA 2P17A 4LHNA 2CWSA 4WVWA 4AEDC 3LA7A 3ZIXA 3LFMA 4XUNA 2IXHA 3WNOA 3K77A 4BE3A 2CDOA 4CDQC 1W90A 1VBC3 2FZ2A 1GP6A 2JG8B 2PXJA 5GALA 4FQZA 3D4KA 1A78A 1CAUA 3K3NA 3SCFA 1SEFA 2RM23 2HEVF 1LGBA 1MZ5A 2YBPA 4KH9A 3J4UH 3I2OA 4EWDA 4OI2A 2VMGA 4O65A 4OHZA 1DG6A 1XNAA 2QQLA 3Q9OA 4M4RA 3NV2A 1CR7A 1Z78A 3FX3A 2OPKA 2WZPP 1LODA 3VN4A 4ZONA 5HI0A 3WF4A 3DKQA 3ST7A 4Y24A 5FPAA 1R1A3 2ZHKA 3MLKA 4F7ZA 3M7AA 1GV9A 4RGKA 1IOAA 4UFKA 3Q8CA 3OJBA 2FDHA 1OT5A 2VL4A 1ENRA 2JG8A 1OOPC 3V0AB 2IXCA 1OLRA 1MEC1 2QBXA 1UD1A 1VMFA 3E97A 3KF5A 1W39A 2D43A 2WABA 3LOBA 4JRLA 3ZO0B 1KJLA 1N1YA 1S0EA 3H8UA 3WCRA 2DURA 1JYXA 4LMFA 1UIKA 3VBHC 1ZM1A 1WGPA 5A33B 3W5MA 2WWJA 3I4IA 2B8MA 2C26A 2C5DA 1RL3A 2CY6A 1BEV1 1TMF2 3MO4A 5D2AA 1XPWA 2YFUA 5T3NA 5KXBA 4FFIA 5J96B 4FPCA 1PX4A 2AZ5A 2Z42A 4YVSC 1RHI3 1C3HA 1RUD3 2VW1A 1TMF3 5DAPA 3UGFA 4C8DA 1WMXA 3VBRA 1SLCA 2DWRA 3D6EA 3VBOB 5ABJA 3FZ3A 2LW8A 2V5YA 1XNDA 2XLAA 4Y1VA 1H4HA 5EJ3A 4CE8A 3OUHA 2B5HA 2B39A 1H2LA 1V9U3 4Q0VA 1H9PA 1QDOA 1UWWA 4XIKA 4MX3A 1AL23 2VMCA 4LBMA 5LATA 3BI3A 4S2DA 3HBZA 1NUKA 2PQQA 3K75B 2YUEA 4XJZA 2G9FA 4Q26A 5FY4A 1RTVA 1O3QA 2XPJA 1MQTA 3UYJA 4I3GA 3LFIA 4XTMA 3QD6A 2A6YA 1UU6A 2ZOEB 2WNVB 3AL6A 3A7QA 1RUJ2 4OFGA 2NQYA 1T6BX 4LKDA 3USUA 1TNFA 2RS33 2KM2A 2RMU3 1MVEA 4Q1RA 1CZVA 4K8RB 5LBBA 1OKOA 1FT9A 2FCVA 2LRPA 2UWAA 3MW2A 1VAKA 4JZRA 2FCUA 2RMU2 2WAAA 2WFF1 3C7HA 5FZBA 2NZ9A 1VP6A 3ZXFA 4Z1VA 1QJY1 3IDCB 3RSJA 5IT6A 4LNVA 4XURA 4NWVA 4RHV3 1W99A 2YMZA 3AZXA 4CSWA 1M06G 3WT3A 1CAXB 1NE6A 1BEV2 1ZZ9A 1UMHA 2XVLA 3AJYA 3SKVA 1VRH1 4CVUA 4XFFA 3AK0A 3WUCA 4EWEA 5FYIA 3EYPA 1FPN1 1OOPB 2VBDA 3NRUA 1TZOA 5FMOL 4AVSA 5FP8A 1W6QA 1O4ZA 2K46A 4W6XA 4XCBA 4XYXA 3AL5A 3EQEA 1HRV1 4QB6A 3WXPA 1QDCA 3AM2A 1CAVA 4EQVA 4FAHA 3KCCA 2Q8OA 1LOEA 2J42A 2XB6C 2ZABA 5AFBA 4IGOA 2JDUA 3ES4A 2WNVA 3PDQA 4KMQA 1PO13 4N7IA 4UYBA 2WS92 3ZN5A 4CEYB 4Z2AA 5L73A 1L3JA 4OYUA 4RQPC 2WNUA 5G05L 2XMLA 2LROA 1AYN3 1ULOA 2O8QA 4YPJA 4AVCA 3KQRA 4FAGA 1S0DA 2YXSA 3WF3A 3ZOIA 1JZ5A 5JZGA 5F39A 1LKNA 4RYDA 2JKBA 3L2HA 4GXLA 1MS5A 1DHKB 1QJFA 1MZEA 2CTVA 1VLNA 3LCPA 1HQLA 1YFXA 3PJYA 4QHOA 5CFDA 2OIIA 1KS4A 3ETQA 4NE9A 4IEQA 1W9TA 4NVPA 2BWAA 2XBO2 1GFF2 2A6VA 3IKWA 3LA2A 3IIAA 4QKBA 4AG4A 1FOD1 2EIBA 1Q43A 1CJDA 2RVAA 4QQLA 3K2OA 2VD7A 2X5IA 2R043 5BNPA 1W8ZA 2V4VA 2RG4A 1CONA 1UL9A 3HNMA 5M0TA 3NAPB 3ALQA 4QX0A 2GP3A 2ZMNA 2Q8EA 2VTXJ 3M3CA 1C1LA 2NLRA 4FP2A 1JOBA 4OMCA 1M4WA 2BNMA 5EWSA 3B5LB 5FLJA 5BNOC 1W6NB 4QT6A 5DG2A 3VL9A 4KWUA 4K1ZA 1EAH3 1E5RA 2NMNA 4M00A 2A1XA 1ZBA2 2R071 1VBD3 3JZVA 4MSVA 4PLNA 5FPBA 3DV8A 2C6SA 2CGOA 2V4AA 3D0SA 2RJ2A 5JSOA 3BB6A 2D3SA 2UYAA 1YUDA 1YQ5A 1UX6A 4XHBA 1AR91 3OD4A 3AMMA 4RA0A 4PHZA 5IAVA 3G7DA 2XOMA 1S55A 2Z2SB 4RS5B 5AFEA 1QQP1 4BOWA 4A6SA 1OFSA 1LOFA 5DDJ1 2UURA 2VZUA 5GKAC 3IMNA 5JSPA 1W8NA 3BPSA 2XVGA 5T5PA 3SITA 3BN6A 5FXXA 3N4MA 1CQ9A 3ILRA 3P1IA 4E2QA 4LXLA 1KD7A 4MLOA 2X5IB 4ASLA 4XQ4A 1UZ0A 2WBKA 4AI2A 1AF9A 4GD4A 1PO22 5FZFA 4LBLA 2NPIA 4KU8A 4R4XA 3U14A 1H6YA 4AOCA 4X8PA 3AMPA 4W50A 5IVBA 2WZR2 1AR92 3C7GA 5CU1A 2FDFA 4I30A 3O1MA 4X6RB 4D7YA 2W9XA 2Y60A 1LR5A 3AMNA 3KT1A 3PIGA 1JYWA 4N8MA 4K7JA 2NM1A 2WN2A 1NLSA 2WO1A 3ZFGB 1UOBA 4N9HA 1DQ6A 2YC2A 4IV3A 3QH7A 5F5IA 3O1SA 1RUC3 2Y8KA 4OUEA 5CADA 1ZRRA 4NUBA 4NMIA 3ORJA 5F3GA 3INAA 1WMFA 3TOJA 3WZ1A 3H3LA 5A7PA 1L7RA 1ODMA 1VPHA 3IAQA 1SLLA 3R0RA 1SFYA 2BRTA 5C3QA 1ASJ1 1SDDB 3LPGA 1HB3A 2YC0A 1O5UA 5FZ3A 3GDBA 4QKNA 2WO7A 5FYZA 5FY9A 3ACGA 1ZVFA 2IFRA 1XNTA 1K5JA 1O4YA 1DGLA 1J1TA 1AYN2 2HYXA 4Q0UA 3VBOC 1H2NA 4COWA 3WNMA 4E4DX 2OW4A 2GNDA 1LGNA 2JB8A 3NO8A 2GAUA 1G9FA 2P3YA 2WRAA 4BK4A 1QU0A 1ZZCA 5K0UB 1A8DA 1H2KA 2ENRA 3DCQA 4OULA 1G9CA 2WKKA 4UBHA 4QDQA 2AENA 5JR2A 1U5XA 4B7EA 2PFWA 2UU8A 2WZR1 5EFUA 1WLDA 4LHKA 2VZ3A 1OBNA 5DAVA 5A7OA 4NAOA 4ORFA 4CYDA 1QMJA 3N9PA 3ZN6B 1EAH2 2WT2A 4B3NA 5J37A 2XL7A 2VH9A 3LEKA 4CXWA 2VOKA 1ENSA 3JD73 4CU6A 3ZXKA 4CP0A 4IW3A 4XFGA 1HX6A 4HANA 5FV3A 4U36A 4E27A 5BNNC 2XXZA 1HRV2 2ARCA 4BH9A 4XAEA 5DDJ2 4M3CF 1GYKA 2VTXA 4R52A 3E6DA 3QLQA 3BGAA 4K21A 3VBOA 2QUOA 1LESA 4JTOA 2GP5A 2GMMA 2VJXA 3BOPA 5E16A 4AFDA 4WVMB 1H9WA 4K9SA 1PVC1 3HN3A 5CKNA 3TEZA 4IEWA 4LTAA 1QJU1 4XMAA 3ZR5A 1N3OA 1DQ1A 3ZYRA 4KWJA 5E6HA 3VZNA 4AYUA 1N3PA 5LA0A 4HFSA 2R073 4D0QA 3JBG1 4XEZA 1H8TB 5FREA 1Y9GA 1QJX3 4IERA 4UFIA 1AYN1 3KT7A 3LA3A 2WNEA 1AR93 4BB3A 3UJOA 4XOGA 2BBVA 4XUTA 3BIEA 1QJU2 1LEDA 2ZXQA 1ZZ7A 2Y6GA 2X10A 3AKPA 4XZPA 4A2UA 4AHWA 5EYYA 2WYSA 3NNGA 3ACLA 1RUJ1 3DKWA 4Y4RA 3AMHA 5C9AC 2W2IA 5JAXA 1PO23 1LHNA 2QNKA 1UOJA 1UOGA 3SCGA 1CWPA 3TN92 2BV4A 3AYAA 4YWAA 1DF0A 1XRUA 2P2KA 5FCCA 2JEMA 3O1UA 1ZZBA 1FAYA 2VVEA 2AR6A 2HBUA 3LQCA 4O7XA 4YZ4A 1D4M2 4CP2A 3U10A 1SLTA 3VBFB 4LA2A 4P14A 2Y6FA 1NY71 2XJPA 4IE7A 2X29A 4WM8A 4XPVA 3SEPA 1TMF1 1VBD1 2GNBA 1IPKA 5KHIA 3IM0A 2JDZA 4Q27A 4AHXA 4NN0A 3T4HB 4BHPA 4DXRA 4OMDA 1WLCA 1LHWA 2YDEA 1JH5A 1KQRA 1YIFA 2ZGPA 3K4AA 4QPYA 3RJ2X 3NJXA 3ABZA 4JHZA 4L8QA 3WNNA 3FUOA 5DUUA 2ZGUA 4CEYC 4ZZ5A 2A6WA 1TE1B 1UYPA 2W92A 3BIWE 4Q4V2 4UT5A 1UF2C 2VQ0A 1J3QA 1GZCA 3GALA 3O14A 4ASKA 2Q5TA 4FPHA 1J59A 1LOFC 2E33A 3OGJA 4PBOA 3BTYA 5JMOA 2B46X 3SQOA 2B7YA 1ZX5A 1RINA 1C8NA 2C1FA 2ADEA 3E6BA 1HXS3 2W08A 2Y6KA 5C8CC 5FWJA 3VKLA 2HBTA 4XJAA 1XB9A 1W6PB 2QVSB 4AGGA 1D2QA 2X8KA 4PJYA 5L9VA 4LO4B 1NZIA 1OFNA 4FOYA 2ZHLA 5FWEA 5ABJB 5BV6A 4URTA 2VCMA 5J09A 1FOD2 4XCAA 4OI1A 5SV8A 1DZTA 1IGOA 1TVGA 3ZYBA 2VZTA 4KWKA 1Q8PA 1SPPA 4BJ0A 1RUC1 1YQ6A 3RNSA 4LBJA 3J7MA 4QMAA 2JG9B 1HIXA 5K0UC 2CNAA 1NA1C 4KI5M 1CGPA 5A1FA 3OUJA 2EIDA 4Q8KA 1FV3A 4FP3A 1ASJ3 2WNVC 1XSQA 2VOTA 1CAWA 5FUIA 3ZFFB 3RFRA 3FBMA 1W06A 1PIV1 2RS51 1WD3A 3PVEA 4CCMA 4YM0A 1W6PA 2VY0A 1NCRC 1GKBA 3RWKX 5BNNA 5TSWA 2QQPA 4AXOA 1UNBA 1W04A 3D82A 1CAXA 4UFHA 4ES9A 2WYFA 2DVFA 2E6VA 2O8OA 4UW4A 3OBRA 1NCRB 3ENRA 3OCPA 3Q8BA 4HONA 1IHMA 2BQPA 4XDQA 4C1XA 1JZ4A 3T0BA 1YJKA 4OQ9A 3TN91 5FZ0A 4DRVA 1JUIA 2YPJA 4YGCA 5KHHA 1PGL1 2R30A 3SNMA 4ZS3A 1GQHA 1CD3G 3RZJA 1LOBA 3ILNA 1NZCA 4MGIE 4NHXA 2J1VA 4FFGA 2DU1A 2VQTA 1Q8VA 1RGSA 2ZEWA 1W6QB 4G9SB 3M3OA 3MV01 2WDBA 1BQPA 4MO3M 4OHYA 5FY7A 3HQXA 3IPVA 4HK8A 4G4FA 4RN5A 2E53A 2JDKA 4IDZA 3WDXA 2QZ2A 1UU5A 2AREA 2XQXA 1X33A 4P9GA 4TLGA 4GMP3 5F8PA 3PUHA 4WM8C 4FTSA 2WNUC 2W46A 4GKYA 4Q4X1 5HXVA 1NX9A 4YW1A 1CZSA 2MNGA 3KT4A 4QPIC 4N7UA 5J48A 2ZHMA 1SACA 3WP6A 4D7SA 4YRDA 1J58A 3DXUA 3MFCA 3N9OA 1GNZA 3GCWA 1QOSA 1QHDA 2VZSA 1E5SA 4N43B 5D8AC 2Y34A 3MGUA 5F32A 5FIXA 4AQ6A 5I0DA 3RG0A 3ZVXA 2ADDA 1RUI2 2PYTA 4LPLA 2E7QA 3NL1A 1B35C 3ZXLA 4FPKA 1MPXA 3HQUA 1HW5A 1QXRA 4QX1A 3T2PA 2ZGTA 1UIJA 1UZZA 2GC2A 3U37A 2QQJA 2P6HA 4ISQA 2D3PA 4Y1XA 1P8JA 2GN3A 3B3QE 4O61A 4CDXB 4DXTA 1JYNA 2Y0IA 1XU2A 1JZ2A 2BEOA 4IETA 2B4KA 2G9ZA 4M4PA 1UY1A 2VMDA 4QQPA 4TXWA 2P37A 4Q5OA 4XFBA 3UT0A 1W6MB 5FO9B 2FMDA 1GU3A 1WBLA 3AZYA 5F6KA 3VBFC 4ASMB 5F3IA 5FKCA 1HXS2 5IK7A 5IYYA 1JTZX 4FFHA 4Y26A 2VOVA 1RUG1 1RVF3 4AFAA 4GH4A 4HVQA 2WLQA 2WA3A 1RB8G 5LWBA 4V2WA 2J22A 3RQ0A 2VNGA 4XF3A 5LCWL 1ACCA 1DGWX 1VMHA 3KCYA 5FYYA 3UGHA 2VW0A 2OA2A 1DGRA 5DUWA 2DCYA 4LBQB 3MV11 4DFSA 5F1RA 1MR5A 2O0OA 1W8WA 2ZA9A 5FY8A 3RVHA 3E5XA 5JIUA 3WX5A 2VMIA 2VMEA 1V70A 2R1BA 4IE6A 3LF7A 3MW3A 4LKEA 3ZXGA 3Q8AA 4GZ9A 2XLGA 3LIGA 4R9DA 3EHKA 2WQ8A 5A80A 4LO6B 5FJKA 3R4SA 1Y3TA 2EIGA 1R091 4ZKTB 2DVAA 1T6GC 2GALA 3OGVA 1GZ9A 3I2FA 3I49A 2RS11 1ALYA 2W94A 3CLPA 3BYWA 1AR63 4MYEA 1VBC2 4NRPA 1YJLA 3AP5A 1PZ9A 4HXCA 5SV5A 2P3KA 5LASA 1VBE3 3UETA 4UI9L 3WNKA 3POJA 4AFCA 1G6NA 5CFCC 3POFA 3J8F3 1O7FA 5A32A 5H9QA 5JPNB 2C0ZA 3CJIB 2ERFA 3MYXA 1NG0A 2JKXA 3MLLA 4NIAA 3ZFEB 5JOWA 3N7KA 4ZZ8A 3VB9A 1D2SA 4YVWC 2WC2A 4QU2A 2HWE1 5CKMA 2Y6HA 2D98A 5C70A 2WT0A 5GLWA 1DYKA 3VD5A 4BA6A 4CDWB 5AC93 2IC1A 1BBT2 4P02B 4Q4Y1 1XJAA 4R9BA 5LY2A 2DBNA 1TQ5A 2I74A 3K46A 5FZ1A 4ATEA 4KWLA 2BYVE 4Y20B 5F3CA 3BOWA 5GLUA 3N36A 3QCWA 1PO12 3X29B 3ZM8A 1SZBA 2YV8A 5DMYA 4TLFA 3AYCA 4PDWC 3E5QA 4CDUA 4QD2A 1IS3A 3GYDA 1ULPA 2DVDA 1PMJX 5KWRA 4X6QB 3CU7A 4AL9A 3DPRA 2MEV1 3GJBA 3THDA 1NQJA 3ZMOA 3T3YA 4YVWB 4LBQD 5J36A 3ASIA 4YW6A 4KL1A 1W05A 3UV9A 1BLZA 3DYMA 3LEGA 1H30A 4EN6B 5KXCA 2RS31 3MF9A 5FZMA 3RZKA 2RMU1 4Y22A 2D44A 4KU7A 3FLTA 2WQZC 3AXDA 4JDOA 3RYKA 3NJVA 2F6BA 3VBSC 4AI0A 3N7LA 4YZ1A 3OEBA 3OBAA 1DQ4A 3JBG3 3POGA 4ZY9A 3ZYHA 5A6YA 2B45X 3KCXA 3WD5A 4IESA 4RS5A 4Y3OA 2XUEA 2HWD3 4FO9A 3JBG2 4JCKA 3WHTA 4QPIA 3ZMNA 2PHTA 3QH6A 2CAUA 4IEPA 4Q4V1 4YVSB 1RUH2 3U75A 3H42B 3ZDVA 1NA1B 1XE8A 3FMGA 2R062 4AFMA 2YGMA 4FBFA 4CCEA 2A5ZA 3Q8FA 2J1SA 1OLME 2FDKA 1PIV2 3WQ0A 2JIJA 1COV1 2K0GA 2WZR3 2KD7A 1AJOA 2GMEA 2OQ7A 3GZAA 5ISLA 4JRAA 1UY0A 2D3RA 4UF0B 3THCA 1YFYA 4M01A 2C9AA 2AUYA 5C3PA 1ZBA3 2D6NA 3TEXA 3TEYA 4XJUA 1ZYBA 4NHYA 3WQ7A 2UWCA 1OI6A 2HWC3 2QQWA 4FTBA 3ECQA 4MXWA 4LHSA 1Z7S1 4E2GA 2QCSB 2VNRA 3G6JB 3KD4A 3O0VA 4QWNA 2VGDA 4NPLA 3NJYA 2ZPXA 4M0HA 4EJRA 3N3HA 3ZR6A 4CRQA 1FV2A 4H3WA 2OYZA 1XBFA 3VBUC 2W39A 1OURA 5IK8A 4R9AA 4R9CA 1BXHA 2FD8A 2EAAA 1QXPA 3I8TA 2XH6A 4IE4A 4LULA 4ZU5A 4SLIA 2HEWF 3GBWA 2BWCA 4AVVA 3IWZA 5APAA 3ZFEC 3NNFA 1PNFA 4L97A 5L7OA 1O3RA 2A73B 4JAAA 1LU1A 4YZ5A 4BXFA 4MVTA 4NRMA 5DG1A 1KGYA 2XWBB 2IXLA 2J1RA 1QJY2 3OG2A 4EV0A 4YGBA 3VDDB 2BUKA 5BPXA 1ZRDA 1D0GA 2JDPA 1WCDJ 3JB4C 5CFDB 1NXMA 5FZ6A 5C3SA 4RR3A 5LA9A 2NP0A 2DCTA 2WWSA 3SEEA 2GU9A 1HJGA 4B8EA 3H8RA 1MS4A 4XQWA 1KDMA 5FAXA 4AK3A 3WVJA 1UAIA 1VBA3 2VUDA 3ZX7A 4IE0A 2PAMA 1AX1A 2VMHA 3JCIA 4BCUA 5DAQA 4AQ2A 4NPRA 2XBO1 4Q2FA 2P3JA 3AFKA 4AVBA 1VBA2 2AACA 3JD72 4NO4A 2BBAA 4XZUG 4CPBA 2WIIB 1ULDA 2HWB3 3OYWA 1N3QA 4QX5A 2YZ4A 5B4XA 4Y1YA 2XL9A 3GHMA 3PVBB 4Q8LA 5A6ZA 2RDNA 5HCHA 4UWDA 4L0PA 4JKLA 3VDAA 3O1VA 4OCTA 4CUBA 1X7NA 4J1WA 1PMIA 1W0NA 4HK9A 1POV0 2JD9A 2R7EB 3LSDA 5KHGA 3GCXA 3NV4A 2W1QA 3R05A 4Q4W3 3TWIA 1FI2A 1UQXA 4AW7A 4CXXA 4S2HA 1W8UA 3HD8B 5FZCA 4FTEA 3UL2A 5J7MA 3PTYA 4QHBA 4PQ9A 1W3VA 4E9KA 2YROA 5A3NA 3ZPYA 3J26N 2RS13 1OVSA 1H1AA 1RUI1 3N9LA 4M3CE 2PHXA 4JC1A 1LHVA 1RUNA 4DRRA 1YLLA 4L92A 4P9XA 5FPZA 1PIV3 1OMIA 4BDVB 2Q8DA 3W9AA 3ZYGA 4PIYA 3VZOA 1BMV2 2WA4A 4LKFA 3IDBB 2XLFA 2GC3A 2YBKA 2ZEXA 4D8MA 4E4HA 2MPFA 1HB2A 4FPLA 1SLBA 3ZFFC 1W6MA 2Y38A 1GQPA 2YG0A 4Z2WA 5CFCA 3SC7X 4W6YA 1AR62 1VAVA 1JMUB 2UYBA 2PTMA 4A4AA 1F2NA 4S2GA 3CHXA 5L19A 3S6PA 2E9QA 2YU1A 3AVRA 3I3QA 4IEZA 4QGLA 2Q0AA 1AX2A 1EP0A 2RJLA 5FP7A 2XKOA 3C8XA 1AR71 1X36A 5HCBA 4TTGA 1PVC2 3NNLA 1EYBA 1KJRA 5DUVA 3USSA 4B1LA 5I0SA 3VV1A 2LTNA 4GIQA 2RS32 5LA2A 3J7NA 3WQ1A 2KR2A 5FOBB 4E2SA 3I2KA 5DQ0A 3KGLA 2EIEA 4W4ZA 5CB7A 3ZXJA 4AEJA 4XACA 1US2A 3S7EA 1YQ2A 1TME1 2Z4FA 1RUF3 1R1A1 3NKGA 1K12A 3TBDA 2P3IA 4E8DA 2BW8A 2JG9A 2UY9A 5FYCA 2CHHA 3MPBA 1OPOA 3ZKYA 5H9SA 2W1UA 3NQHA 3VD3A 4OI0A 4HOOA 5CKQA 3I59B 2RS53 4D69A 5IVEA 3F95A 5EJZB 4LITA 3AXEA 1RITA 3OBZA 5A7SA 1N1VA 3WNLA 1HB4A 1H4GA 3OPWA 3BKZA 3D5OA 4X8NA 5FLIA 3JD71 4GJYA 4DOUA 1W6NA 5AVPA 4OZXA 1GWKA 2JG8C 1AYM1 1ND3B 1AR82 1YEWA 3JQWA 3KV5A 5FYMA 5BNPC 1KEXA 2DYCA 2VNVA 4CDQB 1DLCA 2XHNA 1FPN3 1APNA 3TNPB 1EUUA 1CIYA 2BDRA 5IUQA 1G9AA 1E5HA 5A32B 5KR7A 1KDKA 2GC0A 4Q4Y2 4K8FA 2JG9C 1BBT1 3WLUA 3LAGA 4AI8A 4AEDA 4UAPA 4XETA 2ORXA 2XJVA 3MIBA 1WW5A 1XU1A 4BQ3A 3WG1A 5DXDA 4LBNA 1DP0A 1URXA 2HWB2 2WFPA 3GBGA 4EWAA 1F9KA 5BUVA 3WY6A 1V9U2 3CKHA 1EPWA 4GKXA 4PF1A 4ZPIA 4XDOA 3FHQA 3K51A 4COYA 5LRSA 1CAUB 2CAVA 3W20A 1Z7S3 2RR13 3R4UA 2ZCWA 3SCHA 4HSJA 4R8HA 5DZEA 1POQA 4DY5A 1VBB2 2ORZA 5FZAA 2ID4A 2X5IC 5DN2A 5C4WC 4LT5A 1CVNA 1OKQA 4ET7A 2D6LX 3I3DA 3NW4A 5JI9A 4OHVA 1NXD1 1OD5A 1CJPA 3OOXA 4CDXA 3OEAA 3VD4A 4YW7A 1GSLA 1UU4A 1ZZ6A 3GF6A 4Y4YA 1JOJA 5FYVA 1OH4A 1ZRIA 3O1OA 4DUWA 1JZ7A 4YM1A 3V0BB 3EXUA 4YGDA 4DUVA 3KMHA 2QQKA 4H14A 5BNQA 1R092 2QKDA 4ZHNA 2Y26A 3CQOA 1SHWB 3K48A 4JKKA 5F5AA 1BCXA 1BHGA 4B4PA 3NSTA 3B01A 5J98B 2DUOA 2XWJB 1ULCA 4ES8A 4J1XA 2KA3A 2CWMA 1RUE2 2W5FA 3WG2A 4JV4A 5FY5A 5DUXA 2EAKA 2A75A 1UZYA 1W6OB 2W87A 4FOQA 1GICA 2VE1A 4UF0A 1ULEA 5IHRA 3LDKA 4YW4A 1UY3A 1LECA 1OA4A 3MPPG 3DL3A 1IQAA 2BVBA 3PVNA 4HKLA 4D6QA 5H9PA 5EV7A 1CIWA 2WT1A 1BK0A 2VR4A 3OY8A 4DXSA 1F31A 5IVFA 1HB1A 1W8OA 4LKSA 5JWPA 1PHMA 1CX4A 2JDYA 5ERLA 3TAYA 1GR3A 1RJ8A 2HWF1 5CBLA 2MHFA 5AVAA 5FBZA 3VHRA 2J1EA 4RSUA 1Y9MA 3N7JA 3VDBA 1WWYA 1NA1A 1O5LA 5EZWA 1S0CA 2DUPA 5JXHA 1A8MA 4NHKA 3M3QA 4A44A 5E1RA 4LO5B 1AZDA 1W9SA 1S0GA 3UKNA 2ZKNA 2A71A 3JQXA 5D21A 3DN7A 4UW3A 2V09A 3FWEA 1YI7A 5FZLA 1O3TA 2R49A 1OA3A 5ACA1 4MGYE 5JOXA 1RUI3 3VDDA 4PF5A 1G9DA 1MZFA 2HWD2 1AR61 2RV9A 2VOXA 2XKPA 3IN9A 5I8SA 5T5LA 3OSDA 1C5IA 1KFUL 4I0AA 1XNKA 4Z8BA 1R082 2WO3A 1W6OA 3POBA 2Z5WA 1W9FA 1FOD3 1SFNA 3POIA 1HLCA 5LY1A 3ATGA 5C8CA 3GM8A 4NIIA 5C7GA 3CMGA 4QQ2A 5A6XA 2RDSA 3VBSB 1PK6B 1QOOA 2Y6JA 1C8M2 5KHKA 2JIGA 3WDTA 1H1IA 2YHJA 2HWD1 4K6BA 4LO8A 2W0XA 4I09A 4P9JA 4AI1A 2FHRA 1DQ0A 4RGAA 1Y43B 3PLQA 2IVIB 2J7MA 4CCJA 2V72A 1LU2A 4C1WA 2GNMA 4CDUB 5HV0A 1REDA 1YIPA 2ARAA 3MIHA 1QH6A 4RR3B 1B35A 2DCKA 2G19A 2PQSA 1F4AA 2YY1A 2RM21 4PIZA 1FMD2 3GBFA 3AKSA 4XBNA 2ZGRA 3UNPA 2VECA 1QNWA 2BPA2 4HPKA 1LULA 3IDEA 1SBEA 1ND2B 3HEIA 4LE3A 1EV12 2J1UA 2R0FA 5BNNB 5LZ6A 3WEZA 4MGTA 5D1IA 3PVOA 4C91A 1S2KA 2Q1FA 1BJQA 4RHV2 5FPUA 3RYRA 1NCQB 3VBSA 2JJ6A 2HWC1 4E8CA 4OI4A 5CYYA 3WW1A 3POSA 3U0ZA 2PHDA 3GGLA 1LRHA 2FQPA 2P4EA 2RDRA 4OQ8A 3B02A 2MEV3 3LB9A 2VCCA 3WQBA 5JOYA 3SISA 2PELA 1HQNA 5CVRA 1MS3A 5K7PA 4B4QA 3IB3A 5JZGC 4YSFA 3LPFA 5E89A 2OZ6A 4J25A 4P9YA 1I5PA 1Q8OA 2I2SA 4Z82A 2WFF2 5C3RA 1XYPA 1ZA4A 2VXJA 4D6RA 1QF3A 4JGZC 3RI8A 1YNAA 4QPGC 3WDVA 1F5JA 5LBFA 1YQ8A 3BTXA 2D93A 1ASJ2 1IPJA 1WW7A 2AH2A 2XJTA 2HKXA 3ZXEA 2ARBA 3UJQA 3O1PA 1SLIA 3VKMA 3BODA 1WMDA 1YI9A 5HPOA 4XIOA 1U5YA 1NCQA 1R1A2 3VKOA 2VNOA 3UGGA 1PK6A 3U4XA 2QDRA 1AYM3 4I2OA 4FPFA 3T1MA 2RHPA 5LB6A 4TZDA 4B1MA 4KG8A 1VJ2A 4YW3A 3C3VA 5JXJA 3ZLIA 1RYYA 3NMBA 4FXKB 3HBKA 4C90A 1ULFA 5EYXA 1QXJA 3BU7A 3RPQA 4MG2A 5CZKA 2JX9A 1AR72 3MICA 4H2AA 4OLLA 4BQ2A 3O1TA 1QJU3 3VBUA 5FMOS 3EBRA 1HN1A 1XE0A 1XE7A 1ZNPA 1W03A 2ET7A 4KQ7A 4Y33A 2QQVA 3VHPA 2Z69A 4BQ1A 2EA7A 4W8JA 2HWF3 1NY72 3ZSLA 3KVAA 1MS8A 1WA4A 1GWLA 1GZTA 3APBA 1WCKA 1WCQA 2CU5A 4FSJA 1DYPA 1ND2C 4IGQA 4AZZA 1MS0A 2R16A 2WWUA 3J8F2 4IL7A 2YBSA 1K45A 4HVRA 4I0BA 1QWRA 4QDSA 1AXYA 4XDPA 1V0AA 1LHOA 3KM5A 1COV2 1EPZA 2C24A 5EXOA 4FI9A 1SG3A 1HV0A 1SLAA 4C0HA 4CUCA 3URFA 4L2NA 1JU3A 5CNAA 1AVBA 4CDXC 1GOGA 2WAOA 3T2OA 4AI9A 1RMU2 4AEMA 3AZWA 5I0RA 4P00B 1MEC3 5KC5A 1REEA 1J3PA 2RDQA 2BERA 4XAAA 1WW4A 3TRSB 1JZ3A 3VBRC 1XOYA 1R64A 4RHV1 4P08A 4NROA 2E26A 1D4M1 2BTVC 2PAKA 1EV13 2JXAA 2E31A 2JE9A 5JIAA 1K5MA 1TEIA 2AYHA 1V6IA 3AP6A 4IEOA 1QJZA 1JN2P 2DDUA 3T4VA 3GXUA 1H6XA 3AX4A 5E8AA 1JHNA 2QQNA 5FMBA 4CEYA 1YXWA 2KXLA 3BPZA 4CTEA 3LD8A 2IWGB 2DV9A 2Q1ZB 3QACA 4AEDB 4GWMA 1HJFA 1RHI1 1RUD1 1HRV3 1W2OA 2JECA 2WQ4A 4QB1A 3S7IA 4IEVA 5A3TA 3W59A 2QQMA 4NWWA 2RE9A 2VBBA 4NPMA 1LOCA 2WSUA 1LHUA 5C6CA 1PM4A 5A6QA 1QGLA 2GN7A 3ZSEA 1VBE1 1UMZA 1B09A 1X82A 3LDRA 4QM9A 4XJ8A 1ZZ8A 1XYNA 1FNYA 2E32A 5T50A 2JWPA 2LALA 2PLV3 4YW5A 3RZHA 2JICA 4XBLA 2DUQA 5F2SA 4DXZA 1DU3D 1VMJA 2GSYA 3ACFA 4JVAA 3GZEA 5F3EA 3WW4A 3B93A 3IBMA 5FQ0A 1LOAA 4PBPA 5ANQA 1KS5A 2CGPA 3ZFFA 1VE0A 2XONA 3J7HA 3VZLA 3ZXAC 4Q0SA 4OHXA 1NKGA 2N7GA 1ND3C 4PIXA 5BNPB 2BGPA 4IV1C 2ZX3A 1FXZA 3M70A 1F8VA 5AC91 5K0UA 4AGVA 2W95A 4CP9B 4INDA 4A3XA 3PNAA 4BK5A 3ME2A 2BGOA 1IPSA 4JTNA 3KV9A 1F15A 2D7FA 2WS93 4QXBA 5HV4A 4QXKA 2PA7A 4QPGB 3R4DB 1Y7BA 3ACHA 1UO9A 2FCTA 2GNTA 1I6XA 1YFWA 4N43C 3SLIA 2CL2A 4XUQA 4EN8B 3HIFA 4KBBA 3MIGA 2P1BA 4XABA 2DFCA 2X05A 1EAH1 2ZBJA 4EN0A 1DGWA 5JZGB 3KS7A 4WM7B 2VC9A 3S5AA 1O91A 3WW2A 2ZGNA 4GB31 3ZN6A 2YPDA 1WZXA 1LENA 1WD4A 3U78A 4Q0QA 2BOJA 3K4DA 4UW5A 2R061 5FMDA 2J1AA 5JVVA 2ZEYA 2JDHA 2VZRA 3A23A 1OQEA 1V6MA 2DCJA 3AP7A 3CL1A 4BMEA 4MADA 5C8CB 2EXJA 1LNSA 3MHZA 4AWDA 1U0AA 3GZUC 1AL22 3I3EA 5DZGA 4HL0A 3GNEA 2GH8A 3FFZA 5BY5A 1ULGA 5JMCA 3ACIA 3TYJA 3KSCA 1QOTA 4FPEA 3WNPA 4CCDA 2QQOA 3M3EA 4GB32 4QAWA 3WHUA 4DEVA 1OA2A 1PGSA 4Y5TA 1OQ1A 3V64A 1R081 5FP4A 2WR9A 2JD4A 3OD0A 4A45A 1VBB1 1UXXX 2UY8A 3NVCA 5FUNA 4CCNA 5K8SA 1ZBE1 1CX1A 5BYNA 1X8EA 3SH3A 2BZDA 4LE4A 3BALA 5L7OC 2IVJA 3MW4A 4ISRA 5FZ7A 5C5UA 4BM8A 3WP3A 3HR9A 1OQDA 2ZX1A 4UOJA 5GM0A 4C0BA 2D5HA 1V6KA 2AEZA 1STMA 2VQAA 2OS2A 3MF6A 3NKTA 4LA3A 3WF0A 4YARA 1IS5A 4B7KA 1IZ3A 3T08A 4MV2A 4HPKB 4CZSA 5JSRA 3VLBB 3J9SA 4YVSA 3RDIA 3HT1A 3T0DA 1I1EA 2FBEA 1WCUA 1KITA 4OUSA 2WJSA 4LK7A 1AX0A 2RM22 4PLOA 2TNFA 1TNRA 3WP5A 5FP9A 3VBFA 2DVBA 2DBIA 4GMP0 2IXJA 2R0HA 3CJIA 4D3WA 2ZX2A 1Z0HA 4YYOA 2RR11 4H55A 3SMHA 1J3RA 4XFIA 2VZVA 3KGZA 5JLVA 4UXAA 5JDBA 5JUVA 1WKYA 5GZEA 3H0OA 4IGPA 2XHKA 1BVVA 1GUIA 3OYWB 3VHNA 4MGZE 1G7YA 1D4VB 4LUKA 3CDZB 2OT7A 2GMPA 2OXBA 3I3BA 4Y5Z0 5FRAA 5J3UA 1H8VA 3AZZA 3DEMA 1QY4A 3BCWA 2HWF2 2IXIA 4L11A 3ZSJA 1VBA1 1SCRA 3IDAA 1C5HA 2WSVA 3KB5A 4AAPA 4BISA 5CAZA 4EN7B 5FPVA 5I0UA 4RL7A 4K1YA 1RVF1 1YRZA 3W21A 1W2NA 4V1PA 2K2SA 1Q8QA 3H50A 2E7AA 4PQQA 1QKQA 4LOSA 1PM7A 4PDWA 3TNQA 1A6CA 2CSGA 4CCLA 1VAMA 3KVBA 1UKGA 1ZRCA 1FMD3 1NLQA 4AF9A 3W58A 3SH5A 3N9QA 4WZFA 3MBWA 5T5JA 2DU0A 3T0AA 2ARXA 1NQDA 1ODNA 1XNCA 2RJKA 3T30A 1GP4A 1UZVA 1U12A 3S5QA 5JI7A 3C7EA 4JDNA 5L9RA 5C4WB 4QM8A 1OPMA 3A0NA 3AC0A 1AUYA 4GB33 4YM3A 2DF7A 3ZYPA 2QFEA 1HKDA 4XHXA 2HLEA 3PL0A 4K40A 5KXDA 4A7ZA 2OQ6A 4MHUA 5CG8A 3MEPA 1JZ6A 2WNOA 3NJZA 4QXCA 5FXZA 4RFT0 5A70A 3J8F1 4K20A 5AC92 3KV6A 1NOVA 2D6OX 4BYYA 1AL0G 3CEWA 3GHNA 4CEWB 4XXPA 4QKFA 1JODA 1JOPA 1J1LA 1BVP1 4K3UA 2XR4A 2GDFA 1DZRA 4AAXA 2VAUA 5HXMA 1VRBA 5C71A 4QX7A 1O59A 3LDBA 4H7LA 4XMIA 4YM2A 3CBNA 5JOZA 1W9YA 3DPRC 1JYTA 1GANA 5K4LA 3KHCA 4EYUA 4Q4Y3 3RZLA 5FO7B 4YG3A 2BVVA 2VZQA 1V6JA 2W3JA 2UWBA 5FKBA 3ROUA 1NAEA 3JU9A 4AI3A 4XQDA 5CEHA 3AP4A 1RUH1 1W2AX 1NT0A 4E4SA 1IQDC 3HNBM 1BYHA 1H8TC 3E1F1 4NAMA 4XE9A 5EPAA 5FK8A 3U1XA 4KGQA 1XC6A 4N53C 4ZU4A 5GLVA 5FZHA 4Z07A 1DDLA 5L36A 3AFGA 2C9KA 4LOTA 1JYIA 4MGKE 1W8HA 3SHRA 4N43A 3RZMA 4IE5A 4LQRA 3I2IA 3MIEA 4WVVA 3VDCA 3HOBA 5HBAA 3FC0A 1W0PA 3WCSA 4FFFA 5LK5A 4CXYA 4P9WA 2Y6LA 2YGLA 2ZGMA 3H3UA 4BQWA 2R063 2W68A 3ZPOA 1MACA 4ITCA 2QDNA 3CZUA 4XW3A 2FDJA 3HJRA 4PLMA 5IJRA 1SCSA 2WLPA 1U5IA 1AR83 1PGL2 2A3YA 5JR7B 3DGTA 2D6MA 2O1QA 3OF1A 5A3MA 4AHZA 3C2UA 1RMU3 3VD7A 1RUC2 1GNYA 4FPOB 4KG0A 4NHLA 5KHJA 5FZEA 3MIFA 4CEWA 2IFWA 4LK6A 1T2XA 3SKJE 4DB5A 5CIRA 5GZGA 4N53A 5FLHA 3V0AA 4XF4A 1R083 3POYA 3I7DA 3D0JA 4D6SA 1BBT3 3AYDA 2VVDA 1OH3A 3I54A 4CP1A 1RXGA 1S0JA 4DPNA 4UW6A 1Z7S2 3H8XA 4CDQA 4KBZA 3VBRB 1K5MC 5FYHA 3WDWA 3FL7A 5A3LA 3POEA 4WV8A 3B9CA 3PIJA 3N9MA 2R041 1VRH3 2B42B 4A6OA 1G86A 1CZTA 1C8M1 2LM3A 2OX0A 3MI8A 2VZOA 3U4SA 2WUHA 4IXLA 2SBAA 4B29A 2C4XA 4YNIA 3QBQA 3POWA 5EQUA 3FN9A 4HT1T 1MQTB 1GZWB 2NYYA 1RJ7A 5A33A 4CPBD 3LSEA 1NCRA 5A1LA 5FMCA 2Q4SA 2R32A 4XILA 5FYUA 4BIOA 4MHRA 4BWOA 1UYXA 4AVTA 5GLZA 3MUZ1 1CESA 5EJ1B 3K4ZA 3OPTA 3TEWA 2VUJA 4DNYA 1RC6A 2VCBA 3AJZA 3RJRA 3V0BA 4GULA 2EALA 2Y0OA 3THPA 4EN9B 1WLWA 3MZHA 2D6PA 4UBGA 3RGBA 1JBCA 1WW6A 3UK9A 5DDJ3 3WOGA 1OF3A 3ZXDA 1G9BA 2X53S 2G1MA 4IQPA 2W52A 1MQTC 4FQ4A 5FPXA 1BMV1 3WG3A 2P5BA 3FUQA 2H6CA 5EP9A 1UPSA 3VL8A 3KWVA 1IS6A 1HXS1 4ZXEA 3PUQA 1C1FA 2Z79A 3DXTA 4YFWA 1JZ8A 4G3YC 1GBGA 1CAVB 2PN5A 3HAGA 2BNNA 2E7TA 4DS0A 5CFCB 1GQGA 1V6OA 2VVFA 1W0OA 3THTA 2ZMKA 5FY0A 2QTWB 1RUE1 2F4PA 3UKTA 1FMD1 2E63A 5GLTA 4CU7A 5KBFA 4UFLA 2OKXA 4A3ZA 3T1LA 4RFRB 3AZVA 2H0VA 3I2HA 3IZOA 3ON7A 4NOTA 3I2JA 4AR2A 1O3SA 3ZSMA 4XF9A 4ARYA 5IAXA 1Y4WA 5BNOB 2PHUA 2ZGKA 3WR0A 4P9IA 4PI2A 5ACA3 3PHMA 3V65A 1GWMA 1OHFA 2AEYA 1NCQC 3R6SA 5IVCA 4GAZA 4M0NA 2B9UA 1QEXA 1DQ5A 4DY3A 3RI9A 1W2TA 4URAA 2YFZA 4QGMA 3RZZA 3OBTA 3S57A 4RQPA 4Y1UA 1QIQA 2L9LA 1QQP3 3H3ZA 5DZFA 1OD3A 4DMIA 5LRRA 2ET1A 3DYPA 2BNOA 4XFCA 5I8YA 1RUOA 1IKQA 2VCAA 5FBJA 3S30A 1RHI2 1RUD2 4EZ4A 1H1MA 1J83A 1N1SA 3N9NA 3LGRA 3NAPA 5LK7B 4GWNA 1L7LA 1PZ7A 1KRIA 2ZTNA 1UY2A 3MUY1 5DABA 5FR3A 1W9WA 2ZZJA 3MDPA 5T5OA 1RUG3 1AR73 4CP9A 4CCCA 1ZBE3 3KQ4B 1W2UA 3CF6E 5L7OB 2IZWA 3CZJA 3E5UA 2QE3A 4FPYA 3UESA 2VQUA 4MXWB 5LA1A 5EHDA 3KF3A 4RQPB 1K5MB 4TYSA 2MEV2 1B35B 5IK4A 1H0BA 3M2MA 3ZYIB 1HRI1 2R072 1C8M3 1CN1A 2Q8CA 5KXEA 2ZS6B 4JGYB 3CJXA 4XF1A 4A42A 2BU9A 5C4WA 5F5CA 5A3WA 4LLOA 1YFUA 4P9LA 1Y9QA 3IMMA 3ETPA 4CEWC 5BNOA 1DIWA 4GJZA 1UOFA 2Y33A 2ZGOA 1LGCA 2D40A 2VUAA 4NR1A 1GNHA 3H7JA 4IUGA 4Q1PA 3VBHB 3ZFEA 4QKDA 1EY2A 2AC1A 3FHIB 2CDPA 4ZU7A 3OGSA 3HN1A 1QNYA 3L2YA 4Q29A 1S1AA 5IVYA 1RVF2 5FZOB 5T52A 1PGW2 1XYOA 1GP5A 4DINB 1YC61 1TME2 1PVXA 3BU0A 2D97A 1SBDA 4WM7C 2WN3A 1O4TA 1XNBA 2ILMA 4FPGA 1FYUA 5F7UA 2BFUS 1YCIA 4FXGB 3CNAA 1KFXL 3H9AA 4QQHA 2TBVA 1QJEA 1LTEA 2GZWA 1RXFA 5FXVA 4AVAA 4HMZA 3EO6A 4WZCA 3VZJA 1RUJ3 1C28A 3I97A 5FTTC 1DQ2A 2A6ZA 4GWJA 1VBB3 4A7YA 4QB2A 2WFF3 3WINE 4NJ4A 1GOFA 1PMHX 1R1ZA 1DFQA 3PMEA 4LO7A 5ACA2 2XJUA 1SPPB 2LUWA 1S0IA 2ZGLA 1X8MA 3WV6A 4DUXA 3B94A 3LEIA 4QX2A 1DZQA 4LJHA 1AXZA 5FFOC 5FZOA 3ZFGA 5CISA 3AP9A 1A34A 2HYKA 3U11A 1RUF1 2W47A 1LOGA 5I93A 2PLV2 1PX3A 1BKZA 3BTZA 4DEQA 1OUSA 2JB4A 4WM7A 5JPMB 5C3OA 3GZTB 1SMVA 4YG6A 5E88A 3K3OA 2VUCA 5C8WA 1JI6A 1VRH2 2PAEA 1IS4A 3VZKA 2W1WA 5LEJA 3VZMA 4MZUA 3WNXA 4I0WB 4DIQA 3GJAA 3NNJA 5ABJC 4EROA 1ENXA 1LEMA 1HN0A 1HQWA 2BP6A 2JDNA 5T54A 5I91A 4Y1ZA 1EV11 4IEXA 2RS52 3W5NA 4LR4A 4Q4V3 3A0KA 1PZ8A 3ITQA 3LWCA 4XJWA 1YO8A 2SLIA 4AGRA 3A22A 4Z92B 4XUPA 4FPJA 1FATA 3M1HA 1IG0A 4WBBA 4V2VA 2OUJA 2HWE3 1K42A 3HT2A 4L9BA 1V6NA 1COV3 4QPWA 1VBC1 3A4UA 4HBNA 2RS12 5DPNA 2J1TA 3EB7A 4AHYA 5B4NA 1POV3 1RUG2 4BQXA 5FQ0B 2GH2A 2OVUA 3RRDA 5IFPA 1XXNA 3VDDC 1IG3A 4HKWA 4CCKA 3JXSA 4HZFA 5FZDA 4XXAA 3PUAA 4WVZA 2JE8A 3LEMA 1RUH3 4Q4W2
chains in the Genus database with same CATH topology
5IWFA 3KV9A 4E4HA 3N9MA 3PU8A 4QXBA 4CCLA 5LW9A 3KVBA 5F39A 4ASKA 2OX0A 5FJHA 3U4SA 3N9QA 5FPAA 5FY5A 2Q8CA 3ZLIA 4UF0A 5F5CA 2YU1A 5FZ8A 5A3WA 3AVRA 4D6QA 5F3IA 4GJZA 5FP7A 2OQ7A 4CUGA 5FWJA 5FZKA 5A7OA 2YU2A 5FYUA 5FY1A 4UF0B 5A7WB 5A3PA 5ISLA 4Y33A 3N9PA 3PURA 5IVFA 2YPDA 3U78A 5LWBA 4V2WA 5F37A 3OPTA 5FWEA 5FUPA 2OQ6A 5FYTA 5FXWA 5IVYA 3KVAA 5FYYA 4QXCA 5FZGA 5FZOB 5FXZA 3K2OA 2VD7A 5FV3A 5FY8A 3RVHA 2XXZA 3KV6A 4QWNA 4IGQA 3NJYA 5A7NA 2WWJA 2WWUA 2YBSA 4XDPA 2GP3A 4BU2A 2Q8EA 5FYCA 5FZ9A 3PUSA 5A80A 5FJKA 4QXHA 5A1FA 2GP5A 2P5BA 5IVJA 5FXVA 5FZLA 4LIVA 1VRBA 4QX7A 3LDBA 4C8DA 5FP4A 5E6HA 4HOOA 5FPBA 4AI9A 4EZHA 3PUQA 3DXTA 4QX8A 5FUNA 4CCNA 5K4LA 5IVEA 4EYUA 3KV4A 4CCMA 4BXFA 4LITA 3PTRB 5A7SA 5LY1A 3OPWA 5CEHA 5FZ7A 5F2WA 4CCOA 5FZOA 4GJYA 5FY4A 5A1LA 5FY0A 5FZ6A 4HONA 4TN7A 3KV5A 5FYMA 2OS2A 5FPLA 5FYBA 5FZIA 5A7QA 3UYJA 5FZ0A 5FXXA 5FZHA 4CCJA 3LD8A 3AL6A 4QU1A 4LXLA 5KR7A 4Y4RA 4GD4A 2W2IA 3K3OA 5FZFA 5A3TA 3PU3A 5LY2A 5FP9A 5IVBA 5IVCA 4GAZA 5FYSA 5FY7A 5IW0A 5FZBA 5FZ1A 5A7WA 3ZPOA 4DIQA 4URAA 5F3CA 4XDOA 5IVVA 5FPUA 4CSWA 5FZ4A 5F2SA 5F5IA 4IGPA 4LIUA 5FZAA 5FYIA 4NUBA 5FBJA 5F3EA 4EZ4A 2OT7A 5F3GA 5FZEA 2XDVA 5ANQA 3N9NA 5FZCA 5FP8A 4V2VA 5A7PA 5FZMA 3DXUA 5FYVA 3N9OA 4D6RA 5A3NA 4AAPA 2PXJA 4BISA 3AL5A 3K3NA 3N9LA 4D6SA 5FZ3A 5FP3A 5F32A 2YBPA 5FPVA 4DO0A 3AVSA 4IGOA 5FY9A 3PDQA 5FYZA 2Q8DA 4CCKA 5F5AA 5FZDA 5FYHA 3PUAA 2XMLA 4Y3OA 2YBKA 2XUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWF A;  3KV9 A;  4E4H A;  3N9M A;  3PU8 A;  4QXB A;  4CCL A;  5LW9 A;  3KVB A;  5F39 A;  4ASK A;  2OX0 A;  5FJH A;  3U4S A;  3N9Q A;  5FPA A;  5FY5 A;  2Q8C A;  3ZLI A;  4UF0 A;  5F5C A;  2YU1 A;  5FZ8 A;  5A3W A;  3AVR A;  4D6Q A;  5F3I A;  4GJZ A;  5FP7 A;  2OQ7 A;  4CUG A;  5FWJ A;  5FZK A;  5A7O A;  2YU2 A;  5FYU A;  5FY1 A;  4UF0 B;  5A7W B;  5A3P A;  5ISL A;  4Y33 A;  3N9P A;  3PUR A;  5IVF A;  2YPD A;  3U78 A;  5LWB A;  4V2W A;  5F37 A;  3OPT A;  5FWE A;  5FUP A;  2OQ6 A;  5FYT A;  5FXW A;  5IVY A;  3KVA A;  5FYY A;  4QXC A;  5FZG A;  5FZO B;  5FXZ A;  3K2O A;  2VD7 A;  5FV3 A;  5FY8 A;  3RVH A;  2XXZ A;  3KV6 A;  4QWN A;  4IGQ A;  3NJY A;  5A7N A;  2WWJ A;  2WWU A;  2YBS A;  4XDP A;  2GP3 A;  4BU2 A;  2Q8E A;  5FYC A;  5FZ9 A;  3PUS A;  5A80 A;  5FJK A;  4QXH A;  5A1F A;  2GP5 A;  2P5B A;  5IVJ A;  5FXV A;  5FZL A;  4LIV A;  1VRB A;  4QX7 A;  3LDB A;  4C8D A;  5FP4 A;  5E6H A;  4HOO A;  5FPB A;  4AI9 A;  4EZH A;  3PUQ A;  3DXT A;  4QX8 A;  5FUN A;  4CCN A;  5K4L A;  5IVE A;  4EYU A;  3KV4 A;  4CCM A;  4BXF A;  4LIT A;  3PTR B;  5A7S A;  5LY1 A;  3OPW A;  5CEH A;  5FZ7 A;  5F2W A;  4CCO A;  5FZO A;  4GJY A;  5FY4 A;  5A1L A;  5FY0 A;  5FZ6 A;  4HON A;  4TN7 A;  3KV5 A;  5FYM A;  2OS2 A;  5FPL A;  5FYB A;  5FZI A;  5A7Q A;  3UYJ A;  5FZ0 A;  5FXX A;  5FZH A;  4CCJ A;  3LD8 A;  3AL6 A;  4QU1 A;  4LXL A;  5KR7 A;  4Y4R A;  4GD4 A;  2W2I A;  3K3O A;  5FZF A;  5A3T A;  3PU3 A;  5LY2 A;  5FP9 A;  5IVB A;  5IVC A;  4GAZ A;  5FYS A;  5FY7 A;  5IW0 A;  5FZB A;  5FZ1 A;  5A7W A;  3ZPO A;  4DIQ A;  4URA A;  5F3C A;  4XDO A;  5IVV A;  5FPU A;  4CSW A;  5FZ4 A;  5F2S A;  5F5I A;  4IGP A;  4LIU A;  5FZA A;  5FYI A;  4NUB A;  5FBJ A;  5F3E A;  4EZ4 A;  2OT7 A;  5F3G A;  5FZE A;  2XDV A;  5ANQ A;  3N9N A;  5FZC A;  5FP8 A;  4V2V A;  5A7P A;  5FZM A;  3DXU A;  5FYV A;  3N9O A;  4D6R A;  5A3N A;  4AAP A;  2PXJ A;  4BIS A;  3AL5 A;  3K3N A;  3N9L A;  4D6S A;  5FZ3 A;  5FP3 A;  5F32 A;  2YBP A;  5FPV A;  4DO0 A;  3AVS A;  4IGO A;  5FY9 A;  3PDQ A;  5FYZ A;  2Q8D A;  4CCK A;  5F5A A;  5FZD A;  5FYH A;  3PUA A;  2XML A;  4Y3O A;  2YBK A;  2XUE A; 
#chains in the Genus database with same CATH topology
 1ZRE A;  3M3I A;  3T2Q A;  1FX5 A;  1W8F A;  1W8T A;  2DFB A;  2FDG A;  3LE0 A;  2YB7 A;  4CU9 A;  2R04 2;  1HRI 3;  1F5F A;  1MS9 A;  3OB8 A;  4BQY A;  3VHO A;  3NNM A;  4SBV A;  3DUI A;  3TN9 3;  1UYZ A;  2WZE A;  3KLS A;  4QPI B;  1US3 A;  1HRI 2;  1X9P A;  5HCF A;  4XFA A;  3PMS A;  4MET A;  1UX7 A;  1XQN A;  5K9Y A;  2X09 A;  4UFJ A;  5FZK A;  4U2A A;  5A7W B;  4JGZ A;  5A3P A;  2WL1 A;  2HWC 2;  3P6B A;  3PUR A;  1MZ6 A;  4BIF A;  1G8W A;  1Q5O A;  1H2M A;  1S0B A;  4HN0 A;  2ZHN A;  5FZG A;  4LBQ A;  5CA6 A;  4Y22 B;  4YZ3 A;  4KGG A;  2EIC A;  3D3A A;  3O0W A;  1MVQ A;  3T09 A;  3B9I A;  3N35 A;  5A7N A;  4O9E A;  1H8T A;  2CGN A;  1RUF 2;  1O8S A;  3HMY A;  4HET A;  1JW6 A;  3OUI A;  3ZYJ B;  4BU2 A;  2G9G A;  1BEV 3;  2A7A A;  3BTA A;  3Q8E A;  3ILF A;  4O9G A;  4BQ5 A;  3DEC A;  4OVE A;  3BVC A;  4BZ4 A;  5I8T A;  3CIH A;  2VUL A;  4QXH A;  5I0T A;  3RZG A;  3RMX A;  1LB2 A;  4JX0 A;  1CPM A;  4LIV A;  1S2E A;  1GLH A;  3VGI A;  1IKP A;  1CPN A;  2VU9 A;  4MGS A;  4YGE A;  4DQA A;  3OGR A;  1X50 A;  2ETE A;  2VTF A;  2VO5 A;  1W28 A;  1VB4 A;  4QX8 A;  3KV4 A;  2VZP A;  3H1Y A;  5CFD C;  4GH4 B;  1VBE 2;  3OTF A;  4IV3 C;  5IAT A;  4L99 A;  5KC6 A;  1JHJ A;  3QOP A;  4QX3 A;  1GMM A;  1VB2 A;  3RS6 A;  4CCO A;  1C57 A;  5LBC A;  2XUM A;  3S0M A;  1PNG A;  2D5F A;  4GMP 1;  4TN7 A;  1UZW A;  4N9I A;  4YW2 A;  5FYB A;  5FZI A;  1W3X A;  4ONU A;  3HWJ A;  4H7M A;  3AKQ A;  4XTP A;  3O7O A;  3L9J T;  4XFH A;  3RYP A;  3ZKU A;  4HLT A;  1UPI A;  2ES3 A;  2VG9 A;  1VAL A;  3SH4 A;  5A3U A;  1DLL A;  2A70 A;  3D8C A;  4LBO A;  3LOI A;  1DYO A;  3N7M A;  4HN1 A;  3H1W A;  3BUC A;  3MID A;  3LKJ A;  3ZFG C;  3AKT A;  1K3I A;  1ST8 A;  2DCZ A;  1NE4 A;  2HJI A;  5FYS A;  4S2F A;  3A21 A;  4YZ2 A;  5B2G B;  3FFQ A;  3NWK A;  3OY8 B;  5A7W A;  4AE2 A;  1JUH A;  2ZX0 A;  4Q0P A;  5IVV A;  4JQR A;  3P3P A;  4XC9 A;  1JYV A;  4CDW C;  2NN8 A;  4XF0 A;  1MS1 A;  4ATF A;  4MUV A;  5A1A A;  1UXZ A;  2QZ3 A;  2ZX4 A;  1I5Z A;  2ZJC A;  4QGN A;  3ZYF A;  4CU8 A;  2WO2 A;  2IUW A;  2V5D A;  3B69 A;  3LIH A;  5GJ6 A;  3HVD A;  4AEK A;  1JYC A;  4N53 B;  1YYN A;  3H8O A;  3FJS A;  4FOV A;  4JGY C;  3WW3 A;  2XJS A;  4RS5 C;  3V56 A;  1EUT A;  2CV6 A;  2XJQ A;  3IT8 A;  5FP3 A;  1POV 1;  2DTW A;  3PUI A;  2XG3 A;  5HCA A;  2YC4 A;  2BGC A;  2F4L A;  5FDB A;  3B00 A;  3WG4 A;  2LS6 A;  1SFP A;  3FHA A;  3HPN A;  4FOW A;  4QHZ A;  2NMO A;  2TUN A;  5IK5 A;  4BLI A;  4OHW A;  5LW9 A;  1X9T A;  3O12 A;  5IWF A;  3T2T A;  3PU8 A;  1TME 3;  4Y20 A;  2PHF A;  5CG9 A;  1RUE 3;  1V00 A;  5FJH A;  3FLP A;  1WLT A;  4M3C A;  2BOI A;  2A3X A;  4IV1 B;  4Q4W 1;  3TB0 A;  3VBU B;  3ZIW A;  4CDW A;  1OSG A;  3AB0 A;  4FT8 A;  2ZEZ A;  2Y64 A;  5FZ8 A;  1PVC 3;  4JQT A;  1LAJ A;  3EJK A;  1R09 3;  4COV A;  2JDA A;  2VM9 A;  3C7O A;  2YU2 A;  1AHS A;  3VKN A;  4UFM A;  2EVX A;  1OLM A;  4LHL A;  5J1X A;  1S2B A;  5C33 A;  2JDM A;  4KNC A;  1QJX 1;  2ZKL A;  5F37 A;  2ATF A;  5JXI A;  4W65 A;  4ZXK A;  4Y5S A;  5FXW A;  2FDI A;  2AGS A;  1D4M 3;  1ENQ A;  1ONA A;  1VIW B;  5LBE A;  4LOR A;  4WVM A;  3AMQ A;  3M4F A;  4HG6 B;  1JS9 A;  5EIY B;  1DCS A;  1YWK A;  4M3C B;  1A3K A;  3FLR A;  5C9A B;  2XVK A;  5FZ9 A;  3PUS A;  1F4H A;  3M8L A;  4IEU A;  5IVJ A;  4GQ7 A;  3NV1 A;  4PT6 A;  4CDU C;  4F8A A;  1AYM 2;  4LUM A;  4W6W A;  2ZML A;  4F3J A;  1F35 A;  1PO1 1;  5JXG A;  4IV1 A;  2R1D A;  2EXK A;  3PTR B;  1PK6 C;  1AJK A;  2K9Z A;  1WA6 X;  2ZZQ A;  1YQC A;  3HQR A;  3F2Z A;  4I02 A;  4FVV A;  4I01 A;  2JE7 A;  1I9R A;  3AKR A;  3WUD A;  2PLV 1;  2ZGQ A;  3JUU A;  2JEN A;  5LEK A;  1N47 A;  5FPL A;  5A7Q A;  2H0B A;  2PMW B;  3I2D A;  3C7F A;  2XQR A;  3H1M A;  1E5I A;  4GWI A;  4N90 A;  4AQT A;  2B9V A;  1SDW A;  3WSO A;  1HDK A;  2HWE 2;  1JXN A;  4PCR A;  4WM8 B;  2BFU L;  1UKR A;  4JDM A;  3WF1 A;  3AYE A;  1BZW A;  4PDW B;  3USU B;  2BJS A;  3O5S A;  4F83 A;  1HV1 A;  3O1R A;  3NAP C;  2W1S A;  1L7Q A;  1ND2 A;  5C9A A;  1GOH A;  1WCS A;  2F17 A;  4OZO A;  1SQ4 A;  1JU4 A;  4Q4X 2;  3DF0 A;  1CAW B;  2O14 A;  3SXW A;  1UN1 A;  3NV3 A;  4D94 A;  1E57 A;  5FZ4 A;  4AQS A;  1LCL A;  1MEC 2;  1UMI A;  4BMB A;  4NIG A;  2ZGS A;  4RR3 C;  1UY4 A;  2E51 A;  2RR1 2;  4JKM A;  4MH0 E;  1NYW A;  4YVW A;  1QH7 A;  1BK1 A;  1PGW 1;  1WME A;  2CYF A;  2Q30 A;  2XDV A;  2ZAH A;  3WDY A;  4RGG A;  2QQU A;  4I3P A;  4DZG A;  5FOJ B;  4XVH A;  3CJI C;  2QJV A;  5GZD A;  4EE2 A;  4FCA A;  1OF4 A;  1OUX A;  3EMR A;  1D0H A;  3MFA A;  3I3M A;  2DTY A;  4PI0 A;  1OOP A;  4YLZ A;  3FBY A;  5C5T A;  4DO0 A;  3AVS A;  3III A;  2V73 A;  3FE5 A;  3KHB A;  2TEP A;  4MGQ A;  1OC1 A;  2VXR A;  2D6K A;  4GH4 C;  4IV3 B;  5F5Q A;  4QQO A;  4YFZ A;  3VBH A;  2A6X A;  1S4C A;  4TSV A;  4LLF A;  1AL2 1;  1AR8 1;  1QJX 2;  2G4I A;  1TG7 A;  2W91 A;  2VOW A;  5DAW A;  3WDU A;  2FMY A;  2VW2 A;  1RMU 1;  5D8A B;  2ZAC A;  3PJQ A;  4COZ A;  1O6U A;  3J7L A;  4JGY A;  4JGZ B;  5IFT A;  2HEY F;  1OLQ A;  3RWN A;  4AFB A;  4BPZ A;  4A41 A;  5F9T A;  1Q56 A;  1C4R A;  2HH9 A;  4OUM A;  3U07 A;  4BXS V;  4CUG A;  5A3O A;  2DVG A;  5FY1 A;  4COU A;  1S0F A;  2WNU B;  4HSL A;  5T55 A;  2VPV A;  4CUA A;  4NID A;  1WBF A;  3OGG A;  4ARX A;  1QJY 3;  3I2G A;  1N1T A;  5FUP A;  2Q1M A;  5FYT A;  3OPZ A;  1ZA7 A;  2WS9 1;  3ZN4 A;  5L9B A;  4BQ4 A;  3VKF C;  3ZSK A;  2I07 B;  3VD9 A;  2A3W A;  5JCT A;  1KXG A;  3O0X A;  4GAL A;  2IXK A;  4NRQ A;  4IEY A;  4P5H A;  2OUH A;  1D7P M;  1REF A;  4MOA A;  1WUV A;  1OVP A;  5GZF A;  1YHF A;  4MXV A;  4NIH A;  4E4Z A;  4HKO A;  2VZ1 A;  1OXC A;  3DYO A;  1FPN 2;  4B4R A;  4EZH A;  1Q8S A;  1UW8 A;  3CO2 A;  2OZJ A;  2ZAA A;  1LJ7 A;  2XBO 3;  4BLJ A;  5FK7 A;  1ZBA 1;  3KZ4 C;  3IPV B;  4GA9 A;  1V9U 1;  2VBP A;  3P5B A;  2HWB 1;  3VUO A;  3RMY A;  1I3H A;  4CA9 A;  4TWT A;  3LZZ A;  5F2W A;  1O8P A;  4LBK A;  1DBN A;  2R6Q A;  4R4Z A;  2EXI A;  3WF2 A;  1Q3E A;  3JB8 A;  3DPR B;  4Q4X 3;  5FO8 B;  1QQP 2;  1UYY A;  2EXH A;  3B7M A;  5D8A A;  4J6G A;  4JHT A;  1FNZ A;  4QU1 A;  1AXK A;  4QPG A;  2PHL A;  5BXX A;  3I59 A;  3UKV A;  5F6L B;  2WZ8 A;  4NHM A;  4ZS2 A;  3MLJ A;  2WIN B;  1NLR A;  4XBQ A;  2YYO A;  1DGR N;  3ZDS A;  1GZW A;  4YG0 A;  2PHW A;  4XJ9 A;  1PO2 1;  1U5Z A;  1VBD 2;  3PU3 A;  2XGX A;  4RD7 A;  4XUO A;  4P5Y A;  5DAX A;  1VR3 A;  4LEJ A;  5IW0 A;  2EF6 A;  2GC1 A;  1ZRF A;  1ND3 A;  1UCX A;  1XSR A;  1RIR A;  2PHR A;  3HNY M;  2P6C A;  3WP4 A;  1J84 A;  2VMF A;  4QDR A;  4HVO A;  2I45 A;  1ZBE 2;  2P34 A;  3E6C C;  2H6B A;  3IAP A;  5H9R A;  2XJR A;  3H7Y A;  4A7K A;  2OPW A;  1V6L A;  3ES1 A;  1SBF A;  4D7T A;  5G04 L;  2QQI A;  5GZC A;  4LIU A;  5ANN A;  2FZ1 A;  3P3N A;  3ELN A;  2P17 A;  4LHN A;  2CWS A;  4WVW A;  4AED C;  3LA7 A;  3ZIX A;  3LFM A;  4XUN A;  2IXH A;  3WNO A;  3K77 A;  4BE3 A;  2CDO A;  4CDQ C;  1W90 A;  1VBC 3;  2FZ2 A;  1GP6 A;  2JG8 B;  2PXJ A;  5GAL A;  4FQZ A;  3D4K A;  1A78 A;  1CAU A;  3K3N A;  3SCF A;  1SEF A;  2RM2 3;  2HEV F;  1LGB A;  1MZ5 A;  2YBP A;  4KH9 A;  3J4U H;  3I2O A;  4EWD A;  4OI2 A;  2VMG A;  4O65 A;  4OHZ A;  1DG6 A;  1XNA A;  2QQL A;  3Q9O A;  4M4R A;  3NV2 A;  1CR7 A;  1Z78 A;  3FX3 A;  2OPK A;  2WZP P;  1LOD A;  3VN4 A;  4ZON A;  5HI0 A;  3WF4 A;  3DKQ A;  3ST7 A;  4Y24 A;  5FPA A;  1R1A 3;  2ZHK A;  3MLK A;  4F7Z A;  3M7A A;  1GV9 A;  4RGK A;  1IOA A;  4UFK A;  3Q8C A;  3OJB A;  2FDH A;  1OT5 A;  2VL4 A;  1ENR A;  2JG8 A;  1OOP C;  3V0A B;  2IXC A;  1OLR A;  1MEC 1;  2QBX A;  1UD1 A;  1VMF A;  3E97 A;  3KF5 A;  1W39 A;  2D43 A;  2WAB A;  3LOB A;  4JRL A;  3ZO0 B;  1KJL A;  1N1Y A;  1S0E A;  3H8U A;  3WCR A;  2DUR A;  1JYX A;  4LMF A;  1UIK A;  3VBH C;  1ZM1 A;  1WGP A;  5A33 B;  3W5M A;  2WWJ A;  3I4I A;  2B8M A;  2C26 A;  2C5D A;  1RL3 A;  2CY6 A;  1BEV 1;  1TMF 2;  3MO4 A;  5D2A A;  1XPW A;  2YFU A;  5T3N A;  5KXB A;  4FFI A;  5J96 B;  4FPC A;  1PX4 A;  2AZ5 A;  2Z42 A;  4YVS C;  1RHI 3;  1C3H A;  1RUD 3;  2VW1 A;  1TMF 3;  5DAP A;  3UGF A;  4C8D A;  1WMX A;  3VBR A;  1SLC A;  2DWR A;  3D6E A;  3VBO B;  5ABJ A;  3FZ3 A;  2LW8 A;  2V5Y A;  1XND A;  2XLA A;  4Y1V A;  1H4H A;  5EJ3 A;  4CE8 A;  3OUH A;  2B5H A;  2B39 A;  1H2L A;  1V9U 3;  4Q0V A;  1H9P A;  1QDO A;  1UWW A;  4XIK A;  4MX3 A;  1AL2 3;  2VMC A;  4LBM A;  5LAT A;  3BI3 A;  4S2D A;  3HBZ A;  1NUK A;  2PQQ A;  3K75 B;  2YUE A;  4XJZ A;  2G9F A;  4Q26 A;  5FY4 A;  1RTV A;  1O3Q A;  2XPJ A;  1MQT A;  3UYJ A;  4I3G A;  3LFI A;  4XTM A;  3QD6 A;  2A6Y A;  1UU6 A;  2ZOE B;  2WNV B;  3AL6 A;  3A7Q A;  1RUJ 2;  4OFG A;  2NQY A;  1T6B X;  4LKD A;  3USU A;  1TNF A;  2RS3 3;  2KM2 A;  2RMU 3;  1MVE A;  4Q1R A;  1CZV A;  4K8R B;  5LBB A;  1OKO A;  1FT9 A;  2FCV A;  2LRP A;  2UWA A;  3MW2 A;  1VAK A;  4JZR A;  2FCU A;  2RMU 2;  2WAA A;  2WFF 1;  3C7H A;  5FZB A;  2NZ9 A;  1VP6 A;  3ZXF A;  4Z1V A;  1QJY 1;  3IDC B;  3RSJ A;  5IT6 A;  4LNV A;  4XUR A;  4NWV A;  4RHV 3;  1W99 A;  2YMZ A;  3AZX A;  4CSW A;  1M06 G;  3WT3 A;  1CAX B;  1NE6 A;  1BEV 2;  1ZZ9 A;  1UMH A;  2XVL A;  3AJY A;  3SKV A;  1VRH 1;  4CVU A;  4XFF A;  3AK0 A;  3WUC A;  4EWE A;  5FYI A;  3EYP A;  1FPN 1;  1OOP B;  2VBD A;  3NRU A;  1TZO A;  5FMO L;  4AVS A;  5FP8 A;  1W6Q A;  1O4Z A;  2K46 A;  4W6X A;  4XCB A;  4XYX A;  3AL5 A;  3EQE A;  1HRV 1;  4QB6 A;  3WXP A;  1QDC A;  3AM2 A;  1CAV A;  4EQV A;  4FAH A;  3KCC A;  2Q8O A;  1LOE A;  2J42 A;  2XB6 C;  2ZAB A;  5AFB A;  4IGO A;  2JDU A;  3ES4 A;  2WNV A;  3PDQ A;  4KMQ A;  1PO1 3;  4N7I A;  4UYB A;  2WS9 2;  3ZN5 A;  4CEY B;  4Z2A A;  5L73 A;  1L3J A;  4OYU A;  4RQP C;  2WNU A;  5G05 L;  2XML A;  2LRO A;  1AYN 3;  1ULO A;  2O8Q A;  4YPJ A;  4AVC A;  3KQR A;  4FAG A;  1S0D A;  2YXS A;  3WF3 A;  3ZOI A;  1JZ5 A;  5JZG A;  5F39 A;  1LKN A;  4RYD A;  2JKB A;  3L2H A;  4GXL A;  1MS5 A;  1DHK B;  1QJF A;  1MZE A;  2CTV A;  1VLN A;  3LCP A;  1HQL A;  1YFX A;  3PJY A;  4QHO A;  5CFD A;  2OII A;  1KS4 A;  3ETQ A;  4NE9 A;  4IEQ A;  1W9T A;  4NVP A;  2BWA A;  2XBO 2;  1GFF 2;  2A6V A;  3IKW A;  3LA2 A;  3IIA A;  4QKB A;  4AG4 A;  1FOD 1;  2EIB A;  1Q43 A;  1CJD A;  2RVA A;  4QQL A;  3K2O A;  2VD7 A;  2X5I A;  2R04 3;  5BNP A;  1W8Z A;  2V4V A;  2RG4 A;  1CON A;  1UL9 A;  3HNM A;  5M0T A;  3NAP B;  3ALQ A;  4QX0 A;  2GP3 A;  2ZMN A;  2Q8E A;  2VTX J;  3M3C A;  1C1L A;  2NLR A;  4FP2 A;  1JOB A;  4OMC A;  1M4W A;  2BNM A;  5EWS A;  3B5L B;  5FLJ A;  5BNO C;  1W6N B;  4QT6 A;  5DG2 A;  3VL9 A;  4KWU A;  4K1Z A;  1EAH 3;  1E5R A;  2NMN A;  4M00 A;  2A1X A;  1ZBA 2;  2R07 1;  1VBD 3;  3JZV A;  4MSV A;  4PLN A;  5FPB A;  3DV8 A;  2C6S A;  2CGO A;  2V4A A;  3D0S A;  2RJ2 A;  5JSO A;  3BB6 A;  2D3S A;  2UYA A;  1YUD A;  1YQ5 A;  1UX6 A;  4XHB A;  1AR9 1;  3OD4 A;  3AMM A;  4RA0 A;  4PHZ A;  5IAV A;  3G7D A;  2XOM A;  1S55 A;  2Z2S B;  4RS5 B;  5AFE A;  1QQP 1;  4BOW A;  4A6S A;  1OFS A;  1LOF A;  5DDJ 1;  2UUR A;  2VZU A;  5GKA C;  3IMN A;  5JSP A;  1W8N A;  3BPS A;  2XVG A;  5T5P A;  3SIT A;  3BN6 A;  5FXX A;  3N4M A;  1CQ9 A;  3ILR A;  3P1I A;  4E2Q A;  4LXL A;  1KD7 A;  4MLO A;  2X5I B;  4ASL A;  4XQ4 A;  1UZ0 A;  2WBK A;  4AI2 A;  1AF9 A;  4GD4 A;  1PO2 2;  5FZF A;  4LBL A;  2NPI A;  4KU8 A;  4R4X A;  3U14 A;  1H6Y A;  4AOC A;  4X8P A;  3AMP A;  4W50 A;  5IVB A;  2WZR 2;  1AR9 2;  3C7G A;  5CU1 A;  2FDF A;  4I30 A;  3O1M A;  4X6R B;  4D7Y A;  2W9X A;  2Y60 A;  1LR5 A;  3AMN A;  3KT1 A;  3PIG A;  1JYW A;  4N8M A;  4K7J A;  2NM1 A;  2WN2 A;  1NLS A;  2WO1 A;  3ZFG B;  1UOB A;  4N9H A;  1DQ6 A;  2YC2 A;  4IV3 A;  3QH7 A;  5F5I A;  3O1S A;  1RUC 3;  2Y8K A;  4OUE A;  5CAD A;  1ZRR A;  4NUB A;  4NMI A;  3ORJ A;  5F3G A;  3INA A;  1WMF A;  3TOJ A;  3WZ1 A;  3H3L A;  5A7P A;  1L7R A;  1ODM A;  1VPH A;  3IAQ A;  1SLL A;  3R0R A;  1SFY A;  2BRT A;  5C3Q A;  1ASJ 1;  1SDD B;  3LPG A;  1HB3 A;  2YC0 A;  1O5U A;  5FZ3 A;  3GDB A;  4QKN A;  2WO7 A;  5FYZ A;  5FY9 A;  3ACG A;  1ZVF A;  2IFR A;  1XNT A;  1K5J A;  1O4Y A;  1DGL A;  1J1T A;  1AYN 2;  2HYX A;  4Q0U A;  3VBO C;  1H2N A;  4COW A;  3WNM A;  4E4D X;  2OW4 A;  2GND A;  1LGN A;  2JB8 A;  3NO8 A;  2GAU A;  1G9F A;  2P3Y A;  2WRA A;  4BK4 A;  1QU0 A;  1ZZC A;  5K0U B;  1A8D A;  1H2K A;  2ENR A;  3DCQ A;  4OUL A;  1G9C A;  2WKK A;  4UBH A;  4QDQ A;  2AEN A;  5JR2 A;  1U5X A;  4B7E A;  2PFW A;  2UU8 A;  2WZR 1;  5EFU A;  1WLD A;  4LHK A;  2VZ3 A;  1OBN A;  5DAV A;  5A7O A;  4NAO A;  4ORF A;  4CYD A;  1QMJ A;  3N9P A;  3ZN6 B;  1EAH 2;  2WT2 A;  4B3N A;  5J37 A;  2XL7 A;  2VH9 A;  3LEK A;  4CXW A;  2VOK A;  1ENS A;  3JD7 3;  4CU6 A;  3ZXK A;  4CP0 A;  4IW3 A;  4XFG A;  1HX6 A;  4HAN A;  5FV3 A;  4U36 A;  4E27 A;  5BNN C;  2XXZ A;  1HRV 2;  2ARC A;  4BH9 A;  4XAE A;  5DDJ 2;  4M3C F;  1GYK A;  2VTX A;  4R52 A;  3E6D A;  3QLQ A;  3BGA A;  4K21 A;  3VBO A;  2QUO A;  1LES A;  4JTO A;  2GP5 A;  2GMM A;  2VJX A;  3BOP A;  5E16 A;  4AFD A;  4WVM B;  1H9W A;  4K9S A;  1PVC 1;  3HN3 A;  5CKN A;  3TEZ A;  4IEW A;  4LTA A;  1QJU 1;  4XMA A;  3ZR5 A;  1N3O A;  1DQ1 A;  3ZYR A;  4KWJ A;  5E6H A;  3VZN A;  4AYU A;  1N3P A;  5LA0 A;  4HFS A;  2R07 3;  4D0Q A;  3JBG 1;  4XEZ A;  1H8T B;  5FRE A;  1Y9G A;  1QJX 3;  4IER A;  4UFI A;  1AYN 1;  3KT7 A;  3LA3 A;  2WNE A;  1AR9 3;  4BB3 A;  3UJO A;  4XOG A;  2BBV A;  4XUT A;  3BIE A;  1QJU 2;  1LED A;  2ZXQ A;  1ZZ7 A;  2Y6G A;  2X10 A;  3AKP A;  4XZP A;  4A2U A;  4AHW A;  5EYY A;  2WYS A;  3NNG A;  3ACL A;  1RUJ 1;  3DKW A;  4Y4R A;  3AMH A;  5C9A C;  2W2I A;  5JAX A;  1PO2 3;  1LHN A;  2QNK A;  1UOJ A;  1UOG A;  3SCG A;  1CWP A;  3TN9 2;  2BV4 A;  3AYA A;  4YWA A;  1DF0 A;  1XRU A;  2P2K A;  5FCC A;  2JEM A;  3O1U A;  1ZZB A;  1FAY A;  2VVE A;  2AR6 A;  2HBU A;  3LQC A;  4O7X A;  4YZ4 A;  1D4M 2;  4CP2 A;  3U10 A;  1SLT A;  3VBF B;  4LA2 A;  4P14 A;  2Y6F A;  1NY7 1;  2XJP A;  4IE7 A;  2X29 A;  4WM8 A;  4XPV A;  3SEP A;  1TMF 1;  1VBD 1;  2GNB A;  1IPK A;  5KHI A;  3IM0 A;  2JDZ A;  4Q27 A;  4AHX A;  4NN0 A;  3T4H B;  4BHP A;  4DXR A;  4OMD A;  1WLC A;  1LHW A;  2YDE A;  1JH5 A;  1KQR A;  1YIF A;  2ZGP A;  3K4A A;  4QPY A;  3RJ2 X;  3NJX A;  3ABZ A;  4JHZ A;  4L8Q A;  3WNN A;  3FUO A;  5DUU A;  2ZGU A;  4CEY C;  4ZZ5 A;  2A6W A;  1TE1 B;  1UYP A;  2W92 A;  3BIW E;  4Q4V 2;  4UT5 A;  1UF2 C;  2VQ0 A;  1J3Q A;  1GZC A;  3GAL A;  3O14 A;  4ASK A;  2Q5T A;  4FPH A;  1J59 A;  1LOF C;  2E33 A;  3OGJ A;  4PBO A;  3BTY A;  5JMO A;  2B46 X;  3SQO A;  2B7Y A;  1ZX5 A;  1RIN A;  1C8N A;  2C1F A;  2ADE A;  3E6B A;  1HXS 3;  2W08 A;  2Y6K A;  5C8C C;  5FWJ A;  3VKL A;  2HBT A;  4XJA A;  1XB9 A;  1W6P B;  2QVS B;  4AGG A;  1D2Q A;  2X8K A;  4PJY A;  5L9V A;  4LO4 B;  1NZI A;  1OFN A;  4FOY A;  2ZHL A;  5FWE A;  5ABJ B;  5BV6 A;  4URT A;  2VCM A;  5J09 A;  1FOD 2;  4XCA A;  4OI1 A;  5SV8 A;  1DZT A;  1IGO A;  1TVG A;  3ZYB A;  2VZT A;  4KWK A;  1Q8P A;  1SPP A;  4BJ0 A;  1RUC 1;  1YQ6 A;  3RNS A;  4LBJ A;  3J7M A;  4QMA A;  2JG9 B;  1HIX A;  5K0U C;  2CNA A;  1NA1 C;  4KI5 M;  1CGP A;  5A1F A;  3OUJ A;  2EID A;  4Q8K A;  1FV3 A;  4FP3 A;  1ASJ 3;  2WNV C;  1XSQ A;  2VOT A;  1CAW A;  5FUI A;  3ZFF B;  3RFR A;  3FBM A;  1W06 A;  1PIV 1;  2RS5 1;  1WD3 A;  3PVE A;  4CCM A;  4YM0 A;  1W6P A;  2VY0 A;  1NCR C;  1GKB A;  3RWK X;  5BNN A;  5TSW A;  2QQP A;  4AXO A;  1UNB A;  1W04 A;  3D82 A;  1CAX A;  4UFH A;  4ES9 A;  2WYF A;  2DVF A;  2E6V A;  2O8O A;  4UW4 A;  3OBR A;  1NCR B;  3ENR A;  3OCP A;  3Q8B A;  4HON A;  1IHM A;  2BQP A;  4XDQ A;  4C1X A;  1JZ4 A;  3T0B A;  1YJK A;  4OQ9 A;  3TN9 1;  5FZ0 A;  4DRV A;  1JUI A;  2YPJ A;  4YGC A;  5KHH A;  1PGL 1;  2R30 A;  3SNM A;  4ZS3 A;  1GQH A;  1CD3 G;  3RZJ A;  1LOB A;  3ILN A;  1NZC A;  4MGI E;  4NHX A;  2J1V A;  4FFG A;  2DU1 A;  2VQT A;  1Q8V A;  1RGS A;  2ZEW A;  1W6Q B;  4G9S B;  3M3O A;  3MV0 1;  2WDB A;  1BQP A;  4MO3 M;  4OHY A;  5FY7 A;  3HQX A;  3IPV A;  4HK8 A;  4G4F A;  4RN5 A;  2E53 A;  2JDK A;  4IDZ A;  3WDX A;  2QZ2 A;  1UU5 A;  2ARE A;  2XQX A;  1X33 A;  4P9G A;  4TLG A;  4GMP 3;  5F8P A;  3PUH A;  4WM8 C;  4FTS A;  2WNU C;  2W46 A;  4GKY A;  4Q4X 1;  5HXV A;  1NX9 A;  4YW1 A;  1CZS A;  2MNG A;  3KT4 A;  4QPI C;  4N7U A;  5J48 A;  2ZHM A;  1SAC A;  3WP6 A;  4D7S A;  4YRD A;  1J58 A;  3DXU A;  3MFC A;  3N9O A;  1GNZ A;  3GCW A;  1QOS A;  1QHD A;  2VZS A;  1E5S A;  4N43 B;  5D8A C;  2Y34 A;  3MGU A;  5F32 A;  5FIX A;  4AQ6 A;  5I0D A;  3RG0 A;  3ZVX A;  2ADD A;  1RUI 2;  2PYT A;  4LPL A;  2E7Q A;  3NL1 A;  1B35 C;  3ZXL A;  4FPK A;  1MPX A;  3HQU A;  1HW5 A;  1QXR A;  4QX1 A;  3T2P A;  2ZGT A;  1UIJ A;  1UZZ A;  2GC2 A;  3U37 A;  2QQJ A;  2P6H A;  4ISQ A;  2D3P A;  4Y1X A;  1P8J A;  2GN3 A;  3B3Q E;  4O61 A;  4CDX B;  4DXT A;  1JYN A;  2Y0I A;  1XU2 A;  1JZ2 A;  2BEO A;  4IET A;  2B4K A;  2G9Z A;  4M4P A;  1UY1 A;  2VMD A;  4QQP A;  4TXW A;  2P37 A;  4Q5O A;  4XFB A;  3UT0 A;  1W6M B;  5FO9 B;  2FMD A;  1GU3 A;  1WBL A;  3AZY A;  5F6K A;  3VBF C;  4ASM B;  5F3I A;  5FKC A;  1HXS 2;  5IK7 A;  5IYY A;  1JTZ X;  4FFH A;  4Y26 A;  2VOV A;  1RUG 1;  1RVF 3;  4AFA A;  4GH4 A;  4HVQ A;  2WLQ A;  2WA3 A;  1RB8 G;  5LWB A;  4V2W A;  2J22 A;  3RQ0 A;  2VNG A;  4XF3 A;  5LCW L;  1ACC A;  1DGW X;  1VMH A;  3KCY A;  5FYY A;  3UGH A;  2VW0 A;  2OA2 A;  1DGR A;  5DUW A;  2DCY A;  4LBQ B;  3MV1 1;  4DFS A;  5F1R A;  1MR5 A;  2O0O A;  1W8W A;  2ZA9 A;  5FY8 A;  3RVH A;  3E5X A;  5JIU A;  3WX5 A;  2VMI A;  2VME A;  1V70 A;  2R1B A;  4IE6 A;  3LF7 A;  3MW3 A;  4LKE A;  3ZXG A;  3Q8A A;  4GZ9 A;  2XLG A;  3LIG A;  4R9D A;  3EHK A;  2WQ8 A;  5A80 A;  4LO6 B;  5FJK A;  3R4S A;  1Y3T A;  2EIG A;  1R09 1;  4ZKT B;  2DVA A;  1T6G C;  2GAL A;  3OGV A;  1GZ9 A;  3I2F A;  3I49 A;  2RS1 1;  1ALY A;  2W94 A;  3CLP A;  3BYW A;  1AR6 3;  4MYE A;  1VBC 2;  4NRP A;  1YJL A;  3AP5 A;  1PZ9 A;  4HXC A;  5SV5 A;  2P3K A;  5LAS A;  1VBE 3;  3UET A;  4UI9 L;  3WNK A;  3POJ A;  4AFC A;  1G6N A;  5CFC C;  3POF A;  3J8F 3;  1O7F A;  5A32 A;  5H9Q A;  5JPN B;  2C0Z A;  3CJI B;  2ERF A;  3MYX A;  1NG0 A;  2JKX A;  3MLL A;  4NIA A;  3ZFE B;  5JOW A;  3N7K A;  4ZZ8 A;  3VB9 A;  1D2S A;  4YVW C;  2WC2 A;  4QU2 A;  2HWE 1;  5CKM A;  2Y6H A;  2D98 A;  5C70 A;  2WT0 A;  5GLW A;  1DYK A;  3VD5 A;  4BA6 A;  4CDW B;  5AC9 3;  2IC1 A;  1BBT 2;  4P02 B;  4Q4Y 1;  1XJA A;  4R9B A;  5LY2 A;  2DBN A;  1TQ5 A;  2I74 A;  3K46 A;  5FZ1 A;  4ATE A;  4KWL A;  2BYV E;  4Y20 B;  5F3C A;  3BOW A;  5GLU A;  3N36 A;  3QCW A;  1PO1 2;  3X29 B;  3ZM8 A;  1SZB A;  2YV8 A;  5DMY A;  4TLF A;  3AYC A;  4PDW C;  3E5Q A;  4CDU A;  4QD2 A;  1IS3 A;  3GYD A;  1ULP A;  2DVD A;  1PMJ X;  5KWR A;  4X6Q B;  3CU7 A;  4AL9 A;  3DPR A;  2MEV 1;  3GJB A;  3THD A;  1NQJ A;  3ZMO A;  3T3Y A;  4YVW B;  4LBQ D;  5J36 A;  3ASI A;  4YW6 A;  4KL1 A;  1W05 A;  3UV9 A;  1BLZ A;  3DYM A;  3LEG A;  1H30 A;  4EN6 B;  5KXC A;  2RS3 1;  3MF9 A;  5FZM A;  3RZK A;  2RMU 1;  4Y22 A;  2D44 A;  4KU7 A;  3FLT A;  2WQZ C;  3AXD A;  4JDO A;  3RYK A;  3NJV A;  2F6B A;  3VBS C;  4AI0 A;  3N7L A;  4YZ1 A;  3OEB A;  3OBA A;  1DQ4 A;  3JBG 3;  3POG A;  4ZY9 A;  3ZYH A;  5A6Y A;  2B45 X;  3KCX A;  3WD5 A;  4IES A;  4RS5 A;  4Y3O A;  2XUE A;  2HWD 3;  4FO9 A;  3JBG 2;  4JCK A;  3WHT A;  4QPI A;  3ZMN A;  2PHT A;  3QH6 A;  2CAU A;  4IEP A;  4Q4V 1;  4YVS B;  1RUH 2;  3U75 A;  3H42 B;  3ZDV A;  1NA1 B;  1XE8 A;  3FMG A;  2R06 2;  4AFM A;  2YGM A;  4FBF A;  4CCE A;  2A5Z A;  3Q8F A;  2J1S A;  1OLM E;  2FDK A;  1PIV 2;  3WQ0 A;  2JIJ A;  1COV 1;  2K0G A;  2WZR 3;  2KD7 A;  1AJO A;  2GME A;  2OQ7 A;  3GZA A;  5ISL A;  4JRA A;  1UY0 A;  2D3R A;  4UF0 B;  3THC A;  1YFY A;  4M01 A;  2C9A A;  2AUY A;  5C3P A;  1ZBA 3;  2D6N A;  3TEX A;  3TEY A;  4XJU A;  1ZYB A;  4NHY A;  3WQ7 A;  2UWC A;  1OI6 A;  2HWC 3;  2QQW A;  4FTB A;  3ECQ A;  4MXW A;  4LHS A;  1Z7S 1;  4E2G A;  2QCS B;  2VNR A;  3G6J B;  3KD4 A;  3O0V A;  4QWN A;  2VGD A;  4NPL A;  3NJY A;  2ZPX A;  4M0H A;  4EJR A;  3N3H A;  3ZR6 A;  4CRQ A;  1FV2 A;  4H3W A;  2OYZ A;  1XBF A;  3VBU C;  2W39 A;  1OUR A;  5IK8 A;  4R9A A;  4R9C A;  1BXH A;  2FD8 A;  2EAA A;  1QXP A;  3I8T A;  2XH6 A;  4IE4 A;  4LUL A;  4ZU5 A;  4SLI A;  2HEW F;  3GBW A;  2BWC A;  4AVV A;  3IWZ A;  5APA A;  3ZFE C;  3NNF A;  1PNF A;  4L97 A;  5L7O A;  1O3R A;  2A73 B;  4JAA A;  1LU1 A;  4YZ5 A;  4BXF A;  4MVT A;  4NRM A;  5DG1 A;  1KGY A;  2XWB B;  2IXL A;  2J1R A;  1QJY 2;  3OG2 A;  4EV0 A;  4YGB A;  3VDD B;  2BUK A;  5BPX A;  1ZRD A;  1D0G A;  2JDP A;  1WCD J;  3JB4 C;  5CFD B;  1NXM A;  5FZ6 A;  5C3S A;  4RR3 A;  5LA9 A;  2NP0 A;  2DCT A;  2WWS A;  3SEE A;  2GU9 A;  1HJG A;  4B8E A;  3H8R A;  1MS4 A;  4XQW A;  1KDM A;  5FAX A;  4AK3 A;  3WVJ A;  1UAI A;  1VBA 3;  2VUD A;  3ZX7 A;  4IE0 A;  2PAM A;  1AX1 A;  2VMH A;  3JCI A;  4BCU A;  5DAQ A;  4AQ2 A;  4NPR A;  2XBO 1;  4Q2F A;  2P3J A;  3AFK A;  4AVB A;  1VBA 2;  2AAC A;  3JD7 2;  4NO4 A;  2BBA A;  4XZU G;  4CPB A;  2WII B;  1ULD A;  2HWB 3;  3OYW A;  1N3Q A;  4QX5 A;  2YZ4 A;  5B4X A;  4Y1Y A;  2XL9 A;  3GHM A;  3PVB B;  4Q8L A;  5A6Z A;  2RDN A;  5HCH A;  4UWD A;  4L0P A;  4JKL A;  3VDA A;  3O1V A;  4OCT A;  4CUB A;  1X7N A;  4J1W A;  1PMI A;  1W0N A;  4HK9 A;  1POV 0;  2JD9 A;  2R7E B;  3LSD A;  5KHG A;  3GCX A;  3NV4 A;  2W1Q A;  3R05 A;  4Q4W 3;  3TWI A;  1FI2 A;  1UQX A;  4AW7 A;  4CXX A;  4S2H A;  1W8U A;  3HD8 B;  5FZC A;  4FTE A;  3UL2 A;  5J7M A;  3PTY A;  4QHB A;  4PQ9 A;  1W3V A;  4E9K A;  2YRO A;  5A3N A;  3ZPY A;  3J26 N;  2RS1 3;  1OVS A;  1H1A A;  1RUI 1;  3N9L A;  4M3C E;  2PHX A;  4JC1 A;  1LHV A;  1RUN A;  4DRR A;  1YLL A;  4L92 A;  4P9X A;  5FPZ A;  1PIV 3;  1OMI A;  4BDV B;  2Q8D A;  3W9A A;  3ZYG A;  4PIY A;  3VZO A;  1BMV 2;  2WA4 A;  4LKF A;  3IDB B;  2XLF A;  2GC3 A;  2YBK A;  2ZEX A;  4D8M A;  4E4H A;  2MPF A;  1HB2 A;  4FPL A;  1SLB A;  3ZFF C;  1W6M A;  2Y38 A;  1GQP A;  2YG0 A;  4Z2W A;  5CFC A;  3SC7 X;  4W6Y A;  1AR6 2;  1VAV A;  1JMU B;  2UYB A;  2PTM A;  4A4A A;  1F2N A;  4S2G A;  3CHX A;  5L19 A;  3S6P A;  2E9Q A;  2YU1 A;  3AVR A;  3I3Q A;  4IEZ A;  4QGL A;  2Q0A A;  1AX2 A;  1EP0 A;  2RJL A;  5FP7 A;  2XKO A;  3C8X A;  1AR7 1;  1X36 A;  5HCB A;  4TTG A;  1PVC 2;  3NNL A;  1EYB A;  1KJR A;  5DUV A;  3USS A;  4B1L A;  5I0S A;  3VV1 A;  2LTN A;  4GIQ A;  2RS3 2;  5LA2 A;  3J7N A;  3WQ1 A;  2KR2 A;  5FOB B;  4E2S A;  3I2K A;  5DQ0 A;  3KGL A;  2EIE A;  4W4Z A;  5CB7 A;  3ZXJ A;  4AEJ A;  4XAC A;  1US2 A;  3S7E A;  1YQ2 A;  1TME 1;  2Z4F A;  1RUF 3;  1R1A 1;  3NKG A;  1K12 A;  3TBD A;  2P3I A;  4E8D A;  2BW8 A;  2JG9 A;  2UY9 A;  5FYC A;  2CHH A;  3MPB A;  1OPO A;  3ZKY A;  5H9S A;  2W1U A;  3NQH A;  3VD3 A;  4OI0 A;  4HOO A;  5CKQ A;  3I59 B;  2RS5 3;  4D69 A;  5IVE A;  3F95 A;  5EJZ B;  4LIT A;  3AXE A;  1RIT A;  3OBZ A;  5A7S A;  1N1V A;  3WNL A;  1HB4 A;  1H4G A;  3OPW A;  3BKZ A;  3D5O A;  4X8N A;  5FLI A;  3JD7 1;  4GJY A;  4DOU A;  1W6N A;  5AVP A;  4OZX A;  1GWK A;  2JG8 C;  1AYM 1;  1ND3 B;  1AR8 2;  1YEW A;  3JQW A;  3KV5 A;  5FYM A;  5BNP C;  1KEX A;  2DYC A;  2VNV A;  4CDQ B;  1DLC A;  2XHN A;  1FPN 3;  1APN A;  3TNP B;  1EUU A;  1CIY A;  2BDR A;  5IUQ A;  1G9A A;  1E5H A;  5A32 B;  5KR7 A;  1KDK A;  2GC0 A;  4Q4Y 2;  4K8F A;  2JG9 C;  1BBT 1;  3WLU A;  3LAG A;  4AI8 A;  4AED A;  4UAP A;  4XET A;  2ORX A;  2XJV A;  3MIB A;  1WW5 A;  1XU1 A;  4BQ3 A;  3WG1 A;  5DXD A;  4LBN A;  1DP0 A;  1URX A;  2HWB 2;  2WFP A;  3GBG A;  4EWA A;  1F9K A;  5BUV A;  3WY6 A;  1V9U 2;  3CKH A;  1EPW A;  4GKX A;  4PF1 A;  4ZPI A;  4XDO A;  3FHQ A;  3K51 A;  4COY A;  5LRS A;  1CAU B;  2CAV A;  3W20 A;  1Z7S 3;  2RR1 3;  3R4U A;  2ZCW A;  3SCH A;  4HSJ A;  4R8H A;  5DZE A;  1POQ A;  4DY5 A;  1VBB 2;  2ORZ A;  5FZA A;  2ID4 A;  2X5I C;  5DN2 A;  5C4W C;  4LT5 A;  1CVN A;  1OKQ A;  4ET7 A;  2D6L X;  3I3D A;  3NW4 A;  5JI9 A;  4OHV A;  1NXD 1;  1OD5 A;  1CJP A;  3OOX A;  4CDX A;  3OEA A;  3VD4 A;  4YW7 A;  1GSL A;  1UU4 A;  1ZZ6 A;  3GF6 A;  4Y4Y A;  1JOJ A;  5FYV A;  1OH4 A;  1ZRI A;  3O1O A;  4DUW A;  1JZ7 A;  4YM1 A;  3V0B B;  3EXU A;  4YGD A;  4DUV A;  3KMH A;  2QQK A;  4H14 A;  5BNQ A;  1R09 2;  2QKD A;  4ZHN A;  2Y26 A;  3CQO A;  1SHW B;  3K48 A;  4JKK A;  5F5A A;  1BCX A;  1BHG A;  4B4P A;  3NST A;  3B01 A;  5J98 B;  2DUO A;  2XWJ B;  1ULC A;  4ES8 A;  4J1X A;  2KA3 A;  2CWM A;  1RUE 2;  2W5F A;  3WG2 A;  4JV4 A;  5FY5 A;  5DUX A;  2EAK A;  2A75 A;  1UZY A;  1W6O B;  2W87 A;  4FOQ A;  1GIC A;  2VE1 A;  4UF0 A;  1ULE A;  5IHR A;  3LDK A;  4YW4 A;  1UY3 A;  1LEC A;  1OA4 A;  3MPP G;  3DL3 A;  1IQA A;  2BVB A;  3PVN A;  4HKL A;  4D6Q A;  5H9P A;  5EV7 A;  1CIW A;  2WT1 A;  1BK0 A;  2VR4 A;  3OY8 A;  4DXS A;  1F31 A;  5IVF A;  1HB1 A;  1W8O A;  4LKS A;  5JWP A;  1PHM A;  1CX4 A;  2JDY A;  5ERL A;  3TAY A;  1GR3 A;  1RJ8 A;  2HWF 1;  5CBL A;  2MHF A;  5AVA A;  5FBZ A;  3VHR A;  2J1E A;  4RSU A;  1Y9M A;  3N7J A;  3VDB A;  1WWY A;  1NA1 A;  1O5L A;  5EZW A;  1S0C A;  2DUP A;  5JXH A;  1A8M A;  4NHK A;  3M3Q A;  4A44 A;  5E1R A;  4LO5 B;  1AZD A;  1W9S A;  1S0G A;  3UKN A;  2ZKN A;  2A71 A;  3JQX A;  5D21 A;  3DN7 A;  4UW3 A;  2V09 A;  3FWE A;  1YI7 A;  5FZL A;  1O3T A;  2R49 A;  1OA3 A;  5ACA 1;  4MGY E;  5JOX A;  1RUI 3;  3VDD A;  4PF5 A;  1G9D A;  1MZF A;  2HWD 2;  1AR6 1;  2RV9 A;  2VOX A;  2XKP A;  3IN9 A;  5I8S A;  5T5L A;  3OSD A;  1C5I A;  1KFU L;  4I0A A;  1XNK A;  4Z8B A;  1R08 2;  2WO3 A;  1W6O A;  3POB A;  2Z5W A;  1W9F A;  1FOD 3;  1SFN A;  3POI A;  1HLC A;  5LY1 A;  3ATG A;  5C8C A;  3GM8 A;  4NII A;  5C7G A;  3CMG A;  4QQ2 A;  5A6X A;  2RDS A;  3VBS B;  1PK6 B;  1QOO A;  2Y6J A;  1C8M 2;  5KHK A;  2JIG A;  3WDT A;  1H1I A;  2YHJ A;  2HWD 1;  4K6B A;  4LO8 A;  2W0X A;  4I09 A;  4P9J A;  4AI1 A;  2FHR A;  1DQ0 A;  4RGA A;  1Y43 B;  3PLQ A;  2IVI B;  2J7M A;  4CCJ A;  2V72 A;  1LU2 A;  4C1W A;  2GNM A;  4CDU B;  5HV0 A;  1RED A;  1YIP A;  2ARA A;  3MIH A;  1QH6 A;  4RR3 B;  1B35 A;  2DCK A;  2G19 A;  2PQS A;  1F4A A;  2YY1 A;  2RM2 1;  4PIZ A;  1FMD 2;  3GBF A;  3AKS A;  4XBN A;  2ZGR A;  3UNP A;  2VEC A;  1QNW A;  2BPA 2;  4HPK A;  1LUL A;  3IDE A;  1SBE A;  1ND2 B;  3HEI A;  4LE3 A;  1EV1 2;  2J1U A;  2R0F A;  5BNN B;  5LZ6 A;  3WEZ A;  4MGT A;  5D1I A;  3PVO A;  4C91 A;  1S2K A;  2Q1F A;  1BJQ A;  4RHV 2;  5FPU A;  3RYR A;  1NCQ B;  3VBS A;  2JJ6 A;  2HWC 1;  4E8C A;  4OI4 A;  5CYY A;  3WW1 A;  3POS A;  3U0Z A;  2PHD A;  3GGL A;  1LRH A;  2FQP A;  2P4E A;  2RDR A;  4OQ8 A;  3B02 A;  2MEV 3;  3LB9 A;  2VCC A;  3WQB A;  5JOY A;  3SIS A;  2PEL A;  1HQN A;  5CVR A;  1MS3 A;  5K7P A;  4B4Q A;  3IB3 A;  5JZG C;  4YSF A;  3LPF A;  5E89 A;  2OZ6 A;  4J25 A;  4P9Y A;  1I5P A;  1Q8O A;  2I2S A;  4Z82 A;  2WFF 2;  5C3R A;  1XYP A;  1ZA4 A;  2VXJ A;  4D6R A;  1QF3 A;  4JGZ C;  3RI8 A;  1YNA A;  4QPG C;  3WDV A;  1F5J A;  5LBF A;  1YQ8 A;  3BTX A;  2D93 A;  1ASJ 2;  1IPJ A;  1WW7 A;  2AH2 A;  2XJT A;  2HKX A;  3ZXE A;  2ARB A;  3UJQ A;  3O1P A;  1SLI A;  3VKM A;  3BOD A;  1WMD A;  1YI9 A;  5HPO A;  4XIO A;  1U5Y A;  1NCQ A;  1R1A 2;  3VKO A;  2VNO A;  3UGG A;  1PK6 A;  3U4X A;  2QDR A;  1AYM 3;  4I2O A;  4FPF A;  3T1M A;  2RHP A;  5LB6 A;  4TZD A;  4B1M A;  4KG8 A;  1VJ2 A;  4YW3 A;  3C3V A;  5JXJ A;  3ZLI A;  1RYY A;  3NMB A;  4FXK B;  3HBK A;  4C90 A;  1ULF A;  5EYX A;  1QXJ A;  3BU7 A;  3RPQ A;  4MG2 A;  5CZK A;  2JX9 A;  1AR7 2;  3MIC A;  4H2A A;  4OLL A;  4BQ2 A;  3O1T A;  1QJU 3;  3VBU A;  5FMO S;  3EBR A;  1HN1 A;  1XE0 A;  1XE7 A;  1ZNP A;  1W03 A;  2ET7 A;  4KQ7 A;  4Y33 A;  2QQV A;  3VHP A;  2Z69 A;  4BQ1 A;  2EA7 A;  4W8J A;  2HWF 3;  1NY7 2;  3ZSL A;  3KVA A;  1MS8 A;  1WA4 A;  1GWL A;  1GZT A;  3APB A;  1WCK A;  1WCQ A;  2CU5 A;  4FSJ A;  1DYP A;  1ND2 C;  4IGQ A;  4AZZ A;  1MS0 A;  2R16 A;  2WWU A;  3J8F 2;  4IL7 A;  2YBS A;  1K45 A;  4HVR A;  4I0B A;  1QWR A;  4QDS A;  1AXY A;  4XDP A;  1V0A A;  1LHO A;  3KM5 A;  1COV 2;  1EPZ A;  2C24 A;  5EXO A;  4FI9 A;  1SG3 A;  1HV0 A;  1SLA A;  4C0H A;  4CUC A;  3URF A;  4L2N A;  1JU3 A;  5CNA A;  1AVB A;  4CDX C;  1GOG A;  2WAO A;  3T2O A;  4AI9 A;  1RMU 2;  4AEM A;  3AZW A;  5I0R A;  4P00 B;  1MEC 3;  5KC5 A;  1REE A;  1J3P A;  2RDQ A;  2BER A;  4XAA A;  1WW4 A;  3TRS B;  1JZ3 A;  3VBR C;  1XOY A;  1R64 A;  4RHV 1;  4P08 A;  4NRO A;  2E26 A;  1D4M 1;  2BTV C;  2PAK A;  1EV1 3;  2JXA A;  2E31 A;  2JE9 A;  5JIA A;  1K5M A;  1TEI A;  2AYH A;  1V6I A;  3AP6 A;  4IEO A;  1QJZ A;  1JN2 P;  2DDU A;  3T4V A;  3GXU A;  1H6X A;  3AX4 A;  5E8A A;  1JHN A;  2QQN A;  5FMB A;  4CEY A;  1YXW A;  2KXL A;  3BPZ A;  4CTE A;  3LD8 A;  2IWG B;  2DV9 A;  2Q1Z B;  3QAC A;  4AED B;  4GWM A;  1HJF A;  1RHI 1;  1RUD 1;  1HRV 3;  1W2O A;  2JEC A;  2WQ4 A;  4QB1 A;  3S7I A;  4IEV A;  5A3T A;  3W59 A;  2QQM A;  4NWW A;  2RE9 A;  2VBB A;  4NPM A;  1LOC A;  2WSU A;  1LHU A;  5C6C A;  1PM4 A;  5A6Q A;  1QGL A;  2GN7 A;  3ZSE A;  1VBE 1;  1UMZ A;  1B09 A;  1X82 A;  3LDR A;  4QM9 A;  4XJ8 A;  1ZZ8 A;  1XYN A;  1FNY A;  2E32 A;  5T50 A;  2JWP A;  2LAL A;  2PLV 3;  4YW5 A;  3RZH A;  2JIC A;  4XBL A;  2DUQ A;  5F2S A;  4DXZ A;  1DU3 D;  1VMJ A;  2GSY A;  3ACF A;  4JVA A;  3GZE A;  5F3E A;  3WW4 A;  3B93 A;  3IBM A;  5FQ0 A;  1LOA A;  4PBP A;  5ANQ A;  1KS5 A;  2CGP A;  3ZFF A;  1VE0 A;  2XON A;  3J7H A;  3VZL A;  3ZXA C;  4Q0S A;  4OHX A;  1NKG A;  2N7G A;  1ND3 C;  4PIX A;  5BNP B;  2BGP A;  4IV1 C;  2ZX3 A;  1FXZ A;  3M70 A;  1F8V A;  5AC9 1;  5K0U A;  4AGV A;  2W95 A;  4CP9 B;  4IND A;  4A3X A;  3PNA A;  4BK5 A;  3ME2 A;  2BGO A;  1IPS A;  4JTN A;  3KV9 A;  1F15 A;  2D7F A;  2WS9 3;  4QXB A;  5HV4 A;  4QXK A;  2PA7 A;  4QPG B;  3R4D B;  1Y7B A;  3ACH A;  1UO9 A;  2FCT A;  2GNT A;  1I6X A;  1YFW A;  4N43 C;  3SLI A;  2CL2 A;  4XUQ A;  4EN8 B;  3HIF A;  4KBB A;  3MIG A;  2P1B A;  4XAB A;  2DFC A;  2X05 A;  1EAH 1;  2ZBJ A;  4EN0 A;  1DGW A;  5JZG B;  3KS7 A;  4WM7 B;  2VC9 A;  3S5A A;  1O91 A;  3WW2 A;  2ZGN A;  4GB3 1;  3ZN6 A;  2YPD A;  1WZX A;  1LEN A;  1WD4 A;  3U78 A;  4Q0Q A;  2BOJ A;  3K4D A;  4UW5 A;  2R06 1;  5FMD A;  2J1A A;  5JVV A;  2ZEY A;  2JDH A;  2VZR A;  3A23 A;  1OQE A;  1V6M A;  2DCJ A;  3AP7 A;  3CL1 A;  4BME A;  4MAD A;  5C8C B;  2EXJ A;  1LNS A;  3MHZ A;  4AWD A;  1U0A A;  3GZU C;  1AL2 2;  3I3E A;  5DZG A;  4HL0 A;  3GNE A;  2GH8 A;  3FFZ A;  5BY5 A;  1ULG A;  5JMC A;  3ACI A;  3TYJ A;  3KSC A;  1QOT A;  4FPE A;  3WNP A;  4CCD A;  2QQO A;  3M3E A;  4GB3 2;  4QAW A;  3WHU A;  4DEV A;  1OA2 A;  1PGS A;  4Y5T A;  1OQ1 A;  3V64 A;  1R08 1;  5FP4 A;  2WR9 A;  2JD4 A;  3OD0 A;  4A45 A;  1VBB 1;  1UXX X;  2UY8 A;  3NVC A;  5FUN A;  4CCN A;  5K8S A;  1ZBE 1;  1CX1 A;  5BYN A;  1X8E A;  3SH3 A;  2BZD A;  4LE4 A;  3BAL A;  5L7O C;  2IVJ A;  3MW4 A;  4ISR A;  5FZ7 A;  5C5U A;  4BM8 A;  3WP3 A;  3HR9 A;  1OQD A;  2ZX1 A;  4UOJ A;  5GM0 A;  4C0B A;  2D5H A;  1V6K A;  2AEZ A;  1STM A;  2VQA A;  2OS2 A;  3MF6 A;  3NKT A;  4LA3 A;  3WF0 A;  4YAR A;  1IS5 A;  4B7K A;  1IZ3 A;  3T08 A;  4MV2 A;  4HPK B;  4CZS A;  5JSR A;  3VLB B;  3J9S A;  4YVS A;  3RDI A;  3HT1 A;  3T0D A;  1I1E A;  2FBE A;  1WCU A;  1KIT A;  4OUS A;  2WJS A;  4LK7 A;  1AX0 A;  2RM2 2;  4PLO A;  2TNF A;  1TNR A;  3WP5 A;  5FP9 A;  3VBF A;  2DVB A;  2DBI A;  4GMP 0;  2IXJ A;  2R0H A;  3CJI A;  4D3W A;  2ZX2 A;  1Z0H A;  4YYO A;  2RR1 1;  4H55 A;  3SMH A;  1J3R A;  4XFI A;  2VZV A;  3KGZ A;  5JLV A;  4UXA A;  5JDB A;  5JUV A;  1WKY A;  5GZE A;  3H0O A;  4IGP A;  2XHK A;  1BVV A;  1GUI A;  3OYW B;  3VHN A;  4MGZ E;  1G7Y A;  1D4V B;  4LUK A;  3CDZ B;  2OT7 A;  2GMP A;  2OXB A;  3I3B A;  4Y5Z 0;  5FRA A;  5J3U A;  1H8V A;  3AZZ A;  3DEM A;  1QY4 A;  3BCW A;  2HWF 2;  2IXI A;  4L11 A;  3ZSJ A;  1VBA 1;  1SCR A;  3IDA A;  1C5H A;  2WSV A;  3KB5 A;  4AAP A;  4BIS A;  5CAZ A;  4EN7 B;  5FPV A;  5I0U A;  4RL7 A;  4K1Y A;  1RVF 1;  1YRZ A;  3W21 A;  1W2N A;  4V1P A;  2K2S A;  1Q8Q A;  3H50 A;  2E7A A;  4PQQ A;  1QKQ A;  4LOS A;  1PM7 A;  4PDW A;  3TNQ A;  1A6C A;  2CSG A;  4CCL A;  1VAM A;  3KVB A;  1UKG A;  1ZRC A;  1FMD 3;  1NLQ A;  4AF9 A;  3W58 A;  3SH5 A;  3N9Q A;  4WZF A;  3MBW A;  5T5J A;  2DU0 A;  3T0A A;  2ARX A;  1NQD A;  1ODN A;  1XNC A;  2RJK A;  3T30 A;  1GP4 A;  1UZV A;  1U12 A;  3S5Q A;  5JI7 A;  3C7E A;  4JDN A;  5L9R A;  5C4W B;  4QM8 A;  1OPM A;  3A0N A;  3AC0 A;  1AUY A;  4GB3 3;  4YM3 A;  2DF7 A;  3ZYP A;  2QFE A;  1HKD A;  4XHX A;  2HLE A;  3PL0 A;  4K40 A;  5KXD A;  4A7Z A;  2OQ6 A;  4MHU A;  5CG8 A;  3MEP A;  1JZ6 A;  2WNO A;  3NJZ A;  4QXC A;  5FXZ A;  4RFT 0;  5A70 A;  3J8F 1;  4K20 A;  5AC9 2;  3KV6 A;  1NOV A;  2D6O X;  4BYY A;  1AL0 G;  3CEW A;  3GHN A;  4CEW B;  4XXP A;  4QKF A;  1JOD A;  1JOP A;  1J1L A;  1BVP 1;  4K3U A;  2XR4 A;  2GDF A;  1DZR A;  4AAX A;  2VAU A;  5HXM A;  1VRB A;  5C71 A;  4QX7 A;  1O59 A;  3LDB A;  4H7L A;  4XMI A;  4YM2 A;  3CBN A;  5JOZ A;  1W9Y A;  3DPR C;  1JYT A;  1GAN A;  5K4L A;  3KHC A;  4EYU A;  4Q4Y 3;  3RZL A;  5FO7 B;  4YG3 A;  2BVV A;  2VZQ A;  1V6J A;  2W3J A;  2UWB A;  5FKB A;  3ROU A;  1NAE A;  3JU9 A;  4AI3 A;  4XQD A;  5CEH A;  3AP4 A;  1RUH 1;  1W2A X;  1NT0 A;  4E4S A;  1IQD C;  3HNB M;  1BYH A;  1H8T C;  3E1F 1;  4NAM A;  4XE9 A;  5EPA A;  5FK8 A;  3U1X A;  4KGQ A;  1XC6 A;  4N53 C;  4ZU4 A;  5GLV A;  5FZH A;  4Z07 A;  1DDL A;  5L36 A;  3AFG A;  2C9K A;  4LOT A;  1JYI A;  4MGK E;  1W8H A;  3SHR A;  4N43 A;  3RZM A;  4IE5 A;  4LQR A;  3I2I A;  3MIE A;  4WVV A;  3VDC A;  3HOB A;  5HBA A;  3FC0 A;  1W0P A;  3WCS A;  4FFF A;  5LK5 A;  4CXY A;  4P9W A;  2Y6L A;  2YGL A;  2ZGM A;  3H3U A;  4BQW A;  2R06 3;  2W68 A;  3ZPO A;  1MAC A;  4ITC A;  2QDN A;  3CZU A;  4XW3 A;  2FDJ A;  3HJR A;  4PLM A;  5IJR A;  1SCS A;  2WLP A;  1U5I A;  1AR8 3;  1PGL 2;  2A3Y A;  5JR7 B;  3DGT A;  2D6M A;  2O1Q A;  3OF1 A;  5A3M A;  4AHZ A;  3C2U A;  1RMU 3;  3VD7 A;  1RUC 2;  1GNY A;  4FPO B;  4KG0 A;  4NHL A;  5KHJ A;  5FZE A;  3MIF A;  4CEW A;  2IFW A;  4LK6 A;  1T2X A;  3SKJ E;  4DB5 A;  5CIR A;  5GZG A;  4N53 A;  5FLH A;  3V0A A;  4XF4 A;  1R08 3;  3POY A;  3I7D A;  3D0J A;  4D6S A;  1BBT 3;  3AYD A;  2VVD A;  1OH3 A;  3I54 A;  4CP1 A;  1RXG A;  1S0J A;  4DPN A;  4UW6 A;  1Z7S 2;  3H8X A;  4CDQ A;  4KBZ A;  3VBR B;  1K5M C;  5FYH A;  3WDW A;  3FL7 A;  5A3L A;  3POE A;  4WV8 A;  3B9C A;  3PIJ A;  3N9M A;  2R04 1;  1VRH 3;  2B42 B;  4A6O A;  1G86 A;  1CZT A;  1C8M 1;  2LM3 A;  2OX0 A;  3MI8 A;  2VZO A;  3U4S A;  2WUH A;  4IXL A;  2SBA A;  4B29 A;  2C4X A;  4YNI A;  3QBQ A;  3POW A;  5EQU A;  3FN9 A;  4HT1 T;  1MQT B;  1GZW B;  2NYY A;  1RJ7 A;  5A33 A;  4CPB D;  3LSE A;  1NCR A;  5A1L A;  5FMC A;  2Q4S A;  2R32 A;  4XIL A;  5FYU A;  4BIO A;  4MHR A;  4BWO A;  1UYX A;  4AVT A;  5GLZ A;  3MUZ 1;  1CES A;  5EJ1 B;  3K4Z A;  3OPT A;  3TEW A;  2VUJ A;  4DNY A;  1RC6 A;  2VCB A;  3AJZ A;  3RJR A;  3V0B A;  4GUL A;  2EAL A;  2Y0O A;  3THP A;  4EN9 B;  1WLW A;  3MZH A;  2D6P A;  4UBG A;  3RGB A;  1JBC A;  1WW6 A;  3UK9 A;  5DDJ 3;  3WOG A;  1OF3 A;  3ZXD A;  1G9B A;  2X53 S;  2G1M A;  4IQP A;  2W52 A;  1MQT C;  4FQ4 A;  5FPX A;  1BMV 1;  3WG3 A;  2P5B A;  3FUQ A;  2H6C A;  5EP9 A;  1UPS A;  3VL8 A;  3KWV A;  1IS6 A;  1HXS 1;  4ZXE A;  3PUQ A;  1C1F A;  2Z79 A;  3DXT A;  4YFW A;  1JZ8 A;  4G3Y C;  1GBG A;  1CAV B;  2PN5 A;  3HAG A;  2BNN A;  2E7T A;  4DS0 A;  5CFC B;  1GQG A;  1V6O A;  2VVF A;  1W0O A;  3THT A;  2ZMK A;  5FY0 A;  2QTW B;  1RUE 1;  2F4P A;  3UKT A;  1FMD 1;  2E63 A;  5GLT A;  4CU7 A;  5KBF A;  4UFL A;  2OKX A;  4A3Z A;  3T1L A;  4RFR B;  3AZV A;  2H0V A;  3I2H A;  3IZO A;  3ON7 A;  4NOT A;  3I2J A;  4AR2 A;  1O3S A;  3ZSM A;  4XF9 A;  4ARY A;  5IAX A;  1Y4W A;  5BNO B;  2PHU A;  2ZGK A;  3WR0 A;  4P9I A;  4PI2 A;  5ACA 3;  3PHM A;  3V65 A;  1GWM A;  1OHF A;  2AEY A;  1NCQ C;  3R6S A;  5IVC A;  4GAZ A;  4M0N A;  2B9U A;  1QEX A;  1DQ5 A;  4DY3 A;  3RI9 A;  1W2T A;  4URA A;  2YFZ A;  4QGM A;  3RZZ A;  3OBT A;  3S57 A;  4RQP A;  4Y1U A;  1QIQ A;  2L9L A;  1QQP 3;  3H3Z A;  5DZF A;  1OD3 A;  4DMI A;  5LRR A;  2ET1 A;  3DYP A;  2BNO A;  4XFC A;  5I8Y A;  1RUO A;  1IKQ A;  2VCA A;  5FBJ A;  3S30 A;  1RHI 2;  1RUD 2;  4EZ4 A;  1H1M A;  1J83 A;  1N1S A;  3N9N A;  3LGR A;  3NAP A;  5LK7 B;  4GWN A;  1L7L A;  1PZ7 A;  1KRI A;  2ZTN A;  1UY2 A;  3MUY 1;  5DAB A;  5FR3 A;  1W9W A;  2ZZJ A;  3MDP A;  5T5O A;  1RUG 3;  1AR7 3;  4CP9 A;  4CCC A;  1ZBE 3;  3KQ4 B;  1W2U A;  3CF6 E;  5L7O B;  2IZW A;  3CZJ A;  3E5U A;  2QE3 A;  4FPY A;  3UES A;  2VQU A;  4MXW B;  5LA1 A;  5EHD A;  3KF3 A;  4RQP B;  1K5M B;  4TYS A;  2MEV 2;  1B35 B;  5IK4 A;  1H0B A;  3M2M A;  3ZYI B;  1HRI 1;  2R07 2;  1C8M 3;  1CN1 A;  2Q8C A;  5KXE A;  2ZS6 B;  4JGY B;  3CJX A;  4XF1 A;  4A42 A;  2BU9 A;  5C4W A;  5F5C A;  5A3W A;  4LLO A;  1YFU A;  4P9L A;  1Y9Q A;  3IMM A;  3ETP A;  4CEW C;  5BNO A;  1DIW A;  4GJZ A;  1UOF A;  2Y33 A;  2ZGO A;  1LGC A;  2D40 A;  2VUA A;  4NR1 A;  1GNH A;  3H7J A;  4IUG A;  4Q1P A;  3VBH B;  3ZFE A;  4QKD A;  1EY2 A;  2AC1 A;  3FHI B;  2CDP A;  4ZU7 A;  3OGS A;  3HN1 A;  1QNY A;  3L2Y A;  4Q29 A;  1S1A A;  5IVY A;  1RVF 2;  5FZO B;  5T52 A;  1PGW 2;  1XYO A;  1GP5 A;  4DIN B;  1YC6 1;  1TME 2;  1PVX A;  3BU0 A;  2D97 A;  1SBD A;  4WM7 C;  2WN3 A;  1O4T A;  1XNB A;  2ILM A;  4FPG A;  1FYU A;  5F7U A;  2BFU S;  1YCI A;  4FXG B;  3CNA A;  1KFX L;  3H9A A;  4QQH A;  2TBV A;  1QJE A;  1LTE A;  2GZW A;  1RXF A;  5FXV A;  4AVA A;  4HMZ A;  3EO6 A;  4WZC A;  3VZJ A;  1RUJ 3;  1C28 A;  3I97 A;  5FTT C;  1DQ2 A;  2A6Z A;  4GWJ A;  1VBB 3;  4A7Y A;  4QB2 A;  2WFF 3;  3WIN E;  4NJ4 A;  1GOF A;  1PMH X;  1R1Z A;  1DFQ A;  3PME A;  4LO7 A;  5ACA 2;  2XJU A;  1SPP B;  2LUW A;  1S0I A;  2ZGL A;  1X8M A;  3WV6 A;  4DUX A;  3B94 A;  3LEI A;  4QX2 A;  1DZQ A;  4LJH A;  1AXZ A;  5FFO C;  5FZO A;  3ZFG A;  5CIS A;  3AP9 A;  1A34 A;  2HYK A;  3U11 A;  1RUF 1;  2W47 A;  1LOG A;  5I93 A;  2PLV 2;  1PX3 A;  1BKZ A;  3BTZ A;  4DEQ A;  1OUS A;  2JB4 A;  4WM7 A;  5JPM B;  5C3O A;  3GZT B;  1SMV A;  4YG6 A;  5E88 A;  3K3O A;  2VUC A;  5C8W A;  1JI6 A;  1VRH 2;  2PAE A;  1IS4 A;  3VZK A;  2W1W A;  5LEJ A;  3VZM A;  4MZU A;  3WNX A;  4I0W B;  4DIQ A;  3GJA A;  3NNJ A;  5ABJ C;  4ERO A;  1ENX A;  1LEM A;  1HN0 A;  1HQW A;  2BP6 A;  2JDN A;  5T54 A;  5I91 A;  4Y1Z A;  1EV1 1;  4IEX A;  2RS5 2;  3W5N A;  4LR4 A;  4Q4V 3;  3A0K A;  1PZ8 A;  3ITQ A;  3LWC A;  4XJW A;  1YO8 A;  2SLI A;  4AGR A;  3A22 A;  4Z92 B;  4XUP A;  4FPJ A;  1FAT A;  3M1H A;  1IG0 A;  4WBB A;  4V2V A;  2OUJ A;  2HWE 3;  1K42 A;  3HT2 A;  4L9B A;  1V6N A;  1COV 3;  4QPW A;  1VBC 1;  3A4U A;  4HBN A;  2RS1 2;  5DPN A;  2J1T A;  3EB7 A;  4AHY A;  5B4N A;  1POV 3;  1RUG 2;  4BQX A;  5FQ0 B;  2GH2 A;  2OVU A;  3RRD A;  5IFP A;  1XXN A;  3VDD C;  1IG3 A;  4HKW A;  4CCK A;  3JXS A;  4HZF A;  5FZD A;  4XXA A;  3PUA A;  4WVZ A;  2JE8 A;  3LEM A;  1RUH 3;  4Q4W 2; 
#chains in the Genus database with same CATH homology
 5IWF A;  3KV9 A;  4E4H A;  3N9M A;  3PU8 A;  4QXB A;  4CCL A;  5LW9 A;  3KVB A;  5F39 A;  4ASK A;  2OX0 A;  5FJH A;  3U4S A;  3N9Q A;  5FPA A;  5FY5 A;  2Q8C A;  3ZLI A;  4UF0 A;  5F5C A;  2YU1 A;  5FZ8 A;  5A3W A;  3AVR A;  4D6Q A;  5F3I A;  4GJZ A;  5FP7 A;  2OQ7 A;  4CUG A;  5FWJ A;  5FZK A;  5A7O A;  2YU2 A;  5FYU A;  5FY1 A;  4UF0 B;  5A7W B;  5A3P A;  5ISL A;  4Y33 A;  3N9P A;  3PUR A;  5IVF A;  2YPD A;  3U78 A;  5LWB A;  4V2W A;  5F37 A;  3OPT A;  5FWE A;  5FUP A;  2OQ6 A;  5FYT A;  5FXW A;  5IVY A;  3KVA A;  5FYY A;  4QXC A;  5FZG A;  5FZO B;  5FXZ A;  3K2O A;  2VD7 A;  5FV3 A;  5FY8 A;  3RVH A;  2XXZ A;  3KV6 A;  4QWN A;  4IGQ A;  3NJY A;  5A7N A;  2WWJ A;  2WWU A;  2YBS A;  4XDP A;  2GP3 A;  4BU2 A;  2Q8E A;  5FYC A;  5FZ9 A;  3PUS A;  5A80 A;  5FJK A;  4QXH A;  5A1F A;  2GP5 A;  2P5B A;  5IVJ A;  5FXV A;  5FZL A;  4LIV A;  1VRB A;  4QX7 A;  3LDB A;  4C8D A;  5FP4 A;  5E6H A;  4HOO A;  5FPB A;  4AI9 A;  4EZH A;  3PUQ A;  3DXT A;  4QX8 A;  5FUN A;  4CCN A;  5K4L A;  5IVE A;  4EYU A;  3KV4 A;  4CCM A;  4BXF A;  4LIT A;  3PTR B;  5A7S A;  5LY1 A;  3OPW A;  5CEH A;  5FZ7 A;  5F2W A;  4CCO A;  5FZO A;  4GJY A;  5FY4 A;  5A1L A;  5FY0 A;  5FZ6 A;  4HON A;  4TN7 A;  3KV5 A;  5FYM A;  2OS2 A;  5FPL A;  5FYB A;  5FZI A;  5A7Q A;  3UYJ A;  5FZ0 A;  5FXX A;  5FZH A;  4CCJ A;  3LD8 A;  3AL6 A;  4QU1 A;  4LXL A;  5KR7 A;  4Y4R A;  4GD4 A;  2W2I A;  3K3O A;  5FZF A;  5A3T A;  3PU3 A;  5LY2 A;  5FP9 A;  5IVB A;  5IVC A;  4GAZ A;  5FYS A;  5FY7 A;  5IW0 A;  5FZB A;  5FZ1 A;  5A7W A;  3ZPO A;  4DIQ A;  4URA A;  5F3C A;  4XDO A;  5IVV A;  5FPU A;  4CSW A;  5FZ4 A;  5F2S A;  5F5I A;  4IGP A;  4LIU A;  5FZA A;  5FYI A;  4NUB A;  5FBJ A;  5F3E A;  4EZ4 A;  2OT7 A;  5F3G A;  5FZE A;  2XDV A;  5ANQ A;  3N9N A;  5FZC A;  5FP8 A;  4V2V A;  5A7P A;  5FZM A;  3DXU A;  5FYV A;  3N9O A;  4D6R A;  5A3N A;  4AAP A;  2PXJ A;  4BIS A;  3AL5 A;  3K3N A;  3N9L A;  4D6S A;  5FZ3 A;  5FP3 A;  5F32 A;  2YBP A;  5FPV A;  4DO0 A;  3AVS A;  4IGO A;  5FY9 A;  3PDQ A;  5FYZ A;  2Q8D A;  4CCK A;  5F5A A;  5FZD A;  5FYH A;  3PUA A;  2XML A;  4Y3O A;  2YBK A;  2XUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...