5F3AA

Crystal structure of the bromodomain of human atad2 in complex with compound a14
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
b'SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the bromodomain of human ATAD2 in complex with Compound A14
rcsb
molecule keywords ATPase family AAA domain-containing protein 2
source organism Homo sapiens
molecule tags Transferase
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f3aA00
5FDZA 4IR6A 4YADA 5HENA 2DATA 4DONA 3U5OA 4QR5A 5DKHA 4CUTA 5FE2A 1ZS5A 5FBXA 5FG5A 4KV1A 4O76A 5E0RA 4HXNA 4PY6A 5FH7A 4YYGA 5A7CA 5DFDA 2MJVB 4O78A 4NR8A 4IOOA 4Z93A 5F3AA 5D7XA 4MR5A 5FG4A 4UIYA 5HQ5A 5C7NA 4LDFA 5LUUA 3U5PA 5DLZA 3MB4A 4TT4A 4IOQA 4UYEA 2H60A 4LYIA 5A83A 4MEOA 4MEQA 5EI4A 5LVRA 4UYFB 5FE5A 2OO1A 5C4QA 5LKUA 5LKXA 5ENHA 2KTBB 4TQNA 2F6JA 5II1A 5A5NA 3Q2EA 3UV5A 5BT4A 4A9KA 4TT2A 4LZ2A 5HRWA 3MXFA 3ZYUA 5ENCA 4HBVA 4WHUA 5LJ2A 4YYJA 4O77A 2R10A 4A9IA 4MR6A 5A5OA 3SVHA 1EQFA 3JVKA 5AMFA 2RI7A 4MR3A 5L99A 2RNWA 2G4AA 4N4FA 4BW1A 5JI8A 3UVDA 4PCEA 4LZRA 4IR3A 2RNYA 3UVYA 5F63A 3U5KA 4QSSA 3P1CA 5ETBA 3MQMA 3G0JA 5CRMA 5FE6A 4A9JA 5LJ1A 4PKLA 4QEWA 5D24A 4N4GA 3K2JA 4HXOA 4NXJA 4QEVA 4ZC9A 3UV2A 5I7YA 5F60A 5L8TA 5FE3A 3MULA 4NR6A 5LKZA 3MUKA 2L84A 2YQDA 5CUBA 5EQ1A 4J0RA 5FB0A 3SVFA 4HXSA 4WIVA 4YAXA 4O7FA 4BHWA 4N4IA 4FLPA 4OGIA 5HFQA 4ZW1A 3LQJA 5DYAA 5H85A 4NRBA 4N3WA 4ALHA 3P1FA 5D3JA 5E73A 5CFWA 5D3TA 5EWCA 5I89A 5CUCA 5LKTA 4CUSA 5BT5A 2YELA 4PS5A 5I86A 4QSPA 5EP7A 2R0SA 5TB6A 2LSPB 4BW2A 2YW5A 4NRCA 5HCLA 2E3KA 4CUUA 5D0CA 4CFLA 4O7CA 4Z6HA 5A81A 4QSRA 5D3LA 5EK9A 4NS5A 4UITA 5KTUA 4QYDA 4CUQA 4QB3A 4XY9A 5EWDA 5JWMA 4TZ2A 5D25A 4NR4A 4XYAA 3HMEA 4XUBA 5A5QA 2DVVA 5HFRA 5D3RA 3O35A 4Y03A 4YY4A 5ETDA 5F62A 4X2IA 4YBSA 5EPRA 3SVGA 4UYGA 4UIWA 4F3IA 5IGMA 3ONIA 3QZTA 3U5JA 4YYIA 5FE0A 2YYNA 3HMHA 4UYHA 3RCWA 5G4SA 3P1EA 5F61A 5ENFA 4CFKA 3UV4A 5CY9A 4C67A 5E3DA 5FFVA 2E7NA 1JSPB 5K29A 4RVRA 5A85A 5A5SA 1F68A 4UIXA 4CL9A 5CRZA 3I3JA 3G0LA 4O7BA 4XUAA 5EWWA 4IR5A 5FH8A 5HLSA 5DKCA 2WP1A 3FKMX 4QSVA 3UW9A 4MEPA 4QSXA 5CUEA 5DYCA 5FH6A 5EGUA 4QUUA 4WHWA 4BW3A 3U5MA 2YEMA 4TT6A 5ENIA 5KTXA 4HBWA 5FE1A 5IG6A 3U5NA 4E96A 4UYFA 4NYXA 4PTBA 5E74A 5I88A 5I80A 5F25A 4TU4A 4N4HA 2RS9B 5D3SA 5EWHA 2R0VA 5D3PA 4QSQA 5CTLA 5EICA 4ZQLA 5C85A 5EPBA 4NUEA 1N72A 5ENBA 4O7EA 4Q0NA 5CUGA 4A9LA 5IGNA 5FE4A 4Z1SA 5EU1A 2NXBA 4J1PA 5F36A 4O7AA 4YYDA 4QZSA 4CLBA 2D9EA 5EPSA 5D26A 5H1UA 4A9FA 3IU6A 3LJWA 5TCMA 4QSTA 5FE8A 5CQ6A 4QYLA 4XY8A 5DW1A 3NXBA 4QBMA 1X0JA 5A5PA 5D3HA 5L8UA 2OUOA 5IIDA 5E9IA 5E9YA 5HQ7A 4QR4A 4UIVA 4QSUA 5E9MA 3U5LA 4KV4A 3UVWA 4ALGA 5F2PA 2D82A 5E3GA 3O37A 5ENJA 5KO4A 1JM4B 5FG6A 4YYHA 4TYLA 4O74A 5ENEA 5HELA 5D3NA 4LYWA 5DY7A 5CQ3A 2OSSA 4LZSA 5CGPA 5C8GA 5F1HA 4NYWA 3O33A 5HEMA 5FE7A 4A9OA 3QZSA 5ENGA 5IGLA 4QNSA 5FFWA 2WP2A 4UYDA 4TS8A 2GRCA 4IR4A 3HMFA 4TTEA 5E9VA 5AMEA 4AKNA 4YK0A 4A9MA 4UIZA 5L96A 5EVAA 4C66A 3MB3A 4YABA 5CQ5A 5EV9A 5LVQA 2I7KA 4YY6A 4LRGA 5CP5A 2DWWA 5F5ZA 2L85A 4YYNA 4YBTA 5EA1A 5KTWA 4NR9A 4YC9A 3S92A 4NQNA 4A9HA 5HM0A 5CUAA 4O72A 4YH4A 4LR6A 4LYSA 5II2A 4NUDA 5FB1A 3P1DA 4CURA 5DLXA 3DAIA 5CZGA 4NR5A 5I40A 5F1LA 1E6IA 5I29A 2DKWA 5IBNA 2RO1A 4YATA 4HXLA 4QR3A 3LXJA 2RFJA 3JVMA 4J3IA 4QC3A 4NYVA 3Q2FA 5KHMA 2YEKA 4YYKA 5E7DA 5EM3A 5HRVA 4NQMA 5CU8A 4YBMA 2RNXA 4QC1A 5E9KA 4HXMA 4A9EA 5IGKA 4O75A 3UVXA 5BT3A 3JVJA 4CUPA 4Z1QA 5CQTA 3IU5A 4QEUA 3TLPA 3AADA 4A9NA 4LC2A 4YH3A 5DX4A 5DFCA 5DYXA 5HQ6A 2N9GA 5H1TA 4O71A 4HXKA 4Q0OA 5C87A 5C89A 5FE9A 5CQ7A 5ACYA 2YDWA 4IORA 5DBMA 2E7OA 3LQIA 4BW4A 4GPJA 5CQAA 4TZ8A 5H1VA 2L5EA 4NR7A 4QSWA 2I8NA 4HBXA 5DFBA 5I1QA 4MR4A 4OUFA 5FFYA 4OGJA 5I83A 3S91A 5CS8A 4KCXA 5J0DA 1WUMA 5L98A 5CQ8A 3O36A 5AD3A 4TU6A 5KU3A 3P5OA 4MENA 5EISA 4NRAA 5DYUA 5A82A 5LJ0A 4PCIA 5CPEA 5DKDA 3LQHA 2DVSA 4HXRA 2DVRA 2R0YA 5COIA 5G4RA 4O70A 5EWVA 5DW2A 4UIUA 3O34A 3DWYA 4NUCA 4QUTA 5CUDA 4J0SA 5I7XA 4Z6IA 5AD2A 5HRXA 5L97A 2FSAA 5CQ4A 4BJXA 3GG3A 3JVLA 4HXPA 4YYMA 2DVQA 4QY4A 4HBYA 3AQAA 3QZVA 5HJCA 5A5RA 1WUGA 3D7CA 2F6NA 5E9LA
chains in the Genus database with same CATH superfamily
5FDZA 4IR6A 4YADA 5HENA 2DATA 4DONA 3U5OA 4QR5A 5DKHA 4CUTA 5FE2A 1ZS5A 5FBXA 5FG5A 4KV1A 4O76A 5E0RA 4HXNA 4PY6A 5FH7A 4YYGA 5A7CA 5DFDA 2MJVB 4O78A 4NR8A 4IOOA 4Z93A 5F3AA 5D7XA 4MR5A 5FG4A 4UIYA 5HQ5A 5C7NA 4LDFA 5LUUA 3U5PA 5DLZA 3MB4A 4TT4A 4IOQA 4UYEA 2H60A 4LYIA 5A83A 4MEOA 3D1DA 4MEQA 5EI4A 5LVRA 4UYFB 5FE5A 2OO1A 5C4QA 5LKUA 5LKXA 5ENHA 2KTBB 4TQNA 2F6JA 5II1A 5A5NA 3Q2EA 3UV5A 5BT4A 4A9KA 4TT2A 4AKGA 4LZ2A 5HRWA 3MXFA 3ZYUA 5ENCA 4HBVA 4WHUA 5LJ2A 4YYJA 4O77A 2R10A 4A9IA 4MR6A 5A5OA 3SVHA 1EQFA 3JVKA 5AMFA 2RI7A 4MR3A 5L99A 2RNWA 2G4AA 4N4FA 4BW1A 5JI8A 3UVDA 4PCEA 4LZRA 4IR3A 2RNYA 3UVYA 5F63A 3U5KA 4QSSA 3P1CA 5ETBA 3MQMA 3G0JA 5CRMA 5FE6A 4A9JA 5LJ1A 4PKLA 4QEWA 4N4GA 4NXJA 3K2JA 4HXOA 4QEVA 5D24A 4ZC9A 3UV2A 2EJNA 5I7YA 5F60A 5L8TA 5FE3A 3MULA 4NR6A 5LKZA 3MUKA 2L84A 2YQDA 5CUBA 5EQ1A 4J0RA 5FB0A 3SVFA 4AKIA 4HXSA 4WIVA 4YAXA 4O7FA 4BHWA 4N4IA 4FLPA 4OGIA 5HFQA 4ZW1A 3LQJA 5DYAA 5H85A 4NRBA 4N3WA 4ALHA 3P1FA 5D3JA 5E73A 5CFWA 5D3TA 5EWCA 5I89A 5CUCA 5LKTA 4CUSA 5BT5A 2YELA 4PS5A 5I86A 4QSPA 5EP7A 2R0SA 5TB6A 2LSPB 4BW2A 2YW5A 4NRCA 5HCLA 2E3KA 4CUUA 5D0CA 4CFLA 4O7CA 4Z6HA 5A81A 4QSRA 5D3LA 5EK9A 4NS5A 4UITA 5KTUA 4QYDA 4CUQA 4QB3A 4XY9A 5EWDA 5JWMA 4TZ2A 5D25A 4NR4A 4XYAA 3HMEA 4XUBA 5A5QA 2DVVA 5HFRA 5D3RA 3O35A 4Y03A 4YY4A 5ETDA 5F62A 4X2IA 4YBSA 5EPRA 3SVGA 4UYGA 4UIWA 4F3IA 5IGMA 3ONIA 3QZTA 3U5JA 4YYIA 5FE0A 2YYNA 3HMHA 4UYHA 3RCWA 5G4SA 3P1EA 5F61A 5ENFA 4CFKA 3UV4A 5CY9A 4C67A 5E3DA 5FFVA 2E7NA 1JSPB 3VKHA 5K29A 4RVRA 5A85A 5A5SA 1F68A 4UIXA 4CL9A 5CRZA 3I3JA 3G0LA 4O7BA 4XUAA 5EWWA 4IR5A 5FH8A 5HLSA 5DKCA 2WP1A 3FKMX 4QSVA 3UW9A 4MEPA 4QSXA 5CUEA 5DYCA 5FH6A 5EGUA 4QUUA 4WHWA 4BW3A 3U5MA 2YEMA 4TT6A 5ENIA 5KTXA 4HBWA 3ERRA 5FE1A 5IG6A 3U5NA 4E96A 4UYFA 4NYXA 4PTBA 5E74A 5I88A 5I80A 5F25A 4TU4A 4N4HA 2RS9B 5D3SA 5EWHA 2R0VA 5D3PA 4QSQA 5CTLA 5EICA 4ZQLA 5C85A 4AKHA 5EPBA 4NUEA 1N72A 5ENBA 4O7EA 4Q0NA 5CUGA 4A9LA 5IGNA 5FE4A 4Z1SA 5EU1A 2NXBA 4J1PA 5F36A 4O7AA 4YYDA 4QZSA 4CLBA 2D9EA 5EPSA 5D26A 5H1UA 4A9FA 3IU6A 3LJWA 5TCMA 4QSTA 5FE8A 5CQ6A 4QYLA 4XY8A 5DW1A 3NXBA 4QBMA 1X0JA 5A5PA 5D3HA 5L8UA 2OUOA 5IIDA 5E9IA 5E9YA 5HQ7A 4QR4A 4UIVA 4QSUA 5E9MA 3U5LA 4KV4A 3UVWA 4ALGA 5F2PA 2D82A 5E3GA 3O37A 5ENJA 5KO4A 1JM4B 5FG6A 4YYHA 4TYLA 4O74A 5ENEA 5HELA 5D3NA 4LYWA 5DY7A 5CQ3A 2OSSA 4LZSA 5CGPA 5C8GA 5F1HA 4NYWA 3O33A 5HEMA 5FE7A 4A9OA 3QZSA 5ENGA 5IGLA 4QNSA 3D1BA 2WP2A 4UYDA 4TS8A 5FFWA 2GRCA 4IR4A 3HMFA 4TTEA 5E9VA 5AMEA 4AKNA 4YK0A 4A9MA 4UIZA 5L96A 5EVAA 4C66A 3MB3A 4YABA 5CQ5A 5EV9A 5LVQA 2I7KA 4YY6A 4LRGA 5CP5A 2DWWA 5F5ZA 2L85A 4YYNA 4YBTA 5EA1A 5KTWA 4NR9A 4YC9A 3S92A 4NQNA 4A9HA 5HM0A 5CUAA 4O72A 4YH4A 4LR6A 4LYSA 5II2A 4NUDA 5FB1A 3P1DA 4CURA 5DLXA 3DAIA 5CZGA 4NR5A 5I40A 5F1LA 1E6IA 5I29A 2DKWA 5IBNA 2RO1A 4YATA 4HXLA 4QR3A 3LXJA 2RFJA 3JVMA 4J3IA 4QC3A 4NYVA 3Q2FA 5KHMA 2YEKA 4YYKA 5E7DA 5EM3A 5HRVA 4NQMA 5CU8A 4YBMA 2RNXA 4QC1A 5E9KA 4HXMA 4A9EA 5IGKA 4O75A 3UVXA 5BT3A 3JVJA 1ZKRA 4CUPA 4Z1QA 5CQTA 3IU5A 4QEUA 3TLPA 3AADA 4A9NA 4LC2A 4YH3A 5DX4A 5DFCA 5DYXA 5HQ6A 2N9GA 5H1TA 4O71A 4HXKA 4Q0OA 5C87A 5C89A 5FE9A 5CQ7A 5ACYA 2YDWA 4IORA 5DBMA 2E7OA 3LQIA 4BW4A 4GPJA 5CQAA 4TZ8A 5H1VA 2L5EA 4NR7A 4QSWA 2I8NA 4HBXA 5DFBA 5I1QA 4MR4A 4OUFA 5FFYA 4OGJA 5I83A 3S91A 4AI6A 3VKGA 5CS8A 4KCXA 5J0DA 1WUMA 5L98A 5CQ8A 3O36A 5AD3A 4TU6A 1PUOA 3P5OA 4MENA 5KU3A 5EISA 4NRAA 5DYUA 5A82A 5LJ0A 4PCIA 5CPEA 5DKDA 3LQHA 2DVSA 4HXRA 2DVRA 2R0YA 5COIA 5G4RA 4O70A 5EWVA 5DW2A 4UIUA 3O34A 3DWYA 4NUCA 5CUDA 4QUTA 4J0SA 5I7XA 4Z6IA 5AD2A 5HRXA 5L97A 2FSAA 5CQ4A 4BJXA 3GG3A 3JVLA 4HXPA 4YYMA 2DVQA 4QY4A 4HBYA 3AQAA 3QZVA 5HJCA 5A5RA 1WUGA 3D7CA 2F6NA 5E9LA
chains in the Genus database with same CATH topology
5FDZA 4IR6A 4YADA 5HENA 2DATA 4DONA 3U5OA 4QR5A 5DKHA 4CUTA 5FE2A 1ZS5A 5FBXA 5FG5A 4KV1A 4O76A 5E0RA 4HXNA 4PY6A 5FH7A 4YYGA 5A7CA 5DFDA 2MJVB 4O78A 4NR8A 4IOOA 4Z93A 5F3AA 5D7XA 4MR5A 5FG4A 4UIYA 5HQ5A 5C7NA 4LDFA 5LUUA 3U5PA 5DLZA 3MB4A 4TT4A 4IOQA 4UYEA 2H60A 4LYIA 5A83A 4MEOA 4MEQA 5EI4A 5LVRA 4UYFB 5FE5A 2OO1A 5C4QA 5LKUA 5LKXA 5ENHA 2KTBB 4TQNA 2F6JA 5II1A 5A5NA 3Q2EA 3UV5A 5BT4A 4A9KA 4TT2A 4LZ2A 5HRWA 3MXFA 3ZYUA 5ENCA 4HBVA 4WHUA 5LJ2A 4YYJA 4O77A 2R10A 4A9IA 4MR6A 5A5OA 3SVHA 1EQFA 3JVKA 5AMFA 2RI7A 4MR3A 5L99A 2RNWA 2G4AA 4N4FA 4BW1A 5JI8A 3UVDA 4PCEA 4LZRA 4IR3A 2RNYA 3UVYA 5F63A 3U5KA 4QSSA 3P1CA 5ETBA 3MQMA 3G0JA 5CRMA 5FE6A 4A9JA 5LJ1A 4PKLA 4QEWA 5D24A 4N4GA 3K2JA 4HXOA 4NXJA 4QEVA 4ZC9A 3UV2A 5I7YA 5F60A 5L8TA 5FE3A 3MULA 4NR6A 5LKZA 3MUKA 2L84A 2YQDA 5CUBA 5EQ1A 4J0RA 5FB0A 3SVFA 4HXSA 4WIVA 4YAXA 4O7FA 4BHWA 4N4IA 4FLPA 4OGIA 5HFQA 4ZW1A 3LQJA 5DYAA 5H85A 4NRBA 4N3WA 4ALHA 3P1FA 5D3JA 5E73A 5CFWA 5D3TA 5EWCA 5I89A 5CUCA 5LKTA 4CUSA 5BT5A 2YELA 4PS5A 5I86A 4QSPA 5EP7A 2R0SA 5TB6A 2LSPB 4BW2A 2YW5A 4NRCA 5HCLA 2E3KA 4CUUA 5D0CA 4CFLA 4O7CA 4Z6HA 5A81A 4QSRA 5D3LA 5EK9A 4NS5A 4UITA 5KTUA 4QYDA 4CUQA 4QB3A 4XY9A 5EWDA 5JWMA 4TZ2A 5D25A 4NR4A 4XYAA 3HMEA 4XUBA 5A5QA 2DVVA 5HFRA 5D3RA 3O35A 4Y03A 4YY4A 5ETDA 5F62A 4X2IA 4YBSA 5EPRA 3SVGA 4UYGA 4UIWA 4F3IA 5IGMA 3ONIA 3QZTA 3U5JA 4YYIA 5FE0A 2YYNA 3HMHA 4UYHA 3RCWA 5G4SA 3P1EA 5F61A 5ENFA 4CFKA 3UV4A 5CY9A 4C67A 5E3DA 5FFVA 2E7NA 1JSPB 5K29A 4RVRA 5A85A 5A5SA 1F68A 4UIXA 4CL9A 5CRZA 3I3JA 3G0LA 4O7BA 4XUAA 5EWWA 4IR5A 5FH8A 5HLSA 5DKCA 2WP1A 3FKMX 4QSVA 3UW9A 4MEPA 4QSXA 5CUEA 5DYCA 5FH6A 5EGUA 4QUUA 4WHWA 4BW3A 3U5MA 2YEMA 4TT6A 5ENIA 5KTXA 4HBWA 5FE1A 5IG6A 3U5NA 4E96A 4UYFA 4NYXA 4PTBA 5E74A 5I88A 5I80A 5F25A 4TU4A 4N4HA 2RS9B 5D3SA 5EWHA 2R0VA 5D3PA 4QSQA 5CTLA 5EICA 4ZQLA 5C85A 5EPBA 4NUEA 1N72A 5ENBA 4O7EA 4Q0NA 5CUGA 4A9LA 5IGNA 5FE4A 4Z1SA 5EU1A 2NXBA 4J1PA 5F36A 4O7AA 4YYDA 4QZSA 4CLBA 2D9EA 5EPSA 5D26A 5H1UA 4A9FA 3IU6A 3LJWA 5TCMA 4QSTA 5FE8A 5CQ6A 4QYLA 4XY8A 5DW1A 3NXBA 4QBMA 1X0JA 5A5PA 5D3HA 5L8UA 2OUOA 5IIDA 5E9IA 5E9YA 5HQ7A 4QR4A 4UIVA 4QSUA 5E9MA 3U5LA 4KV4A 3UVWA 4ALGA 5F2PA 2D82A 5E3GA 3O37A 5ENJA 5KO4A 1JM4B 5FG6A 4YYHA 4TYLA 4O74A 5ENEA 5HELA 5D3NA 4LYWA 5DY7A 5CQ3A 2OSSA 4LZSA 5CGPA 5C8GA 5F1HA 4NYWA 3O33A 5HEMA 5FE7A 4A9OA 3QZSA 5ENGA 5IGLA 4QNSA 5FFWA 2WP2A 4UYDA 4TS8A 2GRCA 4IR4A 3HMFA 4TTEA 5E9VA 5AMEA 4AKNA 4YK0A 4A9MA 4UIZA 5L96A 5EVAA 4C66A 3MB3A 4YABA 5CQ5A 5EV9A 5LVQA 2I7KA 4YY6A 4LRGA 5CP5A 2DWWA 5F5ZA 2L85A 4YYNA 4YBTA 5EA1A 5KTWA 4NR9A 4YC9A 3S92A 4NQNA 4A9HA 5HM0A 5CUAA 4O72A 4YH4A 4LR6A 4LYSA 5II2A 4NUDA 5FB1A 3P1DA 4CURA 5DLXA 3DAIA 5CZGA 4NR5A 5I40A 5F1LA 1E6IA 5I29A 2DKWA 5IBNA 2RO1A 4YATA 4HXLA 4QR3A 3LXJA 2RFJA 3JVMA 4J3IA 4QC3A 4NYVA 3Q2FA 5KHMA 2YEKA 4YYKA 5E7DA 5EM3A 5HRVA 4NQMA 5CU8A 4YBMA 2RNXA 4QC1A 5E9KA 4HXMA 4A9EA 5IGKA 4O75A 3UVXA 5BT3A 3JVJA 4CUPA 4Z1QA 5CQTA 3IU5A 4QEUA 3TLPA 3AADA 4A9NA 4LC2A 4YH3A 5DX4A 5DFCA 5DYXA 5HQ6A 2N9GA 5H1TA 4O71A 4HXKA 4Q0OA 5C87A 5C89A 5FE9A 5CQ7A 5ACYA 2YDWA 4IORA 5DBMA 2E7OA 3LQIA 4BW4A 4GPJA 5CQAA 4TZ8A 5H1VA 2L5EA 4NR7A 4QSWA 2I8NA 4HBXA 5DFBA 5I1QA 4MR4A 4OUFA 5FFYA 4OGJA 5I83A 3S91A 5CS8A 4KCXA 5J0DA 1WUMA 5L98A 5CQ8A 3O36A 5AD3A 4TU6A 5KU3A 3P5OA 4MENA 5EISA 4NRAA 5DYUA 5A82A 5LJ0A 4PCIA 5CPEA 5DKDA 3LQHA 2DVSA 4HXRA 2DVRA 2R0YA 5COIA 5G4RA 4O70A 5EWVA 5DW2A 4UIUA 3O34A 3DWYA 4NUCA 4QUTA 5CUDA 4J0SA 5I7XA 4Z6IA 5AD2A 5HRXA 5L97A 2FSAA 5CQ4A 4BJXA 3GG3A 3JVLA 4HXPA 4YYMA 2DVQA 4QY4A 4HBYA 3AQAA 3QZVA 5HJCA 5A5RA 1WUGA 3D7CA 2F6NA 5E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FDZ A;  4IR6 A;  4YAD A;  5HEN A;  2DAT A;  4DON A;  3U5O A;  4QR5 A;  5DKH A;  4CUT A;  5FE2 A;  1ZS5 A;  5FBX A;  5FG5 A;  4KV1 A;  4O76 A;  5E0R A;  4HXN A;  4PY6 A;  5FH7 A;  4YYG A;  5A7C A;  5DFD A;  2MJV B;  4O78 A;  4NR8 A;  4IOO A;  4Z93 A;  5F3A A;  5D7X A;  4MR5 A;  5FG4 A;  4UIY A;  5HQ5 A;  5C7N A;  4LDF A;  5LUU A;  3U5P A;  5DLZ A;  3MB4 A;  4TT4 A;  4IOQ A;  4UYE A;  2H60 A;  4LYI A;  5A83 A;  4MEO A;  4MEQ A;  5EI4 A;  5LVR A;  4UYF B;  5FE5 A;  2OO1 A;  5C4Q A;  5LKU A;  5LKX A;  5ENH A;  2KTB B;  4TQN A;  2F6J A;  5II1 A;  5A5N A;  3Q2E A;  3UV5 A;  5BT4 A;  4A9K A;  4TT2 A;  4LZ2 A;  5HRW A;  3MXF A;  3ZYU A;  5ENC A;  4HBV A;  4WHU A;  5LJ2 A;  4YYJ A;  4O77 A;  2R10 A;  4A9I A;  4MR6 A;  5A5O A;  3SVH A;  1EQF A;  3JVK A;  5AMF A;  2RI7 A;  4MR3 A;  5L99 A;  2RNW A;  2G4A A;  4N4F A;  4BW1 A;  5JI8 A;  3UVD A;  4PCE A;  4LZR A;  4IR3 A;  2RNY A;  3UVY A;  5F63 A;  3U5K A;  4QSS A;  3P1C A;  5ETB A;  3MQM A;  3G0J A;  5CRM A;  5FE6 A;  4A9J A;  5LJ1 A;  4PKL A;  4QEW A;  5D24 A;  4N4G A;  3K2J A;  4HXO A;  4NXJ A;  4QEV A;  4ZC9 A;  3UV2 A;  5I7Y A;  5F60 A;  5L8T A;  5FE3 A;  3MUL A;  4NR6 A;  5LKZ A;  3MUK A;  2L84 A;  2YQD A;  5CUB A;  5EQ1 A;  4J0R A;  5FB0 A;  3SVF A;  4HXS A;  4WIV A;  4YAX A;  4O7F A;  4BHW A;  4N4I A;  4FLP A;  4OGI A;  5HFQ A;  4ZW1 A;  3LQJ A;  5DYA A;  5H85 A;  4NRB A;  4N3W A;  4ALH A;  3P1F A;  5D3J A;  5E73 A;  5CFW A;  5D3T A;  5EWC A;  5I89 A;  5CUC A;  5LKT A;  4CUS A;  5BT5 A;  2YEL A;  4PS5 A;  5I86 A;  4QSP A;  5EP7 A;  2R0S A;  5TB6 A;  2LSP B;  4BW2 A;  2YW5 A;  4NRC A;  5HCL A;  2E3K A;  4CUU A;  5D0C A;  4CFL A;  4O7C A;  4Z6H A;  5A81 A;  4QSR A;  5D3L A;  5EK9 A;  4NS5 A;  4UIT A;  5KTU A;  4QYD A;  4CUQ A;  4QB3 A;  4XY9 A;  5EWD A;  5JWM A;  4TZ2 A;  5D25 A;  4NR4 A;  4XYA A;  3HME A;  4XUB A;  5A5Q A;  2DVV A;  5HFR A;  5D3R A;  3O35 A;  4Y03 A;  4YY4 A;  5ETD A;  5F62 A;  4X2I A;  4YBS A;  5EPR A;  3SVG A;  4UYG A;  4UIW A;  4F3I A;  5IGM A;  3ONI A;  3QZT A;  3U5J A;  4YYI A;  5FE0 A;  2YYN A;  3HMH A;  4UYH A;  3RCW A;  5G4S A;  3P1E A;  5F61 A;  5ENF A;  4CFK A;  3UV4 A;  5CY9 A;  4C67 A;  5E3D A;  5FFV A;  2E7N A;  1JSP B;  5K29 A;  4RVR A;  5A85 A;  5A5S A;  1F68 A;  4UIX A;  4CL9 A;  5CRZ A;  3I3J A;  3G0L A;  4O7B A;  4XUA A;  5EWW A;  4IR5 A;  5FH8 A;  5HLS A;  5DKC A;  2WP1 A;  3FKM X;  4QSV A;  3UW9 A;  4MEP A;  4QSX A;  5CUE A;  5DYC A;  5FH6 A;  5EGU A;  4QUU A;  4WHW A;  4BW3 A;  3U5M A;  2YEM A;  4TT6 A;  5ENI A;  5KTX A;  4HBW A;  5FE1 A;  5IG6 A;  3U5N A;  4E96 A;  4UYF A;  4NYX A;  4PTB A;  5E74 A;  5I88 A;  5I80 A;  5F25 A;  4TU4 A;  4N4H A;  2RS9 B;  5D3S A;  5EWH A;  2R0V A;  5D3P A;  4QSQ A;  5CTL A;  5EIC A;  4ZQL A;  5C85 A;  5EPB A;  4NUE A;  1N72 A;  5ENB A;  4O7E A;  4Q0N A;  5CUG A;  4A9L A;  5IGN A;  5FE4 A;  4Z1S A;  5EU1 A;  2NXB A;  4J1P A;  5F36 A;  4O7A A;  4YYD A;  4QZS A;  4CLB A;  2D9E A;  5EPS A;  5D26 A;  5H1U A;  4A9F A;  3IU6 A;  3LJW A;  5TCM A;  4QST A;  5FE8 A;  5CQ6 A;  4QYL A;  4XY8 A;  5DW1 A;  3NXB A;  4QBM A;  1X0J A;  5A5P A;  5D3H A;  5L8U A;  2OUO A;  5IID A;  5E9I A;  5E9Y A;  5HQ7 A;  4QR4 A;  4UIV A;  4QSU A;  5E9M A;  3U5L A;  4KV4 A;  3UVW A;  4ALG A;  5F2P A;  2D82 A;  5E3G A;  3O37 A;  5ENJ A;  5KO4 A;  1JM4 B;  5FG6 A;  4YYH A;  4TYL A;  4O74 A;  5ENE A;  5HEL A;  5D3N A;  4LYW A;  5DY7 A;  5CQ3 A;  2OSS A;  4LZS A;  5CGP A;  5C8G A;  5F1H A;  4NYW A;  3O33 A;  5HEM A;  5FE7 A;  4A9O A;  3QZS A;  5ENG A;  5IGL A;  4QNS A;  5FFW A;  2WP2 A;  4UYD A;  4TS8 A;  2GRC A;  4IR4 A;  3HMF A;  4TTE A;  5E9V A;  5AME A;  4AKN A;  4YK0 A;  4A9M A;  4UIZ A;  5L96 A;  5EVA A;  4C66 A;  3MB3 A;  4YAB A;  5CQ5 A;  5EV9 A;  5LVQ A;  2I7K A;  4YY6 A;  4LRG A;  5CP5 A;  2DWW A;  5F5Z A;  2L85 A;  4YYN A;  4YBT A;  5EA1 A;  5KTW A;  4NR9 A;  4YC9 A;  3S92 A;  4NQN A;  4A9H A;  5HM0 A;  5CUA A;  4O72 A;  4YH4 A;  4LR6 A;  4LYS A;  5II2 A;  4NUD A;  5FB1 A;  3P1D A;  4CUR A;  5DLX A;  3DAI A;  5CZG A;  4NR5 A;  5I40 A;  5F1L A;  1E6I A;  5I29 A;  2DKW A;  5IBN A;  2RO1 A;  4YAT A;  4HXL A;  4QR3 A;  3LXJ A;  2RFJ A;  3JVM A;  4J3I A;  4QC3 A;  4NYV A;  3Q2F A;  5KHM A;  2YEK A;  4YYK A;  5E7D A;  5EM3 A;  5HRV A;  4NQM A;  5CU8 A;  4YBM A;  2RNX A;  4QC1 A;  5E9K A;  4HXM A;  4A9E A;  5IGK A;  4O75 A;  3UVX A;  5BT3 A;  3JVJ A;  4CUP A;  4Z1Q A;  5CQT A;  3IU5 A;  4QEU A;  3TLP A;  3AAD A;  4A9N A;  4LC2 A;  4YH3 A;  5DX4 A;  5DFC A;  5DYX A;  5HQ6 A;  2N9G A;  5H1T A;  4O71 A;  4HXK A;  4Q0O A;  5C87 A;  5C89 A;  5FE9 A;  5CQ7 A;  5ACY A;  2YDW A;  4IOR A;  5DBM A;  2E7O A;  3LQI A;  4BW4 A;  4GPJ A;  5CQA A;  4TZ8 A;  5H1V A;  2L5E A;  4NR7 A;  4QSW A;  2I8N A;  4HBX A;  5DFB A;  5I1Q A;  4MR4 A;  4OUF A;  5FFY A;  4OGJ A;  5I83 A;  3S91 A;  5CS8 A;  4KCX A;  5J0D A;  1WUM A;  5L98 A;  5CQ8 A;  3O36 A;  5AD3 A;  4TU6 A;  5KU3 A;  3P5O A;  4MEN A;  5EIS A;  4NRA A;  5DYU A;  5A82 A;  5LJ0 A;  4PCI A;  5CPE A;  5DKD A;  3LQH A;  2DVS A;  4HXR A;  2DVR A;  2R0Y A;  5COI A;  5G4R A;  4O70 A;  5EWV A;  5DW2 A;  4UIU A;  3O34 A;  3DWY A;  4NUC A;  4QUT A;  5CUD A;  4J0S A;  5I7X A;  4Z6I A;  5AD2 A;  5HRX A;  5L97 A;  2FSA A;  5CQ4 A;  4BJX A;  3GG3 A;  3JVL A;  4HXP A;  4YYM A;  2DVQ A;  4QY4 A;  4HBY A;  3AQA A;  3QZV A;  5HJC A;  5A5R A;  1WUG A;  3D7C A;  2F6N A;  5E9L A; 
#chains in the Genus database with same CATH topology
 5FDZ A;  4IR6 A;  4YAD A;  5HEN A;  2DAT A;  4DON A;  3U5O A;  4QR5 A;  5DKH A;  4CUT A;  5FE2 A;  1ZS5 A;  5FBX A;  5FG5 A;  4KV1 A;  4O76 A;  5E0R A;  4HXN A;  4PY6 A;  5FH7 A;  4YYG A;  5A7C A;  5DFD A;  2MJV B;  4O78 A;  4NR8 A;  4IOO A;  4Z93 A;  5F3A A;  5D7X A;  4MR5 A;  5FG4 A;  4UIY A;  5HQ5 A;  5C7N A;  4LDF A;  5LUU A;  3U5P A;  5DLZ A;  3MB4 A;  4TT4 A;  4IOQ A;  4UYE A;  2H60 A;  4LYI A;  5A83 A;  4MEO A;  3D1D A;  4MEQ A;  5EI4 A;  5LVR A;  4UYF B;  5FE5 A;  2OO1 A;  5C4Q A;  5LKU A;  5LKX A;  5ENH A;  2KTB B;  4TQN A;  2F6J A;  5II1 A;  5A5N A;  3Q2E A;  3UV5 A;  5BT4 A;  4A9K A;  4TT2 A;  4AKG A;  4LZ2 A;  5HRW A;  3MXF A;  3ZYU A;  5ENC A;  4HBV A;  4WHU A;  5LJ2 A;  4YYJ A;  4O77 A;  2R10 A;  4A9I A;  4MR6 A;  5A5O A;  3SVH A;  1EQF A;  3JVK A;  5AMF A;  2RI7 A;  4MR3 A;  5L99 A;  2RNW A;  2G4A A;  4N4F A;  4BW1 A;  5JI8 A;  3UVD A;  4PCE A;  4LZR A;  4IR3 A;  2RNY A;  3UVY A;  5F63 A;  3U5K A;  4QSS A;  3P1C A;  5ETB A;  3MQM A;  3G0J A;  5CRM A;  5FE6 A;  4A9J A;  5LJ1 A;  4PKL A;  4QEW A;  4N4G A;  4NXJ A;  3K2J A;  4HXO A;  4QEV A;  5D24 A;  4ZC9 A;  3UV2 A;  2EJN A;  5I7Y A;  5F60 A;  5L8T A;  5FE3 A;  3MUL A;  4NR6 A;  5LKZ A;  3MUK A;  2L84 A;  2YQD A;  5CUB A;  5EQ1 A;  4J0R A;  5FB0 A;  3SVF A;  4AKI A;  4HXS A;  4WIV A;  4YAX A;  4O7F A;  4BHW A;  4N4I A;  4FLP A;  4OGI A;  5HFQ A;  4ZW1 A;  3LQJ A;  5DYA A;  5H85 A;  4NRB A;  4N3W A;  4ALH A;  3P1F A;  5D3J A;  5E73 A;  5CFW A;  5D3T A;  5EWC A;  5I89 A;  5CUC A;  5LKT A;  4CUS A;  5BT5 A;  2YEL A;  4PS5 A;  5I86 A;  4QSP A;  5EP7 A;  2R0S A;  5TB6 A;  2LSP B;  4BW2 A;  2YW5 A;  4NRC A;  5HCL A;  2E3K A;  4CUU A;  5D0C A;  4CFL A;  4O7C A;  4Z6H A;  5A81 A;  4QSR A;  5D3L A;  5EK9 A;  4NS5 A;  4UIT A;  5KTU A;  4QYD A;  4CUQ A;  4QB3 A;  4XY9 A;  5EWD A;  5JWM A;  4TZ2 A;  5D25 A;  4NR4 A;  4XYA A;  3HME A;  4XUB A;  5A5Q A;  2DVV A;  5HFR A;  5D3R A;  3O35 A;  4Y03 A;  4YY4 A;  5ETD A;  5F62 A;  4X2I A;  4YBS A;  5EPR A;  3SVG A;  4UYG A;  4UIW A;  4F3I A;  5IGM A;  3ONI A;  3QZT A;  3U5J A;  4YYI A;  5FE0 A;  2YYN A;  3HMH A;  4UYH A;  3RCW A;  5G4S A;  3P1E A;  5F61 A;  5ENF A;  4CFK A;  3UV4 A;  5CY9 A;  4C67 A;  5E3D A;  5FFV A;  2E7N A;  1JSP B;  3VKH A;  5K29 A;  4RVR A;  5A85 A;  5A5S A;  1F68 A;  4UIX A;  4CL9 A;  5CRZ A;  3I3J A;  3G0L A;  4O7B A;  4XUA A;  5EWW A;  4IR5 A;  5FH8 A;  5HLS A;  5DKC A;  2WP1 A;  3FKM X;  4QSV A;  3UW9 A;  4MEP A;  4QSX A;  5CUE A;  5DYC A;  5FH6 A;  5EGU A;  4QUU A;  4WHW A;  4BW3 A;  3U5M A;  2YEM A;  4TT6 A;  5ENI A;  5KTX A;  4HBW A;  3ERR A;  5FE1 A;  5IG6 A;  3U5N A;  4E96 A;  4UYF A;  4NYX A;  4PTB A;  5E74 A;  5I88 A;  5I80 A;  5F25 A;  4TU4 A;  4N4H A;  2RS9 B;  5D3S A;  5EWH A;  2R0V A;  5D3P A;  4QSQ A;  5CTL A;  5EIC A;  4ZQL A;  5C85 A;  4AKH A;  5EPB A;  4NUE A;  1N72 A;  5ENB A;  4O7E A;  4Q0N A;  5CUG A;  4A9L A;  5IGN A;  5FE4 A;  4Z1S A;  5EU1 A;  2NXB A;  4J1P A;  5F36 A;  4O7A A;  4YYD A;  4QZS A;  4CLB A;  2D9E A;  5EPS A;  5D26 A;  5H1U A;  4A9F A;  3IU6 A;  3LJW A;  5TCM A;  4QST A;  5FE8 A;  5CQ6 A;  4QYL A;  4XY8 A;  5DW1 A;  3NXB A;  4QBM A;  1X0J A;  5A5P A;  5D3H A;  5L8U A;  2OUO A;  5IID A;  5E9I A;  5E9Y A;  5HQ7 A;  4QR4 A;  4UIV A;  4QSU A;  5E9M A;  3U5L A;  4KV4 A;  3UVW A;  4ALG A;  5F2P A;  2D82 A;  5E3G A;  3O37 A;  5ENJ A;  5KO4 A;  1JM4 B;  5FG6 A;  4YYH A;  4TYL A;  4O74 A;  5ENE A;  5HEL A;  5D3N A;  4LYW A;  5DY7 A;  5CQ3 A;  2OSS A;  4LZS A;  5CGP A;  5C8G A;  5F1H A;  4NYW A;  3O33 A;  5HEM A;  5FE7 A;  4A9O A;  3QZS A;  5ENG A;  5IGL A;  4QNS A;  3D1B A;  2WP2 A;  4UYD A;  4TS8 A;  5FFW A;  2GRC A;  4IR4 A;  3HMF A;  4TTE A;  5E9V A;  5AME A;  4AKN A;  4YK0 A;  4A9M A;  4UIZ A;  5L96 A;  5EVA A;  4C66 A;  3MB3 A;  4YAB A;  5CQ5 A;  5EV9 A;  5LVQ A;  2I7K A;  4YY6 A;  4LRG A;  5CP5 A;  2DWW A;  5F5Z A;  2L85 A;  4YYN A;  4YBT A;  5EA1 A;  5KTW A;  4NR9 A;  4YC9 A;  3S92 A;  4NQN A;  4A9H A;  5HM0 A;  5CUA A;  4O72 A;  4YH4 A;  4LR6 A;  4LYS A;  5II2 A;  4NUD A;  5FB1 A;  3P1D A;  4CUR A;  5DLX A;  3DAI A;  5CZG A;  4NR5 A;  5I40 A;  5F1L A;  1E6I A;  5I29 A;  2DKW A;  5IBN A;  2RO1 A;  4YAT A;  4HXL A;  4QR3 A;  3LXJ A;  2RFJ A;  3JVM A;  4J3I A;  4QC3 A;  4NYV A;  3Q2F A;  5KHM A;  2YEK A;  4YYK A;  5E7D A;  5EM3 A;  5HRV A;  4NQM A;  5CU8 A;  4YBM A;  2RNX A;  4QC1 A;  5E9K A;  4HXM A;  4A9E A;  5IGK A;  4O75 A;  3UVX A;  5BT3 A;  3JVJ A;  1ZKR A;  4CUP A;  4Z1Q A;  5CQT A;  3IU5 A;  4QEU A;  3TLP A;  3AAD A;  4A9N A;  4LC2 A;  4YH3 A;  5DX4 A;  5DFC A;  5DYX A;  5HQ6 A;  2N9G A;  5H1T A;  4O71 A;  4HXK A;  4Q0O A;  5C87 A;  5C89 A;  5FE9 A;  5CQ7 A;  5ACY A;  2YDW A;  4IOR A;  5DBM A;  2E7O A;  3LQI A;  4BW4 A;  4GPJ A;  5CQA A;  4TZ8 A;  5H1V A;  2L5E A;  4NR7 A;  4QSW A;  2I8N A;  4HBX A;  5DFB A;  5I1Q A;  4MR4 A;  4OUF A;  5FFY A;  4OGJ A;  5I83 A;  3S91 A;  4AI6 A;  3VKG A;  5CS8 A;  4KCX A;  5J0D A;  1WUM A;  5L98 A;  5CQ8 A;  3O36 A;  5AD3 A;  4TU6 A;  1PUO A;  3P5O A;  4MEN A;  5KU3 A;  5EIS A;  4NRA A;  5DYU A;  5A82 A;  5LJ0 A;  4PCI A;  5CPE A;  5DKD A;  3LQH A;  2DVS A;  4HXR A;  2DVR A;  2R0Y A;  5COI A;  5G4R A;  4O70 A;  5EWV A;  5DW2 A;  4UIU A;  3O34 A;  3DWY A;  4NUC A;  5CUD A;  4QUT A;  4J0S A;  5I7X A;  4Z6I A;  5AD2 A;  5HRX A;  5L97 A;  2FSA A;  5CQ4 A;  4BJX A;  3GG3 A;  3JVL A;  4HXP A;  4YYM A;  2DVQ A;  4QY4 A;  4HBY A;  3AQA A;  3QZV A;  5HJC A;  5A5R A;  1WUG A;  3D7C A;  2F6N A;  5E9L A; 
#chains in the Genus database with same CATH homology
 5FDZ A;  4IR6 A;  4YAD A;  5HEN A;  2DAT A;  4DON A;  3U5O A;  4QR5 A;  5DKH A;  4CUT A;  5FE2 A;  1ZS5 A;  5FBX A;  5FG5 A;  4KV1 A;  4O76 A;  5E0R A;  4HXN A;  4PY6 A;  5FH7 A;  4YYG A;  5A7C A;  5DFD A;  2MJV B;  4O78 A;  4NR8 A;  4IOO A;  4Z93 A;  5F3A A;  5D7X A;  4MR5 A;  5FG4 A;  4UIY A;  5HQ5 A;  5C7N A;  4LDF A;  5LUU A;  3U5P A;  5DLZ A;  3MB4 A;  4TT4 A;  4IOQ A;  4UYE A;  2H60 A;  4LYI A;  5A83 A;  4MEO A;  4MEQ A;  5EI4 A;  5LVR A;  4UYF B;  5FE5 A;  2OO1 A;  5C4Q A;  5LKU A;  5LKX A;  5ENH A;  2KTB B;  4TQN A;  2F6J A;  5II1 A;  5A5N A;  3Q2E A;  3UV5 A;  5BT4 A;  4A9K A;  4TT2 A;  4LZ2 A;  5HRW A;  3MXF A;  3ZYU A;  5ENC A;  4HBV A;  4WHU A;  5LJ2 A;  4YYJ A;  4O77 A;  2R10 A;  4A9I A;  4MR6 A;  5A5O A;  3SVH A;  1EQF A;  3JVK A;  5AMF A;  2RI7 A;  4MR3 A;  5L99 A;  2RNW A;  2G4A A;  4N4F A;  4BW1 A;  5JI8 A;  3UVD A;  4PCE A;  4LZR A;  4IR3 A;  2RNY A;  3UVY A;  5F63 A;  3U5K A;  4QSS A;  3P1C A;  5ETB A;  3MQM A;  3G0J A;  5CRM A;  5FE6 A;  4A9J A;  5LJ1 A;  4PKL A;  4QEW A;  5D24 A;  4N4G A;  3K2J A;  4HXO A;  4NXJ A;  4QEV A;  4ZC9 A;  3UV2 A;  5I7Y A;  5F60 A;  5L8T A;  5FE3 A;  3MUL A;  4NR6 A;  5LKZ A;  3MUK A;  2L84 A;  2YQD A;  5CUB A;  5EQ1 A;  4J0R A;  5FB0 A;  3SVF A;  4HXS A;  4WIV A;  4YAX A;  4O7F A;  4BHW A;  4N4I A;  4FLP A;  4OGI A;  5HFQ A;  4ZW1 A;  3LQJ A;  5DYA A;  5H85 A;  4NRB A;  4N3W A;  4ALH A;  3P1F A;  5D3J A;  5E73 A;  5CFW A;  5D3T A;  5EWC A;  5I89 A;  5CUC A;  5LKT A;  4CUS A;  5BT5 A;  2YEL A;  4PS5 A;  5I86 A;  4QSP A;  5EP7 A;  2R0S A;  5TB6 A;  2LSP B;  4BW2 A;  2YW5 A;  4NRC A;  5HCL A;  2E3K A;  4CUU A;  5D0C A;  4CFL A;  4O7C A;  4Z6H A;  5A81 A;  4QSR A;  5D3L A;  5EK9 A;  4NS5 A;  4UIT A;  5KTU A;  4QYD A;  4CUQ A;  4QB3 A;  4XY9 A;  5EWD A;  5JWM A;  4TZ2 A;  5D25 A;  4NR4 A;  4XYA A;  3HME A;  4XUB A;  5A5Q A;  2DVV A;  5HFR A;  5D3R A;  3O35 A;  4Y03 A;  4YY4 A;  5ETD A;  5F62 A;  4X2I A;  4YBS A;  5EPR A;  3SVG A;  4UYG A;  4UIW A;  4F3I A;  5IGM A;  3ONI A;  3QZT A;  3U5J A;  4YYI A;  5FE0 A;  2YYN A;  3HMH A;  4UYH A;  3RCW A;  5G4S A;  3P1E A;  5F61 A;  5ENF A;  4CFK A;  3UV4 A;  5CY9 A;  4C67 A;  5E3D A;  5FFV A;  2E7N A;  1JSP B;  5K29 A;  4RVR A;  5A85 A;  5A5S A;  1F68 A;  4UIX A;  4CL9 A;  5CRZ A;  3I3J A;  3G0L A;  4O7B A;  4XUA A;  5EWW A;  4IR5 A;  5FH8 A;  5HLS A;  5DKC A;  2WP1 A;  3FKM X;  4QSV A;  3UW9 A;  4MEP A;  4QSX A;  5CUE A;  5DYC A;  5FH6 A;  5EGU A;  4QUU A;  4WHW A;  4BW3 A;  3U5M A;  2YEM A;  4TT6 A;  5ENI A;  5KTX A;  4HBW A;  5FE1 A;  5IG6 A;  3U5N A;  4E96 A;  4UYF A;  4NYX A;  4PTB A;  5E74 A;  5I88 A;  5I80 A;  5F25 A;  4TU4 A;  4N4H A;  2RS9 B;  5D3S A;  5EWH A;  2R0V A;  5D3P A;  4QSQ A;  5CTL A;  5EIC A;  4ZQL A;  5C85 A;  5EPB A;  4NUE A;  1N72 A;  5ENB A;  4O7E A;  4Q0N A;  5CUG A;  4A9L A;  5IGN A;  5FE4 A;  4Z1S A;  5EU1 A;  2NXB A;  4J1P A;  5F36 A;  4O7A A;  4YYD A;  4QZS A;  4CLB A;  2D9E A;  5EPS A;  5D26 A;  5H1U A;  4A9F A;  3IU6 A;  3LJW A;  5TCM A;  4QST A;  5FE8 A;  5CQ6 A;  4QYL A;  4XY8 A;  5DW1 A;  3NXB A;  4QBM A;  1X0J A;  5A5P A;  5D3H A;  5L8U A;  2OUO A;  5IID A;  5E9I A;  5E9Y A;  5HQ7 A;  4QR4 A;  4UIV A;  4QSU A;  5E9M A;  3U5L A;  4KV4 A;  3UVW A;  4ALG A;  5F2P A;  2D82 A;  5E3G A;  3O37 A;  5ENJ A;  5KO4 A;  1JM4 B;  5FG6 A;  4YYH A;  4TYL A;  4O74 A;  5ENE A;  5HEL A;  5D3N A;  4LYW A;  5DY7 A;  5CQ3 A;  2OSS A;  4LZS A;  5CGP A;  5C8G A;  5F1H A;  4NYW A;  3O33 A;  5HEM A;  5FE7 A;  4A9O A;  3QZS A;  5ENG A;  5IGL A;  4QNS A;  5FFW A;  2WP2 A;  4UYD A;  4TS8 A;  2GRC A;  4IR4 A;  3HMF A;  4TTE A;  5E9V A;  5AME A;  4AKN A;  4YK0 A;  4A9M A;  4UIZ A;  5L96 A;  5EVA A;  4C66 A;  3MB3 A;  4YAB A;  5CQ5 A;  5EV9 A;  5LVQ A;  2I7K A;  4YY6 A;  4LRG A;  5CP5 A;  2DWW A;  5F5Z A;  2L85 A;  4YYN A;  4YBT A;  5EA1 A;  5KTW A;  4NR9 A;  4YC9 A;  3S92 A;  4NQN A;  4A9H A;  5HM0 A;  5CUA A;  4O72 A;  4YH4 A;  4LR6 A;  4LYS A;  5II2 A;  4NUD A;  5FB1 A;  3P1D A;  4CUR A;  5DLX A;  3DAI A;  5CZG A;  4NR5 A;  5I40 A;  5F1L A;  1E6I A;  5I29 A;  2DKW A;  5IBN A;  2RO1 A;  4YAT A;  4HXL A;  4QR3 A;  3LXJ A;  2RFJ A;  3JVM A;  4J3I A;  4QC3 A;  4NYV A;  3Q2F A;  5KHM A;  2YEK A;  4YYK A;  5E7D A;  5EM3 A;  5HRV A;  4NQM A;  5CU8 A;  4YBM A;  2RNX A;  4QC1 A;  5E9K A;  4HXM A;  4A9E A;  5IGK A;  4O75 A;  3UVX A;  5BT3 A;  3JVJ A;  4CUP A;  4Z1Q A;  5CQT A;  3IU5 A;  4QEU A;  3TLP A;  3AAD A;  4A9N A;  4LC2 A;  4YH3 A;  5DX4 A;  5DFC A;  5DYX A;  5HQ6 A;  2N9G A;  5H1T A;  4O71 A;  4HXK A;  4Q0O A;  5C87 A;  5C89 A;  5FE9 A;  5CQ7 A;  5ACY A;  2YDW A;  4IOR A;  5DBM A;  2E7O A;  3LQI A;  4BW4 A;  4GPJ A;  5CQA A;  4TZ8 A;  5H1V A;  2L5E A;  4NR7 A;  4QSW A;  2I8N A;  4HBX A;  5DFB A;  5I1Q A;  4MR4 A;  4OUF A;  5FFY A;  4OGJ A;  5I83 A;  3S91 A;  5CS8 A;  4KCX A;  5J0D A;  1WUM A;  5L98 A;  5CQ8 A;  3O36 A;  5AD3 A;  4TU6 A;  5KU3 A;  3P5O A;  4MEN A;  5EIS A;  4NRA A;  5DYU A;  5A82 A;  5LJ0 A;  4PCI A;  5CPE A;  5DKD A;  3LQH A;  2DVS A;  4HXR A;  2DVR A;  2R0Y A;  5COI A;  5G4R A;  4O70 A;  5EWV A;  5DW2 A;  4UIU A;  3O34 A;  3DWY A;  4NUC A;  4QUT A;  5CUD A;  4J0S A;  5I7X A;  4Z6I A;  5AD2 A;  5HRX A;  5L97 A;  2FSA A;  5CQ4 A;  4BJX A;  3GG3 A;  3JVL A;  4HXP A;  4YYM A;  2DVQ A;  4QY4 A;  4HBY A;  3AQA A;  3QZV A;  5HJC A;  5A5R A;  1WUG A;  3D7C A;  2F6N A;  5E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...