5F3AA

Crystal structure of the bromodomain of human atad2 in complex with compound a14
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
b'SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Crystal structure of the bromodomain of human ATAD2 in complex with Compound A14
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f3aA00
2YQDA 5LJ1A 4LYIA 5D3SA 5HENA 4UYHA 4UIWA 5DYXA 5FE5A 4QSXA 4BW3A 3P1DA 4UIZA 3QZVA 5D26A 5A85A 4O76A 4O7EA 4QSWA 1ZS5A 5E9KA 4QSQA 2DVSA 4O7FA 5E74A 5ENHA 5DYUA 4KV4A 3UV2A 5LJ0A 5D24A 5ETDA 4A9OA 5IGNA 4A9KA 4CLBA 4NR6A 4X2IA 3MXFA 3O37A 5E3DA 5L99A 5CU8A 3HMHA 5D3JA 5F61A 4UYFA 4CUUA 4TU4A 5A5SA 3IU6A 4CFKA 5FG5A 5F36A 2DKWA 5CRMA 5A5PA 2G4AA 5II2A 3UW9A 2E7OA 3AQAA 4QSVA 5J0DA 2DVQA 4IR6A 4QYDA 4CUSA 5A5OA 4Z93A 5C4QA 5LKXA 1N72A 4O71A 4ZW1A 5DFDA 3Q2FA 4NQMA 4GPJA 5IIDA 5FE8A 5FE9A 4QR4A 5ENJA 5HQ6A 4CUQA 5EP7A 4HXRA 1JSPB 4YYHA 4HXSA 5L8TA 4O78A 4A9MA 5DY7A 5EPBA 5EM3A 4ZC9A 2E3KA 4J0SA 4BW1A 5FE3A 5I29A 4QSTA 4A9JA 2WP1A 2R0SA 4C66A 1EQFA 3LXJA 3LQHA 4TT4A 5EWCA 4HXNA 5CUBA 4QB3A 4FLPA 3UVXA 5DYCA 4J3IA 4Z6IA 4HBVA 4LDFA 4O70A 4N4HA 2L5EA 4HXOA 4YYMA 2RNXA 4XY8A 4N4FA 5CQ5A 5EPSA 2DVRA 4Z6HA 4WIVA 4O77A 3QZSA 3U5LA 2YEKA 5EPRA 3SVHA 5FH7A 5CPEA 4LR6A 4MEOA 4HBYA 5DYAA 4UITA 5CGPA 5I86A 5HQ5A 5HRXA 5E3GA 3MULA 5D0CA 5F63A 4NRBA 4YATA 5CS8A 5H1VA 5LUUA 5E9VA 4PCIA 5KTUA 5C87A 5IG6A 5AMFA 5E9YA 2RO1A 4O75A 5I80A 5FH6A 4YC9A 5HLSA 5EU1A 4QC1A 5L97A 4WHUA 4A9HA 3S91A 5IGMA 2YYNA 4YBTA 5EWVA 4CL9A 5HQ7A 4A9EA 3HMFA 5F25A 5FE1A 4IOQA 3P1CA 4UYFB 4RVRA 4MR5A 4NYWA 4NXJA 3Q2EA 4NR9A 5II1A 5DKCA 4UYGA 5E7DA 5IGLA 5CUEA 5E0RA 5LVRA 2I8NA 2L84A 5FH8A 4XYAA 4PTBA 3LJWA 4LZSA 4IR4A 4XY9A 4O7BA 4TT6A 4UYEA 5I7YA 4HXLA 4HBWA 5EISA 2DWWA 2YDWA 3O34A 4NR8A 5CQ6A 4YYNA 4PY6A 5I89A 3SVGA 2RI7A 4KV1A 4AKNA 4PKLA 4BW2A 4YBMA 4QBMA 5CRZA 4DONA 2RS9B 4OUFA 2R0VA 4UIVA 5I83A 4QR3A 2RNYA 5DFCA 4OGIA 4LYSA 5CQAA 5AD2A 5ACYA 4NUDA 2H60A 5HJCA 5FFWA 1WUGA 3JVKA 4IR5A 5D3RA 5L96A 4WHWA 5D3NA 5A83A 5DX4A 5A5RA 4YYJA 5FE7A 3U5PA 5LJ2A 4Y03A 3G0LA 4A9FA 4LRGA 4NYXA 5CQ4A 4NUEA 2OSSA 5H85A 5JWMA 5HFQA 4YYKA 5CUDA 3U5JA 5CUCA 5DBMA 4BHWA 1JM4B 5FDZA 5G4RA 4A9IA 2RFJA 2OO1A 5DFBA 4IOOA 4N4GA 5A82A 2RNWA 4MENA 4IR3A 4NRAA 4QSUA 5I88A 4YY4A 5DW1A 4CFLA 4A9LA 5HCLA 4QEVA 5A81A 5L8UA 4UIXA 5C89A 4O7CA 4QNSA 4MR4A 4NUCA 4MR6A 3UVWA 5AD3A 5HRVA 5ENFA 4CUPA 5D7XA 5DLXA 3D7CA 5C7NA 4TS8A 3U5KA 5H1UA 4IORA 3P1EA 5LKZA 2R10A 5A7CA 4QZSA 5L98A 4NR4A 5ENIA 5TB6A 1F68A 4KCXA 3QZTA 2DVVA 5DKDA 5HELA 4YYDA 3P1FA 4TQNA 5HRWA 3O36A 3HMEA 5EQ1A 5CP5A 5CZGA 3S92A 4TT2A 5EGUA 3FKMX 4QUUA 5I40A 5LKUA 5HM0A 2KTBB 2D9EA 3O33A 5BT4A 5FE6A 5I7XA 4F3IA 3MQMA 5KU3A 4ALGA 5CQ7A 3UV5A 2YEMA 5ENCA 4YY6A 4CURA 3K2JA 5A5NA 4CUTA 5KO4A 5AMEA 2LSPB 3U5NA 5KTXA 5EWHA 4QUTA 4TZ8A 4MEPA 4Q0OA 4YYIA 5DKHA 5E73A 3ONIA 4HXKA 2YW5A 3JVJA 4N3WA 1E6IA 4TZ2A 4LZRA 4QY4A 4ZQLA 2E7NA 2F6JA 5FFVA 4BW4A 5IGKA 4QSRA 5EA1A 5FB1A 4YBSA 4MR3A 4YAXA 5DW2A 3LQJA 4QEWA 3UVYA 4LZ2A 2DATA 4A9NA 4NQNA 5K29A 5FE2A 4QR5A 4LYWA 3DAIA 4NR7A 5E9MA 5F60A 4UIUA 3SVFA 5CFWA 5EWDA 5CUAA 5BT5A 4UIYA 3IU5A 5CTLA 4QEUA 2OUOA 2N9GA 4MEQA 5FG4A 2YELA 5FBXA 3I3JA 4QSPA 5FFYA 5EV9A 5FE4A 4YYGA 3UVDA 5ETBA 3TLPA 5D3HA 3MUKA 1X0JA 5IBNA 5CY9A 3JVMA 4NRCA 3LQIA 4YABA 5KTWA 4PS5A 5LVQA 5COIA 5D3PA 4QSSA 5CUGA 4NR5A 5F2PA 5EI4A 4OGJA 5CQ3A 4BJXA 3AADA 2WP2A 5E9LA 5ENEA 4XUAA 5EWWA 3O35A 4YH4A 5DLZA 4HXPA 3MB3A 5F62A 5A5QA 2F6NA 4N4IA 5KHMA 5F5ZA 3JVLA 4TTEA 5EVAA 2NXBA 2D82A 4QYLA 3DWYA 5D3TA 4YH3A 5CQTA 4ALHA 2MJVB 5EICA 4J1PA 5F1HA 5HEMA 5ENBA 3MB4A 4HBXA 5FE0A 4UYDA 5FG6A 3NXBA 5CQ8A 2FSAA 4Z1SA 5HFRA 5JI8A 4Z1QA 5C8GA 3U5OA 4HXMA 4YK0A 4Q0NA 3RCWA 5E9IA 2L85A 3P5OA 5D3LA 5FB0A 5G4SA 4LC2A 3ZYUA 4TYLA 4O74A 5H1TA 3UV4A 2GRCA 5TCMA 3G0JA 5C85A 4O72A 4E96A 4XUBA 5ENGA 5LKTA 5F3AA 4PCEA 4NYVA 4C67A 4O7AA 4QC3A 5D25A 5F1LA 3GG3A 3U5MA 4J0RA 4TU6A 4YADA 2I7KA 4NS5A 2R0YA 5EK9A 5I1QA 5BT3A 1WUMA
chains in the Genus database with same CATH superfamily
2YQDA 5LJ1A 4LYIA 5D3SA 5HENA 4UYHA 4UIWA 5DYXA 5FE5A 4QSXA 4BW3A 3P1DA 4UIZA 3QZVA 5D26A 5A85A 4O76A 4O7EA 4QSWA 1ZS5A 5E9KA 4QSQA 2DVSA 4O7FA 5E74A 5ENHA 5DYUA 4KV4A 3UV2A 5LJ0A 5D24A 5ETDA 4A9OA 5IGNA 4A9KA 4CLBA 4NR6A 4X2IA 3MXFA 3O37A 5E3DA 5L99A 5CU8A 3HMHA 5D3JA 5F61A 4UYFA 4CUUA 4TU4A 5A5SA 3IU6A 4CFKA 5FG5A 5F36A 2DKWA 5CRMA 5A5PA 2G4AA 5II2A 3UW9A 2E7OA 3AQAA 4QSVA 5J0DA 2DVQA 4IR6A 4QYDA 4CUSA 5A5OA 4Z93A 5C4QA 5LKXA 1N72A 4O71A 4ZW1A 5DFDA 3Q2FA 4NQMA 4GPJA 5IIDA 5FE8A 5FE9A 4QR4A 5ENJA 5HQ6A 4CUQA 5EP7A 4HXRA 1JSPB 4YYHA 4HXSA 5L8TA 4O78A 4A9MA 5DY7A 5EPBA 5EM3A 4ZC9A 2E3KA 4J0SA 4BW1A 5FE3A 3D1BA 5I29A 4QSTA 4A9JA 2WP1A 2R0SA 4C66A 1EQFA 3LXJA 3LQHA 4TT4A 5EWCA 4HXNA 5CUBA 4QB3A 4FLPA 3UVXA 5DYCA 4J3IA 4Z6IA 4HBVA 4LDFA 4O70A 4N4HA 2L5EA 4HXOA 4YYMA 2RNXA 4XY8A 4N4FA 5CQ5A 5EPSA 2DVRA 4Z6HA 4WIVA 4O77A 3QZSA 3U5LA 2YEKA 5EPRA 3SVHA 5FH7A 5CPEA 4LR6A 4MEOA 4HBYA 5DYAA 4UITA 5CGPA 5I86A 5HQ5A 5HRXA 5E3GA 3MULA 5D0CA 5F63A 4NRBA 4YATA 5CS8A 5H1VA 5LUUA 5E9VA 4PCIA 5KTUA 5C87A 5IG6A 5AMFA 5E9YA 2RO1A 4O75A 5I80A 5FH6A 4YC9A 5HLSA 5EU1A 4QC1A 5L97A 4WHUA 4A9HA 3S91A 5IGMA 1PUOA 2YYNA 4YBTA 5EWVA 4CL9A 5HQ7A 4A9EA 3HMFA 5F25A 5FE1A 4IOQA 2EJNA 3P1CA 4UYFB 4RVRA 4MR5A 4NYWA 4NXJA 3Q2EA 4NR9A 5II1A 5DKCA 4UYGA 5E7DA 5IGLA 5CUEA 5E0RA 5LVRA 4AKIA 2I8NA 2L84A 5FH8A 4XYAA 4PTBA 3LJWA 4LZSA 4IR4A 4XY9A 4O7BA 4TT6A 4UYEA 5I7YA 4HXLA 4HBWA 5EISA 2DWWA 4AKGA 2YDWA 3O34A 4NR8A 5CQ6A 4YYNA 4PY6A 5I89A 3SVGA 2RI7A 4KV1A 4AKNA 4PKLA 4BW2A 4YBMA 4QBMA 5CRZA 4DONA 2RS9B 4OUFA 2R0VA 4UIVA 5I83A 4QR3A 2RNYA 5DFCA 4OGIA 4LYSA 5CQAA 5AD2A 5ACYA 4NUDA 2H60A 5HJCA 5FFWA 1WUGA 3JVKA 4IR5A 5D3RA 5L96A 4WHWA 5D3NA 5A83A 5DX4A 5A5RA 4YYJA 5FE7A 3U5PA 5LJ2A 4Y03A 3G0LA 4A9FA 4LRGA 4NYXA 5CQ4A 4NUEA 2OSSA 5H85A 5JWMA 5HFQA 3ERRA 4YYKA 5CUDA 3U5JA 5CUCA 5DBMA 4BHWA 1JM4B 5FDZA 5G4RA 4A9IA 2RFJA 2OO1A 5DFBA 4IOOA 4N4GA 5A82A 2RNWA 4MENA 4IR3A 4NRAA 4QSUA 5I88A 4YY4A 5DW1A 4CFLA 4A9LA 5HCLA 4QEVA 5A81A 5L8UA 4UIXA 5C89A 4O7CA 4QNSA 4MR4A 4NUCA 3VKHA 4MR6A 3UVWA 5AD3A 5HRVA 5ENFA 4CUPA 5D7XA 5DLXA 3D7CA 5C7NA 4TS8A 3U5KA 5H1UA 4IORA 3P1EA 5LKZA 2R10A 5A7CA 4QZSA 5L98A 4NR4A 5ENIA 5TB6A 1F68A 4KCXA 3QZTA 2DVVA 5DKDA 5HELA 4YYDA 3P1FA 4TQNA 5HRWA 3O36A 3HMEA 5EQ1A 5CP5A 5CZGA 3S92A 4TT2A 5EGUA 3FKMX 4QUUA 5I40A 5LKUA 5HM0A 2KTBB 2D9EA 3O33A 5BT4A 5FE6A 5I7XA 4F3IA 3MQMA 5KU3A 4ALGA 5CQ7A 3UV5A 2YEMA 5ENCA 3VKGA 4YY6A 4CURA 3K2JA 5A5NA 4CUTA 5KO4A 5AMEA 2LSPB 3U5NA 5KTXA 5EWHA 4QUTA 4TZ8A 4MEPA 4Q0OA 4YYIA 5DKHA 5E73A 3ONIA 4HXKA 2YW5A 1ZKRA 3JVJA 4N3WA 1E6IA 4TZ2A 4LZRA 4QY4A 4ZQLA 2E7NA 2F6JA 5FFVA 4BW4A 5IGKA 4QSRA 5EA1A 5FB1A 4YBSA 4MR3A 4YAXA 5DW2A 3LQJA 4QEWA 3UVYA 4LZ2A 2DATA 4A9NA 4NQNA 5K29A 5FE2A 4QR5A 4LYWA 3DAIA 4NR7A 5E9MA 5F60A 4UIUA 3SVFA 5CFWA 5EWDA 5CUAA 5BT5A 4UIYA 3IU5A 5CTLA 4QEUA 2OUOA 2N9GA 4MEQA 5FG4A 2YELA 5FBXA 4AKHA 3I3JA 4QSPA 5FFYA 5EV9A 5FE4A 4YYGA 3UVDA 5ETBA 3TLPA 5D3HA 3MUKA 1X0JA 5IBNA 5CY9A 3JVMA 4NRCA 3LQIA 4YABA 5KTWA 4PS5A 5LVQA 5COIA 5D3PA 4QSSA 5CUGA 4NR5A 5F2PA 5EI4A 4OGJA 5CQ3A 4BJXA 3AADA 2WP2A 5E9LA 5ENEA 4XUAA 5EWWA 3O35A 4YH4A 5DLZA 4HXPA 3MB3A 5F62A 5A5QA 2F6NA 4N4IA 5KHMA 5F5ZA 3JVLA 4TTEA 5EVAA 2NXBA 2D82A 4QYLA 3DWYA 5D3TA 4YH3A 5CQTA 4ALHA 2MJVB 5EICA 4J1PA 5F1HA 5HEMA 5ENBA 3D1DA 3MB4A 4HBXA 5FE0A 4UYDA 5FG6A 3NXBA 5CQ8A 2FSAA 4Z1SA 5HFRA 5JI8A 4Z1QA 5C8GA 3U5OA 4HXMA 4YK0A 4Q0NA 3RCWA 5E9IA 2L85A 3P5OA 5D3LA 5FB0A 5G4SA 4LC2A 3ZYUA 4TYLA 4O74A 5H1TA 3UV4A 2GRCA 5TCMA 3G0JA 5C85A 4O72A 4E96A 4XUBA 5ENGA 5LKTA 5F3AA 4PCEA 4NYVA 4C67A 4O7AA 4QC3A 5D25A 5F1LA 3GG3A 3U5MA 4J0RA 4TU6A 4YADA 4AI6A 2I7KA 4NS5A 2R0YA 5EK9A 5I1QA 5BT3A 1WUMA
chains in the Genus database with same CATH topology
2YQDA 5LJ1A 4LYIA 5D3SA 5HENA 4UYHA 4UIWA 5DYXA 5FE5A 4QSXA 4BW3A 3P1DA 4UIZA 3QZVA 5D26A 5A85A 4O76A 4O7EA 4QSWA 1ZS5A 5E9KA 4QSQA 2DVSA 4O7FA 5E74A 5ENHA 5DYUA 4KV4A 3UV2A 5LJ0A 5D24A 5ETDA 4A9OA 5IGNA 4A9KA 4CLBA 4NR6A 4X2IA 3MXFA 3O37A 5E3DA 5L99A 5CU8A 3HMHA 5D3JA 5F61A 4UYFA 4CUUA 4TU4A 5A5SA 3IU6A 4CFKA 5FG5A 5F36A 2DKWA 5CRMA 5A5PA 2G4AA 5II2A 3UW9A 2E7OA 3AQAA 4QSVA 5J0DA 2DVQA 4IR6A 4QYDA 4CUSA 5A5OA 4Z93A 5C4QA 5LKXA 1N72A 4O71A 4ZW1A 5DFDA 3Q2FA 4NQMA 4GPJA 5IIDA 5FE8A 5FE9A 4QR4A 5ENJA 5HQ6A 4CUQA 5EP7A 4HXRA 1JSPB 4YYHA 4HXSA 5L8TA 4O78A 4A9MA 5DY7A 5EPBA 5EM3A 4ZC9A 2E3KA 4J0SA 4BW1A 5FE3A 5I29A 4QSTA 4A9JA 2WP1A 2R0SA 4C66A 1EQFA 3LXJA 3LQHA 4TT4A 5EWCA 4HXNA 5CUBA 4QB3A 4FLPA 3UVXA 5DYCA 4J3IA 4Z6IA 4HBVA 4LDFA 4O70A 4N4HA 2L5EA 4HXOA 4YYMA 2RNXA 4XY8A 4N4FA 5CQ5A 5EPSA 2DVRA 4Z6HA 4WIVA 4O77A 3QZSA 3U5LA 2YEKA 5EPRA 3SVHA 5FH7A 5CPEA 4LR6A 4MEOA 4HBYA 5DYAA 4UITA 5CGPA 5I86A 5HQ5A 5HRXA 5E3GA 3MULA 5D0CA 5F63A 4NRBA 4YATA 5CS8A 5H1VA 5LUUA 5E9VA 4PCIA 5KTUA 5C87A 5IG6A 5AMFA 5E9YA 2RO1A 4O75A 5I80A 5FH6A 4YC9A 5HLSA 5EU1A 4QC1A 5L97A 4WHUA 4A9HA 3S91A 5IGMA 2YYNA 4YBTA 5EWVA 4CL9A 5HQ7A 4A9EA 3HMFA 5F25A 5FE1A 4IOQA 3P1CA 4UYFB 4RVRA 4MR5A 4NYWA 4NXJA 3Q2EA 4NR9A 5II1A 5DKCA 4UYGA 5E7DA 5IGLA 5CUEA 5E0RA 5LVRA 2I8NA 2L84A 5FH8A 4XYAA 4PTBA 3LJWA 4LZSA 4IR4A 4XY9A 4O7BA 4TT6A 4UYEA 5I7YA 4HXLA 4HBWA 5EISA 2DWWA 2YDWA 3O34A 4NR8A 5CQ6A 4YYNA 4PY6A 5I89A 3SVGA 2RI7A 4KV1A 4AKNA 4PKLA 4BW2A 4YBMA 4QBMA 5CRZA 4DONA 2RS9B 4OUFA 2R0VA 4UIVA 5I83A 4QR3A 2RNYA 5DFCA 4OGIA 4LYSA 5CQAA 5AD2A 5ACYA 4NUDA 2H60A 5HJCA 5FFWA 1WUGA 3JVKA 4IR5A 5D3RA 5L96A 4WHWA 5D3NA 5A83A 5DX4A 5A5RA 4YYJA 5FE7A 3U5PA 5LJ2A 4Y03A 3G0LA 4A9FA 4LRGA 4NYXA 5CQ4A 4NUEA 2OSSA 5H85A 5JWMA 5HFQA 4YYKA 5CUDA 3U5JA 5CUCA 5DBMA 4BHWA 1JM4B 5FDZA 5G4RA 4A9IA 2RFJA 2OO1A 5DFBA 4IOOA 4N4GA 5A82A 2RNWA 4MENA 4IR3A 4NRAA 4QSUA 5I88A 4YY4A 5DW1A 4CFLA 4A9LA 5HCLA 4QEVA 5A81A 5L8UA 4UIXA 5C89A 4O7CA 4QNSA 4MR4A 4NUCA 4MR6A 3UVWA 5AD3A 5HRVA 5ENFA 4CUPA 5D7XA 5DLXA 3D7CA 5C7NA 4TS8A 3U5KA 5H1UA 4IORA 3P1EA 5LKZA 2R10A 5A7CA 4QZSA 5L98A 4NR4A 5ENIA 5TB6A 1F68A 4KCXA 3QZTA 2DVVA 5DKDA 5HELA 4YYDA 3P1FA 4TQNA 5HRWA 3O36A 3HMEA 5EQ1A 5CP5A 5CZGA 3S92A 4TT2A 5EGUA 3FKMX 4QUUA 5I40A 5LKUA 5HM0A 2KTBB 2D9EA 3O33A 5BT4A 5FE6A 5I7XA 4F3IA 3MQMA 5KU3A 4ALGA 5CQ7A 3UV5A 2YEMA 5ENCA 4YY6A 4CURA 3K2JA 5A5NA 4CUTA 5KO4A 5AMEA 2LSPB 3U5NA 5KTXA 5EWHA 4QUTA 4TZ8A 4MEPA 4Q0OA 4YYIA 5DKHA 5E73A 3ONIA 4HXKA 2YW5A 3JVJA 4N3WA 1E6IA 4TZ2A 4LZRA 4QY4A 4ZQLA 2E7NA 2F6JA 5FFVA 4BW4A 5IGKA 4QSRA 5EA1A 5FB1A 4YBSA 4MR3A 4YAXA 5DW2A 3LQJA 4QEWA 3UVYA 4LZ2A 2DATA 4A9NA 4NQNA 5K29A 5FE2A 4QR5A 4LYWA 3DAIA 4NR7A 5E9MA 5F60A 4UIUA 3SVFA 5CFWA 5EWDA 5CUAA 5BT5A 4UIYA 3IU5A 5CTLA 4QEUA 2OUOA 2N9GA 4MEQA 5FG4A 2YELA 5FBXA 3I3JA 4QSPA 5FFYA 5EV9A 5FE4A 4YYGA 3UVDA 5ETBA 3TLPA 5D3HA 3MUKA 1X0JA 5IBNA 5CY9A 3JVMA 4NRCA 3LQIA 4YABA 5KTWA 4PS5A 5LVQA 5COIA 5D3PA 4QSSA 5CUGA 4NR5A 5F2PA 5EI4A 4OGJA 5CQ3A 4BJXA 3AADA 2WP2A 5E9LA 5ENEA 4XUAA 5EWWA 3O35A 4YH4A 5DLZA 4HXPA 3MB3A 5F62A 5A5QA 2F6NA 4N4IA 5KHMA 5F5ZA 3JVLA 4TTEA 5EVAA 2NXBA 2D82A 4QYLA 3DWYA 5D3TA 4YH3A 5CQTA 4ALHA 2MJVB 5EICA 4J1PA 5F1HA 5HEMA 5ENBA 3MB4A 4HBXA 5FE0A 4UYDA 5FG6A 3NXBA 5CQ8A 2FSAA 4Z1SA 5HFRA 5JI8A 4Z1QA 5C8GA 3U5OA 4HXMA 4YK0A 4Q0NA 3RCWA 5E9IA 2L85A 3P5OA 5D3LA 5FB0A 5G4SA 4LC2A 3ZYUA 4TYLA 4O74A 5H1TA 3UV4A 2GRCA 5TCMA 3G0JA 5C85A 4O72A 4E96A 4XUBA 5ENGA 5LKTA 5F3AA 4PCEA 4NYVA 4C67A 4O7AA 4QC3A 5D25A 5F1LA 3GG3A 3U5MA 4J0RA 4TU6A 4YADA 2I7KA 4NS5A 2R0YA 5EK9A 5I1QA 5BT3A 1WUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQD A;  5LJ1 A;  4LYI A;  5D3S A;  5HEN A;  4UYH A;  4UIW A;  5DYX A;  5FE5 A;  4QSX A;  4BW3 A;  3P1D A;  4UIZ A;  3QZV A;  5D26 A;  5A85 A;  4O76 A;  4O7E A;  4QSW A;  1ZS5 A;  5E9K A;  4QSQ A;  2DVS A;  4O7F A;  5E74 A;  5ENH A;  5DYU A;  4KV4 A;  3UV2 A;  5LJ0 A;  5D24 A;  5ETD A;  4A9O A;  5IGN A;  4A9K A;  4CLB A;  4NR6 A;  4X2I A;  3MXF A;  3O37 A;  5E3D A;  5L99 A;  5CU8 A;  3HMH A;  5D3J A;  5F61 A;  4UYF A;  4CUU A;  4TU4 A;  5A5S A;  3IU6 A;  4CFK A;  5FG5 A;  5F36 A;  2DKW A;  5CRM A;  5A5P A;  2G4A A;  5II2 A;  3UW9 A;  2E7O A;  3AQA A;  4QSV A;  5J0D A;  2DVQ A;  4IR6 A;  4QYD A;  4CUS A;  5A5O A;  4Z93 A;  5C4Q A;  5LKX A;  1N72 A;  4O71 A;  4ZW1 A;  5DFD A;  3Q2F A;  4NQM A;  4GPJ A;  5IID A;  5FE8 A;  5FE9 A;  4QR4 A;  5ENJ A;  5HQ6 A;  4CUQ A;  5EP7 A;  4HXR A;  1JSP B;  4YYH A;  4HXS A;  5L8T A;  4O78 A;  4A9M A;  5DY7 A;  5EPB A;  5EM3 A;  4ZC9 A;  2E3K A;  4J0S A;  4BW1 A;  5FE3 A;  5I29 A;  4QST A;  4A9J A;  2WP1 A;  2R0S A;  4C66 A;  1EQF A;  3LXJ A;  3LQH A;  4TT4 A;  5EWC A;  4HXN A;  5CUB A;  4QB3 A;  4FLP A;  3UVX A;  5DYC A;  4J3I A;  4Z6I A;  4HBV A;  4LDF A;  4O70 A;  4N4H A;  2L5E A;  4HXO A;  4YYM A;  2RNX A;  4XY8 A;  4N4F A;  5CQ5 A;  5EPS A;  2DVR A;  4Z6H A;  4WIV A;  4O77 A;  3QZS A;  3U5L A;  2YEK A;  5EPR A;  3SVH A;  5FH7 A;  5CPE A;  4LR6 A;  4MEO A;  4HBY A;  5DYA A;  4UIT A;  5CGP A;  5I86 A;  5HQ5 A;  5HRX A;  5E3G A;  3MUL A;  5D0C A;  5F63 A;  4NRB A;  4YAT A;  5CS8 A;  5H1V A;  5LUU A;  5E9V A;  4PCI A;  5KTU A;  5C87 A;  5IG6 A;  5AMF A;  5E9Y A;  2RO1 A;  4O75 A;  5I80 A;  5FH6 A;  4YC9 A;  5HLS A;  5EU1 A;  4QC1 A;  5L97 A;  4WHU A;  4A9H A;  3S91 A;  5IGM A;  2YYN A;  4YBT A;  5EWV A;  4CL9 A;  5HQ7 A;  4A9E A;  3HMF A;  5F25 A;  5FE1 A;  4IOQ A;  3P1C A;  4UYF B;  4RVR A;  4MR5 A;  4NYW A;  4NXJ A;  3Q2E A;  4NR9 A;  5II1 A;  5DKC A;  4UYG A;  5E7D A;  5IGL A;  5CUE A;  5E0R A;  5LVR A;  2I8N A;  2L84 A;  5FH8 A;  4XYA A;  4PTB A;  3LJW A;  4LZS A;  4IR4 A;  4XY9 A;  4O7B A;  4TT6 A;  4UYE A;  5I7Y A;  4HXL A;  4HBW A;  5EIS A;  2DWW A;  2YDW A;  3O34 A;  4NR8 A;  5CQ6 A;  4YYN A;  4PY6 A;  5I89 A;  3SVG A;  2RI7 A;  4KV1 A;  4AKN A;  4PKL A;  4BW2 A;  4YBM A;  4QBM A;  5CRZ A;  4DON A;  2RS9 B;  4OUF A;  2R0V A;  4UIV A;  5I83 A;  4QR3 A;  2RNY A;  5DFC A;  4OGI A;  4LYS A;  5CQA A;  5AD2 A;  5ACY A;  4NUD A;  2H60 A;  5HJC A;  5FFW A;  1WUG A;  3JVK A;  4IR5 A;  5D3R A;  5L96 A;  4WHW A;  5D3N A;  5A83 A;  5DX4 A;  5A5R A;  4YYJ A;  5FE7 A;  3U5P A;  5LJ2 A;  4Y03 A;  3G0L A;  4A9F A;  4LRG A;  4NYX A;  5CQ4 A;  4NUE A;  2OSS A;  5H85 A;  5JWM A;  5HFQ A;  4YYK A;  5CUD A;  3U5J A;  5CUC A;  5DBM A;  4BHW A;  1JM4 B;  5FDZ A;  5G4R A;  4A9I A;  2RFJ A;  2OO1 A;  5DFB A;  4IOO A;  4N4G A;  5A82 A;  2RNW A;  4MEN A;  4IR3 A;  4NRA A;  4QSU A;  5I88 A;  4YY4 A;  5DW1 A;  4CFL A;  4A9L A;  5HCL A;  4QEV A;  5A81 A;  5L8U A;  4UIX A;  5C89 A;  4O7C A;  4QNS A;  4MR4 A;  4NUC A;  4MR6 A;  3UVW A;  5AD3 A;  5HRV A;  5ENF A;  4CUP A;  5D7X A;  5DLX A;  3D7C A;  5C7N A;  4TS8 A;  3U5K A;  5H1U A;  4IOR A;  3P1E A;  5LKZ A;  2R10 A;  5A7C A;  4QZS A;  5L98 A;  4NR4 A;  5ENI A;  5TB6 A;  1F68 A;  4KCX A;  3QZT A;  2DVV A;  5DKD A;  5HEL A;  4YYD A;  3P1F A;  4TQN A;  5HRW A;  3O36 A;  3HME A;  5EQ1 A;  5CP5 A;  5CZG A;  3S92 A;  4TT2 A;  5EGU A;  3FKM X;  4QUU A;  5I40 A;  5LKU A;  5HM0 A;  2KTB B;  2D9E A;  3O33 A;  5BT4 A;  5FE6 A;  5I7X A;  4F3I A;  3MQM A;  5KU3 A;  4ALG A;  5CQ7 A;  3UV5 A;  2YEM A;  5ENC A;  4YY6 A;  4CUR A;  3K2J A;  5A5N A;  4CUT A;  5KO4 A;  5AME A;  2LSP B;  3U5N A;  5KTX A;  5EWH A;  4QUT A;  4TZ8 A;  4MEP A;  4Q0O A;  4YYI A;  5DKH A;  5E73 A;  3ONI A;  4HXK A;  2YW5 A;  3JVJ A;  4N3W A;  1E6I A;  4TZ2 A;  4LZR A;  4QY4 A;  4ZQL A;  2E7N A;  2F6J A;  5FFV A;  4BW4 A;  5IGK A;  4QSR A;  5EA1 A;  5FB1 A;  4YBS A;  4MR3 A;  4YAX A;  5DW2 A;  3LQJ A;  4QEW A;  3UVY A;  4LZ2 A;  2DAT A;  4A9N A;  4NQN A;  5K29 A;  5FE2 A;  4QR5 A;  4LYW A;  3DAI A;  4NR7 A;  5E9M A;  5F60 A;  4UIU A;  3SVF A;  5CFW A;  5EWD A;  5CUA A;  5BT5 A;  4UIY A;  3IU5 A;  5CTL A;  4QEU A;  2OUO A;  2N9G A;  4MEQ A;  5FG4 A;  2YEL A;  5FBX A;  3I3J A;  4QSP A;  5FFY A;  5EV9 A;  5FE4 A;  4YYG A;  3UVD A;  5ETB A;  3TLP A;  5D3H A;  3MUK A;  1X0J A;  5IBN A;  5CY9 A;  3JVM A;  4NRC A;  3LQI A;  4YAB A;  5KTW A;  4PS5 A;  5LVQ A;  5COI A;  5D3P A;  4QSS A;  5CUG A;  4NR5 A;  5F2P A;  5EI4 A;  4OGJ A;  5CQ3 A;  4BJX A;  3AAD A;  2WP2 A;  5E9L A;  5ENE A;  4XUA A;  5EWW A;  3O35 A;  4YH4 A;  5DLZ A;  4HXP A;  3MB3 A;  5F62 A;  5A5Q A;  2F6N A;  4N4I A;  5KHM A;  5F5Z A;  3JVL A;  4TTE A;  5EVA A;  2NXB A;  2D82 A;  4QYL A;  3DWY A;  5D3T A;  4YH3 A;  5CQT A;  4ALH A;  2MJV B;  5EIC A;  4J1P A;  5F1H A;  5HEM A;  5ENB A;  3MB4 A;  4HBX A;  5FE0 A;  4UYD A;  5FG6 A;  3NXB A;  5CQ8 A;  2FSA A;  4Z1S A;  5HFR A;  5JI8 A;  4Z1Q A;  5C8G A;  3U5O A;  4HXM A;  4YK0 A;  4Q0N A;  3RCW A;  5E9I A;  2L85 A;  3P5O A;  5D3L A;  5FB0 A;  5G4S A;  4LC2 A;  3ZYU A;  4TYL A;  4O74 A;  5H1T A;  3UV4 A;  2GRC A;  5TCM A;  3G0J A;  5C85 A;  4O72 A;  4E96 A;  4XUB A;  5ENG A;  5LKT A;  5F3A A;  4PCE A;  4NYV A;  4C67 A;  4O7A A;  4QC3 A;  5D25 A;  5F1L A;  3GG3 A;  3U5M A;  4J0R A;  4TU6 A;  4YAD A;  2I7K A;  4NS5 A;  2R0Y A;  5EK9 A;  5I1Q A;  5BT3 A;  1WUM A; 
#chains in the Genus database with same CATH topology
 2YQD A;  5LJ1 A;  4LYI A;  5D3S A;  5HEN A;  4UYH A;  4UIW A;  5DYX A;  5FE5 A;  4QSX A;  4BW3 A;  3P1D A;  4UIZ A;  3QZV A;  5D26 A;  5A85 A;  4O76 A;  4O7E A;  4QSW A;  1ZS5 A;  5E9K A;  4QSQ A;  2DVS A;  4O7F A;  5E74 A;  5ENH A;  5DYU A;  4KV4 A;  3UV2 A;  5LJ0 A;  5D24 A;  5ETD A;  4A9O A;  5IGN A;  4A9K A;  4CLB A;  4NR6 A;  4X2I A;  3MXF A;  3O37 A;  5E3D A;  5L99 A;  5CU8 A;  3HMH A;  5D3J A;  5F61 A;  4UYF A;  4CUU A;  4TU4 A;  5A5S A;  3IU6 A;  4CFK A;  5FG5 A;  5F36 A;  2DKW A;  5CRM A;  5A5P A;  2G4A A;  5II2 A;  3UW9 A;  2E7O A;  3AQA A;  4QSV A;  5J0D A;  2DVQ A;  4IR6 A;  4QYD A;  4CUS A;  5A5O A;  4Z93 A;  5C4Q A;  5LKX A;  1N72 A;  4O71 A;  4ZW1 A;  5DFD A;  3Q2F A;  4NQM A;  4GPJ A;  5IID A;  5FE8 A;  5FE9 A;  4QR4 A;  5ENJ A;  5HQ6 A;  4CUQ A;  5EP7 A;  4HXR A;  1JSP B;  4YYH A;  4HXS A;  5L8T A;  4O78 A;  4A9M A;  5DY7 A;  5EPB A;  5EM3 A;  4ZC9 A;  2E3K A;  4J0S A;  4BW1 A;  5FE3 A;  3D1B A;  5I29 A;  4QST A;  4A9J A;  2WP1 A;  2R0S A;  4C66 A;  1EQF A;  3LXJ A;  3LQH A;  4TT4 A;  5EWC A;  4HXN A;  5CUB A;  4QB3 A;  4FLP A;  3UVX A;  5DYC A;  4J3I A;  4Z6I A;  4HBV A;  4LDF A;  4O70 A;  4N4H A;  2L5E A;  4HXO A;  4YYM A;  2RNX A;  4XY8 A;  4N4F A;  5CQ5 A;  5EPS A;  2DVR A;  4Z6H A;  4WIV A;  4O77 A;  3QZS A;  3U5L A;  2YEK A;  5EPR A;  3SVH A;  5FH7 A;  5CPE A;  4LR6 A;  4MEO A;  4HBY A;  5DYA A;  4UIT A;  5CGP A;  5I86 A;  5HQ5 A;  5HRX A;  5E3G A;  3MUL A;  5D0C A;  5F63 A;  4NRB A;  4YAT A;  5CS8 A;  5H1V A;  5LUU A;  5E9V A;  4PCI A;  5KTU A;  5C87 A;  5IG6 A;  5AMF A;  5E9Y A;  2RO1 A;  4O75 A;  5I80 A;  5FH6 A;  4YC9 A;  5HLS A;  5EU1 A;  4QC1 A;  5L97 A;  4WHU A;  4A9H A;  3S91 A;  5IGM A;  1PUO A;  2YYN A;  4YBT A;  5EWV A;  4CL9 A;  5HQ7 A;  4A9E A;  3HMF A;  5F25 A;  5FE1 A;  4IOQ A;  2EJN A;  3P1C A;  4UYF B;  4RVR A;  4MR5 A;  4NYW A;  4NXJ A;  3Q2E A;  4NR9 A;  5II1 A;  5DKC A;  4UYG A;  5E7D A;  5IGL A;  5CUE A;  5E0R A;  5LVR A;  4AKI A;  2I8N A;  2L84 A;  5FH8 A;  4XYA A;  4PTB A;  3LJW A;  4LZS A;  4IR4 A;  4XY9 A;  4O7B A;  4TT6 A;  4UYE A;  5I7Y A;  4HXL A;  4HBW A;  5EIS A;  2DWW A;  4AKG A;  2YDW A;  3O34 A;  4NR8 A;  5CQ6 A;  4YYN A;  4PY6 A;  5I89 A;  3SVG A;  2RI7 A;  4KV1 A;  4AKN A;  4PKL A;  4BW2 A;  4YBM A;  4QBM A;  5CRZ A;  4DON A;  2RS9 B;  4OUF A;  2R0V A;  4UIV A;  5I83 A;  4QR3 A;  2RNY A;  5DFC A;  4OGI A;  4LYS A;  5CQA A;  5AD2 A;  5ACY A;  4NUD A;  2H60 A;  5HJC A;  5FFW A;  1WUG A;  3JVK A;  4IR5 A;  5D3R A;  5L96 A;  4WHW A;  5D3N A;  5A83 A;  5DX4 A;  5A5R A;  4YYJ A;  5FE7 A;  3U5P A;  5LJ2 A;  4Y03 A;  3G0L A;  4A9F A;  4LRG A;  4NYX A;  5CQ4 A;  4NUE A;  2OSS A;  5H85 A;  5JWM A;  5HFQ A;  3ERR A;  4YYK A;  5CUD A;  3U5J A;  5CUC A;  5DBM A;  4BHW A;  1JM4 B;  5FDZ A;  5G4R A;  4A9I A;  2RFJ A;  2OO1 A;  5DFB A;  4IOO A;  4N4G A;  5A82 A;  2RNW A;  4MEN A;  4IR3 A;  4NRA A;  4QSU A;  5I88 A;  4YY4 A;  5DW1 A;  4CFL A;  4A9L A;  5HCL A;  4QEV A;  5A81 A;  5L8U A;  4UIX A;  5C89 A;  4O7C A;  4QNS A;  4MR4 A;  4NUC A;  3VKH A;  4MR6 A;  3UVW A;  5AD3 A;  5HRV A;  5ENF A;  4CUP A;  5D7X A;  5DLX A;  3D7C A;  5C7N A;  4TS8 A;  3U5K A;  5H1U A;  4IOR A;  3P1E A;  5LKZ A;  2R10 A;  5A7C A;  4QZS A;  5L98 A;  4NR4 A;  5ENI A;  5TB6 A;  1F68 A;  4KCX A;  3QZT A;  2DVV A;  5DKD A;  5HEL A;  4YYD A;  3P1F A;  4TQN A;  5HRW A;  3O36 A;  3HME A;  5EQ1 A;  5CP5 A;  5CZG A;  3S92 A;  4TT2 A;  5EGU A;  3FKM X;  4QUU A;  5I40 A;  5LKU A;  5HM0 A;  2KTB B;  2D9E A;  3O33 A;  5BT4 A;  5FE6 A;  5I7X A;  4F3I A;  3MQM A;  5KU3 A;  4ALG A;  5CQ7 A;  3UV5 A;  2YEM A;  5ENC A;  3VKG A;  4YY6 A;  4CUR A;  3K2J A;  5A5N A;  4CUT A;  5KO4 A;  5AME A;  2LSP B;  3U5N A;  5KTX A;  5EWH A;  4QUT A;  4TZ8 A;  4MEP A;  4Q0O A;  4YYI A;  5DKH A;  5E73 A;  3ONI A;  4HXK A;  2YW5 A;  1ZKR A;  3JVJ A;  4N3W A;  1E6I A;  4TZ2 A;  4LZR A;  4QY4 A;  4ZQL A;  2E7N A;  2F6J A;  5FFV A;  4BW4 A;  5IGK A;  4QSR A;  5EA1 A;  5FB1 A;  4YBS A;  4MR3 A;  4YAX A;  5DW2 A;  3LQJ A;  4QEW A;  3UVY A;  4LZ2 A;  2DAT A;  4A9N A;  4NQN A;  5K29 A;  5FE2 A;  4QR5 A;  4LYW A;  3DAI A;  4NR7 A;  5E9M A;  5F60 A;  4UIU A;  3SVF A;  5CFW A;  5EWD A;  5CUA A;  5BT5 A;  4UIY A;  3IU5 A;  5CTL A;  4QEU A;  2OUO A;  2N9G A;  4MEQ A;  5FG4 A;  2YEL A;  5FBX A;  4AKH A;  3I3J A;  4QSP A;  5FFY A;  5EV9 A;  5FE4 A;  4YYG A;  3UVD A;  5ETB A;  3TLP A;  5D3H A;  3MUK A;  1X0J A;  5IBN A;  5CY9 A;  3JVM A;  4NRC A;  3LQI A;  4YAB A;  5KTW A;  4PS5 A;  5LVQ A;  5COI A;  5D3P A;  4QSS A;  5CUG A;  4NR5 A;  5F2P A;  5EI4 A;  4OGJ A;  5CQ3 A;  4BJX A;  3AAD A;  2WP2 A;  5E9L A;  5ENE A;  4XUA A;  5EWW A;  3O35 A;  4YH4 A;  5DLZ A;  4HXP A;  3MB3 A;  5F62 A;  5A5Q A;  2F6N A;  4N4I A;  5KHM A;  5F5Z A;  3JVL A;  4TTE A;  5EVA A;  2NXB A;  2D82 A;  4QYL A;  3DWY A;  5D3T A;  4YH3 A;  5CQT A;  4ALH A;  2MJV B;  5EIC A;  4J1P A;  5F1H A;  5HEM A;  5ENB A;  3D1D A;  3MB4 A;  4HBX A;  5FE0 A;  4UYD A;  5FG6 A;  3NXB A;  5CQ8 A;  2FSA A;  4Z1S A;  5HFR A;  5JI8 A;  4Z1Q A;  5C8G A;  3U5O A;  4HXM A;  4YK0 A;  4Q0N A;  3RCW A;  5E9I A;  2L85 A;  3P5O A;  5D3L A;  5FB0 A;  5G4S A;  4LC2 A;  3ZYU A;  4TYL A;  4O74 A;  5H1T A;  3UV4 A;  2GRC A;  5TCM A;  3G0J A;  5C85 A;  4O72 A;  4E96 A;  4XUB A;  5ENG A;  5LKT A;  5F3A A;  4PCE A;  4NYV A;  4C67 A;  4O7A A;  4QC3 A;  5D25 A;  5F1L A;  3GG3 A;  3U5M A;  4J0R A;  4TU6 A;  4YAD A;  4AI6 A;  2I7K A;  4NS5 A;  2R0Y A;  5EK9 A;  5I1Q A;  5BT3 A;  1WUM A; 
#chains in the Genus database with same CATH homology
 2YQD A;  5LJ1 A;  4LYI A;  5D3S A;  5HEN A;  4UYH A;  4UIW A;  5DYX A;  5FE5 A;  4QSX A;  4BW3 A;  3P1D A;  4UIZ A;  3QZV A;  5D26 A;  5A85 A;  4O76 A;  4O7E A;  4QSW A;  1ZS5 A;  5E9K A;  4QSQ A;  2DVS A;  4O7F A;  5E74 A;  5ENH A;  5DYU A;  4KV4 A;  3UV2 A;  5LJ0 A;  5D24 A;  5ETD A;  4A9O A;  5IGN A;  4A9K A;  4CLB A;  4NR6 A;  4X2I A;  3MXF A;  3O37 A;  5E3D A;  5L99 A;  5CU8 A;  3HMH A;  5D3J A;  5F61 A;  4UYF A;  4CUU A;  4TU4 A;  5A5S A;  3IU6 A;  4CFK A;  5FG5 A;  5F36 A;  2DKW A;  5CRM A;  5A5P A;  2G4A A;  5II2 A;  3UW9 A;  2E7O A;  3AQA A;  4QSV A;  5J0D A;  2DVQ A;  4IR6 A;  4QYD A;  4CUS A;  5A5O A;  4Z93 A;  5C4Q A;  5LKX A;  1N72 A;  4O71 A;  4ZW1 A;  5DFD A;  3Q2F A;  4NQM A;  4GPJ A;  5IID A;  5FE8 A;  5FE9 A;  4QR4 A;  5ENJ A;  5HQ6 A;  4CUQ A;  5EP7 A;  4HXR A;  1JSP B;  4YYH A;  4HXS A;  5L8T A;  4O78 A;  4A9M A;  5DY7 A;  5EPB A;  5EM3 A;  4ZC9 A;  2E3K A;  4J0S A;  4BW1 A;  5FE3 A;  5I29 A;  4QST A;  4A9J A;  2WP1 A;  2R0S A;  4C66 A;  1EQF A;  3LXJ A;  3LQH A;  4TT4 A;  5EWC A;  4HXN A;  5CUB A;  4QB3 A;  4FLP A;  3UVX A;  5DYC A;  4J3I A;  4Z6I A;  4HBV A;  4LDF A;  4O70 A;  4N4H A;  2L5E A;  4HXO A;  4YYM A;  2RNX A;  4XY8 A;  4N4F A;  5CQ5 A;  5EPS A;  2DVR A;  4Z6H A;  4WIV A;  4O77 A;  3QZS A;  3U5L A;  2YEK A;  5EPR A;  3SVH A;  5FH7 A;  5CPE A;  4LR6 A;  4MEO A;  4HBY A;  5DYA A;  4UIT A;  5CGP A;  5I86 A;  5HQ5 A;  5HRX A;  5E3G A;  3MUL A;  5D0C A;  5F63 A;  4NRB A;  4YAT A;  5CS8 A;  5H1V A;  5LUU A;  5E9V A;  4PCI A;  5KTU A;  5C87 A;  5IG6 A;  5AMF A;  5E9Y A;  2RO1 A;  4O75 A;  5I80 A;  5FH6 A;  4YC9 A;  5HLS A;  5EU1 A;  4QC1 A;  5L97 A;  4WHU A;  4A9H A;  3S91 A;  5IGM A;  2YYN A;  4YBT A;  5EWV A;  4CL9 A;  5HQ7 A;  4A9E A;  3HMF A;  5F25 A;  5FE1 A;  4IOQ A;  3P1C A;  4UYF B;  4RVR A;  4MR5 A;  4NYW A;  4NXJ A;  3Q2E A;  4NR9 A;  5II1 A;  5DKC A;  4UYG A;  5E7D A;  5IGL A;  5CUE A;  5E0R A;  5LVR A;  2I8N A;  2L84 A;  5FH8 A;  4XYA A;  4PTB A;  3LJW A;  4LZS A;  4IR4 A;  4XY9 A;  4O7B A;  4TT6 A;  4UYE A;  5I7Y A;  4HXL A;  4HBW A;  5EIS A;  2DWW A;  2YDW A;  3O34 A;  4NR8 A;  5CQ6 A;  4YYN A;  4PY6 A;  5I89 A;  3SVG A;  2RI7 A;  4KV1 A;  4AKN A;  4PKL A;  4BW2 A;  4YBM A;  4QBM A;  5CRZ A;  4DON A;  2RS9 B;  4OUF A;  2R0V A;  4UIV A;  5I83 A;  4QR3 A;  2RNY A;  5DFC A;  4OGI A;  4LYS A;  5CQA A;  5AD2 A;  5ACY A;  4NUD A;  2H60 A;  5HJC A;  5FFW A;  1WUG A;  3JVK A;  4IR5 A;  5D3R A;  5L96 A;  4WHW A;  5D3N A;  5A83 A;  5DX4 A;  5A5R A;  4YYJ A;  5FE7 A;  3U5P A;  5LJ2 A;  4Y03 A;  3G0L A;  4A9F A;  4LRG A;  4NYX A;  5CQ4 A;  4NUE A;  2OSS A;  5H85 A;  5JWM A;  5HFQ A;  4YYK A;  5CUD A;  3U5J A;  5CUC A;  5DBM A;  4BHW A;  1JM4 B;  5FDZ A;  5G4R A;  4A9I A;  2RFJ A;  2OO1 A;  5DFB A;  4IOO A;  4N4G A;  5A82 A;  2RNW A;  4MEN A;  4IR3 A;  4NRA A;  4QSU A;  5I88 A;  4YY4 A;  5DW1 A;  4CFL A;  4A9L A;  5HCL A;  4QEV A;  5A81 A;  5L8U A;  4UIX A;  5C89 A;  4O7C A;  4QNS A;  4MR4 A;  4NUC A;  4MR6 A;  3UVW A;  5AD3 A;  5HRV A;  5ENF A;  4CUP A;  5D7X A;  5DLX A;  3D7C A;  5C7N A;  4TS8 A;  3U5K A;  5H1U A;  4IOR A;  3P1E A;  5LKZ A;  2R10 A;  5A7C A;  4QZS A;  5L98 A;  4NR4 A;  5ENI A;  5TB6 A;  1F68 A;  4KCX A;  3QZT A;  2DVV A;  5DKD A;  5HEL A;  4YYD A;  3P1F A;  4TQN A;  5HRW A;  3O36 A;  3HME A;  5EQ1 A;  5CP5 A;  5CZG A;  3S92 A;  4TT2 A;  5EGU A;  3FKM X;  4QUU A;  5I40 A;  5LKU A;  5HM0 A;  2KTB B;  2D9E A;  3O33 A;  5BT4 A;  5FE6 A;  5I7X A;  4F3I A;  3MQM A;  5KU3 A;  4ALG A;  5CQ7 A;  3UV5 A;  2YEM A;  5ENC A;  4YY6 A;  4CUR A;  3K2J A;  5A5N A;  4CUT A;  5KO4 A;  5AME A;  2LSP B;  3U5N A;  5KTX A;  5EWH A;  4QUT A;  4TZ8 A;  4MEP A;  4Q0O A;  4YYI A;  5DKH A;  5E73 A;  3ONI A;  4HXK A;  2YW5 A;  3JVJ A;  4N3W A;  1E6I A;  4TZ2 A;  4LZR A;  4QY4 A;  4ZQL A;  2E7N A;  2F6J A;  5FFV A;  4BW4 A;  5IGK A;  4QSR A;  5EA1 A;  5FB1 A;  4YBS A;  4MR3 A;  4YAX A;  5DW2 A;  3LQJ A;  4QEW A;  3UVY A;  4LZ2 A;  2DAT A;  4A9N A;  4NQN A;  5K29 A;  5FE2 A;  4QR5 A;  4LYW A;  3DAI A;  4NR7 A;  5E9M A;  5F60 A;  4UIU A;  3SVF A;  5CFW A;  5EWD A;  5CUA A;  5BT5 A;  4UIY A;  3IU5 A;  5CTL A;  4QEU A;  2OUO A;  2N9G A;  4MEQ A;  5FG4 A;  2YEL A;  5FBX A;  3I3J A;  4QSP A;  5FFY A;  5EV9 A;  5FE4 A;  4YYG A;  3UVD A;  5ETB A;  3TLP A;  5D3H A;  3MUK A;  1X0J A;  5IBN A;  5CY9 A;  3JVM A;  4NRC A;  3LQI A;  4YAB A;  5KTW A;  4PS5 A;  5LVQ A;  5COI A;  5D3P A;  4QSS A;  5CUG A;  4NR5 A;  5F2P A;  5EI4 A;  4OGJ A;  5CQ3 A;  4BJX A;  3AAD A;  2WP2 A;  5E9L A;  5ENE A;  4XUA A;  5EWW A;  3O35 A;  4YH4 A;  5DLZ A;  4HXP A;  3MB3 A;  5F62 A;  5A5Q A;  2F6N A;  4N4I A;  5KHM A;  5F5Z A;  3JVL A;  4TTE A;  5EVA A;  2NXB A;  2D82 A;  4QYL A;  3DWY A;  5D3T A;  4YH3 A;  5CQT A;  4ALH A;  2MJV B;  5EIC A;  4J1P A;  5F1H A;  5HEM A;  5ENB A;  3MB4 A;  4HBX A;  5FE0 A;  4UYD A;  5FG6 A;  3NXB A;  5CQ8 A;  2FSA A;  4Z1S A;  5HFR A;  5JI8 A;  4Z1Q A;  5C8G A;  3U5O A;  4HXM A;  4YK0 A;  4Q0N A;  3RCW A;  5E9I A;  2L85 A;  3P5O A;  5D3L A;  5FB0 A;  5G4S A;  4LC2 A;  3ZYU A;  4TYL A;  4O74 A;  5H1T A;  3UV4 A;  2GRC A;  5TCM A;  3G0J A;  5C85 A;  4O72 A;  4E96 A;  4XUB A;  5ENG A;  5LKT A;  5F3A A;  4PCE A;  4NYV A;  4C67 A;  4O7A A;  4QC3 A;  5D25 A;  5F1L A;  3GG3 A;  3U5M A;  4J0R A;  4TU6 A;  4YAD A;  2I7K A;  4NS5 A;  2R0Y A;  5EK9 A;  5I1Q A;  5BT3 A;  1WUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...