5F3AA

Crystal structure of the bromodomain of human atad2 in complex with compound a14
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Crystal structure of the bromodomain of human ATAD2 in complex with Compound A14
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f3aA00
5I40A 3TLPA 3JVKA 4PS5A 4O76A 4OGJA 4PKLA 5DLZA 5HCLA 3NXBA 5CGPA 5HFRA 4TYLA 4KV4A 5FE2A 4O71A 5LJ1A 2MJVB 5HEMA 5EU1A 5D3JA 4UIYA 4UIXA 5EWCA 5A7CA 4C66A 4FLPA 4XY9A 3QZVA 4N4IA 3UV5A 5C7NA 5HM0A 3SVGA 2OO1A 4QB3A 3MB3A 1JSPB 5E9MA 2DVSA 5DY7A 5A81A 4A9OA 5LKUA 5EWHA 5CQ3A 4LZ2A 4QEWA 5A5SA 1WUGA 5DFCA 5DFBA 5D3HA 4PCEA 4UYFB 4E96A 4CFLA 3LJWA 5E73A 3HMHA 4O7BA 5ENEA 5E9YA 3LQIA 4J3IA 5F1LA 4QR4A 3UVDA 4YY4A 5DBMA 4MEQA 2OUOA 3LQJA 4QSTA 4CUUA 4NR5A 2YW5A 5FE8A 4NYVA 5CQ7A 5ETDA 2I7KA 4QUUA 3O34A 5I83A 5F1HA 4HXOA 4ZC9A 2RS9B 4MENA 3G0LA 2DVQA 4NR6A 4IORA 3Q2FA 5LVRA 5FB1A 4OGIA 4MEOA 4YYIA 5L98A 5CQ4A 3JVLA 5DYAA 2I8NA 5L96A 5AMEA 4GPJA 5E3DA 3DWYA 4O74A 3UW9A 4A9HA 5ENHA 4QEVA 5EWDA 2R10A 5D3PA 4YYGA 4O77A 5DLXA 5EK9A 3MUKA 5C8GA 5ETBA 4ALGA 5I7XA 5F63A 3UV4A 5C4QA 5IGMA 5CUDA 4QC1A 5AMFA 4NRCA 3IU6A 5E74A 5IGLA 4YYKA 2WP1A 4O7EA 4ALHA 3GG3A 1ZS5A 5CP5A 4TU6A 5DKCA 5HENA 4LYWA 4PY6A 5CU8A 5ENJA 5J0DA 4QNSA 5EA1A 4QR5A 4ZW1A 5EQ1A 4WHWA 5F61A 5D3RA 4Z93A 5E9KA 5KTWA 4HBXA 4LDFA 5D3NA 4O7CA 5EPBA 2E3KA 4RVRA 4O7AA 5CUEA 5IG6A 4QSSA 5CPEA 5EP7A 5HQ5A 3P1FA 4Q0OA 3SVHA 4LZSA 2E7NA 5CTLA 5DKDA 5HLSA 2R0YA 5ENFA 1X0JA 2LSPB 2R0SA 4MR5A 5CUGA 4C67A 3UVXA 4HXLA 4IOOA 5HRVA 4LYSA 3FKMX 4TT6A 4NR9A 2F6JA 3U5JA 4XUAA 4BW3A 2D82A 5F3AA 4UYEA 4YAXA 3S92A 5HRWA 4O75A 5L97A 2RO1A 2NXBA 5AD3A 4MR3A 3QZTA 3U5PA 2WP2A 4BW2A 5D7XA 4CLBA 4UYHA 5E0RA 4IR3A 5ENCA 2KTBB 4UYDA 4CURA 5A5RA 3O33A 4UYFA 4TZ8A 4N4GA 5CFWA 3U5NA 1F68A 4TS8A 4BJXA 4NS5A 3UVWA 5G4RA 4CFKA 5CQ6A 4NXJA 5I1QA 4KCXA 2DVRA 2RNYA 2YDWA 4N4HA 5F36A 4Z1QA 2F6NA 4J0RA 5H1VA 5FFVA 5FE5A 5D26A 3P5OA 5HJCA 4XYAA 3O37A 5A82A 5EISA 4A9LA 1JM4B 2YQDA 5IGNA 4UYGA 5BT3A 5KHMA 4HBVA 5I7YA 5EGUA 2L85A 3I3JA 5I80A 1N72A 3P1EA 5D3LA 5FE3A 4Q0NA 5IGKA 3MB4A 4O72A 4NRBA 4YYHA 4HBYA 5EWVA 4TT2A 5BT5A 5D24A 4A9KA 4UIWA 2DATA 4NQNA 2H60A 2D9EA 4QSUA 4XY8A 5DW2A 4IR6A 4NUEA 5A83A 4NR8A 5KU3A 4NUDA 4NYXA 5A5PA 3ZYUA 3AADA 5CUCA 3P1CA 5F25A 2RNXA 5E7DA 5LUUA 2RNWA 5LKTA 5FG5A 4ZQLA 5CQ8A 2N9GA 4YYMA 5L8TA 3RCWA 4O7FA 5FE0A 4CUTA 4A9NA 1EQFA 5C85A 5FH6A 5DFDA 5L99A 5CZGA 5D0CA 5CY9A 4YABA 5FH7A 4Y03A 5FE6A 4A9FA 5LJ0A 5CQAA 4YY6A 4UIUA 2GRCA 4NR4A 5BT4A 5H85A 4YH3A 4YH4A 4QSPA 3AQAA 4TU4A 5FE7A 5ENBA 4YBSA 2YYNA 4A9EA 2DKWA 4O78A 4NUCA 5DKHA 3U5KA 4QY4A 4KV1A 4NQMA 5HQ7A 5E3GA 5DYXA 5JI8A 5AD2A 5FB0A 5D3SA 5II1A 5E9LA 3DAIA 5COIA 4YYNA 4TTEA 5CQTA 4A9MA 4CUSA 5HQ6A 5D25A 5A5OA 1WUMA 4QBMA 5FE9A 4PCIA 4XUBA 4YYJA 4TT4A 4QSXA 5JWMA 5EPSA 4YBMA 4CUPA 4UIZA 5C89A 5K29A 5FH8A 5A5NA 3O36A 5H1TA 5C87A 5FBXA 5HFQA 3MQMA 5DX4A 4QUTA 3P1DA 4QR3A 4HXKA 4HXSA 5FG4A 3HMEA 5ACYA 3SVFA 5HRXA 3IU5A 2RI7A 4HXNA 5E9VA 5G4SA 3G0JA 2G4AA 4MR4A 5TCMA 5TB6A 4A9IA 4QYDA 4IR5A 2YEKA 5KO4A 4LZRA 5DYCA 1E6IA 4CUQA 4F3IA 3MULA 5FE1A 5ENIA 5LKXA 3D7CA 5E9IA 5FFYA 4J0SA 4Z6HA 5ENGA 4Z1SA 2FSAA 4MR6A 4Z6IA 3LQHA 5FG6A 4N3WA 4QSRA 3LXJA 5II2A 4QSWA 5FE4A 4PTBA 4QSQA 4UITA 5I89A 5I88A 4NRAA 4BW4A 4YATA 4WIVA 3UV2A 4MEPA 4LYIA 2E7OA 3U5OA 5A5QA 4QEUA 4YK0A 2YELA 5LJ2A 5L8UA 2OSSA 2DWWA 5CS8A 4J1PA 4LC2A 5CRMA 5LVQA 5EI4A 4HBWA 4DONA 5DW1A 4QSVA 4TZ2A 3QZSA 4YC9A 4BW1A 5I29A 4AKNA 5LKZA 5I86A 2DVVA 5H1UA 3MXFA 4IOQA 4A9JA 5EWWA 5EV9A 4TQNA 3O35A 5EPRA 4N4FA 3U5MA 4OUFA 4CL9A 2L5EA 2RFJA 4LR6A 4YYDA 5KTXA 5F60A 4HXPA 4IR4A 5FDZA 4X2IA 4NYWA 5A85A 5EVAA 3JVJA 4QC3A 4LRGA 4O70A 5EICA 5KTUA 5DYUA 5D3TA 3HMFA 5CQ5A 4YADA 2R0VA 5F5ZA 3UVYA 3Q2EA 5HELA 5F2PA 5IBNA 5F62A 5FFWA 4NR7A 3ONIA 2L84A 4WHUA 4HXMA 3U5LA 4QYLA 3S91A 3K2JA 4YBTA 4QZSA 4UIVA 4HXRA 5CRZA 5CUAA 5EM3A 3JVMA 4BHWA 2YEMA 5CUBA 5IIDA
chains in the Genus database with same CATH superfamily
5I40A 3TLPA 3JVKA 4PS5A 4O76A 4OGJA 4PKLA 5DLZA 5HCLA 3NXBA 5CGPA 5HFRA 4TYLA 4KV4A 5FE2A 4O71A 5LJ1A 2MJVB 5HEMA 5EU1A 5D3JA 4UIYA 4UIXA 5EWCA 5A7CA 4C66A 4FLPA 4XY9A 3QZVA 4N4IA 3UV5A 5C7NA 5HM0A 3SVGA 2OO1A 4QB3A 3MB3A 1JSPB 5E9MA 2DVSA 5DY7A 5A81A 4A9OA 5LKUA 5EWHA 5CQ3A 4LZ2A 4QEWA 5A5SA 1WUGA 5DFCA 5DFBA 5D3HA 4PCEA 4UYFB 4E96A 4CFLA 3LJWA 5E73A 3HMHA 4O7BA 5ENEA 5E9YA 3LQIA 4J3IA 5F1LA 4QR4A 3UVDA 4YY4A 5DBMA 4AKGA 4MEQA 2OUOA 3LQJA 4QSTA 4CUUA 4NR5A 2YW5A 5FE8A 4AI6A 4NYVA 5CQ7A 5ETDA 2I7KA 4QUUA 3O34A 5I83A 5F1HA 4HXOA 4ZC9A 2RS9B 4MENA 3G0LA 2DVQA 4NR6A 4IORA 3Q2FA 5LVRA 5FB1A 4OGIA 4MEOA 4YYIA 5L98A 3D1BA 5CQ4A 4AKHA 3JVLA 5DYAA 2I8NA 5L96A 5AMEA 4GPJA 5E3DA 3DWYA 4O74A 3UW9A 4A9HA 5ENHA 4QEVA 5EWDA 2R10A 5D3PA 4YYGA 4O77A 5DLXA 5EK9A 3MUKA 5C8GA 5ETBA 4ALGA 5I7XA 5F63A 3UV4A 5C4QA 5IGMA 5CUDA 4QC1A 5AMFA 4NRCA 3IU6A 5E74A 5IGLA 4YYKA 2WP1A 4O7EA 4ALHA 3GG3A 1ZS5A 5CP5A 4TU6A 5DKCA 5HENA 4LYWA 4PY6A 5CU8A 5ENJA 5J0DA 3VKGA 4QNSA 5EA1A 4QR5A 4ZW1A 5EQ1A 4WHWA 5F61A 5D3RA 4Z93A 5E9KA 5KTWA 4HBXA 4LDFA 5D3NA 4O7CA 5EPBA 2E3KA 4RVRA 4O7AA 5CUEA 5IG6A 4QSSA 5CPEA 5EP7A 5HQ5A 3P1FA 4Q0OA 3SVHA 4LZSA 2E7NA 5CTLA 5DKDA 5HLSA 2R0YA 5ENFA 1X0JA 2LSPB 2R0SA 4MR5A 5CUGA 4C67A 3UVXA 4HXLA 4IOOA 5HRVA 4LYSA 3FKMX 4TT6A 4NR9A 2F6JA 3U5JA 4XUAA 4BW3A 2D82A 5F3AA 4UYEA 4YAXA 3S92A 5HRWA 4O75A 5L97A 2RO1A 2NXBA 5AD3A 4MR3A 3QZTA 3U5PA 2WP2A 4BW2A 5D7XA 4CLBA 4UYHA 5E0RA 4IR3A 5ENCA 2KTBB 4UYDA 4CURA 5A5RA 3O33A 4UYFA 4TZ8A 4N4GA 5CFWA 3U5NA 1F68A 4TS8A 4BJXA 4NS5A 3UVWA 5G4RA 4CFKA 5CQ6A 4NXJA 5I1QA 4KCXA 2DVRA 2RNYA 2YDWA 4N4HA 5F36A 4Z1QA 2F6NA 4J0RA 5H1VA 5FFVA 5FE5A 5D26A 3P5OA 5HJCA 4XYAA 3O37A 5A82A 1ZKRA 5EISA 4A9LA 1JM4B 2YQDA 5IGNA 3D1DA 4UYGA 5BT3A 5KHMA 4HBVA 5I7YA 5EGUA 2L85A 3I3JA 5I80A 1N72A 3P1EA 5D3LA 5FE3A 4Q0NA 5IGKA 3MB4A 4O72A 4NRBA 4YYHA 4HBYA 5EWVA 4TT2A 5BT5A 5D24A 4A9KA 4UIWA 2DATA 4NQNA 2H60A 2D9EA 4QSUA 4XY8A 5DW2A 4IR6A 4NUEA 5A83A 4NR8A 5KU3A 4NUDA 4NYXA 5A5PA 3ZYUA 3AADA 5CUCA 3P1CA 5F25A 2RNXA 5E7DA 5LUUA 2RNWA 5LKTA 5FG5A 4ZQLA 5CQ8A 2N9GA 4YYMA 5L8TA 3RCWA 4O7FA 5FE0A 4CUTA 4A9NA 1EQFA 5C85A 5FH6A 5DFDA 2EJNA 5L99A 5CZGA 5D0CA 5CY9A 4YABA 5FH7A 4Y03A 5FE6A 4A9FA 5LJ0A 5CQAA 4YY6A 4UIUA 2GRCA 4NR4A 5BT4A 5H85A 4YH3A 4YH4A 4QSPA 3AQAA 4TU4A 5FE7A 5ENBA 4YBSA 4AKIA 2YYNA 4A9EA 2DKWA 4O78A 4NUCA 5DKHA 3U5KA 4QY4A 4KV1A 4NQMA 5HQ7A 5E3GA 5DYXA 5JI8A 5AD2A 5FB0A 5D3SA 5II1A 5E9LA 3DAIA 5COIA 4YYNA 4TTEA 5CQTA 4A9MA 4CUSA 5HQ6A 5D25A 5A5OA 1WUMA 4QBMA 5FE9A 4PCIA 4XUBA 4YYJA 4TT4A 4QSXA 5JWMA 5EPSA 4YBMA 4CUPA 4UIZA 5C89A 5K29A 5FH8A 5A5NA 3O36A 5H1TA 5C87A 5FBXA 5HFQA 3MQMA 5DX4A 4QUTA 3P1DA 4QR3A 4HXKA 4HXSA 5FG4A 3HMEA 5ACYA 3SVFA 5HRXA 3IU5A 2RI7A 4HXNA 1PUOA 5E9VA 5G4SA 3G0JA 2G4AA 4MR4A 5TCMA 5TB6A 4A9IA 4QYDA 4IR5A 2YEKA 5KO4A 4LZRA 5DYCA 1E6IA 4CUQA 4F3IA 3MULA 5FE1A 5ENIA 5LKXA 3D7CA 5E9IA 5FFYA 4J0SA 4Z6HA 5ENGA 4Z1SA 2FSAA 4MR6A 4Z6IA 3LQHA 5FG6A 4N3WA 4QSRA 3LXJA 5II2A 4QSWA 5FE4A 4PTBA 4QSQA 4UITA 5I89A 5I88A 4NRAA 4BW4A 3VKHA 4YATA 4WIVA 3UV2A 4MEPA 4LYIA 2E7OA 3U5OA 5A5QA 4QEUA 4YK0A 2YELA 5LJ2A 5L8UA 2OSSA 2DWWA 5CS8A 4J1PA 4LC2A 5CRMA 5LVQA 5EI4A 4HBWA 4DONA 5DW1A 4QSVA 4TZ2A 3QZSA 4YC9A 4BW1A 5I29A 4AKNA 5LKZA 5I86A 2DVVA 5H1UA 3MXFA 4IOQA 4A9JA 5EWWA 5EV9A 4TQNA 3O35A 5EPRA 4N4FA 3U5MA 4OUFA 4CL9A 2L5EA 3ERRA 2RFJA 4LR6A 4YYDA 5KTXA 5F60A 4HXPA 4IR4A 5FDZA 4X2IA 4NYWA 5A85A 5EVAA 3JVJA 4QC3A 4LRGA 4O70A 5EICA 5KTUA 5DYUA 5D3TA 3HMFA 5CQ5A 4YADA 2R0VA 5F5ZA 3UVYA 3Q2EA 5HELA 5F2PA 5IBNA 5F62A 5FFWA 4NR7A 3ONIA 2L84A 4WHUA 4HXMA 3U5LA 4QYLA 3S91A 3K2JA 4YBTA 4QZSA 4UIVA 4HXRA 5CRZA 5CUAA 5EM3A 3JVMA 4BHWA 2YEMA 5CUBA 5IIDA
chains in the Genus database with same CATH topology
5I40A 3TLPA 3JVKA 4PS5A 4O76A 4OGJA 4PKLA 5DLZA 5HCLA 3NXBA 5CGPA 5HFRA 4TYLA 4KV4A 5FE2A 4O71A 5LJ1A 2MJVB 5HEMA 5EU1A 5D3JA 4UIYA 4UIXA 5EWCA 5A7CA 4C66A 4FLPA 4XY9A 3QZVA 4N4IA 3UV5A 5C7NA 5HM0A 3SVGA 2OO1A 4QB3A 3MB3A 1JSPB 5E9MA 2DVSA 5DY7A 5A81A 4A9OA 5LKUA 5EWHA 5CQ3A 4LZ2A 4QEWA 5A5SA 1WUGA 5DFCA 5DFBA 5D3HA 4PCEA 4UYFB 4E96A 4CFLA 3LJWA 5E73A 3HMHA 4O7BA 5ENEA 5E9YA 3LQIA 4J3IA 5F1LA 4QR4A 3UVDA 4YY4A 5DBMA 4MEQA 2OUOA 3LQJA 4QSTA 4CUUA 4NR5A 2YW5A 5FE8A 4NYVA 5CQ7A 5ETDA 2I7KA 4QUUA 3O34A 5I83A 5F1HA 4HXOA 4ZC9A 2RS9B 4MENA 3G0LA 2DVQA 4NR6A 4IORA 3Q2FA 5LVRA 5FB1A 4OGIA 4MEOA 4YYIA 5L98A 5CQ4A 3JVLA 5DYAA 2I8NA 5L96A 5AMEA 4GPJA 5E3DA 3DWYA 4O74A 3UW9A 4A9HA 5ENHA 4QEVA 5EWDA 2R10A 5D3PA 4YYGA 4O77A 5DLXA 5EK9A 3MUKA 5C8GA 5ETBA 4ALGA 5I7XA 5F63A 3UV4A 5C4QA 5IGMA 5CUDA 4QC1A 5AMFA 4NRCA 3IU6A 5E74A 5IGLA 4YYKA 2WP1A 4O7EA 4ALHA 3GG3A 1ZS5A 5CP5A 4TU6A 5DKCA 5HENA 4LYWA 4PY6A 5CU8A 5ENJA 5J0DA 4QNSA 5EA1A 4QR5A 4ZW1A 5EQ1A 4WHWA 5F61A 5D3RA 4Z93A 5E9KA 5KTWA 4HBXA 4LDFA 5D3NA 4O7CA 5EPBA 2E3KA 4RVRA 4O7AA 5CUEA 5IG6A 4QSSA 5CPEA 5EP7A 5HQ5A 3P1FA 4Q0OA 3SVHA 4LZSA 2E7NA 5CTLA 5DKDA 5HLSA 2R0YA 5ENFA 1X0JA 2LSPB 2R0SA 4MR5A 5CUGA 4C67A 3UVXA 4HXLA 4IOOA 5HRVA 4LYSA 3FKMX 4TT6A 4NR9A 2F6JA 3U5JA 4XUAA 4BW3A 2D82A 5F3AA 4UYEA 4YAXA 3S92A 5HRWA 4O75A 5L97A 2RO1A 2NXBA 5AD3A 4MR3A 3QZTA 3U5PA 2WP2A 4BW2A 5D7XA 4CLBA 4UYHA 5E0RA 4IR3A 5ENCA 2KTBB 4UYDA 4CURA 5A5RA 3O33A 4UYFA 4TZ8A 4N4GA 5CFWA 3U5NA 1F68A 4TS8A 4BJXA 4NS5A 3UVWA 5G4RA 4CFKA 5CQ6A 4NXJA 5I1QA 4KCXA 2DVRA 2RNYA 2YDWA 4N4HA 5F36A 4Z1QA 2F6NA 4J0RA 5H1VA 5FFVA 5FE5A 5D26A 3P5OA 5HJCA 4XYAA 3O37A 5A82A 5EISA 4A9LA 1JM4B 2YQDA 5IGNA 4UYGA 5BT3A 5KHMA 4HBVA 5I7YA 5EGUA 2L85A 3I3JA 5I80A 1N72A 3P1EA 5D3LA 5FE3A 4Q0NA 5IGKA 3MB4A 4O72A 4NRBA 4YYHA 4HBYA 5EWVA 4TT2A 5BT5A 5D24A 4A9KA 4UIWA 2DATA 4NQNA 2H60A 2D9EA 4QSUA 4XY8A 5DW2A 4IR6A 4NUEA 5A83A 4NR8A 5KU3A 4NUDA 4NYXA 5A5PA 3ZYUA 3AADA 5CUCA 3P1CA 5F25A 2RNXA 5E7DA 5LUUA 2RNWA 5LKTA 5FG5A 4ZQLA 5CQ8A 2N9GA 4YYMA 5L8TA 3RCWA 4O7FA 5FE0A 4CUTA 4A9NA 1EQFA 5C85A 5FH6A 5DFDA 5L99A 5CZGA 5D0CA 5CY9A 4YABA 5FH7A 4Y03A 5FE6A 4A9FA 5LJ0A 5CQAA 4YY6A 4UIUA 2GRCA 4NR4A 5BT4A 5H85A 4YH3A 4YH4A 4QSPA 3AQAA 4TU4A 5FE7A 5ENBA 4YBSA 2YYNA 4A9EA 2DKWA 4O78A 4NUCA 5DKHA 3U5KA 4QY4A 4KV1A 4NQMA 5HQ7A 5E3GA 5DYXA 5JI8A 5AD2A 5FB0A 5D3SA 5II1A 5E9LA 3DAIA 5COIA 4YYNA 4TTEA 5CQTA 4A9MA 4CUSA 5HQ6A 5D25A 5A5OA 1WUMA 4QBMA 5FE9A 4PCIA 4XUBA 4YYJA 4TT4A 4QSXA 5JWMA 5EPSA 4YBMA 4CUPA 4UIZA 5C89A 5K29A 5FH8A 5A5NA 3O36A 5H1TA 5C87A 5FBXA 5HFQA 3MQMA 5DX4A 4QUTA 3P1DA 4QR3A 4HXKA 4HXSA 5FG4A 3HMEA 5ACYA 3SVFA 5HRXA 3IU5A 2RI7A 4HXNA 5E9VA 5G4SA 3G0JA 2G4AA 4MR4A 5TCMA 5TB6A 4A9IA 4QYDA 4IR5A 2YEKA 5KO4A 4LZRA 5DYCA 1E6IA 4CUQA 4F3IA 3MULA 5FE1A 5ENIA 5LKXA 3D7CA 5E9IA 5FFYA 4J0SA 4Z6HA 5ENGA 4Z1SA 2FSAA 4MR6A 4Z6IA 3LQHA 5FG6A 4N3WA 4QSRA 3LXJA 5II2A 4QSWA 5FE4A 4PTBA 4QSQA 4UITA 5I89A 5I88A 4NRAA 4BW4A 4YATA 4WIVA 3UV2A 4MEPA 4LYIA 2E7OA 3U5OA 5A5QA 4QEUA 4YK0A 2YELA 5LJ2A 5L8UA 2OSSA 2DWWA 5CS8A 4J1PA 4LC2A 5CRMA 5LVQA 5EI4A 4HBWA 4DONA 5DW1A 4QSVA 4TZ2A 3QZSA 4YC9A 4BW1A 5I29A 4AKNA 5LKZA 5I86A 2DVVA 5H1UA 3MXFA 4IOQA 4A9JA 5EWWA 5EV9A 4TQNA 3O35A 5EPRA 4N4FA 3U5MA 4OUFA 4CL9A 2L5EA 2RFJA 4LR6A 4YYDA 5KTXA 5F60A 4HXPA 4IR4A 5FDZA 4X2IA 4NYWA 5A85A 5EVAA 3JVJA 4QC3A 4LRGA 4O70A 5EICA 5KTUA 5DYUA 5D3TA 3HMFA 5CQ5A 4YADA 2R0VA 5F5ZA 3UVYA 3Q2EA 5HELA 5F2PA 5IBNA 5F62A 5FFWA 4NR7A 3ONIA 2L84A 4WHUA 4HXMA 3U5LA 4QYLA 3S91A 3K2JA 4YBTA 4QZSA 4UIVA 4HXRA 5CRZA 5CUAA 5EM3A 3JVMA 4BHWA 2YEMA 5CUBA 5IIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I40 A;  3TLP A;  3JVK A;  4PS5 A;  4O76 A;  4OGJ A;  4PKL A;  5DLZ A;  5HCL A;  3NXB A;  5CGP A;  5HFR A;  4TYL A;  4KV4 A;  5FE2 A;  4O71 A;  5LJ1 A;  2MJV B;  5HEM A;  5EU1 A;  5D3J A;  4UIY A;  4UIX A;  5EWC A;  5A7C A;  4C66 A;  4FLP A;  4XY9 A;  3QZV A;  4N4I A;  3UV5 A;  5C7N A;  5HM0 A;  3SVG A;  2OO1 A;  4QB3 A;  3MB3 A;  1JSP B;  5E9M A;  2DVS A;  5DY7 A;  5A81 A;  4A9O A;  5LKU A;  5EWH A;  5CQ3 A;  4LZ2 A;  4QEW A;  5A5S A;  1WUG A;  5DFC A;  5DFB A;  5D3H A;  4PCE A;  4UYF B;  4E96 A;  4CFL A;  3LJW A;  5E73 A;  3HMH A;  4O7B A;  5ENE A;  5E9Y A;  3LQI A;  4J3I A;  5F1L A;  4QR4 A;  3UVD A;  4YY4 A;  5DBM A;  4MEQ A;  2OUO A;  3LQJ A;  4QST A;  4CUU A;  4NR5 A;  2YW5 A;  5FE8 A;  4NYV A;  5CQ7 A;  5ETD A;  2I7K A;  4QUU A;  3O34 A;  5I83 A;  5F1H A;  4HXO A;  4ZC9 A;  2RS9 B;  4MEN A;  3G0L A;  2DVQ A;  4NR6 A;  4IOR A;  3Q2F A;  5LVR A;  5FB1 A;  4OGI A;  4MEO A;  4YYI A;  5L98 A;  5CQ4 A;  3JVL A;  5DYA A;  2I8N A;  5L96 A;  5AME A;  4GPJ A;  5E3D A;  3DWY A;  4O74 A;  3UW9 A;  4A9H A;  5ENH A;  4QEV A;  5EWD A;  2R10 A;  5D3P A;  4YYG A;  4O77 A;  5DLX A;  5EK9 A;  3MUK A;  5C8G A;  5ETB A;  4ALG A;  5I7X A;  5F63 A;  3UV4 A;  5C4Q A;  5IGM A;  5CUD A;  4QC1 A;  5AMF A;  4NRC A;  3IU6 A;  5E74 A;  5IGL A;  4YYK A;  2WP1 A;  4O7E A;  4ALH A;  3GG3 A;  1ZS5 A;  5CP5 A;  4TU6 A;  5DKC A;  5HEN A;  4LYW A;  4PY6 A;  5CU8 A;  5ENJ A;  5J0D A;  4QNS A;  5EA1 A;  4QR5 A;  4ZW1 A;  5EQ1 A;  4WHW A;  5F61 A;  5D3R A;  4Z93 A;  5E9K A;  5KTW A;  4HBX A;  4LDF A;  5D3N A;  4O7C A;  5EPB A;  2E3K A;  4RVR A;  4O7A A;  5CUE A;  5IG6 A;  4QSS A;  5CPE A;  5EP7 A;  5HQ5 A;  3P1F A;  4Q0O A;  3SVH A;  4LZS A;  2E7N A;  5CTL A;  5DKD A;  5HLS A;  2R0Y A;  5ENF A;  1X0J A;  2LSP B;  2R0S A;  4MR5 A;  5CUG A;  4C67 A;  3UVX A;  4HXL A;  4IOO A;  5HRV A;  4LYS A;  3FKM X;  4TT6 A;  4NR9 A;  2F6J A;  3U5J A;  4XUA A;  4BW3 A;  2D82 A;  5F3A A;  4UYE A;  4YAX A;  3S92 A;  5HRW A;  4O75 A;  5L97 A;  2RO1 A;  2NXB A;  5AD3 A;  4MR3 A;  3QZT A;  3U5P A;  2WP2 A;  4BW2 A;  5D7X A;  4CLB A;  4UYH A;  5E0R A;  4IR3 A;  5ENC A;  2KTB B;  4UYD A;  4CUR A;  5A5R A;  3O33 A;  4UYF A;  4TZ8 A;  4N4G A;  5CFW A;  3U5N A;  1F68 A;  4TS8 A;  4BJX A;  4NS5 A;  3UVW A;  5G4R A;  4CFK A;  5CQ6 A;  4NXJ A;  5I1Q A;  4KCX A;  2DVR A;  2RNY A;  2YDW A;  4N4H A;  5F36 A;  4Z1Q A;  2F6N A;  4J0R A;  5H1V A;  5FFV A;  5FE5 A;  5D26 A;  3P5O A;  5HJC A;  4XYA A;  3O37 A;  5A82 A;  5EIS A;  4A9L A;  1JM4 B;  2YQD A;  5IGN A;  4UYG A;  5BT3 A;  5KHM A;  4HBV A;  5I7Y A;  5EGU A;  2L85 A;  3I3J A;  5I80 A;  1N72 A;  3P1E A;  5D3L A;  5FE3 A;  4Q0N A;  5IGK A;  3MB4 A;  4O72 A;  4NRB A;  4YYH A;  4HBY A;  5EWV A;  4TT2 A;  5BT5 A;  5D24 A;  4A9K A;  4UIW A;  2DAT A;  4NQN A;  2H60 A;  2D9E A;  4QSU A;  4XY8 A;  5DW2 A;  4IR6 A;  4NUE A;  5A83 A;  4NR8 A;  5KU3 A;  4NUD A;  4NYX A;  5A5P A;  3ZYU A;  3AAD A;  5CUC A;  3P1C A;  5F25 A;  2RNX A;  5E7D A;  5LUU A;  2RNW A;  5LKT A;  5FG5 A;  4ZQL A;  5CQ8 A;  2N9G A;  4YYM A;  5L8T A;  3RCW A;  4O7F A;  5FE0 A;  4CUT A;  4A9N A;  1EQF A;  5C85 A;  5FH6 A;  5DFD A;  5L99 A;  5CZG A;  5D0C A;  5CY9 A;  4YAB A;  5FH7 A;  4Y03 A;  5FE6 A;  4A9F A;  5LJ0 A;  5CQA A;  4YY6 A;  4UIU A;  2GRC A;  4NR4 A;  5BT4 A;  5H85 A;  4YH3 A;  4YH4 A;  4QSP A;  3AQA A;  4TU4 A;  5FE7 A;  5ENB A;  4YBS A;  2YYN A;  4A9E A;  2DKW A;  4O78 A;  4NUC A;  5DKH A;  3U5K A;  4QY4 A;  4KV1 A;  4NQM A;  5HQ7 A;  5E3G A;  5DYX A;  5JI8 A;  5AD2 A;  5FB0 A;  5D3S A;  5II1 A;  5E9L A;  3DAI A;  5COI A;  4YYN A;  4TTE A;  5CQT A;  4A9M A;  4CUS A;  5HQ6 A;  5D25 A;  5A5O A;  1WUM A;  4QBM A;  5FE9 A;  4PCI A;  4XUB A;  4YYJ A;  4TT4 A;  4QSX A;  5JWM A;  5EPS A;  4YBM A;  4CUP A;  4UIZ A;  5C89 A;  5K29 A;  5FH8 A;  5A5N A;  3O36 A;  5H1T A;  5C87 A;  5FBX A;  5HFQ A;  3MQM A;  5DX4 A;  4QUT A;  3P1D A;  4QR3 A;  4HXK A;  4HXS A;  5FG4 A;  3HME A;  5ACY A;  3SVF A;  5HRX A;  3IU5 A;  2RI7 A;  4HXN A;  5E9V A;  5G4S A;  3G0J A;  2G4A A;  4MR4 A;  5TCM A;  5TB6 A;  4A9I A;  4QYD A;  4IR5 A;  2YEK A;  5KO4 A;  4LZR A;  5DYC A;  1E6I A;  4CUQ A;  4F3I A;  3MUL A;  5FE1 A;  5ENI A;  5LKX A;  3D7C A;  5E9I A;  5FFY A;  4J0S A;  4Z6H A;  5ENG A;  4Z1S A;  2FSA A;  4MR6 A;  4Z6I A;  3LQH A;  5FG6 A;  4N3W A;  4QSR A;  3LXJ A;  5II2 A;  4QSW A;  5FE4 A;  4PTB A;  4QSQ A;  4UIT A;  5I89 A;  5I88 A;  4NRA A;  4BW4 A;  4YAT A;  4WIV A;  3UV2 A;  4MEP A;  4LYI A;  2E7O A;  3U5O A;  5A5Q A;  4QEU A;  4YK0 A;  2YEL A;  5LJ2 A;  5L8U A;  2OSS A;  2DWW A;  5CS8 A;  4J1P A;  4LC2 A;  5CRM A;  5LVQ A;  5EI4 A;  4HBW A;  4DON A;  5DW1 A;  4QSV A;  4TZ2 A;  3QZS A;  4YC9 A;  4BW1 A;  5I29 A;  4AKN A;  5LKZ A;  5I86 A;  2DVV A;  5H1U A;  3MXF A;  4IOQ A;  4A9J A;  5EWW A;  5EV9 A;  4TQN A;  3O35 A;  5EPR A;  4N4F A;  3U5M A;  4OUF A;  4CL9 A;  2L5E A;  2RFJ A;  4LR6 A;  4YYD A;  5KTX A;  5F60 A;  4HXP A;  4IR4 A;  5FDZ A;  4X2I A;  4NYW A;  5A85 A;  5EVA A;  3JVJ A;  4QC3 A;  4LRG A;  4O70 A;  5EIC A;  5KTU A;  5DYU A;  5D3T A;  3HMF A;  5CQ5 A;  4YAD A;  2R0V A;  5F5Z A;  3UVY A;  3Q2E A;  5HEL A;  5F2P A;  5IBN A;  5F62 A;  5FFW A;  4NR7 A;  3ONI A;  2L84 A;  4WHU A;  4HXM A;  3U5L A;  4QYL A;  3S91 A;  3K2J A;  4YBT A;  4QZS A;  4UIV A;  4HXR A;  5CRZ A;  5CUA A;  5EM3 A;  3JVM A;  4BHW A;  2YEM A;  5CUB A;  5IID A; 
#chains in the Genus database with same CATH topology
 5I40 A;  3TLP A;  3JVK A;  4PS5 A;  4O76 A;  4OGJ A;  4PKL A;  5DLZ A;  5HCL A;  3NXB A;  5CGP A;  5HFR A;  4TYL A;  4KV4 A;  5FE2 A;  4O71 A;  5LJ1 A;  2MJV B;  5HEM A;  5EU1 A;  5D3J A;  4UIY A;  4UIX A;  5EWC A;  5A7C A;  4C66 A;  4FLP A;  4XY9 A;  3QZV A;  4N4I A;  3UV5 A;  5C7N A;  5HM0 A;  3SVG A;  2OO1 A;  4QB3 A;  3MB3 A;  1JSP B;  5E9M A;  2DVS A;  5DY7 A;  5A81 A;  4A9O A;  5LKU A;  5EWH A;  5CQ3 A;  4LZ2 A;  4QEW A;  5A5S A;  1WUG A;  5DFC A;  5DFB A;  5D3H A;  4PCE A;  4UYF B;  4E96 A;  4CFL A;  3LJW A;  5E73 A;  3HMH A;  4O7B A;  5ENE A;  5E9Y A;  3LQI A;  4J3I A;  5F1L A;  4QR4 A;  3UVD A;  4YY4 A;  5DBM A;  4AKG A;  4MEQ A;  2OUO A;  3LQJ A;  4QST A;  4CUU A;  4NR5 A;  2YW5 A;  5FE8 A;  4AI6 A;  4NYV A;  5CQ7 A;  5ETD A;  2I7K A;  4QUU A;  3O34 A;  5I83 A;  5F1H A;  4HXO A;  4ZC9 A;  2RS9 B;  4MEN A;  3G0L A;  2DVQ A;  4NR6 A;  4IOR A;  3Q2F A;  5LVR A;  5FB1 A;  4OGI A;  4MEO A;  4YYI A;  5L98 A;  3D1B A;  5CQ4 A;  4AKH A;  3JVL A;  5DYA A;  2I8N A;  5L96 A;  5AME A;  4GPJ A;  5E3D A;  3DWY A;  4O74 A;  3UW9 A;  4A9H A;  5ENH A;  4QEV A;  5EWD A;  2R10 A;  5D3P A;  4YYG A;  4O77 A;  5DLX A;  5EK9 A;  3MUK A;  5C8G A;  5ETB A;  4ALG A;  5I7X A;  5F63 A;  3UV4 A;  5C4Q A;  5IGM A;  5CUD A;  4QC1 A;  5AMF A;  4NRC A;  3IU6 A;  5E74 A;  5IGL A;  4YYK A;  2WP1 A;  4O7E A;  4ALH A;  3GG3 A;  1ZS5 A;  5CP5 A;  4TU6 A;  5DKC A;  5HEN A;  4LYW A;  4PY6 A;  5CU8 A;  5ENJ A;  5J0D A;  3VKG A;  4QNS A;  5EA1 A;  4QR5 A;  4ZW1 A;  5EQ1 A;  4WHW A;  5F61 A;  5D3R A;  4Z93 A;  5E9K A;  5KTW A;  4HBX A;  4LDF A;  5D3N A;  4O7C A;  5EPB A;  2E3K A;  4RVR A;  4O7A A;  5CUE A;  5IG6 A;  4QSS A;  5CPE A;  5EP7 A;  5HQ5 A;  3P1F A;  4Q0O A;  3SVH A;  4LZS A;  2E7N A;  5CTL A;  5DKD A;  5HLS A;  2R0Y A;  5ENF A;  1X0J A;  2LSP B;  2R0S A;  4MR5 A;  5CUG A;  4C67 A;  3UVX A;  4HXL A;  4IOO A;  5HRV A;  4LYS A;  3FKM X;  4TT6 A;  4NR9 A;  2F6J A;  3U5J A;  4XUA A;  4BW3 A;  2D82 A;  5F3A A;  4UYE A;  4YAX A;  3S92 A;  5HRW A;  4O75 A;  5L97 A;  2RO1 A;  2NXB A;  5AD3 A;  4MR3 A;  3QZT A;  3U5P A;  2WP2 A;  4BW2 A;  5D7X A;  4CLB A;  4UYH A;  5E0R A;  4IR3 A;  5ENC A;  2KTB B;  4UYD A;  4CUR A;  5A5R A;  3O33 A;  4UYF A;  4TZ8 A;  4N4G A;  5CFW A;  3U5N A;  1F68 A;  4TS8 A;  4BJX A;  4NS5 A;  3UVW A;  5G4R A;  4CFK A;  5CQ6 A;  4NXJ A;  5I1Q A;  4KCX A;  2DVR A;  2RNY A;  2YDW A;  4N4H A;  5F36 A;  4Z1Q A;  2F6N A;  4J0R A;  5H1V A;  5FFV A;  5FE5 A;  5D26 A;  3P5O A;  5HJC A;  4XYA A;  3O37 A;  5A82 A;  1ZKR A;  5EIS A;  4A9L A;  1JM4 B;  2YQD A;  5IGN A;  3D1D A;  4UYG A;  5BT3 A;  5KHM A;  4HBV A;  5I7Y A;  5EGU A;  2L85 A;  3I3J A;  5I80 A;  1N72 A;  3P1E A;  5D3L A;  5FE3 A;  4Q0N A;  5IGK A;  3MB4 A;  4O72 A;  4NRB A;  4YYH A;  4HBY A;  5EWV A;  4TT2 A;  5BT5 A;  5D24 A;  4A9K A;  4UIW A;  2DAT A;  4NQN A;  2H60 A;  2D9E A;  4QSU A;  4XY8 A;  5DW2 A;  4IR6 A;  4NUE A;  5A83 A;  4NR8 A;  5KU3 A;  4NUD A;  4NYX A;  5A5P A;  3ZYU A;  3AAD A;  5CUC A;  3P1C A;  5F25 A;  2RNX A;  5E7D A;  5LUU A;  2RNW A;  5LKT A;  5FG5 A;  4ZQL A;  5CQ8 A;  2N9G A;  4YYM A;  5L8T A;  3RCW A;  4O7F A;  5FE0 A;  4CUT A;  4A9N A;  1EQF A;  5C85 A;  5FH6 A;  5DFD A;  2EJN A;  5L99 A;  5CZG A;  5D0C A;  5CY9 A;  4YAB A;  5FH7 A;  4Y03 A;  5FE6 A;  4A9F A;  5LJ0 A;  5CQA A;  4YY6 A;  4UIU A;  2GRC A;  4NR4 A;  5BT4 A;  5H85 A;  4YH3 A;  4YH4 A;  4QSP A;  3AQA A;  4TU4 A;  5FE7 A;  5ENB A;  4YBS A;  4AKI A;  2YYN A;  4A9E A;  2DKW A;  4O78 A;  4NUC A;  5DKH A;  3U5K A;  4QY4 A;  4KV1 A;  4NQM A;  5HQ7 A;  5E3G A;  5DYX A;  5JI8 A;  5AD2 A;  5FB0 A;  5D3S A;  5II1 A;  5E9L A;  3DAI A;  5COI A;  4YYN A;  4TTE A;  5CQT A;  4A9M A;  4CUS A;  5HQ6 A;  5D25 A;  5A5O A;  1WUM A;  4QBM A;  5FE9 A;  4PCI A;  4XUB A;  4YYJ A;  4TT4 A;  4QSX A;  5JWM A;  5EPS A;  4YBM A;  4CUP A;  4UIZ A;  5C89 A;  5K29 A;  5FH8 A;  5A5N A;  3O36 A;  5H1T A;  5C87 A;  5FBX A;  5HFQ A;  3MQM A;  5DX4 A;  4QUT A;  3P1D A;  4QR3 A;  4HXK A;  4HXS A;  5FG4 A;  3HME A;  5ACY A;  3SVF A;  5HRX A;  3IU5 A;  2RI7 A;  4HXN A;  1PUO A;  5E9V A;  5G4S A;  3G0J A;  2G4A A;  4MR4 A;  5TCM A;  5TB6 A;  4A9I A;  4QYD A;  4IR5 A;  2YEK A;  5KO4 A;  4LZR A;  5DYC A;  1E6I A;  4CUQ A;  4F3I A;  3MUL A;  5FE1 A;  5ENI A;  5LKX A;  3D7C A;  5E9I A;  5FFY A;  4J0S A;  4Z6H A;  5ENG A;  4Z1S A;  2FSA A;  4MR6 A;  4Z6I A;  3LQH A;  5FG6 A;  4N3W A;  4QSR A;  3LXJ A;  5II2 A;  4QSW A;  5FE4 A;  4PTB A;  4QSQ A;  4UIT A;  5I89 A;  5I88 A;  4NRA A;  4BW4 A;  3VKH A;  4YAT A;  4WIV A;  3UV2 A;  4MEP A;  4LYI A;  2E7O A;  3U5O A;  5A5Q A;  4QEU A;  4YK0 A;  2YEL A;  5LJ2 A;  5L8U A;  2OSS A;  2DWW A;  5CS8 A;  4J1P A;  4LC2 A;  5CRM A;  5LVQ A;  5EI4 A;  4HBW A;  4DON A;  5DW1 A;  4QSV A;  4TZ2 A;  3QZS A;  4YC9 A;  4BW1 A;  5I29 A;  4AKN A;  5LKZ A;  5I86 A;  2DVV A;  5H1U A;  3MXF A;  4IOQ A;  4A9J A;  5EWW A;  5EV9 A;  4TQN A;  3O35 A;  5EPR A;  4N4F A;  3U5M A;  4OUF A;  4CL9 A;  2L5E A;  3ERR A;  2RFJ A;  4LR6 A;  4YYD A;  5KTX A;  5F60 A;  4HXP A;  4IR4 A;  5FDZ A;  4X2I A;  4NYW A;  5A85 A;  5EVA A;  3JVJ A;  4QC3 A;  4LRG A;  4O70 A;  5EIC A;  5KTU A;  5DYU A;  5D3T A;  3HMF A;  5CQ5 A;  4YAD A;  2R0V A;  5F5Z A;  3UVY A;  3Q2E A;  5HEL A;  5F2P A;  5IBN A;  5F62 A;  5FFW A;  4NR7 A;  3ONI A;  2L84 A;  4WHU A;  4HXM A;  3U5L A;  4QYL A;  3S91 A;  3K2J A;  4YBT A;  4QZS A;  4UIV A;  4HXR A;  5CRZ A;  5CUA A;  5EM3 A;  3JVM A;  4BHW A;  2YEM A;  5CUB A;  5IID A; 
#chains in the Genus database with same CATH homology
 5I40 A;  3TLP A;  3JVK A;  4PS5 A;  4O76 A;  4OGJ A;  4PKL A;  5DLZ A;  5HCL A;  3NXB A;  5CGP A;  5HFR A;  4TYL A;  4KV4 A;  5FE2 A;  4O71 A;  5LJ1 A;  2MJV B;  5HEM A;  5EU1 A;  5D3J A;  4UIY A;  4UIX A;  5EWC A;  5A7C A;  4C66 A;  4FLP A;  4XY9 A;  3QZV A;  4N4I A;  3UV5 A;  5C7N A;  5HM0 A;  3SVG A;  2OO1 A;  4QB3 A;  3MB3 A;  1JSP B;  5E9M A;  2DVS A;  5DY7 A;  5A81 A;  4A9O A;  5LKU A;  5EWH A;  5CQ3 A;  4LZ2 A;  4QEW A;  5A5S A;  1WUG A;  5DFC A;  5DFB A;  5D3H A;  4PCE A;  4UYF B;  4E96 A;  4CFL A;  3LJW A;  5E73 A;  3HMH A;  4O7B A;  5ENE A;  5E9Y A;  3LQI A;  4J3I A;  5F1L A;  4QR4 A;  3UVD A;  4YY4 A;  5DBM A;  4MEQ A;  2OUO A;  3LQJ A;  4QST A;  4CUU A;  4NR5 A;  2YW5 A;  5FE8 A;  4NYV A;  5CQ7 A;  5ETD A;  2I7K A;  4QUU A;  3O34 A;  5I83 A;  5F1H A;  4HXO A;  4ZC9 A;  2RS9 B;  4MEN A;  3G0L A;  2DVQ A;  4NR6 A;  4IOR A;  3Q2F A;  5LVR A;  5FB1 A;  4OGI A;  4MEO A;  4YYI A;  5L98 A;  5CQ4 A;  3JVL A;  5DYA A;  2I8N A;  5L96 A;  5AME A;  4GPJ A;  5E3D A;  3DWY A;  4O74 A;  3UW9 A;  4A9H A;  5ENH A;  4QEV A;  5EWD A;  2R10 A;  5D3P A;  4YYG A;  4O77 A;  5DLX A;  5EK9 A;  3MUK A;  5C8G A;  5ETB A;  4ALG A;  5I7X A;  5F63 A;  3UV4 A;  5C4Q A;  5IGM A;  5CUD A;  4QC1 A;  5AMF A;  4NRC A;  3IU6 A;  5E74 A;  5IGL A;  4YYK A;  2WP1 A;  4O7E A;  4ALH A;  3GG3 A;  1ZS5 A;  5CP5 A;  4TU6 A;  5DKC A;  5HEN A;  4LYW A;  4PY6 A;  5CU8 A;  5ENJ A;  5J0D A;  4QNS A;  5EA1 A;  4QR5 A;  4ZW1 A;  5EQ1 A;  4WHW A;  5F61 A;  5D3R A;  4Z93 A;  5E9K A;  5KTW A;  4HBX A;  4LDF A;  5D3N A;  4O7C A;  5EPB A;  2E3K A;  4RVR A;  4O7A A;  5CUE A;  5IG6 A;  4QSS A;  5CPE A;  5EP7 A;  5HQ5 A;  3P1F A;  4Q0O A;  3SVH A;  4LZS A;  2E7N A;  5CTL A;  5DKD A;  5HLS A;  2R0Y A;  5ENF A;  1X0J A;  2LSP B;  2R0S A;  4MR5 A;  5CUG A;  4C67 A;  3UVX A;  4HXL A;  4IOO A;  5HRV A;  4LYS A;  3FKM X;  4TT6 A;  4NR9 A;  2F6J A;  3U5J A;  4XUA A;  4BW3 A;  2D82 A;  5F3A A;  4UYE A;  4YAX A;  3S92 A;  5HRW A;  4O75 A;  5L97 A;  2RO1 A;  2NXB A;  5AD3 A;  4MR3 A;  3QZT A;  3U5P A;  2WP2 A;  4BW2 A;  5D7X A;  4CLB A;  4UYH A;  5E0R A;  4IR3 A;  5ENC A;  2KTB B;  4UYD A;  4CUR A;  5A5R A;  3O33 A;  4UYF A;  4TZ8 A;  4N4G A;  5CFW A;  3U5N A;  1F68 A;  4TS8 A;  4BJX A;  4NS5 A;  3UVW A;  5G4R A;  4CFK A;  5CQ6 A;  4NXJ A;  5I1Q A;  4KCX A;  2DVR A;  2RNY A;  2YDW A;  4N4H A;  5F36 A;  4Z1Q A;  2F6N A;  4J0R A;  5H1V A;  5FFV A;  5FE5 A;  5D26 A;  3P5O A;  5HJC A;  4XYA A;  3O37 A;  5A82 A;  5EIS A;  4A9L A;  1JM4 B;  2YQD A;  5IGN A;  4UYG A;  5BT3 A;  5KHM A;  4HBV A;  5I7Y A;  5EGU A;  2L85 A;  3I3J A;  5I80 A;  1N72 A;  3P1E A;  5D3L A;  5FE3 A;  4Q0N A;  5IGK A;  3MB4 A;  4O72 A;  4NRB A;  4YYH A;  4HBY A;  5EWV A;  4TT2 A;  5BT5 A;  5D24 A;  4A9K A;  4UIW A;  2DAT A;  4NQN A;  2H60 A;  2D9E A;  4QSU A;  4XY8 A;  5DW2 A;  4IR6 A;  4NUE A;  5A83 A;  4NR8 A;  5KU3 A;  4NUD A;  4NYX A;  5A5P A;  3ZYU A;  3AAD A;  5CUC A;  3P1C A;  5F25 A;  2RNX A;  5E7D A;  5LUU A;  2RNW A;  5LKT A;  5FG5 A;  4ZQL A;  5CQ8 A;  2N9G A;  4YYM A;  5L8T A;  3RCW A;  4O7F A;  5FE0 A;  4CUT A;  4A9N A;  1EQF A;  5C85 A;  5FH6 A;  5DFD A;  5L99 A;  5CZG A;  5D0C A;  5CY9 A;  4YAB A;  5FH7 A;  4Y03 A;  5FE6 A;  4A9F A;  5LJ0 A;  5CQA A;  4YY6 A;  4UIU A;  2GRC A;  4NR4 A;  5BT4 A;  5H85 A;  4YH3 A;  4YH4 A;  4QSP A;  3AQA A;  4TU4 A;  5FE7 A;  5ENB A;  4YBS A;  2YYN A;  4A9E A;  2DKW A;  4O78 A;  4NUC A;  5DKH A;  3U5K A;  4QY4 A;  4KV1 A;  4NQM A;  5HQ7 A;  5E3G A;  5DYX A;  5JI8 A;  5AD2 A;  5FB0 A;  5D3S A;  5II1 A;  5E9L A;  3DAI A;  5COI A;  4YYN A;  4TTE A;  5CQT A;  4A9M A;  4CUS A;  5HQ6 A;  5D25 A;  5A5O A;  1WUM A;  4QBM A;  5FE9 A;  4PCI A;  4XUB A;  4YYJ A;  4TT4 A;  4QSX A;  5JWM A;  5EPS A;  4YBM A;  4CUP A;  4UIZ A;  5C89 A;  5K29 A;  5FH8 A;  5A5N A;  3O36 A;  5H1T A;  5C87 A;  5FBX A;  5HFQ A;  3MQM A;  5DX4 A;  4QUT A;  3P1D A;  4QR3 A;  4HXK A;  4HXS A;  5FG4 A;  3HME A;  5ACY A;  3SVF A;  5HRX A;  3IU5 A;  2RI7 A;  4HXN A;  5E9V A;  5G4S A;  3G0J A;  2G4A A;  4MR4 A;  5TCM A;  5TB6 A;  4A9I A;  4QYD A;  4IR5 A;  2YEK A;  5KO4 A;  4LZR A;  5DYC A;  1E6I A;  4CUQ A;  4F3I A;  3MUL A;  5FE1 A;  5ENI A;  5LKX A;  3D7C A;  5E9I A;  5FFY A;  4J0S A;  4Z6H A;  5ENG A;  4Z1S A;  2FSA A;  4MR6 A;  4Z6I A;  3LQH A;  5FG6 A;  4N3W A;  4QSR A;  3LXJ A;  5II2 A;  4QSW A;  5FE4 A;  4PTB A;  4QSQ A;  4UIT A;  5I89 A;  5I88 A;  4NRA A;  4BW4 A;  4YAT A;  4WIV A;  3UV2 A;  4MEP A;  4LYI A;  2E7O A;  3U5O A;  5A5Q A;  4QEU A;  4YK0 A;  2YEL A;  5LJ2 A;  5L8U A;  2OSS A;  2DWW A;  5CS8 A;  4J1P A;  4LC2 A;  5CRM A;  5LVQ A;  5EI4 A;  4HBW A;  4DON A;  5DW1 A;  4QSV A;  4TZ2 A;  3QZS A;  4YC9 A;  4BW1 A;  5I29 A;  4AKN A;  5LKZ A;  5I86 A;  2DVV A;  5H1U A;  3MXF A;  4IOQ A;  4A9J A;  5EWW A;  5EV9 A;  4TQN A;  3O35 A;  5EPR A;  4N4F A;  3U5M A;  4OUF A;  4CL9 A;  2L5E A;  2RFJ A;  4LR6 A;  4YYD A;  5KTX A;  5F60 A;  4HXP A;  4IR4 A;  5FDZ A;  4X2I A;  4NYW A;  5A85 A;  5EVA A;  3JVJ A;  4QC3 A;  4LRG A;  4O70 A;  5EIC A;  5KTU A;  5DYU A;  5D3T A;  3HMF A;  5CQ5 A;  4YAD A;  2R0V A;  5F5Z A;  3UVY A;  3Q2E A;  5HEL A;  5F2P A;  5IBN A;  5F62 A;  5FFW A;  4NR7 A;  3ONI A;  2L84 A;  4WHU A;  4HXM A;  3U5L A;  4QYL A;  3S91 A;  3K2J A;  4YBT A;  4QZS A;  4UIV A;  4HXR A;  5CRZ A;  5CUA A;  5EM3 A;  3JVM A;  4BHW A;  2YEM A;  5CUB A;  5IID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...