5F3BA

Structure of myostatin in complex with chimeric rk35 antibody
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSGGSYTSYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARQDYAMNYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beyond CDR-grafting: Structure-guided humanization of framework and CDR regions of an anti-myostatin antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/immune system
molecule keywords RK35 Chimeric antibody heavy chain
total genus 50
structure length 218
sequence length 218
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f3bA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f3bA01
2VKXA 3PWUB 1UM6L 3PWPA 4X80H 1B4RA 3OR7B 1OAYH 4WUUB 4XNQB 3LEYH 5SWZA 1DLFL 3LDBB 4S2SA 4NQSA 4HWUA 5FV2A 1X5HA 2H1PH 4PRPB 4RISL 3O9WD 1KBGH 1Z5LB 1X7QB 3IDJA 2WBJC 1LP9F 4HFWB 2G75B 1DJSA 5SV4A 5ID0A 5CJXC 1OD9A 4WUUA 2YBRB 4NBYB 5HYQB 4TSBL 3NPZB 4LSQL 4PJ5A 2Y9RT 1NFDE 3SKJH 2B1HL 5H37H 3MRRB 4MAUL 1GPOL 4FQXB 1D9KA 1QRNA 4XNYH 1AJ7L 5C2BH 3RX5A 3K4ZA 4APQB 2D03L 2NZIA 3IDJB 1N26A 3H9SB 1G9NL 2G75A 2IH1A 3CFBB 4GRLA 1A3RH 3FO9A 2HJLB 1M4KA 3RWJA 5ISZD 3U30C 4NN7B 1FSKB 4K23H 4PRHE 3TT3H 3RY5A 3MRHB 5BOPA 5B38G 2ICWJ 1X5XA 5D1ZA 4QRTB 2Q6WB 3W5NA 1NAMH 4I0KA 1I85A 4UV4L 2IH1B 3SDDD 4BELD 1KTKE 4XCFH 4OGAC 1U3JA 2F53B 2K7PA 3EOAB 1CD9B 3RWJB 2EIZA 2ED7A 5F1OB 1U6AH 1KCKA 3O4LD 4RGNE 4DVRH 5D1ZB 4QRTA 2X4TB 1WAAF 4WW1A 4QRRB 1DVFD 5IR1A 3HC0A 5EC1B 2EDNA 1A3LL 2QADC 4QRQB 4XNYL 3QDJE 3MUJA 2UZXB 3WO4C 3TT1H 1MJJA 3HZVB 3JZ7A 2CK0L 4EUPG 1WIOA 4AL8L 1KEML 3KPPA 3QIUC 1PGRB 4XVTH 1SYSA 2K7QA 3D85B 4Y2DD 5KVEH 1SBSH 1KBGL 1N2RB 4GMSH 2VXTH 3O6FA 4KVNL 4HIXH 2HWZL 3UDWC 4M1DH 2AJ3B 5HDQH 5A40E 2W0FB 5DMYA 3T0AA 5MENE 4YHPB 3D69B 5DK0A 3W81A 1NAMB 4QF1B 2GIYA 4HIHA 3ZTJG 4L3CB 1MRCL 3KVQA 5HVWA 2VMFA 4HS3B 4XVSH 1R3KA 4JKPL 2WBJA 5EUOF 1U8IB 1N2RA 3KPSB 4QHUA 1R5VA 1NAMA 4R4FL 4QNPE 2BX5A 1YMHB 3DI2B 2X40A 1F4HA 3THMH 4XVJL 1U8PB 3IDIB 3SO5A 4Y1AA 4JEGB 1UXWA 1CT8B 2EXYD 3V6OC 4NUGL 3KPSA 5E6IC 5EO0B 3C5ZA 4MWFB 4F7EB 5CJOH 1NEZG 4DOHB 1T1ZA 4TVSa 3O2WL 3GSRB 1HI6A 5EOCL 4JHZA 4WEUD 5DEZA 1U8PA 3IDIA 4PJGB 4Y1AB 4YX2L 5IFAL 3GGWB 5C7XL 2EEBA 1LEGB 1DQQA 5E6ID 4OLVL 2NY6C 1MHHB 4HIJB 3EFDL 5CINH 3PWVA 4W6XB 1WEJH 2IJ0C 2NYYD 4LLVB 4IOIB 4M8QA 3V7AE 5T1KA 4JRYB 3EIFA 3QRGL 1YEIH 5I66B 3EFFA 1ETZA 3QISA 4PJGA 1KCRL 3C9NA 4R96A 1EVUA 4TULL 3GK8H 3V4PH 5A43C 5FIEA 4YZFE 1YA5A 4KK5C 4HIJA 1WFUA 5EIVA 1X4ZA 2XZAH 3QG7L 3MGTB 5HGHA 3P4NA 4I1NB 4WNQB 4U49A 1A3QA 1MVUB 2HG5B 4H8WH 1ETZB 5D6CA 4HW6A 3RU8H 2Y5TA 3QQ9C 4JFPA 4R96B 3F58H 4WDIA 4GRMB 4JY5H 4OJFL 4OLVH 1HSBB 1UJ3C 5EO1B 3PP3H 4KK5D 2VSDA 1MI5D 3W9DA 2CSPA 4MJIB 4AK1A 3BUYB 1CFNB 4WHTB 3ARUA 4WNQA 5DJ8A 4NDMB 5CBAA 4OM0H 5E4EC 4NKIL 4PP2A 3ULVH 4JFPB 1T7YA 1EO5A 1S9VB 4NRXB 2XACC 4CJ1A 3I02A 3RP1A 2AQ3A 3FT4A 1KC5L 3RL2B 1HSBA 2EO1A 4HSQA 3UO1L 5EO1A 4PLKD 3RI5K 2ZZUT 2VLRD 3T2NL 1EJOL 3HMWL 4PTUB 3DXAE 4PB0L 1CFNA 3SY0B 3UTPE 3GJEB 5E2WH 5BRZE 2AV7B 4ZOEA 2ICWI 2Z8SA 1MNUH 4YHIA 1TDQA 3EDKA 1AO7D 1F8TH 1ZLSH 1PG7L 5FF6A 1JZ6A 3ARYA 4KVCL 4P9MH 4CVZB 5D71H 3HE6B 2FEEI 2YWZA 5F3BA 1MCEA 4HKBA 3E8UL 4O02H 3SY0A 5C0BB 1R5IA 2P44B 4UV4H 3MODL 3PWNB 5CGTA 4OUUA 3FQTB 2ZCHH 1NDGA 3F65A 4NKOA 4LLMA 5L7XH 3WJJA 1OARH 1CIUA 4GMTH 4JDZA 3QCTL 2I26N 1NFDF 4MB4A 5GISH 4PJEF 2CDEB 1DN0B 3CD4A 3MJ8A 1WFTA 3RIFF 2P8MB 3QPXL 3AMKA 2V7NA 2R1XB 1A3RL 2VDPL 3TO2A 1A22B 2VDRL 1R5IB 2X10A 3U4EA 3CZFA 4JQXC 5I1GL 4XC3L 5FKPA 3DROB 3ESVF 1J0HA 1CE1H 4JDZB 1RHHB 5D1ZC 3I6KB 2K9UA 4NHUA 4BSJA 2R69L 3L3KA 5FYJD 4XPFH 4JFHE 2M2DA 4KVCH 2PXYD 3UYPA 3OJVC 1BLNB 4JVPA 4U6YB 3O8XC 5HDLA 3DROA 4TTGA 4LRIC 1OPGL 4WENB 4OCMC 3ZE0E 4PJIE 5GS2D 1Y6KR 2WP3T 2XRAH 4HBCH 4M02A 1MCSA 3L3IB 5JLZB 4OGXL 4M4RA 1EH9A 4I13B 2NY3D 3FHQA 3MBXH 5FGCB 4OAWA 3DXAD 4R2GC 1JYNA 1QSEE 4Y5YB 3RWHA 2RJMA 4CVUA 3OZ9L 1M7XA 4Y19B 5HY9A 4ZO9A 2KH2B 1TMCB 2X6MA 5JW3H 2UZIL 1M6OB 2PR4L 2CUIA 3KPLB 4K94H 3OJDA 3VFOB 3BISA 2XZQL 4G3YL 2FIKB 2HAZA 4GAJH 4LLQA 2IQ9H 2NY3C 4FTVE 5KVFL 3MXWL 3BIKB 4N1EA 4Y19A 1AGDB 3SKJL 4R26H 4QRRE 4DGIL 5DD6A 5E8EB 5KSUB 1P2CA 2J1KA 1WCQA 4MAYC 3OAZK 2FIKA 5C0JA 5IROC 5DMIH 1UZ8A 5I1GH 2BRRL 3PHSA 1MJUH 2LVEA 4RGNC 3W39B 3HZYA 4MA8L 4N0UE 4M03A 4H1LA 4JQXA 5F44A 2AAVA 2F5BL 3UJIL 3WLWD 1EMTL 2ZUYA 3QCTH 1CK0L 1MEXH 2GT9B 3AU1A 4Y16A 1GAFH 1XCTA 4XP9L 5GGUB 4AEFA 4HIEB 5CKGA 4YAQB 2VUYA 1NFDA 1QR1A 2Y07H 1IM9B 4LF3B 2ARWA 4M1CD 1UADC 1N5YL 4HUNB 1R5WA 4LGRB 1CDBA 2DLIA 1OQOA 3SO3B 5IIEA 3B9KD 2FYYA 5J89A 4BZ1L 5DVOA 1I3GL 2ZWLT 4N5UA 1R3HA 4OM1L 1Q0XH 2OMNA 1MSPA 2YZ8A 2OL3H 3AGVA 3GO1L 3MROB 5IM7A 1IM9A 3ALWA 4M5ZH 2R1YB 3GSVB 3HMWH 3QXAA 3FRUB 4NYLA 1KXVC 1R5WB 3V52L 5C2UB 1XGUB 3SEPA 1TQCB 1CG9A 3CLEH 1I9EA 4NGHL 3HUJB 2KBGA 3RWGA 4MJ4A 1JUFB 2XFXA 3FQWA 1NBVL 3QIWA 3RWIB 1JZ8A 4Y7MA 4FQQB 2EZ0C 3CXHJ 2D7TL 3VG0H 3WJLA 1MEXL 3MROA 5IM7B 4S11A 4U31A 1B9ZA 4G7VH 4TUKH 4WO4D 3FO0L 4FFWD 5IVZB 1XGUA 2EDTA 1CG9B 4WUKL 5C0CD 5JR1H 4Z77B 3F58L 2YD1A 4GAFB 3QIWB 3FN0H 3BGMB 3AXLB 3SCMB 1UWXH 3OAUL 3FFDA 3JBG7 5DEFA 4BFIA 3SDYL 1P1ZB 3M45A 2PO6B 4KTDL 3WN5A 3UTZB 1CICD 5GHWH 3QPQD 2BHUA 1EDQA 4IMLB 1BZ7A 3SE9H 5C0GA 2F9BT 1FZJA 4AY0A 2I25N 1MHCB 4WJ5B 2XKNB 3SCMA 2EDLA 2H45A 1YY8A 4GKNB 1A3LH 3ARBA 2GK0A 3RZCC 4OCWH 1RZ7L 4U4BA 2VLKD 4BFIB 1E4KA 1W72L 1CLCA 3UTZA 1PY9A 2JB5H 1X6NA 5AZEH 3I2CL 3U7AA 1OF2B 4J4PD 4NC1E 3UZEA 2YPLD 5C0GB 3E6HA 5JR1L 5ACMA 1BBDH 1RVFL 4TUKL 4TVPL 4ZTPH 4ODVH 3GJFH 4GFTB 4ZFOB 3RKDC 4JN1H 3QHTC 3TZVA 3PUCA 5C0CA 3MO1B 2OP4H 3TPUA 2ZUQB 5TE4H 1S7RB 2ORBL 4D9RE 2E6PA 5BMFL 1SJHB 1FFNA 2DM4A 5EUKA 4LAJH 5E5MB 3VXSD 2CIIA 3QUXC 1EAPA 4OM1H 3GMLB 3KG5A 2V5TA 4WWKD 3WUZA 2OXGA 3FCTB 4Y1AD 1OSPH 5K9QI 2QV2A 3BE1L 4ZXBA 5K93A 5IB3A 5LQBL 5L8JB 1SEBA 2PUQT 3CFKB 3O11A 3WNKA 4KRLB 4PJFF 2WWMD 4MD5B 2JIXB 1AE6L 4KV5F 4XPTH 4J3TA 2EYRA 1L6XA 1NJ9A 1A47A 1V7NL 2C4FU 5C0RL 5GSRA 1MQKH 5I2IA 5MEPA 2DL9A 5IB3B 1DQMH 4M7ZC 3WNMA 2R29H 3BH9A 4TNVF 1EGJH 3TVMB 1TFHA 1JE6A 2GITB 3FZUC 1NJ9B 1ZT1A 5C0FB 1KCSL 4H26A 2I24N 4XMKH 2EIEA 5GSRB 3V9FA 2VXUL 2WM0A 1WICA 1E6OH 4KDWA 1T0PB 5D7SL 4AG4H 4LOUC 4TSAH 2DQGH 2P5WB 1BFOB 4XMPL 4YBQD 2FLRT 5K9JH 2B1AL 4S10A 4X8JA 3D39A 5KSAC 1ZLVK 5J11B 5I1HL 3CMOL 3QUKB 1J86A 4AQ1B 5KVFH 2APFA 4FQIH 1I1AC 2OLDA 1BAFH 1U8OB 5E56A 5F93C 4WTWA 4OKVB 4QXWA 5FB8B 3K1DA 1D5IL 4GOSA 5C0BE 1BFOA 2BHZA 1SJEA 3GHBL 3C8HA 2GSGB 1F02I 1HZHL 2XQYK 3RAJH 1K4DB 3HMXA 4DWHA 4KPHL 2Z8RA 1L6ZA 1MCOH 3BVNA 2A9ML 2NY3B 5KBNC 1UB5A 3WDJA 1F90H 4U7KA 3WHXA 4LVOC 5IW6B 3MRLB 3CU1A 4OKVA 3TO4B 3S35X 5IK3B 1H3XA 1WBXB 5D1ZD 1NCBH 4IRJC 1AKJD 4CUCA 4OLXL 3QIWD 4HKZB 1SJEB 1U93B 3K2UH 4IEFB 2ZOLB 4RA0C 1C5DA 2WK2A 4M5YL 2IPKA 3KYOA 3CFCH 4PY7A 5TGBA 1T66C 5T33H 5JPMB 4HCRL 1J8HE 4MAYB 3BVNB 3C5SB 3Q5YA 1VFAA 3B9VA 3MLVH 4K3GA 3RWFA 4DGYL 3MRLA 4PLKC 5I1AB 1R3JA 3WHE0 5D6DA 2ZOLA 1CR9L 4OGYH 1JGEA 1U95B 4WEBH 1Q94B 1IVLA 4M3JA 4MAYA 4P2QE 1JPSL 4OV5B 3T0EE 4XNMA 2W0LA 5F3HB 5I1AA 5F6HI 3L3HA 1MHPH 5D2NA 1OAYL 3C2AH 4CAGA 4DK6A 4B53A 4OF8A 5JHDD 1XF3B 5JHDA 5EOCH 2R0WL 4R6UA 3QQ4B 1QBAA 3PWPD 1UWEH 5BW7C 4NPYA 5HDBF 4ZUSB 1RHFA 5CJOL 4OQTH 1OPGH 2FATH 1NDMA 1YYMH 3C8KB 1JCKA 5HGBB 4LKXA 1CZ8H 4X6BB 4NZRL 4PGEB 1OM3L 5IB1A 4AENB 5JDJA 3D25B 1LO3L 3V6FA 3Q6GH 4N8PA 4A6YL 2R69H 1FE8H 4Z7NE 1KELL 4OZIB 1TPXC 5CEYB 3GKZA 4KGLA 5AEAA 1QFHA 3PG2A 5HGBA 5SX4I 4OSUL 1OAXL 3FB7B 1IQWL 5E1AB 3MXVH 1S5IH 5I8EA 4YHKH 4WI8A 3ZT5A 5ESVB 2F54D 1FL5A 5BV7C 4OZIA 2N7AA 3Q5OA 1DBAH 1CFTB 4X9IA 4ZUVB 5F7HA 4RMQA 3D2UA 4U1LA 2ICCA 3BPNB 5D1QA 5DEGB 4JY5L 1NBYA 4O2FA 3JWOH 2DKUA 1MIMH 2PNDA 2LAAA 3HB3D 2Z4QA 4JGMA 1MUJB 3QZWB 1LE5B 3SDCA 1OVZA 3C60D 4JPVL 4ODHH 4XBGB 1ZSDB 7FABL 3MUY1 4LLDA 5EPMB 3HRPA 4IOFD 4GW5B 3VXOB 2X9XA 1FG2A 4JVWA 3MV11 2IQAA 5D5MB 1MUJA 1FAKT 3SDCB 1EJOH 2ZSVB 2ARJA 2BNRB 2DIAA 2EECA 2C7UA 2ZNXA 3NN8A 4UT7H 1ZSDA 1WZLA 4LLDB 5F1IA 3S98A 1CL7L 3VD3A 4ZOBA 5AZ2H 5F6IC 2PXYB 2DYPA 5T3ZE 4N90E 5IHUL 1TCMA 3OKNA 4F9PA 2J8UA 1UZ6F 5JHDE 3EOBB 3U0PA 4DAGH 1J1PH 5E9DE 4JM4H 3HHRB 1IGFH 5DSCA 5I1CL 5F1IB 2Y7QB 1S9YA 1JGVH 3I84A 4KZEH 4HLJA 3VXTA 4JFFD 4YGVB 1HHJB 1DFBL 1A6UH 1U58A 4YHMH 4ZQKA 3WIHA 1KCLA 3GBMH 3EOBA 3U0PB 4C4KO 4ZS7H 3S8WA 2SEBB 3RDTD 5I16A 5D1XC 4H88H 1S9YB 4R4FH 4JFOA 2NY2C 1BEYH 3G6JE 2FBOJ 2J4WH 3ESUF 4PPTA 3UYOD 1EERB 3MUHL 1CGYA 3FQXB 4CVWA 2H1PL 3HRZA 4JR9H 1JYXA 3H7LA 4PJGE 3KWWB 1TCRB 2VXVL 4G8GB 3X13B 4X6FB 3FRPG 4EUPH 2AK1L 1M7IB 3SKOB 3QNYA 3A6CH 2RBLA 1WBYA 3GHEL 3JTTB 2V9TA 4QTHB 5I1LB 1NBVH 3ARZA 4JFOB 2G60H 1S7SB 4P59H 3L3GA 2X4PB 5C71A 1RUPL 5I1EL 1MFBH 1S7WA 4JGJA 2EDXA 1LP9E 3FQXA 4WV1C 1RV6X 1F11A 3DYMA 5ICYA 3D85D 1MI5A 2R0LH 4LVOB 2AVGA 3X13A 1YEDB 3OWEA 1DEEB 4GW1B 2ZCLL 4CRPA 5C0BD 2QQLL 4NNXB 1NMAH 4I0PD 5I1LA 3QIBC 3LAFA 4OCXL 4PJCF 4KAQH 5GQBA 1EEYA 2BJML 1FVCA 5FECB 4FQJL 4JM2B 3OKMB 4YK4C 3IU4L 1MI5B 3I9GH 4LIQL 4PGCB 5E03A 1DEEA 4GW1A 4EDWL 2VISA 1A1MB 4WW2C 3VD5A 3FAXA 3H3PL 5M7QA 5F71A 4KXZH 3BPCA 1IAII 4QTIH 1HN1A 4UUJB 4ZPVB 3PXHA 1RZKL 2C3HA 1PFCA 1NQBA 3QFJD 1WT5C 2JJSA 2WBWB 1A1MA 3X3FL 5D7JB 3FOMB 4G43A 3QULB 3AS0A 1JFQL 4KY1L 1A9BB 2EYSB 4OD3L 1F4AA 5FOBB 3C08H 3QJHB 1D6VH 4ZPVA 4XVTL 1G9NH 4NQDA 1MCKA 2YRLA 3B8YA 1CE6A 1CVSC 1AJ7H 4FQJH 5DDHA 3T4YA 5SV3A 3MLUL 4LP4A 2IG2L 1LD9A 4KQ3H 3DUUB 3D0VB 5I71C 2W9DH 1JBJA 3DX6B 1KXQE 2FATL 5HHVL 4OGZA 1A9BA 1T2JA 4GRLD 1FGVL 4OLZL 4YUEH 1HQ4A 3TFKC 1P9MC 4HWBL 4HF5H 1EIBA 2HFTA 1A4KB 1MFCL 3ARFC 4LLYB 1T4KA 4LSSL 2ZJSL 4HGMA 3ZE2E 4BZ2H 1Z5LA 1X7QA 3O4OB 5T1MB 1LD9B 1T5WB 3T3PE 4MDIA 3QXDB 1CXHA 3A6CL 4GS7B 1QHPA 4PJ5B 3FJTA 5JOEA 4HFUH 1HQ4B 2H9GA 4UQ3B 1MPAL 5IFJA 2VDML 5DUBA 3O3UN 4X80L 1A6WH 4FQXA 2P43B 3EO9L 1F3RB 1U92B 2AK4E 3RVWD 4XGZA 4DGVH 2Z31B 1E4KC 2JCCE 3P73A 5D1XA 5KOMC 1Q1JL 2N56A 4YFLF 3WBDA 5T1MA 4RMWA 5I1HH 2E5EA 3CFBA 4GRLB 5D2LE 3ME0A 1MRDL 4OFVA 4YHLL 3L1OL 1IE5A 4UT6L 1V05A 3MRHA 3NA9L 4HS8L 1RMFL 5I73C 2XKSA 4EKXA 3JWOC 1RUPH 1T21A 3BDBA 5T1DL 1BIHA 5CJXA 4Q9RL 3FO2B 3DSNA 4JFXB 1OTUC 4EVNB 3RNKA 2DI9A 3WE6A 2FO1A 1N59B 4GT7A 4FTVA 2EIZB 4ZO7A 1F6FB 3UJTL 3WIFA 5FO8B 4Y19D 5J1TC 3DBXB 4Y88A 5BXFA 1UVQA 5F9DC 2X4TA 4HC1H 4WW1B 4QRRA 4UB0L 4XWGL 3SKNB 2JF1A 2D31B 1MCCA 5L2JB 1EEUA 1YN6A 1A7OL 3SDDA 2FX8L 1WWBX 1YQVH 4DN3H 3TESA 1QSFD 2P4AB 3FO2A 2UY6A 3N85L 4N68A 4HUXA 4NCDA 4Q0XH 4XNUL 1RUQL 3KS0J 1G9EA 4PJ7B 1NGZA 3GBML 4NWTL 5IV2A 4WUUE 5EU6D 4JJHA 1LNUB 3VFPA 4URTB 1SYSB 1UKQA 4HMDA 1IKFL 2D31A 1ZE3C 1XGPB 1YN6B 5EOTA 2R8SH 3QEUB 3PE9A 4Y5VA 4M43H 3JV0A 4G8FB 1WGOA 1S7UB 2D7PA 4PY8J 3O6FB 3JVGC 4NKMB 2YXFA 3IDNB 4K7PY 4GKZB 5IQ9A 3D3VE 3I50L 4YHPA 3D69A 5DK0B 4PJ7A 1YEHH 2F58H 4QF1A 4R4BA 2BVUA 5IV2B 3JWDC 4HHAA 2QQLH 4XP4H 4OF7A 2ZP0T 1IL1A 1U0QA 2XWBA 3NACL 2IAMD 1PQZA 4KI5F 3IDUA 3QEUA 2P45B 4IDJH 1KACB 4M6NL 3BKCL 4NSKB 4JZOA 1EX0A 3H42L 5ITFA 5D2LF 3P0VL 3HI5H 4KK6C 1AHWB 5KS9B 3HG1D 4ZNEE 4NKMA 5ADPL 1T7XA 4QHUB 1D6EA 1N8ZB 2CGRH 1MHPL 4LNVA 1FZOA 2XZCL 4HHAB 1YMHA 2ICEA 1KJ3H 4HK0B 5DUMH 4ZFZA 4ENEC 1G6RA 1GH7A 4Z7QF 2Q8AL 4LOUD 1KGCE 1SEQH 1SY6L 4QHLA 2PTTB 1HSAA 2DN7A 4LAQH 3UEZA 2A6DB 2CD0A 3C5ZB 4MWFA 4KK6D 5D2LA 4F7EA 5CZVL 3GMMB 4ODWA 4JPVH 2YUZA 3V4UL 5F9JA 3QDGA 4YDIH 2V2WB 3VWKC 1HI6B 5FAAA 3K3QA 4XCEB 5B38B 2IAMC 4Y4HD 3WSQH 3QCVL 4OZFB 2DMBA 4ZD3H 3CDGB 5IG7B 2CRZA 4GG6B 4YJZL 4PJ7F 1QFWH 4RFNB 4F57H 3SDCD 3WUWA 1QSEB 1RUQH 1VEMA 3VD9A 1JN6B 1V3LA 2YS4A 2CO6B 3CFJA 5TFSH 4HX1A 1UH4A 4OZFA 1NC2B 3LSOA 1ZT4A 2APXA 5MENA 4GBXD 3KPRA 1NCUA 4YE4L 4KVNH 5C07D 5L2KD 1PYWB 1QSEA 1F4YH 2AEPL 2EDHA 2VLRA 1XGQA 3NPSC 3CFJB 3SE4C 4YFEA 4XP4L 4XMLL 1L7IL 4XAKD 5IEHA 4XTRD 5AWNH 5D70L 4PJ8A 1ZT4B 5FV1L 4GH7B 2V5MA 5K59E 1AR1D 1PYWA 1FGVH 4OLZH 2R8SL 5TDOB 3QA3A 1O0VA 1UJ3A 4LGSB 1H5BA 1E6JH 3AVEA 5A2IH 3H2WA 1LILA 3VJ6B 3SGEH 5DJ6B 1MCRA 4ZAKC 1OQXA 2VE6A 4QY8B 2XNAB 1Y0LB 2FHBA 3LS5H 1KB9J 1T6VN 2O5XL 1JF5A 1P4IH 2APWA 4NRXA 3O45B 1UFUA 3MR9A 4JHWL 3STLA 1OAQL 3AREA 2FLBT 1H5BB 1I7TB 2IQ9L 3V2AR 2VDLL 4MQSB 4ACPA 5IMOB 1T3FB 3QHZH 3UTOA 3DVFA 1KJ2B 4FFYL 2AABH 4W68A 3GJEA 1MFCH 4YHNB 1A5FH 1VKXA 4F9LA 4RRPG 2VAAB 5C0EB 3WXWL 1IKNC 2VR5A 4NQEB 5DVNA 1K85A 4K07A 1AE6H 3O45A 5E2JA 4DGYH 3TCXA 5AAWA 3LHPL 3TA3C 5DVKA 5BCAA 3PWJA 5E6YA 4D8PB 1I7TA 4CVZA 1NCCH 3HE6A 1KV3A 2UYLB 3ZYJA 1JZ3A 1YNKL 1QSVA 3WCYA 1CFQB 4OT1L 4YPGB 2KQNA 4X8XA 1YYLH 5FUZL 5C0EA 2W0PA 4OZHE 1YEKH 1ULVA 4LLMB 3DV6B 5JW5A 5J9PB 3G6JF 2YR3A 3FTGB 4XPAL 2BY2A 4KAQL 1EFXB 3MXWH 5I18L 1WUNT 2AXJA 2CDEA 1YMMA 3ZDZF 2UYLA 1DQLH 3NAAL 4LPUA 3P40A 4PR5B 3TBVA 4HG4K 2R0WH 5I76B 4MXQD 2R0LL 3J8F7 3TF7C 2A6KB 4XP9H 2E6JA 2M26A 5KTEL 1K3IA 3U9UB 5JIIA 1RHHA 2BXZA 2Q7YB 5E95B 5F88B 4PBVC 3GI9H 4Q2ZB 5A2FA 1YUHA 4P23D 4R8WL 4PRBA 2NW3B 4XAKE 3NTCH 1JI1A 3VCLA 3QEQB 4NFBA 1U8NB 1BD2B 3B8SA 2BVQB 5I76A 1SY6A 3GSUA 4OLWL 1TENA 3MRCA 3BPOB 4RGOH 1BLNA 3M8OL 4P9HH 1EVTC 1OAQH 4PJDA 3EOYG 2V5SA 5BRZA 4XPAH 5HHXH 3VFRA 4C56A 1BEYL 3EJZC 3CZJA 3EDFA 1F58H 2DLFH 2XOTA 4P0DA 2J6EA 3Q5TA 4F7MA 4D9QE 4LASL 3BWUC 3TN0A 3QEQA 5SWQA 1C1EL 2FO4A 4O2CA 3A67H 2HRLA 2ESVD 4MNQD 3LVEA 3MREA 2PKDA 4JFEB 3QFDA 1B0GA 1M6OA 4JFFB 1B90A 3F5WB 4G8IA 4FABL 4Z76A 5DJCA 3UCRA 4J3SA 4QXTA 4LU5H 2XG4A 3TN0B 1ZA3A 1F3JA 1VGEL 2A9MH 4HUVB 3WNOA 4Z8FL 1BP3B 3QNXB 4HIIA 5L8LB 4EIGB 3MBXL 3EFDH 1IFHL 1PG7W 2YSSA 4OCYH 3QP3A 2IADB 4P3CL 3KGRA 5MI0C 4ZTOL 4HD9A 5GPRA 5I6XB 4J3VA 3K81A 5C0JB 4LPVA 5E8PB 1U8LA 1ZHNA 4LK4A 2MMXA 4F7CB 5ECJE 1OP9A 2VN4A 1AXTH 1IBGL 3MPCA 3LRHA 5KSAA 3O2WH 5D5MF 1OD7A 1S9WB 3MX0A 4I5BA 1U91B 1RZFH 4M1GH 3PF2A 2IADA 4J3XA 5D4QA 4HLZH 5HHME 5ESAA 3D0LA 1KYOK 3AU1B 4MZ2A 2OZ4L 4YHYB 4TVPH 5E8PA 1U8LB 5GGVH 5GGUA 4X83A 4ZD3L 3WO3B 1FFOB 3TBWA 1D9KD 3WFBH 1XT5A 5KSAB 1FNLA 2IWGA 3VGEA 1S9WA 3IRZA 3LPFA 4LF3A 3JXAA 3RIAK 2OCFD 5JOPD 1JPFA 2FJHA 3LN4A 1A14L 1EBAA 5D7IE 5D8JH 1DP0A 4QT5A 3S7GA 3D0LB 3OG6B 1CICC 1I9JL 4AZ8A 3GI8H 3KHQA 2QR0B 4PFEA 4P48A 5F9OL 4J4PA 3WNPA 2DBLH 4WW2B 1MREL 3RIFK 4UTBL 4MA3A 3TBYB 4P2OA 1LO4L 1IQWH 1CVRA 2W1NA 4JE4B 3GSVA 2HKFH 4ODUB 3JUZA 5JXEC 4BUHA 3CFEA 2YRPA 4NRZA 3CXDL 3VU2A 3ARFD 2G5BA 4LARH 3ARDA 2QLVB 2Z93A 4KWUA 4GRWF 1BD2E 1YY9D 1ZXQA 2XPGA 2COQA 4F7TB 1QD0A 4FQQA 4WW2A 2ICWA 3DI3B 4R26L 3O6FC 2YA1A 3G6JB 5CD3A 3VGHA 3N1GC 3NH7H 5H2BA 1E27A 4G42A 4MNHA 4OF5A 4WV1A 3VRJA 4K94C 5HI3D 1WZ1H 5FHBL 5IBTL 2NX5A 4IIQC 3GBLA 5D96B 3TNMA 1AD0B 4JO1H 5CINL 3QFJB 1FNGA 4F7TA 1ORQA 4FMKA 3FFDB 4NWTH 5CSBA 2XXCB 4HZAA 3OF6D 5HD8C 1JWMA 4ENED 1P1ZA 2N7BA 2PO6A 5H2BB 1E27B 2I60H 2FD6L 4G42B 4MNHB 1CLYH 5J13C 3L5WA 4NNPL 1RIUH 1A1NB 4IRJD 2Y5EA 2DLEA 3TNMB 3TPKA 2DRUA 4LNRA 3MFFA 2JKXA 2VXTL 4JG0L 2XQYG 5FO7A 4D2NA 3ZHLA 1AP2B 4G6FB 2LVCA 4F37K 3S3SA 3ZKNC 4FQ2L 4JQIH 4M43L 4PD4K 2F19H 1QACA 1UWGL 5KN5B 1IC5H 2RR3A 1Y18B 1BJ1H 5SX5K 5B3JF 4MJ5A 4C4KT 4FZEL 4LNRB 1N3NA 4MD0B 4MAUH 4NM8L 4MJ6B 5KANG 5F7DB 4TUJB 4X99A 1DQJA 4Z78B 4PJHB 2IALB 5JOPE 5EH1A 1A6TB 2MWCA 2QKIA 4NWUH 1JZ5A 2OTWA 5CD5D 1PD6A 5J12C 4P2QA 3M07A 1ZHLB 1FL3A 4M6OL 5KN5A 4P5TD 3ARPA 5KG9A 4KMQA 4GMTL 4YEEA 1AFVL 4R90H 1FH5L 1MFAL 1FFNB 5C6WH 3CPLB 5HHMD 5EUKB 3U0WL 1J05A 4LPTA 5ERWA 3GIVA 4BQCA 2FNBA 4G80B 4FXLA 4LSRH 2GJ6B 1NSNL 1LO2L 2B39A 4BZ2L 2XN9A 1I1AD 2W9EH 5KG9B 1QUNA 3CFKA 1JGDA 3DMMD 2AK4A 5F7EL 4XB7A 3TH4T 1G7PA 1QRKA 2DI8A 2EE9A 5ERWB 2DWDB 5DD3L 5JHLL 3GIVB 3QUZB 5FYJU 3U4BH 1A0QH 4YDJA 1YECH 1FJ1B 4XNXH 4G80A 3HA0A 4S0SD 2WSKA 1F3DJ 5MEPB 5I2IB 2GJ6A 5E99L 4QRPB 2OZ4A 1G6VK 4FZ8H 3EO9H 1H3WM 4R7NB 3KAAA 1VERA 3HAEH 5EORH 4PUBL 4HEME 2FH6A 3DUSB 3PABA 5FCSH 1QBMH 1IGIH 3TV3H 4Y16C 4RISH 2V17L 3GB7B 1FH5H 1MFAH 1GGUA 3E6FB 2C9AA 2D9QB 3KYNA 1NANI 1VGKA 2VZ1A 5DR5L 4GQ9L 1CL7I 2R4RL 3IJYA 2AS5M 2J8HA 5K9KA 2HRPH 2XWTA 4YO0B 5DMKA 4D9QD 2YPVL 3JVGA 3DUSA 4G7YH 3V5KA 2YD5A 2EDWA 1YPZE 1BOGB 3EGSA 1MIEL 5C2BL 3E6FA 1I1AA 4IOFC 4F80A 3OV6A 5E99H 2GHWB 2NXYC 1A64A 4L29A 4BK5A 1K3ZA 5TDNA 1CBVH 4RQQB 5SWZE 2F19L 5IB4B 1INDL 5J56B 5K9KB 3V79C 2ZUSA 4PJXE 1TPXB 2DBJA 5I17A 2AJVL 5TPWH 1HXMB 5IVNA 5E94B 5EC2B 3EYSH 3PGCB 3MLXH 4XBPB 4LDOB 3OXRB 2XZQH 2I27N 3ZYOA 4S1SL 4F58L 3D3VA 3MACH 4XCFL 3IJSB 3DX7A 1U93A 1C5DB 5IB4A 4E9LA 1UEMA 3QH3A 1RZKH 2CLZB 5D7KD 3WL9A 5ILTH 2AXHA 3IFOA 5GZNC 4N0FA 2J6EL 4OKDA 3W2DH 1G1YA 5EC2A 3C5SA 4LSSH 3B43A 3RGVC 5GS3A 3BGFB 3EJYD 4K7PX 4P2RB 1H0DB 2XN9E 4H0GA 4KKAC 3GSWA 3TIEA 4IOSD 5FK9B 3S5LG 3O2DA 2E8ZA 3B3IB 3OKDB 4Q9BA 3QH3B 1JGEB 2CLZA 1WZMA 4U0RC 4KQ3L 3QQ3A 4DKEH 1YMME 1QA9B 4YDKH 2IC2A 4Z95H 4OV5A 5TQ2L 5DFWH 4OI7A 1KOAA 3MRKB 2FX7L 3PNWB 4OZGF 1UEYA 5D2NB 2VQ1B 4P2RA 4Z7UF 2I07B 4IRJA 4YXHL 2YHGA 4LARL 4HPYH 1JPST 3MNVA 5FCUH 1IGTB 2DTML 4UDTA 3QQ3B 5M94B 2VDLH 2QHRH 4D0DA 5TQ0L 5C9KA 1LP9B 1SM3L 4RFEB 3MLYL 5C0DA 3VFTB 3T0XA 4R9HA 2R1WB 4ZSOB 1J1PL 3O41A 5GISL 2UV3A 3MBEC 4IRJB 2D2OA 2O5YH 4H20H 2ZKHH 3SE8L 4ZFOL 1MCWM 4WO4B 4Z7UE 1FFQA 2PXYC 4AENA 3D25A 2XTJE 1J0IA 1IAIL 3G5VA 3KYKL 3V8CA 2FEDD 4XCYA 4LPYA 3V8OA 3DX9A 5CEYA 2VZ3A 3EYUL 5F72S 5KSBA 5IB2A 1Q9OA 3ARFA 2BY0A 5F9WC 3BT2L 3L6FB 2VLKA 2WNGA 4XVJH 4YC2B 3KPQA 1T1YB 4WFHD 2X09A 4FRWA 5FYJH 3G5VB 1Y6MR 1FCGA 5ESVA 5DRNB 3BQUB 4U3XA 4WW2F 2NTSP 5HYJA 3SOBH 1QPXA 3DURA 5DGRA 4H1LH 1MRFL 5IB2B 3LDBC 4ZTPL 3HC3L 1WCBA 3NIGE 5ILTL 4P59L 1VADB 5IF0B 3GMPB 5FHAL 2Z4QB 3ZE1F 3QZWA 1LE5A 4UB0H 4XWGH 5CD5C 4PP1D 1JIBA 3DECA 4K7FB 4PRNA 3OAZH 4R0LB 3OR6A 5EPMA 2XWJA 2VNCA 2GQHA 1GGTA 1VPOH 1WCBB 3BMWA 3WFCH 5KANI 4PJCA 5HHOA 3MJGX 5E6IB 1SM3H 5I1DA 4QXGH 4GXUM 3HCVB 4P2RD 4HBQA 5D7LE 5JA8B 2P5WD 1AD9B 4JDTL 2Y6SD 2BXYA 1ZKAA 3NA9H 4HS8H 4WHCA 3VRLE 2EYTA 2XWJB 1JNHB 2A0LD 3TFKD 1GZQB 4JN2B 3MRMA 4GSDL 1MRCH 2EDRA 4PV9A 3B5GA 1NCTA 4NZRH 1AD9A 3CDFA 1ZT7A 3X3FH 3BD4A 3OAYK 5DRXB 3HNSL 1EJ6A 2NNAA 4DCQA 1BREA 1FYTE 2Y7QA 1P6AB 3SE8H 2CO7B 2IBBA 3UJIH 4CADA 3BYYA 4XHQA 4KK9C 5JDSB 5EFIA 4XAWH 2P7TA 2FX9L 3MLZH 1CDHA 1C5CH 1P7KB 4X6CE 4YGVA 3L9RA 4PV9B 2YK1L 2P49B 5TDPA 1RJZB 1CQKA 1ACYH 4OSUH 2A73A 3TT3L 4BFGA 3OKKB 2P46B 4QRPD 1KB5L 4HUUA 1VFBB 1SMAA 3TN0D 3SOBL 4Y5XC 4CADB 4DEPC 1I8IA 1DQLL 4LIQH 4UMGA 3ZTJH 4GAYB 4MMZC 2CQVA 2ZPKH 3FFCD 1TQBC 5FYJL 5J8OA 5EU6E 3L9RB 1NLDL 3S88H 3HRZB 1RJZA 2NX5E 2NXYB 3MRNB 3T4AA 4YXKH 4ONGH 4X6FA 5DMGC 3OKKA 4Y4HC 4L4TB 5C92A 5MI0B 4XH2A 1P6FA 1BVKB 4JG1L 4J3UA 4JDVB 3VGAB 1UYWH 3NIFE 1FDLH 1S7SA 1KXTB 1C7TA 2X4PA 3NABH 2AGJH 4CDGC 3IDXL 4X7TA 1MIEH 1F11B 5ICYB 3MV7E 3OZ9H 3ARRA 3RVTD 1FRGH 1YEDA 4HJGA 2HVKA 1C5CL 4XH2B 4NNXA 2BVEA 3MACL 2ID5A 1UKTA 1AHWC 1A4JB 3WS3B 3EYSL 1UM4L 3ARQA 3MJ9H 4OGYL 4EJ1C 2EC9T 1MLCB 1U3ZA 1AXSB 3L95A 4R3SA 3G9VA 3QDMD 4X4MA 5I15H 2AJXL 4XPBH 5H8DA 5DJYA 3RPIB 1TZIA 3HKFA 5HHXL 3CSBA 1A4JA 5I1KL 2AK4D 3SO3C 3K8MA 4JG0H 5C09A 2EXWC 3PJSA 4K3JL 3FQUA 1FFPA 3R1GL 2DDQL 4Y1AE 2JJVA 4X7DC 4KI5C 3D6GA 2ENYA 5GGVY 3FONB 3MV01 1ZGLB 4Y8AA 4JPWL 1MWAB 5IT2L 4XNZC 2ZUXA 3T2NH 3QUMA 4I8DA 1FRGL 4XBEH 3IJHA 2H2SD 4D9RD 2EYSA 3ZTNL 1NL0H 3C2AL 5EBMB 5FM4A 4YQXL 2E7LC 1JWUA 2H2PC 3D48R 4AEIH 1RZKC 2AK1H 4ODVL 1OTTC 1HWGB 2VIRA 4R90L 4PJEA 5F1SA 5JNYA 1DLHA 1MWAA 4PRPD 5IEKA 3DO3A 5D7IA 3IU4H 2ZCKL 4G8GE 4O51A 4JHWH 4HUMB 3SGJA 5I9QB 2AJZB 2GFBA 3MLWL 3DRQB 1S78C 5CUSH 3MRGB 3U4BL 5CEXA 1A4KA 1MFEH 3EUUA 4H8WL 2ZCLH 3VWJB 3WEXA 5DC0A 4CMHC 4XT1C 3PL6C 3G6AB 1QP1A 1A7RH 1CFBA 3ILQC 2X1PA 5I75B 3LHPH 3JUYA 2KZ1B 1W0WA 4OQ1A 5SWZB 2GJZB 2M1KA 2AJZA 2GFBB 2H9GB 4QGYA 4UQ3A 4PJIF 5IFJB 1BGXH 4HJ0D 5CEZD 5TF1L 3MV7A 1ZOXA 3VWJA 3WEXB 4BQ8A 3KPRD 3MV7D 4XWOD 3QHZL 4HFWA 4KDTA 2BNQD 2KL6A 4OD2A 4PJBF 4KUCF 2R9HD 1AR2A 1HWHB 2H3NA 1ZLUH 4KKNA 1D9KB 3P0VH 1FNHA 1TNMA 4BK4A 4Z7WE 5GRVK 1RU9L 1KB5A 3FFCE 4JKKA 2HJLA 5ACLA 3NCEB 3KPMA 2QQNH 1I8MA 4P46D 3V4PL 2DM2A 3OKEB 1A7QL 4RAUB 3B6SA 2CPCA 4R97B 1ZA6B 4DKEL 1W0YT 2V6HA 5BMFH 2EZ0D 2X9YA 5H35A 1P69B 3SKNA 5L2JA 1KB5B 1VEOA 3EAKA 2WUCH 1NCAH 2RHEA 4A6YA 3TH2T 4HUXB 1G7QB 3T3MF 1NGZB 5HVGB 4RAUA 5KS9F 1WAAE 1RUKH 3WJJC 4EEEA 2BVTA 5AD0B 5EOTB 3UZQA 4A2MA 3TA3D 4OBSA 5AZEL 3L3JB 1MFDH 4QRQA 3R4DA 1OAUH 3RRQA 1NFIB 4RIRB 1Q72L 2DQTH 4GKZA 1UCBH 3UX9B 3KPPB 4I18B 5E08L 4FZEH 4ODSH 1J0JA 4HPYL 1DSFH 4X5WA 1ES0A 3BUTA 1S7QA 4HJJH 3STZA 1PQZB 3BZFB 4POYA 1Z6JT 2C3VB 1KEMH 5D7JC 3VE0B 3EOTL 1GOHA 4KROD 4H8WC 4YDKL 3KPSD 1A7RL 2PETA 1NFIA 2AJ3A 1D6EB 2XQBL 1GC1C 1A9EA 1J88A 4ONFL 4TOYL 1FZOB 3I3DA 1FCCA 4YHLH 3NZHH 5IJKA 2VZTA 1ES0B 3GMNA 1UWEL 1H3GA 4EUPB 5IWLC 4HS3A 1WITA 4I3RH 2C3VA 2PTTA 3RTQD 3PP3K 3HG1B 1HYSD 3GMMA 1RQ5A 3VGAC 2XA3A 3G04B 4PJFB 4YDVB 4XZUB 3S36H 3Q6FA 5KVDH 3Q1SL 1FE8L 3HR5B 4JZJC 4P49A 2GSIB 4X6EB 1IAIM 5LAXA 2Z0BA 3PQYA 3VXRA 1EHXA 4HWBA 1W8NA 4J1UA 4RAVB 1M1SA 2FHFA 4BFEA 1MJUL 3G04A 4ODXA 4PJFA 4YDVA 1RZFL 5I6XC 4PJ9D 1NC2A 3LSOB 1CD8A 4BUGA 3HR5A 4XPHL 3O4LB 1L9MA 2BFVL 3BKML 3T65B 2IG2H 1FPTH 4LCWA 2ARJQ 3WIHL 5L9DH 1Z9OA 4M61B 4J1UB 3F7RA 2AJXH 4XPBL 5EBWB 4U1KB 3PP4H 1BQSA 1MHHA 2IGFL 4JFHD 3FN0L 3RWEB 3PWVB 2F54E 4IOIA 4OFIA 3DTXA 4OD3H 5D5ME 2FJFA 3PDOB 3O6MH 3MV9A 4Y4KB 1ZHKB 1WAAA 1F90L 3MXVL 3EFFB 4DTGH 3O4LA 5MP6H 3HB3C 4C55A 3EKCA 3OJ2C 1EZVY 3C9NB 1A6WL 3RTQA 2E7CA 1A6VH 4PJCE 3KLHD 2NR6D 3QPXH 4C83A 2GJJA 3S96B 1LGVA 4M7JL 3P11H 5C6TL 4K55A 2XG5A 3LZFH 1D5IH 2O5XH 1TZGL 3UTTB 3P4NB 4ZOAA 4GXVL 2LAGB 2NY5H 1YMMD 3EO1B 3T0EC 1T6WA 1V3KA 3MRFA 5IMKA 2HG5A 2VXSH 5L88L 3SGKA 1K8IA 5MERA 4Y5XB 3IS1X 2FHCA 5JMOC 8FABB 3KLHC 4C83B 3BDYH 3MR9B 3STLB 2DQGL 2MKLC 5TE7L 1CD1B 2W9DL 3KNBA 1BWWA 4V1DB 2YD6A 3WFEH 5EZLB 5IMOA 3UTTA 2AJSH 3MBED 1MAKA 1KG0B 4MNGB 3ILQD 5K9OB 3U83A 3H8NA 1OGAB 1A6AA 1A6ZA 1FG9C 5HI4D 3Q3GB 3RL2A 3LEYL 4M7LT 2VLME 1F4XH 1BPVA 1CD1A 4L3EA 43CAB 2FSEA 4PTUA 2B0SL 1IGML 1G9MH 1X44A 5E00B 4FG6C 1CTOA 1YEJL 4GBXB 1L9NA 1T1WB 3LS4L 2AV7A 3MLZL 4PJIA 4MQXD 3QUYA 4NFCA 4P5TC 5I9QC 5DQ9B 3LCYA 1OTUD 5SWZD 3ZL4L 1A21A 3O2DH 3QCUH 4NO3A 3FTGA 3I3EA 1RURH 1EFXA 1VACB 43C9A 3OX8A 1J8HD 5J11C 2HMID 2VDOH 3D9AH 5E00A 2N1KA 4U0QB 3HUJF 4ZAKB 5EBLA 3MFGB 4TNWK 3F7PC 5IW1B 3PWNA 3RU8L 3FQTA 3QWRA 2HRPL 5CAYB 1O7VA 3GRWL 1S7TB 3L3OB 5HI3C 2Q7YA 5LCVH 1Z0NA 5F88A 4FG6D 3OX8B 5D93B 4Q2ZA 4X7CC 1ADQL 4FQHA 4PB9L 3IU3B 3TYFB 4HKXB 2P8MA 1BZ9B 4P9HC 4Y4KD 5EBLB 1U8NA 1JHLL 1IGIL 1MREH 1UB6A 3TV3L 3BO8A 5HSFA 3TBSA 1TTGA 3MRCB 3VG9C 3KPTA 4OFDA 3P2TA 3V5HA 5F8RC 1NGWA 4PREA 3MRPA 4U1MA 1UM6H 3DYOA 1QYGL 5C07A 4WFFE 4FZ8L 3I6KA 3VFRB 4C56B 3RKDD 2G60L 2OJZL 1X5IA 4GG8B 1MQ8A 2ATKA 3RZWA 4LMQI 1JNJA 1J0YA 1UB6B 5BS0D 3DV4B 3OXSB 3BO8B 2FDBP 4LBEB 1S78D 3ETBF 4WI9A 4EQ2A 2C5DC 5HVFB 3I50H 3MREB 4CBPA 4PREB 2HLFD 4U1MB 3QFDB 4U6VL 1I9RH 1YEFH 3WFEL 4NN7C 4HPOH 3QDHA 3F5WA 3BDYL 1I3GH 3UJJH 1ZA3B 3OXSA 2JK5A 3GSNB 5GZOD 5HY9B 5D7LA 4HIIB 4NCC2 3MJ9A 3LB6C 3H9HB 1OSZB 4MZ3A 1FYTB 1NUNB 4FFZH 5EU5B 2FCBA 4L3EE 4WFGE 1YQVL 4DN3L 5CZVH 2DYPD 1KN4H 4WU7A 1KCVL 1NC4A 3OPZL 2P5EB 1WTGT 4JRXB 4HUKB 3PDGA 3SDAA 4LCCA 3IYLW 1D5XB 3HE7C 3AFLA 2D7TH 2EC8A 4I5BB 4OB5H 5FXCH 1FYTA 2XZCH 2XIDA 5EU5A 3BP4A 1A7NL 1CTNA 1DR9A 2R0KH 3NFSL 3MRIA 5ESAB 1JPGA 4OBRA 5C09D 4OZFH 3HC3H 2VITB 4NC1C 3V7AG 5ACZB 1RJLB 5IMMA 1FBIH 1TTFA 4LCCB 3RL1A 2HJKB 3B5HA 1MAJA 3BZ4B 1W8OA 3UJJL 3QDMA 4JZJB 1AI1H 5HDOA 5DD1H 1JPFB 2FJHB 4S0TD 3AC0A 2E8YA 2BSSB 1JGVL 3EYOA 4UTBH 3SJVB 3ZZ1A 3LEXB 3B9EA 2H8PB 4QT5B 1OLLA 1JPGB 4WI2A 5ETUA 2KDGA 3KYMA 1KIRB 4IMKA 3QDJD 4I2XE 3ULVD 3S34L 4PLJD 2V2XA 3HNVL 1T83A 4P3CH 4WI4A 5JOFA 2X4NA 3UXFA 1BVLA 2YPLE 2NY1D 4Z7OF 4Y89A 4MCYB 3H0TB 4AH2B 2OJZH 2AI0L 1GAFL 2CJUL 1F4YL 4G9DA 3ILPB 3WFBL 3ULVE 1MCLA 1QYGH 2OR9L 2G5BB 1KJVA 3BPLB 2ZKHL 3ARDC 4HJ0C 4NZUH 1N6UA 3E2HB 4CU8A 2E9JA 1R3HB 4HF5L 4OJFH 4JPKL 2V2XB 4HK3N 1GRWA 2X4NB 2XRAL 5FM5M 1Q0XL 1P84K 3DHJA 4EI6B 1AI1L 1T0NA 3GMRA 4M6ML 4MCYA 4HPOL 1WFNA 3FT3A 5JPNA 2E9BA 3B4NA 3ULUF 1OAKH 4QHNA 1KIQA 3HUJA 3BOVA 1JUFA 2NPLX 3GEWB 4PLJC 1RUML 4OCSL 5DQDL 1BM3H 1MCPL 1XGTA 4L4TE 5HJ3A 4ZTOH 2ZSWA 4WGVB 4LVNB 5JQ6L 1HKLH 4HG4J 2QADB 4J7RA 4ZUTA 5HVHC 4E41D 4KDTC 3PGFH 2A83A 5JPNB 3L5WB 3ZE0F 4F7PB 5CCKL 5DI8A 5C0ND 4Z77A 3VG0L 1XGTB 4KJWC 3GSQB 5HJ3B 5C3TA 4P5KA 4L3ED 3PV6B 3NTCL 2QQKL 1U6AL 1HHHA 3MFFB 4FOMA 5GRJL 5FO7B 2IAND 3FT2A 4JKLA 4EIZC 2OX5A 4ZUTB 5GRVL 4HIXL 3MUZ1 5T5FH 3WN5B 4XTRC 3V52H 2A83B 5I74B 5B39A 1NGQL 3T0EB 1F4XL 5DS8B 3UDWA 3HZKB 4M5ZL 1P7QD 2I9TB 3MLRH 2P24A 1G1CA 3NFPA 3Q6GL 4A6YH 1Y18A 3IDGA 4KJQD 4PGBA 1YY8B 4JY4B 2W91A 3FT2B 4MJ6A 4X9FA 4PJEE 2YD3A 4G6KH 5ICZB 1ZLSL 4OCXH 5KSBF 4QYOA 4P3WA 3NIDE 1A6TA 4HXAH 3T0EA 1RURL 2OTWB 5I15L 3BH8B 5K9JL 1X6LA 1HNGA 1U8QA 3BD5A 4R4ND 3IDGB 5LWYL 1F2XK 1T22B 3I85A 4Z7VB 3IGAA 3GI9L 1UM4H 3MJ9L 4M62L 1OCWH 1J05B 2MJWA 1QO3A 2J7LA 1FO0B 5KTEH 5JO5B 5C0CB 4FQ1L 2VLJE 1I8LA 4Y4KC 5E8DL 2WMPA 2V2TB 4N5EC 4PS4L 4K8RL 3LQAH 4DJMA 1T22A 2HN7B 3VFGH 2AW2A 1NGPL 3DYPA 1GGBL 3MOAL 1FVEA 2ESVE 2NZ9D 3BYTA 4MNQE 4HDIA 2DJUA 2OXHA 5E5MA 4OLEA 1EAPB 3I75B 4Z7UA 3QUZA 2CR3A 3GM8A 1HHGB 4RFNC 4XNZB 5EU4B 3VFNA 1J1XL 5EORL 4JFQA 1CS6A 3ARXA 4ZXBB 4D3CH 2V2TA 2ADJB 3S9DB 4XPGH 5FM5O 4Z5RB 1DBKH 1IGCL 4P4KB 5HDBE 1E28A 3TEUA 1NLDH 2XZAL 2X4UA 3MA9L 3I75A 2PW1B 2YZ1A 2IPTL 3PABB 4I0PA 4JFDD 4RAHA 3DNKA 1HHGA 5EU4A 5CHNB 3N06B 2CR6A 3LH2H 4LKCA 4HGWB 3ARSA 4M6MH 3IJYB 2OP4L 2OTPA 1X5ZA 2J5LB 1NFKA 5DO2D 2XWTB 4GQPH 4KKCD 1G84A 5LGHL 3FZUD 2GITA 2FX9H 3AY4A 1GJIA 3S36L 2D9CA 5C0FA 1T7WA 1BOGA 5T5NG 4YZFF 5IVXB 2CUMA 4J6RL 4O5LH 3MMEB 2X44D 4Y2OA 1JMXA 4L29B 4LKCB 4TN9A 3D18B 1IJ9A 2B5IB 3W0WD 1CFSB 1R24A 5TFSL 5GS0D 3QO0B 5KSAD 2EEAA 4XPTL 5I17B 4JFZH 2JB5L 2B1AH 5JORA 5BVPL 3U4AA 3LKPA 2F58L 4OCWL 3QEGL 4PB0H 1B88A 1ERNA 3VH8G 2E7HA 3ZDYE 4TPRH 3D3VB 3CMGA 4NP4H 3IJSA 3TZVD 4JJ5B 4D0CB 4ZDHA 3FN9A 4YDIL 3S37X 3K0WA 4M7LH 3WL9B 2GYSA 5JORB 2H32H 1DQML 4CU6A 5E08H 1OAKL 1MY5A 1UB5B 3TCLA 4YIQA 2ORBH 5E9DA 3ELAT 3TO4A 1QQDA 5IK3A 1H0DA 5GS1A 5FK9A 2R23B 1PEWA 1Z9MA 4KXZI 3VXUD 4ZDHB 4YDLB 3DOSA 5HPMB 2IPKB 3KYOB 1BQLL 4PY7B 5TGBB 3VXMA 2A9NH 2FD6H 1N0LA 2L0DA 4LCUA 1XGYH 4C56E 4UNUA 1GCFA 1RPQA 2DTMH 5F9WB 3TCLB 4YIQB 4RGNB 1ZEAL 1AO7E 4U7MA 4QRSB 2ICES 3KXFD 4HKJA 5BRZD 1MNUL 5IVXE 4OFYA 3Q48A 4BQ9A 1OP5H 2VKWA 1CU4H 3MLPA 3N50A 5EIIA 4F3FA 2YPKA 4UAOC 1HH9B 1YNTA 4LAQL 2OTUB 4NT6A 3VFTA 4PJAF 3MNZB 5BW7A 3SJVE 4MJ2A 5DHXB 1TETL 3FKUS 1IGFL 1SJVA 4WO4A 3SDYH 3ULSA 3X11B 1MLBA 5L2KE 3SDXB 3PXJA 2P8PB 4KRNA 1YEGL 1XF3A 1CGTA 4G6JL 3ROOB 4XB8A 4I77L 5EIIB 4F3FB 3D2UD 5GGTA 4KV5E 4JGUA 4LRNH 2YK1H 1XIWB 5FA4B 4NPYB 5JIHA 3U46A 4ZUSA 1PKQA 3VWJD 1U8JB 5KSBB 3O3EA 1F97A 3I2CH 5ITBH 4MMXC 2FB4H 1CL7H 4JRYE 4LKXB 1RK1A 1PAMA 4YBHA 3ULSB 3X11A 4PGEA 2EDBA 1OOAA 4UT9H 2P8PA 1NEZA 4PJ7E 3U36A 4LU5L 4CVXB 4EI5D 5DRNA 1XIWA 3ZKMD 4FXKB 3PGDB 1A6PA 3T0VA 1BFSA 4Z9KB 3O3EB 5HHVH 2MPAH 3DMMA 4TULH 3VRIA 3OKYA 4P5TB 4MVBD 3P4OB 1NEZB 1HEZA 2D7QA 2J2ZA 5B39G 1FL5B 4WY7H 1JYWA 4FXKA 3HNTL 4X4YB 3MC0A 1FC2D 4LDLB 5HHNA 1A7OH 1KIUA 5I1IH 4JLRA 1CFTA 4ZUVA 4NZTH 3RGHA 3VXPA 4I3GA 2RIKA 3VFGL 2J12B 1C12A 4PLOB 3LKRA 4JY6B 3V0WH 3P4OA 2HLFC 3QJFA 1CGWA 1QBML 2PR4H 2UWEF 1W72B 3I6GB 1NAML 4DUXA 1I3VA 3S3PA 2MCPH 5HGDA 1KPRA 3G08A 3RUGF 2ZOKB 1YEHL 3ZDXE 1IGJB 4MAYD 4M62H 3S4SB 1TVHA 2UVEA 2Y36H 1LK3L 2Q8BH 3O3BA 2HYMA 3FQRA 2ZSVA 4K3JH 3SGDH 2ARJB 2BNRA 4PJ8D 1IC7H 1OM3H 5HGDB 1K8DB 1QLFA 2BJMH 2KQMA 4LVHB 3LIZH 4DGVL 4DN4H 5BV7H 4D0BB 5TE7H 3ALXA 4QHMB 5L2KA 4KZDL 4N0YL 3W82A 3FQRB 4LP5A 4JQVA 3UPRB 5MEND 1JFQH 4KY1H 1WWAX 3PQYE 3VXRE 3DVGB 2VLLA 3DGCR 2NY5L 4ZOCA 3WXVL 2NXYD 3DXAA 4OLUH 4X7SH 2NLJB 4H25A 3SE4A 5IJVB 4D0BA 1I8IB 2R4SL 2EDQA 4QHMA 3CK0L 4EBQH 1H8SA 2WIIB 1HHJA 1QBBA 4MA1B 4NO0B 3KJ6H 1IC4H 1DE4B 2WAHA 3RAJL 1LEIB 1XAUA 4Y4HA 1BFTA 2AKRA 1KTLB 3CFIC 5I1KH 3SQOH 1T2XA 2C3WA 3GSXB 2Z9TA 1GIGL 2N4IA 2X05A 1A0QL 3VMNA 4H88L 3FFCA 5ICXB 5A2JH 3G5YA 5FDWA 4KKAD 5JQHC 1KPVA 1DBML 3KXFA 4ZS7L 1TVBA 4DN4L 4Z95L 4NO0A 5I8KL 1MF2L 1DBJH 4UNVA 2XY2A 1DE4A 5DHVH 2P42B 3TGXA 2E7LA 1WK0A 4RDQF 1M7IA 2ZPKL 4G3YH 1OTSD 5C8JA 1DLFH 3VXUA 3CVHH 3L3GB 3G5YB 2IFFL 5FDWB 3ZHDA 1KPVB 3KYAA 3SKMB 3ZTNH 3MJ7B 1RY7B 1OAZH 2BVPA 2VAJA 5AWNL 5H94A 4NJAH 2AEWA 5E5RB 1ZLVH 1EK3A 1AXSA 3GNMH 3QUMH 1BBDL 1XF5A 3IDXH 2QQKH 4ZNEA 2V9RA 5KOVC 5DRWA 4MYWB 4NKIH 3ULVL 3ZKND 3DPBA 5ESQB 4TVPE 1FVCB 2Q20A 5DZOA 2NR6C 3DGGB 3O3AA 4BZYA 2B20A 5I8KH 5H94B 2IBGA 2B1HH 4L8BB 1NPUA 1XF5B 5C0NC 1QLEL 4P57A 2C4XA 2VN7A 1WSST 1WQVT 5MEQB 1YPZB 3QIBB 5IKCA 5LQBH 1ZVHA 3M1BB 3WIHH 3LIZL 5L9DL 3T3ME 4RDQG 2AEQH 1P4BL 4RBPH 3HMXL 5KS9E 3O3AB 2AJUL 5BS0B 3WFHB 4L8BA 4RFOH 4GJTB 1IRAY 2WQ8A 4P23B 4JFED 3P9MB 5MEQA 5D7IB 5IKCB 2VXVH 2DD8L 1UCBL 3LD8B 5CP3H 2CMRL 3RVVD 1JF1B 1L7IH 2YKLH 4CNIA 5FOBA 4DOHE 3DRQA 1JNLL 4PG9B 2AJYL 1U8MA 2X4QB 2DWEB 3DWTA 3OKOB 1I9IH 2YEZB 4UINL 4ZYKA 2DQFB 2ZUWA 4EDWH 3S37L 4LRNL 1MAMH 4NGHH 1J8HA 5JW4Q 1BOYA 3S34H 2GTZA 4EN3A 3DUUA 3D0VA 3KDMB 4MJID 1BJ1J 1BBJB 1MRFH 5E4IA 5I30L 1G7JA 4KRPC 4KRPB 1HYRC 2EE6A 4Y2DC 1LEKA 1WC7B 3SCMD 3U7WH 5CP3A 1FZKA 4LLYA 4TOYH 1G7MA 1G6RH 4M7ZB 3Q2CA 1MFBL 3QXDA 5FKAA 2KZWA 5FUOH 1MIML 3IT8D 2MQ0A 1INQB 3F7YB 3B83A 5EBGA 2H3NB 2HP4A 5HHPB 3T77A 5EOQH 3TWCL 4ODSL 2AJYH 1IAIH 3KYKH 3UYRH 4OZGB 1U92A 1MJ8H 2YKLL 3MUGB 4PJGF 4W4OC 2VYRE 3STBA 3L5HA 5ADOH 1EHLH 4GLRI 2WBKA 3REWA 5EWIH 3VFMA 2D3VA 5FKAB 3KPMB 4TTDC 1INQA 3F7YA 4X4XA 1PX3A 5C0AD 1QSZA 3FO0H 3HFML 1ZWIB 4K7PH 1RI8A 3R06A 4OZGA 5FM8A 2NY2B 1GGIL 1ZGLM 1JGLH 2OI9C 4G5ZH 2MNUA 1R3LB 2IANB 1T21B 3P30H 3NPSB 4LHQB 5J3HD 3LKNA 2M8XA 1AGFB 4GRLC 4JDTH 4P2RE 3REWB 3FO9B 5AG8A 4ELMA 1MJ7H 3O6LL 3RVUD 3ECBB 2CDFB 3WIFB 5FO8A 2VDQL 3R06B 5BXFB 5KZCD 5IWLA 2X4OB 3L7EA 3RKPA 1OGAD 4JREB 1AGFA 1QKZH 1G7IA 5DGQA 4OZIE 1ZHBA 4I0PC 1ZEAH 3QG6A 5GSVB 5I1JL 5BV7B 1RZGA 1Q0YL 1S9XA 2X41A 5FGBA 4XNUH 1OAXH 1LNUA 3P0GB 3N9GH 1RVFH 4HFUL 1LVEA 3SJVD 5ID1B 3HC0B 5A2KH 1KNOB 4NFDA 4X5LA 5IJKC 4NN5C 3NCFB 1N64H 4Z7WA 2VLJA 4WFHE 4OZHB 3QUZC 1MJJB 3HZVA 4J12A 1ZS8A 3QG6B 1RZ7H 5GSVA 1D5MB 1RIHH 4GG6E 4DUWA 2AJSL 4NQCE 1JK8A 3UMTA 3ET9F 4HWBH 5IP4A 1GZPA 1JTPA 3D85A 1AC6A 1OT2A 2HTLC 1UACL 3LN9A 1QTYT 2XTJD 3BHBA 4Z7WB 3SQOL 2JJWA 1JF6A 5DZLA 1RK0B 2PYED 4RGMB 4XZUA 1UXSB 5D72H 1I85C 2VDRH 2GSIA 4HK3J 1R3KB 1U8IA 4QHLB 5DR5H 2CH8A 3IFPA 4JKMA 4XCNB 1HSAB 5GGQH 3TLRA 4RAVA 3QEHA 2PW2A 3QDJA 4PJAB 5F1NB 5C08D 4LHUG 3MLXL 5GRWA 4ODWB 4ZFFB 5F9JB 3QDGB 1SBSL 4ODXB 2DL2A 1UXSA 2QQQA 3B2UD 2CKBB 1T0MA 3BRGC 5FGCE 3CDGA 5IG7A 3HI6L 3T65A 2YOCA 4LCWB 2NTFA 1QRND 1UXWB 1F45A 3CFDA 3IXTB 1K6QH 1ZLWK 3WUWB 3HE6D 3O0RH 2CK0H 1E4XI 1RJCA 5F1NA 4U1KA 5EZIL 2P5ED 4J3WA 1WZKA 1YECL 1SVCP 4W4NA 3DTXB 2NXZD 1QFWM 2FJFB 2A2QT 1OLZA 3RHWF 1T0MB 4N0UA 4BZ1H 4L8CB 3VFWB 5KSVA 3LMJL 1YNKH 1LO0L 4KK8C 3O9WC 4LGPB 4FP8H 4QO1A 4M9PA 2P8LA 2X1XR 1DL7H 3VXNB 5DTFB 4O5LL 2WZPD 2MCPL 2HLAB 1UA6L 3FQNA 1J1XH 4Z0XB 5IEHB 1ZVYA 2EIBA 4UBDD 5J12B 3ZKMC 2ATPB 1F4WL 3MJ6A 4XC3H 1AR1C 1NMCB 5IMKB 2P8LB 3IETB 4G6FD 3VXNA 4Y0GA 4XWOC 1D5ZA 2IAMA 5TDOA 2X4SB 5EO9A 2G2RB 3C6LA 1E4XH 4HBCL 1I75A 2NW2A 3CAFA 3VJ6A 5EZLA 4ZAKD 2D03H 5F97E 5EA0H 3VXME 1QEWA 5ALBH 2DMKA 3MODH 3IETA 4PG2C 3BJ91 1J1OH 1E6JL 2CK2A 5CIPH 2X4RA 4M7KH 4N9GA 1AO7A 2G2RA 4L3EB 43CAA 4BSWB 3DSFL 1DBBL 5CS7A 1MCPH 3W9DB 5IBUG 4DQOH 4P23C 5D7IF 1T3FA 3GUTA 4GBXA 1MCOL 5CBAB 5KW9H 1VKXB 3GFUA 1KENH 3QUYB 1EO8L 2AQ1A 1OP3K 2X4RB 3OF6A 4BKLA 4WTZG 4NQVB 1D3CA 1YEEL 2QADD 3FT4B 3GSOB 4BSWA 1VACA 3LPGA 1QPPA 43C9B 2HMIC 2XT1B 4WHYH 3F7VB 2CRMA 4UI2A 1KPUA 5GJSH 4ZAKA 4NM8H 4L8DB 3BJLA 3DHMA 4YC2C 5F89A 4RWHA 4YHIB 5GRUH 4NQVA 4TTDD 1VDGA 4R0LC 1PKQE 3ULUC 1T89C 4JQIL 3C5JB 1WTLA 4KH2A 3IU3A 4Y4FC 3TYFA 1MCIA 4DW2L 2J4WL 2FBJL 4X6DB 4HKBB 1EHAA 2QSCL 2V5RA 2WANA 3INUH 2BC4B 4L8DA 3S6CA 2VTFA 3LOWA 1NSNH 2VXQH 4WI6A 5EZJB 5C9JA 2A6KA 3QUYD 2NY1B 1NGWB 4P2OD 4ETQA 5D7JD 4FQCH 1Q9WB 5FYLD 2MQ3A 3SDXE 4PRAB 1U3HA 4HXBL 4PRBB 3VCLB 3DX8A 1AQKH 2FZ3A 1FNFA 1EO7A 5CGMA 2R1XA 1HDMA 3RVVC 4QLRA 3DV4A 2BVQA 4WUKH 1S7VB 3QR2A 3WNNA 3U4EB 3CZFB 5BQ7B 4MD4B 2FEDC 5FKPB 5IVOA 2APTA 3QYCA 4ETQB 3H42H 4X98A 1S8DA 1WEJL 2QEJA 3ARGD 3K7UA 3DX8B 2AERT 4Y2DB 4CL7A 1KJMB 4KRPD 4TSCH 2NXZB 5SWQB 3GMQB 3VXSE 1YDPA 2A38A 1OTSC 4MDJB 2HH0L 4AL8H 2BDNL 4K8RC 3C5ZD 4TPRL 4M8VA 2K3TA 4B7LA 1MH5B 4XP1L 1RSFA 3H9HA 3BX7C 4Q9CA 4U05A 5MEOB 2CKNA 2XXMB 4N0CD 5E2TH 2W60B 3DJ9A 4G8IB 2X89A 5BVJB 2ZG3A 4N8CL 3CSGA 5DJCB 3VDCA 4J2XA 3U7WL 2WUBL 1MCJA 4OAWB 1KJMA 1RFDH 5CMAB 1YEFL 4HUVA 4LEXL 1FNEA 4ZO6A 1AGCB 2BNRE 5DJ0B 4KHTH 2VABB 3HLAB 2OR9H 3QI9B 4FHBD 3BP4B 5MEOA 5E8OB 2AI0H 2CJUH 5F6IB 4Z7OE 1TZHB 4UINH 3OJDB 3VFOA 3MRIB 2HFEB 5HVHB 4UTAL 5DLML 4JFYB 4HH9A 1FO0L 4RGMC 4UQ2B 2CMRH 3BIKA 1ZHNB 1FNEB 2RCSL 3RL1B 1TJGH 1YPZF 1AGCA 4CMHB 2R2EB 4HV8B 4LCWD 1B0WA 3O6FD 3CU7A 2XTJB 5DD6B 5KSUA 3HPJA 3MLSH 2HTKC 5JXEA 3SJVA 2C1PB 1BD2D 4JANA 4NO5B 3RZCD 5ETUB 3WXVH 4JFYA 3C09B 3VD7A 1LK2A 1TJHH 3KYMB 1JVKA 5FGBC 1UZ8B 3FB8B 1FFOA 2JJSC 1WIPA 1UWXK 5HI5C 2R2EA 3PQYD 1Y6NR 3VXRD 4QCIB 3X12A 2FL5B 2H32B 4G9FA 2VXQL 2E3VA 1QSFB 3H0TA 4AH2A 4JREC 3FMGH 4G9DB 2IPUG 4JANB 2W65A 1RULH 4IRZH 5ALBL 1KJVB 4JHAH 5IOPB 1HCVA 1YYML 4P9HL 1MY7A 1YEIL 3KJ6L 2VL5B 1QVOB 2EIDA 2OSLB 3X12B 3RDTB 2FL5A 1OWWA 1LO5A 1FV1B 2GAZB 4ODUA 1UC6A 1DTUA 4OZGE 3FT3B 4RA3A 4X7SL 5GGRA 3ZDXF 4XBEL 2OZ4H 2V17H 4JKWA 3V5DB 3LKQA 2A6JA 3C87A 4OD1L 1N7ML 3FO1A 3CVHL 4X0KB 1ADQA 2ICWB 4NKQB 4NQDD 4N0YH 2OSLA 3G6JA 3RDTA 5DMGD 1Z0MA 2R1YA 1OB1B 5I8CB 4NC2B 3R1GH 3FRUA 4YXKL 1NUGA 5DI8B 3O2VH 1NEUA 3C60B 1OT1A 1CN4A 5FYLH 3GSQA 1H3UA 4AM0B 3QFJA 5BS0E 1KCUL 1OWRM 5DD3H 5JHLH 2ILLA 4K9EC 4GAGL 4OT1H 1CBVL 3OBAA 1EEZA 4L4VE 5F7EH 3NA4A 2IH3A 4DVRL 1JWMB 1RAMA 1NCCL 4WFFD 3MBEB 1H3PL 5IVZA 4WU5A 1A1NA 2XY1A 4LSVH 4D3CL 1WFOA 4GW4B 4I9WE 3VMPA 3PV7A 2I9TA 2UY7A 3BESR 3BP7B 1HQRA 3CSPA 3P11L 5C6TH 3V0VA 2FX8H 5L6YL 4QKXB 1A5FL 1QLRA 4AEEA 3K80A 5DEFB 4JZNA 4QTIL 4CDHA 2GI7A 1DVFC 1BECA 3MOAH 3CGTA 1A02N 5ICZA 1S5HA 2NY2D 3AS1A 1TQBB 3MV8D 5AYUH 2OQJA 3IRPX 1BZ7B 3BIAX 3BH8A 1INEL 4GW4A 3U6RB 2CRYA 4TUOA 4XXDB 4KJPC 2A1WL 3UTSA 5GRYA 3TM6A 5FUZH 1FVDA 1QLRB 2BSRA 3FAWA 4GKNA 4P9ML 3ARBB 2OYPA 1A6UL 1S5HB 2VDOL 4TUJA 5DO2C 4YHML 1QO3B 4F2MB 2QKIB 1ZANL 1NMAL 3AMLA 1MHEB 3U6RA 1ZHLA 1KFAL 1KLGA 4TUOB 4N8VG 4XXDA 5HPOA 2Q8BL 1MOEA 3VG9B 2HN7A 2UZIH 1FVDB 2BSRB 2VXUH 3PHQA 1RUAH 1QSED 4TYUA 4Y4FA 5ABDE 5D70H 4Z7UB 1TXKA 5D2NC 4ZFOA 3VFNB 5B22A 1N64L 2O5ZL 4NHCL 5IHUH 1IQDA 4GRWE 4QRUA 5F70A 3MO1A 3TPUB 4PJ5E 1G0YR 4UV7H 1KLGB 2XN9B 2ADJA 4O2EA 1IEAB 2FWOA 1SJHA 4HT1L 4PRID 1S3KH 2Z91B 4IBLT 2LU7A 3PHQB 3QIUA 2X4UB 3ZKXB 2DWDA 2EXYC 2DQHH 5FYJE 5HYJE 2WUBH 3WLWC 1B4JL 3KLDA 4HWZB 3BPOC 5D2NE 3C6LD 2W92A 3W11C 4JO3L 4PRHA 3VWKA 1EXUB 1QFWL 4DVBA 4R7NA 2JIXA 4DKFH 3BT2H 4PRPA 3DO7A 3LQAC 4M7LL 4K2UH 4WFED 1AQDB 2J5LC 4Y16D 3SE9L 2EKJA 5GZND 3LZFL 2YMXL 4JCMA 5F1KC 3J7HA 1NGXA 2EH8H 3KYNB 4PRHB 4UT9L 5IB5B 2PYEB 4YE4H 2JCCA 4ZODA 5J6HA 1FL6B 2EKSB 3BH9B 1QRNB 1JYVA 5DMKB 5IESL 1QNZL 1XGRB 2F74A 1I7UA 5DHVA 1PBYA 2VDKH 4B41A 3W0WE 4KI5D 3CVHB 1NGXB 2VR9A 1GSMA 1YEGH 5E7BA 5D8JL 5IB5A 2XTJC 2JCCB 4IDJL 1TETH 2F15A 2EKSA 4D0CA 5JIPA 3NZ8A 1L0XA 2Q6WA 2P48B 1XGRA 3HNVH 2F74B 1I7UB 3HI1B 4U3HA 3UTPD 4BM7A 5E2WL 4L1DA 4ONFH 5E94A 5HI4C 3TT1L 5E9DB 3V0AC 5EU6A 1XZ0A 1YNLL 3UO1H 2R23A 1L0YA 3NCYS 3NZ8B 1RIVH 1KJ3L 2Z8WC 5IR1B 4LVEA 5I0ZA 3IFOB 3RBSA 1BJ8A 4LCUB 3S5LA 1JGLL 1SYVB 5C7XH 1CQYA 3KR3L 3N1FC 3W2DL 5I75C 1N5YH 2LU3A 4Q0XL 4HKJB 4TNWF 3PWLB 1GVIA 2DAVA 3GSWB 3TIEB 3WNLA 4LHJB 4LRIA 2DIJA 5DQJB 5LGHH 3UBXA 1T7VA 3QZWG 2YPKB 3ALPA 2VRAA 4HQQL 1VFAB 3KPSE 1IM3B 2YD8A 4ERSL 2EH8L 1A14H 2O93L 3SPVB 1KSRA 3MRKA 3MOBL 2R39A 4FQXC 4TQEH 1T03H 3THML 2VQ1A 1BGXL 2NY4D 2VLJD 3BP6B 1R3JB 1PLGH 3W0WB 4HIHB 1AGEB 4L3CA 1MLBB 1M05A 5DQJA 3SDXA 5JW4M 1A8JH 2VSCA 1Q94A 1MCQA 2WBJB 1UKSA 5T3XH 4D0DB 2X5PA 5F7LB 3BEVB 4BSVB 3H3BC 4M5YH 4TRPL 3TC9A 5CLWA 1F42A 5F3HA 1EZVX 1U8JA 3CLFH 2Q8AH 3O41B 2JIXD 3CX2A 3QO1A 4NM4L 3BP6A 2C3XA 5HHMB 3UROR 1M05B 2DQDH 5FUCC 1FQ9C 1CXIA 1EFQA 5JHDB 4S1RH 1CT8A 2BVYA 2YXMA 1MFNA 1PSKH 4OF0A 3DX9B 4LPWA 3QDGE 2OBGA 4JFDB 1GGCH 2CIKB 1I9IL 4NJ9H 4RWYL 5KVGH 1T1ZB 3QO1B 3DMMB 1WVZA 3CH1B 1RZIB 3CCHA 4U1IB 2YUWA 1T5XB 3B5TA 2WWMC 3KPQB 4OTXH 4ZXBD 2X70B 1K9TA 3BQUA 3GGWA 3V6FB 4NQXB 1B2WH 1H9VA 1KFAH 2CIKA 5HHOD 2GUOB 3CJJA 2VWEE 3MA9H 4AMKL 4WTZA 5GJTH 3VXPB 5D7SH 1YJDC 3MYZA 5LGKA 1NCNA 5EZIH 5L88H 1N6QL 4U1IA 4IS6B 5I66A 4WEMB 5IF0A 3QJFB 3AY4C 3QI9C 1URLA 1QSFE 4LSRL 1NUDA 4PRNB 2HT2C 1CD0A 1KN2H 3MA7B 5F96H 4ERSH 3D2UB 5CIPB 5T5FL 3S4SA 4V2BA 1IC4L 3U1SL 2A74A 4JM2F 3AM8A 1MQKL 4IS6A 3SGKC 4Z7NF 4XXCC 3LQAL 1HZHH 2L4OA 4PJCB 4CN6A 2R2BB 5LBSL 5T3ZL 5GS0H 4PUBH 4YHYC 2AABL 4WDIB 4BYHA 4KGJA 4GRMA 4MHHG 4LCWE 1IGMH 2HKHH 4KJQC 3QAZB 4GW5A 3MGOA 4MJIA 3RJQB 2A74B 3RTQC 1FG2B 4HZLB 1IC1A 1CYGA 4WHTA 5DJ8B 4E42B 5HHQA 4POZC 4NDMA 2IQAB 5GS1C 1NMCC 5D5MA 4H1LG 3UPRA 1NLBL 5E2UL 1F00I 5D71L 5LJYH 1C7SA 2A6IB 1OL0A 3RHWK 3O4LE 1ZT7B 4RGND 3I02B 3NN8B 5DRXA 5T1KD 4QHKJ 4G8GD 4MXWH 1XMWA 3F12B 5INDB 1K6QL 5JDSA 1WWWX 1L0QA 1MPAH 3MOQA 3TZVC 5M95B 25C8H 3CX5K 5TDPB 4LSPH 5DJZB 1O5DT 5KVDL 5I0DA 1GXEA 2JLLA 2A6IA 4Z7VF 3ZDZE 3BMVA 4M1CC 5DK3A 1KTLA 5SX4H 4NZDA 5FF6B 3TJEH 5C09E 3KPNA 3VI3E 5CJQH 4U1SA 3FFCB 5ICXA 2NY4B 3B9KB 2MTPA 5F3BB 3CH8A 1TVBB 3VDAA 4YUEL 4LL9A 1TNNA 1WLHA 35C8L 5HTSA 1CLOH 4AEHL 3VMOA 3T2QA 1EUUA 2YWYA 3VXUB 1C08A 3MJ8B 5T1LD 4ORGB 4J4PC 3B9KA 2H2SC 1I4FB 2GTWA 5J13B 2J8UE 4F57L 2C3GA 1HXYA 3AM8C 1DFBH 1V7MH 1GHFL 4G8GA 4M3KB 5DUPH 5IQ7H 5JA9A 3GJFA 3SKOA 1FC1A 2W0KA 2D0HA 4NHUB 5CILL 1AXIB 1C08B 2B4CL 3BAEH 2YD4A 4M4PA 3WS3A 1I4FA 2GTWB 5CJBA 3DGGA 2YD7A 1HXYB 2I60L 3PHOB 1ACYL 1X5JA 4U6YA 1HINL 3WJLC 3GJFB 5FYKE 1KJ2L 4FNLL 4GRWB 3WIIL 2AXGB 2AEPH 3QUZD 1FDLL 1YPZA 3QEQE 3IFNL 3QIBA 5H37G 3MTRA 5HI5D 3L3IA 3L5XH 3RPIA 3N1MC 9CGTA 4YX2H 5C09B 2JE8A 3PJSB 4Y5YA 3RWHB 3PHOA 3PIQA 1XR8A 4YK4B 3NACH 4O58H 1ZGLA 4CJ0A 4P23A 4HWEH 3OJMB 5KAQF 2NY7L 3QUMB 1ZGLP 5AG9A 3KPLA 1XF1A 4GKOA 3T2OA 4K71B 1T7ZA 1YQ2A 1JWUB 2Y25A 4PG9A 2X4QA 3MLTB 3OKOA 4AT6B 4M7KL 2RGSA 4OZIF 3DLQR 1OP5K 4FNLH 4LFHG 2X7LB 2RFXA 5ISZA 3T2PA 2F54A 2CXGA 5AZ2L 1SQ2N 4G7VL 4O51B 1BBJA 4G8EB 3ZYZA 2NQCA 2W07A 4H0HB 4HUWA 3QJHA 2F8VA 3MRQA 1QG3A 4NQCB 3S3JA 3MRGA 2DIBA 1K5NB 1FZKB 4AT6A 12E8H 1P7QA 2DKMA 1MCNA 5C70A 1CE6B 4FFVD 5DDHB 3G6AA 3LPWA 2B0SH 5ADPH 2RFXB 5ISZB 2Y06H 1ADQH 3UJTH 1FORL 1QBLL 1CI5A 1W0WB 4G8EA 2GJZA 4XP5L 3GO1H 5CP7B 3P4MB 5FA3A 1XCTB 1IAOA 1X3DA 3LKSA 1X5GA 4YAQA 1K5NA 1WV7T 3UC0L 4ZO8A 1P7QB 1NAKH 1YNLH 4L4VB 1AXTL 1NH6A 3CDCA 4PJ8C 5A2LH 3M8OH 3FB6B 4YPJA 35C8H 4OD2B 2F8OA 2EICA 5MHSE 5CP7A 3S37H 3P4MA 3TJHC 4FFVC 5HYSG 3X3GH 2QHLA 4L4VA 4L8SB 4XGZB 1T66D 3BIBX 3QXUA 3RVWC 1V8HA 1IEBB 4Z8FH 3P73B 5D1XB 4HT1H 3QXAB 3HI6H 5E24E 3DVNB 3FB6A 1OGTA 2Z31C 1QZ1A 2D0GA 3O8XD 3RWGB 5KSBE 2D7NA 3OMZA 3VGDA 5HYFA 1I8MB 3FQWB 5IESH 4Q9QL 1JPSH 2CDFA 2AV1A 1JL8A 3B6SB 2BRRH 3QIUD 1XIWD 4HULB 1ZA6A 5H35B 1EEQA 1CFVH 4QWWC 4UOJA 3O6ML 5TF1H 4NBZB 2F5AL 4CN4A 2JJTC 1G7IB 2YMXH 4A6YB 4PYGA 4P4RA 4F9LC 4EVNA 4S1DC 1ZTXL 3WE6B 1F58L 4PGDB 1RZGB 3M17A 1HILB 2RB8A 4U6HA 1X5FA 4MHHI 1IGCH 4O9HH 2PN5A 4DKAA 1X4YA 1E4JA 4UT6H 2A77L 4W70A 3SDXF 1NCBL 1ND0B 2DF3A 2JB6A 3TBTB 3EYVA 4D9LL 4RIRA 1FZJB 1KLFA 5HYEA 3MLYH 3M17B 1DEDA 1HILA 2J6EH 1FO0H 3VFPB 4X5WB 1VSCA 2GK0B 1S7QB 1GZPB 4OGXH 4KUZL 3H9YA 4Y5VB 5JUEL 1EHNA 1S7UA 3DMMC 4BQBA 3BHBB 1OF2A 1ND0A 3OB8A 4MQ7A 3IDNA 3ARDD 3K8LA 2WWKO 3BPLC 5IQ9B 2CRIA 1CGVA 4N9OB 3MQIA 4ELME 3GRWA 1U41A 3K74B 3GMNB 5GJTL 1FNSL 2R2CA 4EUPA 4FQLH 4U1JA 1J0KA 3TH3T 1AGBA 5EULV 3TZVB 3HG1A 1AHWA 2J88L 2PW2B 3QDJB 1NCDL 4MQ7B 4PJAA 4QOKD 3ZT6A 5KAQG 6CGTA 2E7MA 2IBZX 3UBXG 1N8ZA 1W0VB 1UACH 2R15A 1MJ7L 5JIKA 2ICEB 4PJHE 4HK0A 4ZFZB 3CK0H 5DA0B 3WXWH 2CIIB 5KVGL 4X6EA 3EZJB 4U1JB 2NTFB 4MXVE 3CFDB 3IXTA 2NY4C 1AGBB 4NQEE 4NZJA 5DMJB 3VXSB 2A6DA 4YHOL 2FIRT 1OAUL 3KPOB 5J6GB 4OLYH 1SHMA 1C16A 4NO2A 1SEBB 3O11B 4JHBA 4XCEA 1DANU 5GGQL 5B38A 3DARA 2L7UA 4N0UB 4CGTA 1KLUB 4L8CA 3HNTH 1UH3A 3LKOB 4GG6A 2QTEA 4GRWH 3RJDA 1LDPL 3EDDA 4TSAL 5C86A 3GZKA 1MVFA 3VXSA 4OIIL 1CGUA 4N0CC 5EBWA 1JN6A 2PO6C 3KPOA 2W59A 2HLAA 3C8DA 2FEEL 4YR6B 2H26A 1C16B 1P5UA 3BW9B 1KEGH 4NO2B 4GAGH 1T1XB 4HX1B 3L5JA 3PDOA 1I8LC 1ZHKA 4G7YL 4QXGL 4Y4KA 4UBDC 2ATPA 2YPLB 2VH5H 2Z92A 2IF7A 4Z0BH 1ZT1B 4H26B 3RTQB 1ZVSB 4P4KD 1J8KA 5ENWB 3RZCB 2VLRB 4RRPA 3QWRD 3GBNL 5EO9B 4AIOA 3C6LB 2BP3A 1I1FB 2H26B 3BW9A 5B4MD 4JN1L 2EH7L 4OM0L 5I73B 4X8JB 1QEWB 2YPLA 5DJDB 3T0DA 2Y06L 5ALCL 4Z7WF 3QUKA 2HT2D 3RZCA 3ARBD 4P4KC 4EDXA 4N9GB 1U8OA 3BE1H 2FJGB 3QEQD 3QA3B 4FA8A 5FB8A 4APQD 1VHPA 3NBNA 4D94A 3L3DB 5DJ6A 5HYSA 2GSGA 3GUTB 5EG6C 5DJDA 2O26U 3UYRL 1CICA 4Z0BL 5K9OA 4YWGH 1I3UA 1I1RA 4JFEE 3K2MC 1UWGH 1A6AB 1OGAA 4ONHA 1ONQB 3GSOA 4XP6L 2GY5A 4FQ2H 1WBXA 5DUPL 2FSEB 3L3DA 5HYSB 1FN4A 2G9HA 1KJ2A 5JPMA 4LLAA 1U2HA 4L9LA