5F3DA

Structure of quinolinate synthase in complex with reaction intermediate w
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
303
structure length
303
Chain Sequence
HHHHHMVDEILKLKKEKGYIILAHNYQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLFVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Quinolinate Synthase in Complex with a Substrate Analogue, the Condensation Intermediate, and Substrate-Derived Product.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords Quinolinate synthase A
total genus 112
structure length 303
sequence length 303
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5f3dA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5f3dA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5f3dA01
5KTNA 5KTRA 4ZK6A 5F35A 5KTMA 5LQMA 5KTPA 5F33A 5KTTA 5F3DA 5LQSA 4P3XA 1WZUA 5KTOA 5KTSA 4HHEA
chains in the Genus database with same CATH superfamily
2B4KA 1DC3A 1N6IA 4TL8A 3ROQA 2EG5A 5KMGA 4PONA 3FF1A 4NHOA 3PEUA 1K6XA 3OLZA 4Y0AA 5FBVB 1GEEA 3SMVA 4JOBA 3U80A 3D2BA 1UM9A 3BE5A 4QYXA 5K0CA 3LV8A 4Y6SA 2EGHA 1P5HA 1P73A 5CD1A 3E8XA 3QPUA 2OD2A 2QLMA 3PA6A 1M2OA 3EE6A 2IH4A 2GCGA 2QJWA 3WB9A 2DWQA 4JR2A 4XIJA 4ZFNA 3HG7A 3EZYA 3NHAA 1XMOB 2A8YA 2VHJA 4FINA 2I2DA 4N49A 2D2EA 1QOQB 1Z5UA 5T3YA 4J07A 4EG1A 2RHOA 4LJ8A 5FH9A 3BZUA 2YS7A 4POAA 1SZDA 2HSWA 1ZL0A 3FYHA 2JZOA 4IJMA 3KXIA 2WHYA 2QP9X 4W8HA 2BCGY 3RH0A 1RQ7A 3HV0A 4AP9A 4EVQA 4HXYA 5ALRA 1ORVA 4GI3A 2HHHB 1JU3A 3C3BA 1LS6A 2QYOA 4EATA 3HDJA 3L0IB 4JB2A 3GEEA 3DFUA 4MV0A 2ZSBA 3MUNA 4G63A 5DBGA 1T3SA 3B9BA 3H9BA 3TIGA 5EUMA 3OQOA 1SO8A 4EB3A 3NHZA 1D03A 4B9AA 1PJTA 3OO0A 1LY1A 2WJPA 5E8RA 3U4MA 2FWNA 2DR2A 3FLEA 4MUAA 1FB5A 2O0LA 3VISA 1YZLA 4L5IA 5CB4F 3I62A 4C0XA 1ZWLA 1Q6ZA 3BIXA 1FTYA 1EFDN 2X22A 4N5HX 4DT1B 2OO7A 3OCYA 3NJ4A 1NN0A 2F3SA 3F74A 2HWYA 3KDSE 1U8XX 1IHXA 3K6JA 1FY2A 4RY2A 1OR8A 4Z1OA 5KQSA 2QMZA 2Y77A 3EOBI 2FEMA 2QSJA 2Z2JA 1HFWA 1KJQA 3BGSA 3FA2A 4B80A 2OHXA 5A4AA 3OOHA 3ETJA 4HQNA 1RU3A 4W4TA 3E0QA 3I9OA 4F6RB 1SXPA 1R6TA 4BNGA 4DCGA 3U4AA 4DMFA 1Y5RA 2XMRA 4K86A 2ZETA 3Q7IA 1JKJA 1RTKA 1VE5A 2BL4A 5JW6A 3F90A 2IYNA 1E2MA 4WXYB 4MZXA 2YVKA 2OHGA 2ZS9A 3DMYA 3BE8A 3TTXA 3WIDA 5IJXA 1XXHB 4TZ6A 4AC9A 1VPLA 1T5OA 2GVDC 5KKAA 3GW8A 3O91A 4R68A 2VYCA 2BMDA 1KMIY 4YRQA 3GLHB 2QE7A 1C7FA 4Q15A 4I1RA 5KOJA 2B21A 2G09A 4YP1A 3CG4A 3QU2A 3KWLA 2Y6UA 1IK4A 2FPIA 3LHDA 4QGAA 4YJHA 3RUFA 4C3UA 3I61A 3EX7C 4L76A 3HFRA 5ICFA 1UBUS 1XWWA 2HRQA 1NYQA 4RX1A 2AN5A 2UZ1A 1Q7BA 3T12A 3QK7A 3FI9A 4WECA 5GM1A 1CUHA 2F4VB 1KMNA 1TTTA 1FQJA 4RMNA 1NJGA 2P9GA 2AXEA 3PG5A 4RANA 1OFTA 2BPOA 1Z62A 4PRLA 3HB9A 5TS2A 3WJ7A 5BSMA 2DC1A 5HRAA 3G5MA 1NYLA 2MSEB 1L5ZA 2QZPA 4A91A 3U7GA 3NTUA 4KRXA 4WLNA 4MINA 3T41A 1OXMA 1WU7A 3T7DA 3FPFA 1LH0A 3RS2A 3MS7A 3H8WA 3RYIB 5JXHA 3WGIA 4ZT6A 1E61A 4M0KA 2GXAA 2GN8A 1VGVA 2V5AA 1XNHA 3ZE6A 1RJGA 3OOSA 1PX2A 2NLOA 1BOFA 1EM8B 3AVPA 1GCGA 1YO6A 2UYCA 1QQ7A 1J8FA 5CNIA 5I7SA 3I0MA 3KLOA 2CL5A 2GWRA 4URYR 5BPFA 4HRVA 4RTJA 4PZLA 3WSWA 2CDNA 4CR7A 1GQRA 4CR6A 4PAOA 4B45A 3CONA 5AM3A 5JAHA 1W73A 3CNNA 5FPTA 4JCOA 2ZI5A 3EZ7A 1T2EA 2AFHA 3L8MA 3E8SA 4TWZA 4RKQA 1MJGM 3KB6A 1NVWQ 3ZNPA 2Q1XA 4J4TA 1QO0A 1Z8DA 3KUDA 3F7TA 3N0VA 2NU6B 4FFMA 4FMDB 4R8MA 4HOYA 1P7VA 1L7XA 1DOZA 1QKKA 3HKDA 5ESRA 4EEZA 4N1AA 2WIJA 3Q11A 1K6MA 2BV3A 3SJUA 2VSXA 2OEPA 3KK0A 4M86A 1DTEA 1FSGA 1GYRA 1KHTA 1OLSB 3PICA 3RREA 3VR4H 2ZT8A 4BVBA 1T8SA 4HD8A 1Q0UA 4X84A 4ZREA 4RZQA 5G0WA 2FY8A 2P4EA 4BB9A 3VR6A 1UKEA 3AR6A 3UT0A 4EHNA 4ZCRA 4FWTA 2ENWA 1YVEI 3A4IA 2OFXA 3AEQB 2AV6A 1RKUA 3CZAA 1RAHA 4FFBB 1PVVA 4G36A 2J31A 5EUCA 3VYSB 3ZVRA 1ZDMA 4BPRA 1D7OA 3FOCA 3DF7A 2QVZX 3VYWA 1QHEA 4KIUA 2JLVA 1E96A 2YL2A 3F46A 1EJ6A 2GDZA 3LDFA 4KWCA 1YB6A 4X6LA 1E3WA 3V4FA 2IP2A 5B64A 1W34A 4GC9A 1AS0A 2Q5OA 1PWYE 1NWCA 1P2TA 3OT5A 5LZ2A 3PNMA 1DWUA 1ZISA 1QS0A 1Z15A 4MOWA 1Z2NX 5AHOA 1F8UA 3GLGA 3KSUA 3OJ0A 1GZ3A 3H7IA 3ISJA 3UHPA 3GH3A 1LEHA 3BH0A 5AW2A 5KOJB 4F2GA 1U28C 4MUXA 1W4LA 4WGFA 5FPYA 5J5AA 1YCGA 1G2IA 1SVSA 2J7KA 5K3OA 1V39A 4EEKA 1CJBA 5KPDA 4G0UA 5JNWA 3URKA 1V95A 3BH6A 4IRXA 4UASA 2FP4B 2RC6A 4ZJUA 3ABSB 1KJ9A 4H6XA 4ATNA 1DQYA 1EVKA 3EGXB 5BWMA 3Q4GA 4BNIA 1R8XA 4BE7B 2YWGA 5G0TA 3FMVA 3FR7A 1GAQA 3OO1A 3L43A 1K6EA 1XMIA 4LSGA 4RENA 5COQA 4DWVA 4U2BA 3OICA 5BMVF 2CK3A 2P9CA 4D3XA 4BAZA 2V6BA 3H11B 2YVAA 2ACKA 4O25A 5JAZA 2VHCA 3IT3A 3W1EA 2OFWA 3QWIA 4GLBA 3EZGA 3SIPA 4B3MB 1SVLA 5BRNA 2CLDX 4JUBA 2ZRAA 4P80A 1E9EA 4E94A 5B2FA 5LMZA 1N36B 3TJZA 3BSFA 1QE3A 2F3UA 2RGDA 4UE6A 4NDNE 4Z4IA 4Z4GA 1F38A 3LT0A 3QLVC 4MQLA 5EFZA 4P32A 2XYQA 3EEIA 4PYMA 8AT1A 1NAIA 4ZZ3A 4ND3A 4WJKB 3T7JA 3F6BX 3BWDD 3BMCA 3LGSA 5E7QA 4YBZA 3S1AA 2IUYA 4JI5B 4OKNA 2AFHB 1S1MA 3FUCA 4MR9B 1WJGA 3NC4A 4U9IS 4CDNA 2ZB3A 4RK5A 2F9FA 3R77A 1T36A 3GJ3A 4E88A 2TYSB 4D02A 2QRGA 2DH6A 3AI1A 3B48A 5E9JA 1C50A 1I2ZA 2YY6A 3D7KA 1HNXB 1PQYA 2DPHA 4ND8B 4B40A 5DHPA 4F8EA 4UAVA 4E5DA 2YYAA 3OI7A 4B44A 1UM8A 2P67A 4KXMA 3MGCA 2VR1A 1XCOA 3PIIA 4QQKA 4KH0A 4QTZA 2XOKA 3ZBPA 2P9QA 5I6DA 4MHTA 3G13A 4INPA 5JLJA 1U0BB 2ZJZA 2QRKA 1AS2A 3DHEA 3LK6A 3TIVA 3NHRA 2ZDGA 4QWMA 3KSBC 3AUJB 3BXFA 4FMDF 4KAFA 4HTAA 1LZLA 4BB6A 4K9NA 2H2AA 4TRMA 3MJ4A 3MFQA 3OX1A 3ASUA 2VYQA 1QH8B 3EG9A 2JH9A 4EQ6A 1T10A 2Q46A 2FOIA 2IZ6A 2FHPA 3QPBA 1ZUHA 3QXCA 1F2VA 4N8SA 4XJXA 2QQEA 1S9HA 1NMZA 5K3SA 4BJ1A 3R3JA 4RLFA 1CDDA 2IYVA 4B3JA 1GFZA 4FOLA 4KMMA 3I8XA 2WE8A 2RH9B 4BCDA 5TQ2A 4LXXA 3GXOA 4ONEA 4BQEA 1YACA 4X00A 1N7JA 3FOAA 4FXOA 2YY5A 4NR0A 5EFOA 2VJYA 1MC8A 3UH0A 3BDIA 3GRUA 4A2WA 3GLFA 1SULA 3QMPA 4PZPA 4AZ3A 2ZVQX 4Y2SA 5K8LA 4MUEA 2G9UA 2XGGA 1EM6A 5AVJA 1JFVA 5L7TA 3O8OA 3CLKA 1US8A 5HPYB 4AUEA 2DTEA 4H7PA 4P6VF 1W6UA 3BPSA 4PWYA 2DFTA 3A4MA 4I5IA 2AEFA 1NY6A 4RFLA 4IQFA 5ALZA 1PJBA 4Q9AA 1HL7A 5AHWA 3ZQJA 3J7AC 1I33A 3SHTA 1J06A 3Q7RA 1VL5A 4JLMA 4M1WA 5AI0A 1NXSA 5CXXA 1I1NA 5EWJB 5T3UA 1W2WB 1WHSB 1Z07A 1ZUD1 3JSAA 5JJBA 2PVPA 1FXWA 1TZ2A 3CLTD 1L7BA 3D1JA 3F3KA 3L04A 3G5UA 3E05A 4GOXA 4C1NA 1XZFA 1QIGA 1JVNA 3PPYA 4QJBA 3ZDBA 1EI9A 1CY8A 2VP4A 3L6BA 5E6UB 3N9IA 1HT1E 1MF7A 3LLMA 4MX8A 3ZGOA 3L9WA 3G2OA 2X42A 4UZSA 5JRDS 2O7RA 5TPZA 1HE3A 2R1TB 3RRJA 3T7KA 4G85A 4J0DA 2HHCA 1RXYA 1W19A 4BO8A 2WKWA 3IIJA 4L7VA 5EMHA 3H05A 1ES9A 3HBMA 5LUBA 2GHTA 3C7AA 4ESEA 4BRWA 3CB2A 3MTBA 4KQEA 2LW7A 1Z4KA 2QMQA 1W85B 5CEJA 4BO6A 3CWZA 5MN4A 4GM4A 2BHTA 4G3XA 1X94A 2Q1UA 3G0GA 2D3TA 1NQOA 1S2DA 1U5CA 2YJGA 2ZYSA 1A9RA 1G4UR 4I1SA 5TT1A 4NBNA 5DN6D 3DMDA 4O3FA 1JNYA 3L8DA 4WV3A 5EIWA 3DL0A 4D26A 4MHOA 1CNEA 2QT1A 2ZBUA 3IPAA 1FRNA 4GZLA 4G4JA 4CJXA 3CLSD 1JSCA 1LPBB 5JECA 2PZMA 2I99A 4GOLD 5ES3A 2VG8A 2XT6A 1G8SA 1SC3A 4HXFB 4LAFA 4PHCA 3GLHA 4TVSA 1X3SA 1ZESA 1DIRA 1GNVA 3R1IA 1L5KA 4A03A 3WGUA 4LVOA 5FPQA 4WD3A 2H17A 3NWOA 5KTOA 4QDKA 3PBKA 4NCNA 2ZEJA 3OC0A 3H0EA 4OMDA 3RT9A 4RA9A 4F4JA 3LT2A 1VMAA 1YHYA 2GCOA 3EEBA 1K4MA 2JLAA 3RAPR 2LUOA 5LZ4A 3STXA 1SKAA 3TUIC 3DSRA 4KUEA 1RYBA 2D2IA 3B3AA 5D7NA 3RS4A 4ND7A 1BCRA 3GUCA 4DSTA 4X3PA 1LSSA 3JQ7A 4ZVPA 1ESZA 1PV1A 1GNRA 1PD0A 4L8FA 1ZY2A 2JHCA 2XUAA 3DV0B 3EDCA 4PZYA 5A9RA 1T2DA 1ISHA 4EI7A 4OHMA 3DOUA 3AV0B 3TQHA 1A8PA 1C7EA 2WJVA 2P3LA 1XCPA 3EJWA 3GG9A 2EKPA 4N8DA 4PO1A 4EPVA 4HGNA 5J2UF 3R8FA 3S2YA 4Q1VA 1E5QA 2CL6X 2EERA 2DPYA 4ZDWA 4CKCA 1U0RA 5C51B 2UDPA 2IF2A 1G7CA 4ZO6A 1Z3CA 4E1AA 4TT8A 2ZE5A 4HAYA 3TNYA 3B5IA 1K7EB 1WLSA 1Q17A 1SXJE 3E5NA 3R40A 4PX5A 3VPAA 3ZXSA 2ZRIA 3C14C 3LI2A 3N2YA 3UT5A 2FPSA 3PCTA 4M8NE 4LF4B 1C1YA 1KGSA 3UV6A 2BKXA 4O0LA 4FI3C 3WTCA 4DQ0A 1GTVA 3ZWQA 4L3VA 3MGAA 5EHIA 4CG0A 3ZK7A 3ME5A 3BXPA 3IQGX 3L6CA 1C5KA 2YJTD 1U5AA 1NGSA 4Y2HA 2O8BA 5EWJA 1I2MA 3LXXA 4NYJR 3ZLTA 3WQSB 4XGKA 3TK1A 4RIEA 3DOEA 2P91A 2VNSA 2WKRA 4JFAA 4KMRA 2QD2A 2H5EA 4WBNF 4I5EA 1AQJA 2X5XA 3O5AA 2H2GA 2I4TA 3ZKWA 2ZAGA 3RV3A 2HD4A 1WMFA 3MMNA 4EF5A 3GRRA 2JGKA 3E7PA 2AS0A 1T1IA 4GSLA 4TTQA 4YRIA 4CTMA 1LLDA 3W79A 3CKMA 1L5HA 4JVOA 3EDQA 3ESRA 4UXJA 3VNAA 4J1TC 3VPXA 5JQGB 5CA1A 4GT1A 2EQAA 4YYZA 5KMGB 1JHZA 3A0RB 2XZDA 1CR2A 3AF5A 1COZA 4CI9A 2ZAYA 2MMCA 5I7HA 5KTYA 2B36A 4RK7A 3R76A 4F85A 1KJYA 3WAGA 5FNZA 2OTCA 3OMXA 3OZBA 1FJ2A 1ORHA 3C6QA 5I3CA 5FTKA 1KWGA 1WDKA 3HEAA 3SOZA 1SVMA 5TGZA 2OQIA 3W9YA 1WMDA 4P08A 2IUUA 4X66B 3S7ZA 2BFFA 4D9CA 3SQWA 1DPGA 1JBKA 3M5WA 1AN9A 3C3AA 1NVVR 1PFYA 2WF8A 2CVPA 3VHLB 2H1VA 4DR3B 4BLSA 2BRUA 3NS7A 4MKRA 1C9EA 3FZEA 4Y6OA 4MUJA 4O5OA 1I01A 1PJ3A 2XUPA 3A05A 5H3LA 2VPYA 4QGSA 1PFVA 3LAWA 2AZXA 4BNZA 4R9NA 2Z5FA 3MIZA 4D0RA 1IOLA 3I83A 3PXBA 4ZAFA 3RFCA 4A8TA 4P4NA 2XHZA 5CIQA 1PV2A 1GFSA 2EZTA 2YZ7A 4C08A 4FEYA 2OV2A 4ZYWA 2CVZA 4JBYA 1EGQA 1RLIA 4FFLA 1NDUA 1ZMXA 3COWA 3PQDA 1CZOA 5JY1A 4IFTA 1AKMA 1QOZA 3OZSA 1Y7HA 5CH5A 2ZRLA 5H82A 3PTLA 2HO5A 3AESB 3OAAD 1U1IA 3QEKA 3HJTA 3IUSA 4HGZA 4GUDA 1SBIA 5B3JA 3WZMA 4YV1A 2ZQ5A 3O8RA 1G6OA 2DECA 5HSGA 4NRDA 3ZPXA 3H5NA 1Z6YA 4ZVTA 3JWGA 1CJUC 2INGX 2NVOA 2WZBA 2X6RA 3HJGA 5KKCA 3WK9A 1MDFA 1XZKA 2B99A 1I2AA 4JBHA 4Y6QA 3ZWWA 2VJNA 4H2DA 1YHZA 1FDVA 5AKKA 3P9PA 3UWOA 2CLCX 3O82A 2BFNA 3TIXB 3LUKA 4D0GA 3ANNA 3WO1A 2FZWA 4ZDKA 4MUKA 3ETGA 1ZG3A 4R1MA 5EIHA 1L7PA 4PRZA 1JL3A 5FI5A 4CM7A 1Z47A 2FWPA 1U1FA 2WWIA 2AG5A 5FUYA 1A2OA 3MJHA 2F55A 1YJQA 2QF7A 3EF0A 1J0EA 5IG2A 1ULZA 2BHNA 2WB4A 4CMBA 1SKYB 1NMQA 4E5VA 4TKUB 1IOZA 5H8WA 1WW8A 1QMGA 4QL3A 2VUIB 3PF9A 4DMGA 3LX4A 3JQCA 1KQ3A 3VC7A 1T1EA 5K0LA 1MBZA 4G24A 3RWMB 4QX6A 1JN0A 1RCFA 2G5PA 3H5TA 4XWGA 4BB0A 5E6RA 3FPCA 5BOSA 4RTQA 3QMVA 4JI3B 5AJHA 1ORIA 4QICA 5DNVA 2HK9A 4DYDA 4BVKA 5FEMA 2JCVA 1Z6GA 1FMLA 4YRAA 2C20A 2JJQA 3PYMA 1VRWA 1L8AA 4UHKA 3NMUF 5FUMA 2BGUA 2FRDC 4HBZA 2ZSHA 2HU2A 3HXLA 3I01M 3CH6A 1L5HB 1P5ZB 1VA4A 2BFBB 3KAKA 5HBRA 1E7WA 1T5TA 2XECA 5KTTA 1X7GA 3OZGA 2W2MA 3C8HA 1DAFA 5SY4A 4X60A 1UBJS 5DGCA 5THQA 1QB8A 1TCUA 1W48A 5TMEA 4DLKA 4DSAA 1ZUNB 3QTTA 3NASA 4HUQB 1S4QA 4LVNA 1T8PA 3HVIA 3U7IA 3OPVA 2NGRA 3G1TA 1ITZA 2RJ3A 1PQ4A 3PNVA 4AK9A 1L7AA 1C7ZA 5IVHA 1IZ0A 4NMWA 4Z9BA 4YAUA 2O3SA 2CUZA 5G1PA 5CDSA 2V96A 1U0EA 2XDYA 1U3FA 4YMGA 1I94B 1ENZA 4Q01A 1OGIA 2Z56A 5DNYB 4H3HB 5E1BA 1YR7A 3F8SA 4C0BA 3GLFB 1P7WA 4H7DA 1JQLB 1PJAA 4NULA 5A04A 1WABA 2R1UA 4IJVA 4YWHA 2PZGA 4O0MA 2PUEA 1U5BA 2FEPA 5P21A 4EW3A 4TZKA 5FF9A 1RT9A 3DS8A 3IFSA 1MJGA 3RB8A 2FUNB 3JTEA 4RMJA 1J9GA 3SEQA 2Q7XA 3WL4A 1BEEA 3ZHSA 4NYIQ 3NG1A 3WLQA 5HRUA 1G7RA 1UFKA 2OL4A 3N8DA 1E3LA 3DZBA 2QAGA 1MVLA 1U2SA 3W6NA 3D5TA 4CEHB 1U2DC 4IV0A 2QHXA 2XDAA 1L5WA 3ZJVA 3COVA 1RVDA 1U3CA 2AH5A 3MBOA 4K81B 1XVTA 3IELA 4V1CI 4TTTS 4FOTA 1GD1O 3D6VA 4NBWA 1P9RA 1AV7A 1RMTA 3FWKA 4YT5A 1QYVA 2A9OA 4CTJA 4O1IA 1DLJA 1MGOA 2OQ2A 1YRAA 3OT1A 2O0MA 3RI3A 5FYDA 5HF8A 4FYJA 4E2FA 4Z3DA 4IIEA 3UBMA 1YB1A 4B7XA 3U4HA 1P0QA 3NI2A 5DASA 1N32B 1JT2A 4DDVA 2CLOB 1FP4A 2XE8A 4Y2PA 1Z75A 1K63A 2Q9BA 2R1VB 2TMYA 3EWSA 4GMFA 4AVYA 3GV0A 4E4YA 1Q0ZA 3LA6A 3A10A 3AHEA 2R4QA 4P53A 2OLEA 2YQ4A 1Y3BE 3T5BA 4U3JB 3OQNA 3L4KA 4M0UA 1UOOA 4DR1B 1Z35A 1HX7A 3OHSX 5KC9A 3ELUA 4Q02A 1NM5C 4QEZA 5KB3A 1J21A 1BGXT 1R6AA 1ZVQA 4PQYA 4AW9A 4M49A 1NVMB 2PNFA 4QYTA 1SGWA 1BXGB 3AR9A 1KEWA 4FYIA 3GVCA 5BWNA 2VUUA 1L4KA 1T4CB 1Q15A 4FR5A 4JBLA 5HIIA 4ER5A 4LXQA 4DZRA 2W8BA 6PFKA 1DCTA 3NAQA 2C8VA 5L4SA 4HO1X 1SUWA 3OM1A 4HNHA 2W98A 4EW1A 2PUBA 5CJPA 4LYFA 1X9HA 3PL1A 4PSKA 1LTHR 4C0JA 3VKFA 4MDEA 4JT4A 1CUAA 2VZEA 3AJAA 3OQHA 2LXNA 3CO5A 4G1BA 3D0RA 3VHXA 1ZNZA 1RM3A 2Y76A 5JS1A 4FYXA 4F5DA 3LC0A 3H19A 2A9KA 3I2FA 4MZDA 1G64A 1ZJYA 4D4MA 4PRKA 2B98A 2JLQA 4C30A 3SHWA 4F1JA 4L08A 5DDIP 3H84A 3MA0A 3RIHA 3GPLA 3QVXA 4JN6B 1DRUA 2XQJA 3GZJA 3JVIA 4B2IA 4D6YA 1OHHD 3TMYA 1FC0A 3OFJA 4B7AA 4PICA 3DAPA 4B9EA 2BSQA 3D6HA 4MLCA 3VSBA 1JS1X 2IPNA 5DE3A 3E9DA 1E2UA 4TSRA 1CNFA 2ZJAA 1L8QA 4J1TA 2ZIXB 5JQGA 2KLBA 1TU4A 2R97A 1YZTA 2ZROA 3KYBA 4ERNA 1BCSA 3ZVNA 5IBRA 4Q3BA 1UXKA 5ALOA 3TD6A 2NP7A 1IY8A 4KQ9A 4UW9A 3SYRA 5K6RA 3OTGA 3U7HB 5J4LA 2V03A 3PPWA 1DCFA 5DCYA 2IWHA 4KDRA 2W70A 3ESAA 3WFJA 5FWXB 5IKMA 1X7ZB 5KYUA 3M2TA 3FTNA 1DX6A 2WFAA 4QLAA 3JR3A 1QG2A 2FXVA 4JODA 4MGIR 1WXGA 4NU0A 3VDRA 2OECA 3V5NA 5HKBA 2AN3A 4UBOA 4K9DA 2Q3MA 4JD5A 1MFPA 4JVMA 1JEOA 3OJEA 1Z6ZA 1NXXA 1T9ZA 3QI7A 4M0FA 5C3UA 2YZKA 3RJTA 2GBGA 2HLNA 3E3MA 1SUIA 3EUEA 3QH4A 2V1XA 2X19A 4INZA 3MWKA 1EM8A 2OGWA 4KVAA 2NU8B 1T8UA 1NVGA 2PH7A 1K5PA 3G0OA 5P8WA 1SCDA 5BN4B 2WFMA 2D0PB 4RPCA 1VDMA 4IEEA 4E70A 4FGJA 4PFQA 4X8HA 1EUCA 2QUHA 5JALA 5AKEA 3WNVA 1VGQA 2DPXA 3CBGA 3IULA 4WEOA 5MFPA 2C4TA 4LJ5A 2DXIA 1LPOA 1H42A 4UNIA 4LWQA 4BVLA 3IBCA 1D0VA 1UKAA 2H54A 3OUZA 5ER6A 1QHNA 3QUTA 4P4LA 1CJKC 1PFUA 1SH7A 2R6DA 3HYCA 1KE1A 4AULA 1YDHA 4ARSA 1TPYA 3IT1A 1JLMA 3IT0A 2FEWB 2HADA 3B3QA 3EFEA 4D9FA 2BMVA 3CNOA 1H65A 4KNVA 4ETWA 2WNHA 4N5NA 2C4MA 4MYDA 5HW0A 1WDLA 3S2IA 1T0BA 1FU4A 3RIMA 2FPIB 2C88A 2FWMX 2VHQA 3IP8A 3KWFA 4M89A 4UHCA 3EJ6A 3GJQA 4C05A 1T35A 4B3TB 1JDNA 1XMXA 4NE9A 1J22A 4EB8A 1OB2A 1C9JA 2J4CA 3I2YX 5ALPA 2GJ4A 4CKZA 2D4HA 2C29D 3ZIAD 1B8VA 1Q2XA 1HKUA 3GG2A 1GPWB 4J03A 3MRXA 1DKLA 4PSDA 3I23A 4KTVE 3NAMA 4RK6A 4AG3A 4E4RA 5LWQA 4Z4CA 3CR8A 3G02A 4FFRA 3T9BA 5T8KC 4WDRA 3BXOA 4I2NA 2XXBA 4FQ7A 5BYKA 5K0BA 1RYEA 1MEJA 3OU6A 1WOMA 3L92A 1NI4B 4NP6A 1S3SA 3TB4A 2BHRA 4RH3A 3LCMA 1DINA 2PY6A 4F5EA 1CJTC 1T9KA 3BOSA 2WT9A 3CB4A 3BAFA 1TEHA 1K97A 2XUGA 3ORQA 5CFQA 3DUFA 3BORA 3QPVA 5FHRA 4AG5A 4EBFA 2AJTA 2Y66A 2CXXA 2GK6A 3BGIA 1HQKA 3DM5A 3FLMA 1RC1A 5HF6A 2WY2D 4BUJA 3WYFA 4LY6A 2RKOA 4DN6A 5BW6B 2PPLA 5EWLA 3V33A 1P75A 1BROA 3ZE1B 2XB9A 4DA9A 1E63A 4V0KA 4EP1A 3BF7A 3HP4A 1DV2A 5DM1A 1V5WA 4NPAA 5A6VA 1U81A 4CM6A 4HDNA 5I7UA 1KOLA 1FIUA 5JSHA 3E22B 1WZUA 5E9WA 2RGXA 4H08A 4ED9A 2CCJA 3B6IA 1R3DA 3DZFA 4G0MA 2RGNA 4ZK2A 5KYVA 3AJDA 4KLAA 5GZ1A 5KWIA 3OJFA 3FPKA 2EBFX 4MI3A 1VP3A 1P2UA 4YROA 3U7FB 3L82B 3FKSD 4AQYB 5ED0A 3TTUA 1SBTA 3ZHVA 3MUOA 5HIJA 3K8QA 5LCXA 3F9CA 3WK6A 4NENB 1K5HA 3K0SA 2Z43A 4LYDA 4UEKA 1A8UA 2HXGA 2DR0A 3OPYB 4FT4A 2IS1A 1Q20A 4BNWA 1OCEA 3OWOA 1RQLA 1XDWA 2B37A 5I9SA 4R1NA 1HL3A 4YMIA 1KVSA 2A5GA 4G2NA 2EU8A 1PL8A 1ZK0A 3EA0A 4BU0A 4OF4A 4IKPA 2AIRA 4HWOA 1YNSA 2B25A 2BY4A 3HMKA 3CLUD 1R1DA 4MMZB 1J0BA 4ZYTA 3QLUC 5IX8A 2UU9B 4G8BA 4IHKA 1ABBA 1RKXA 3Q6MA 2R6FA 4G5OA 3KB1A 4K8RB 5JMPA 2HLHA 4HQFA 4AJOA 5ES4B 1R8YA 2RGAA 1ZW1A 3PJEA 2JPDA 3Q5EA 1QPBA 4OBEA 5HVNA 3AZOA 5B58T 3V7UA 4BGUA 4BO5A 1D6NA 4F1WA 4JA0A 1E1CB 2OHJA 3FIUA 3SWWA 1XCBA 1DCMA 2GZRA 1V43A 2ZP1A 1NX6A 3FHLA 3J7TA 3L46A 3AWIA 4N5IX 3G0HA 1X0XA 1DPFA 1QK4A 3IQWA 4B6GA 2DJIA 1SUPA 1GV1A 2Z3WA 3KC2A 1FJGB 1OZAA 3HGMA 1XXHE 2IK8A 2ZR8A 2GPAA 3AUFA 4M1MA 2ADFA 4AZTA 1A9QA 3MSXA 5DF1A 4DNXA 2E0IA 5I7EA 4WZZA 3D8SA 1PV4A 3OCJA 1PN3A 4MVJD 1JAYA 1G20E 4IV5A 4ZAXA 3WAKA 4ZN6A 1V9LA 4NCKA 1LSJA 3CXRA 1CRZA 3HHPA 1P6UA 2IIBA 3VPSA 2HF9A 2WFZA 1EDBA 3H2GA 3CTPA 3OX4A 4MMXB 4OY3A 4CV3A 4YUAA 2ZW9A 4CXMA 3W2TA 1VSVA 1PGQA 4JI1B 3NV7A 5GGXA 3V48A 1HTBA 1Z0ZA 4RZIA 1V8DA 4S1NA 3NH9A 4E5MA 3BGOS 3ZDDA 1KYZA 2Y1EA 4WE3A 4B35A 5KTSA 1HYQA 1WDWB 3LC1O 4ITUA 4CKWB 1DDOA 1G5HA 5EIBD 3P0EA 2CD7A 3IAS6 1N33B 4QJ3A 5EQDA 4I1UA 5HA5A 3SOPA 2HV9A 3HRIA 2Q7OE 3SY8A 2AQKA 1LF5A 3HCOA 4JKIA 1O95A 4XASA 4GKBA 3UN1A 3DPSA 2P7IA 4CLHA 1OLXA 1VA5A 1U2ZA 2FLKA 4CF5A 4RPHA 1KK0A 1XWFA 1KH2A 4ZI5A 1J09A 2FUG6 2XADA 5K3AA 3ZDEA 1YONA 5B6JA 1JHPA 2C7RA 3OSZA 1DQZA 4OB7A 3AP1A 3GZNA 4C5BA 1EWVA 4CZ2A 4M0CA 3KEQA 4OU5A 1TM3E 1EDDA 4NCXA 4R69A 1WKVA 1XD8A 2FSIA 2HU5A 1HMPA 4RV9A 4YI3A 2AC7A 3K6KA 3P0IA 2Q4OA 5L6LB 4MSUA 3T0IA 5M2QA 1SCQA 4IVPA 4FTWA 5IBQA 2ZDQA 1NUHA 4RXUA 4DA8A 5IVKA 4TT3A 2JFPA 2R1VA 4C7XA 4CMJA 1O6GA 2H2IA 3AR7A 3A1FA 1VI5A 4MA4A 3ICPA 5LA6A 1ICEA 3D6TB 3L7NA 3EC1A 3PGXA 1Z56C 4RS4A 3VZQA 4C6TA 3OOJA 5FOQA 5L7WA 4ND4A 2BGRA 4YYEA 3HCPA 2GWHA 2XRYA 3FHOA 3LLCA 4FB5A 1DXOA 3GNLA 1A3CA 2HA7A 4WTOA 1E58A 3BTOA 4WUVA 3HHEA 3Q40A 3X2FA 2MT9A 4NI5A 3VPHA 4Q9JA 1YU6A 1LK7A 2ECOA 5IT0A 3REQB 2WG1A 2MR5A 3W5AA 2OZKA 3W8FA 2XTAA 2HSZA 2WPDA 4WHMA 2HGSA 1U28A 4XI9A 4EJSB 5KOHB 2XQVA 2YRXA 3AY3A 3BCSA 3RVPA 1TZJA 3ZUPA 2YVQA 1AJEA 2I3AA 1GTL1 1LSUA 4QTYA 2AXNA 3OE7D 5BYJA 1IN8A 5AW5A 3R5KA 3WC4A 5L3SB 1DC8A 2O5CA 5AKHA 2CWWA 2X9QA 1MO6A 1VL6A 3A36A 2A1UB 4DARA 2CD9A 4C4OA 4WCVA 1U63A 4YCAA 3PSAA 1P1HA 1Z17A 3C45A 2ONKA 4DMUB 2GJAA 3ISVA 2Q5JA 2FR0A 1GCOA 1HO3A 4HGQA 3E9QA 1JDBB 1PW7A 3IUNA 4QJIA 5JAQA 1IN5A 2VSQA 4HH1A 4CEIB 2ZAOA 2AJCA 4PRYA 3C3KA 5HS4A 1RLOA 3DMNA 4IV8A 1WBBA 8OHMA 3ZUGA 1U8FO 4YPOA 3U26A 3X1WA 1NBIA 3CLRD 3MZ0A 4FYHA 4KYTA 2VK1A 5LL6P 4TMFA 3IPYA 1V47A 4M99A 1JKFA 1RQ2A 1O77A 3OZIA 4Q82A 1OKKD 1DXHA 1QIJA 3QOFA 3C8UA 3DBHA 4ZVKA 1RBMA 2Q3HA 1RRKA 2WJHA 1JHYA 2X0IA 3C43A 3F8WA 3UJ8A 4RELA 4UNQA 1KJNA 4F46A 3JW8A 3P45A 5LNK6 5ECYA 2GILA 4ZU1X 1BMDA 4H1WA 3TE6A 2FR8C 4MWCA 1B4DA 4ARZB 9ABPA 1OA0A 1X3LA 5FV7A 4N3AA 2CVHA 4LZNA 3GARA 4KQMA 3H2BA 4D4HA 5DISB 1NLMA 1C2TA 1U7ZA 1CR6A 1NOIA 2FQ1A 2GBFA 3L7IA 4MK4A 3SLRA 5HJ5A 1V4NA 2DWPA 4WK6A 3H2YA 1V71A 1YDFA 4Q7JB 2QPLA 2PEYA 2XLCA 3CE9A 2VHXA 1WNTA 3CYFA 3T0GA 1N57A 1NQ5A 1S2IA 3M1AA 3B60A 3ODGA 4IUCS 4K28A 2E82A 4L28A 1KI4A 5JCJD 1FMTA 1ONSA 4JEIA 5DBIA 2GM9A 1JEQB 2OV3A 1AO0A 3EVGA 3HFJA 1OTHA 1NAHA 5DHTA 4EX7A 4TGLA 2PPVA 3UJ7A 1U1GA 3C1TA 2P3OA 2HCFA 1XAGA 2GEDA 2G1JA 1N5JA 3BVPA 1P60A 1F1BA 3PT5A 1M6VB 1PG0A 3S7TA 4DDMA 1E98A 3ZXYA 1WP9A 1LSOA 1QLHA 4FUQA 4PC2A 4OIFA 4GWLA 4PY2A 4YRCA 2XMCA 4G0VA 4IRMA 1QYIA 4Q3KA 1GKYA 3THRA 5IZCC 1OJLA 3BFJA 1DEXA 2XXAA 1S96A 3LVBA 2WAMA 4X7PA 3R7DA 4AMGA 2GLUA 1YIDA 1Y4SA 4K46A 5FKJA 3H4MA 4X0EA 3OIVA 2M6LA 2BOVA 4LYAA 1J70A 2WOOA 1IM5A 1ECFA 1UBEA 4KSYA 2NPIA 1E9RA 4OXIA 4XPIA 2I7CA 3NHWA 1M8FA 1T0JB 1COWA 5D2CA 5E6SB 3THSA 4C0KA 3QYPA 3E7WA 1BA3A 2Y27A 3WGMA 1B76A 3IKJA 1A1VA 5ECDA 4KQ1A 1LW6E 2ZDHA 3TVYA 1RRCA 4CT5A 3F5DA 5TMBA 4DKXA 2G40A 4Y2RA 2W0SA 2P6NA 1JNXX 1O57A 1XKXA 4NECA 2AG6A 4HDOB 2XVMA 4IX9A 2B6HA 3T7RA 1Q91A 1ZEMA 3BFVA 1P4SA 4Q1FA 1EIWA 3KJQA 3G7NA 3HN6A 4UD2A 2EEPA 2RCYA 4HQOA 3JQ8A 3PK0A 4QFCA 4QGBA 1D7AA 2C77A 2VAWA 2QENA 3KCQA 4MVJH 3I04A 1EXDA 2AI2A 1IN7A 3G49A 4I8DA 2W2XA 1PUXA 2Q9UA 1E1KA 5ADUS 4JC4A 1KVTA 1WMSA 3UWPA 1QTIA 5HQ3B 3IA2A 1G2PA 2G71A 2FXIA 2D2XA 5C8XA 1R6DA 1N7HA 1SY7A 4E32A 1N25A 1O89A 3DVAB 1XLTA 4Q1AA 5FTWA 4YMUA 1U3VA 2OUIA 1YCFA 2Z4TA 1JHMA 3CKYA 2WIBA 3MWDB 2Y92A 3UKJA 4D4KA 3RADC 1Y7LA 3TPCA 4L15A 5I8WA 4FE3A 4QA9A 1U2DA 2WJZB 4C43A 1E1DA 1LVHA 1Z28A 2XRZA 1UKVY 1ZSNA 2WVHA 4K8OA 1KKLA 1K5GA 3K0EA 2J5RA 3HKCB 4HN4B 4MVXA 2W58A 5F76A 4AYTA 3JARA 2C5FA 2JDID 2QSYA 3OEYA 4WN3A 5KVQA 4YMHA 2DFPA 3BGDA 4E5SA 1QYCA 4BFXA 2UXCB 3BT7A 2JBHA 2EW1A 4J0QA 5EP2A 3RCBA 4YX9A 4F06A 2W48A 3GPBA 2VYND 4E09A 4MP6A 1UC8A 4YXWD 2JGIA 4CETA 2VJDA 3MAJA 4YC7A 3H2ZA 1F8GA 2ZI4A 3ECCA 3NXKA 4NXNB 1Z0JA 2EZ9A 2NO1A 4BKUA 3DLPX 5JZOA 2WJIA 1OIWA 3SXUB 3T7TA 1TJ5A 4RCYA 1SAYA 1FE8A 3OEHD 1OD6A 5G40A 2R6AA 2BFEA 4EJMA 4EVSA 3TF5A 5DTEA 5KDDA 3TECE 2ES4A 3Q9NA 2P2DA 3O74A 2HWWA 1H4VB 2V9ZA 4BLRA 1B0AA 5MN6A 1NY5A 3OCWA 3V42A 3F6CA 2X9NA 3AP3A 3CRW1 4PHFA 5FORA 3UO8B 2VHTA 4C06A 5KVAA 6NULA 3JD0A 1B73A 4CIVA 4IWXA 3DMTC 2C97A 1E0KA 3K1JA 3NBAA 2YDYA 2Q3DA 2QVBA 3BMOA 2P68A 4MI6A 3L7LA 2OV6A 4A10A 4D9KA 1P3JA 4JYAB 2EFDB 2HXYA 1H2AS 3SSOA 4HH0A 1J8QA 1X1AA 2BAGA 4DRXA 1G8HA 1TT7A 3NLLA 4BFCA 3AHIA 2YBDA 3G0BA 5TS3A 5DLPA 1FBNA 3PLNA 5G3ZA 3DFFA 4FYWA 4N0DA 3AK4A 4OQEA 4S1WA 5G41A 4XPIB 5LXTF 5ADWA 1SQFA 1Y98A 2YINC 4IX1A 1BE0A 1KFKB 2BONA 2JAXA 3DZ8A 3HVKA 2NUPA 3P19A 3F8TA 5F3WB 1B7GO 2MR6A 2VDVE 3KJHA 4OLFA 1BHJA 3IUPA 3NTOA 1Y5LA 4L1KA 1N2OA 3IQIX 4YCDA 4DF3A 3GJTA 4RYLA 5TEVA 3VU3A 1XQVA 1XJ5A 1CQPA 3W8DA 1DBVO 1YQXA 3UC5A 4X94A 4YDHB 2CHEA 4HNSA 2WABA 1LX7A 2WMOB 5DCWA 5JATA 3QKTA 4QXAA 4XWOA 3VNVA 5BSKA 1O4WA 2FUCA 4A1FA 5I01A 4H1VA 2Q9CA 4GYKA 2FCRA 2GVNA 5ALXA 3DO8A 3QKSA 4X90A 3TJMA 3ZXUB 2NT3A 5JD3A 2PLRA 3W5CA 3GN2A 4UHEA 4E7PA 3M6FA 4IXWA 4AJEA 1PWEA 1XEWY 3V4SA 2PTHA 3M83A 5A3SA 3K70D 3ZIAA 2RH8A 5E0KB 1I14A 3HWSA 1N3BA 4DRYA 3D6JA 4N41A 2EBHX 4O29A 1MABA 3F78A 4PG5A 4KJXA 2DX7A 4JP2A 3ZU2A 3S29A 3JQFC 3SBXA 1QH9A 1QHHB 1VG8A 1M1NA 3WHIA 4XTRA 1ZH0A 1Y3CE 1AUVA 4Q93A 4Y9SA 1B41A 4BO4A 1ST2A 2Q9AA 3UJCA 4HGPA 3FPBA 1TA4A 3OZRA 2F1HA 4URFA 1T8YA 5IASA 5HWSA 1PNRA 1WNFA 3EVAA 2CHVA 2OP0A 4PAWA 4P5PA 5T4HA 1Q22A 1D1TA 1KL7A 5EHGA 1UBNA 3JYPA 5ALMA 1OH6A 1N8SA 4M22A 3E7XA 4UPVA 2RAUA 1H4QA 5EIAA 3OC6A 2JGAA 2RK4A 4XX0B 3ODPA 3Q2OA 2IPLA 1ABFA 1EA5A 4LGMA 1D9XA 4P5EA 2ORIA 4ZCPA 1TF5A 2AG0A 3K2EA 2JVIA 4MV8A 4F84A 3RVSA 4B82A 3EPPA 3OA0A 3QWAA 4FFDA 4QOIA 1C7JA 3H8SA 5DI9A 2VYNA 1B0UA 2WWFA 3RBXA 3SF8A 4C88A 1EKXA 2D1TA 5DX0A 3JAWA 4AO8A 1F0YA 4EZEA 2VTBB 2KYRA 3C87A 2CZCA 3EH1A 1PZXA 3DPUA 4IJ6A 1DBIA 3LXMA 3B78A 1ZD2P 3R44A 4D99A 3IE0A 1ZD5A 1NLYA 3ZDYB 2HAEA 2MSCB 1M7GA 4BN0A 4WERA 1RHUA 3JYHA 1KZ1A 1JIVA 3B1KA 4UXHA 4MB6A 2Q6TA 3V8BA 3VC3A 3VO9A 4Y2XA 4BX3A 2ISQA 4RDCA 3CUTA 1LVUA 1EE9A 3QWFA 3KQNA 1W93A 3DDOA 4MROA 3D1LA 4ND1A 2WUEA 4DJFC 4FYMA 2ZB4A 4BLQA 1QMPA 3HEMA 3K0BA 1RQGA 1CVIA 2FUKA 2DULA 1V0JA 4ALJA 1ZM3A 3EXHB 2G9RA 1EX9A 2VP0A 3AY0A 3EYAA 4M46A 3AL3A 5DHFA 1G21E 1RMYA 2JB9A 5ENZA 2VPXA 1E0JA 2EYUA 2H4ZA 2I8CA 4KXXA 1SBCA 4PLYA 4QUBA 5LYJA 3WBJA 2DE0X 2GBCA 4UDNA 3Q8MA 4KE6A 4M6WA 1ATIA 721PA 1OSNA 1N1MA 3BFKA 4LF6B 3I0NA 2MYTA 5TQ0B 4C5AA 1SG6A 1CW2B 1D6SA 4KPUB 5JDCA 1JG3A 2JLXA 1H2WA 1BKSB 3BWMA 4P34A 5JLAA 3UJNA 1DRJA 1N1DA 1N9GB 2PUGA 2POCA 1DARA 1N2BA 1OXVA 4XEUA 5G0VA 3RKSA 1QFXA 2WD7B 2PKWA 2PR2A 4RGVA 5KDOA 4M0PA 2DT8A 9LDTA 5EN4A 1M0EA 2WSSD 4JC0A 3PQ2A 4EUHA 5ETJA 3RR2A 3DXXA 4CM4B 4KB5A 3WK7A 1EDEA 1H6CA 2C1XA 2IHJA 4NMXB 3IYLW 1LK5A 5THKA 5BN4A 1ODIA 3FNRA 2Z09A 3BREA 4FHEA 2IXFA 4PGFA 5KUTA 5D5QA 1EVIA 1GAJA 3NBUA 4LDNA 3RC2A 1FFWA 4C07A 4L74A 1N0IA 3JZDA 2JW5A 1MJNA 4H4EA 5LOVA 1KYWA 1PK9A 3R5SA 1ZR2A 1T5DX 1ZVKA 1FU7A 2R1ZA 3L8CA 2HRZA 2RK3A 4HMPA 2HMYB 4RD2A 1Z6TA 4OOEA 4CM8A 5FWYA 2DLDA 1F20A 1YS2X 3LP6A 1UBCA 3H83A 2I66A 3L7OA 4OTZA 2QSUA 4QUDA 2L18A 4Z7QB 3OQ1A 1BWPA 1C9MA 1PKXA 3TZHA 3UF0A 1ZU4A 1U0SY 2AOXA 2X8JA 4CMEA 3S0JA 3TRKA 2QRHA 1IXRC 1XPJA 1I1HA 1ZNYA 3JXEA 3PU6A 3EZ2A 2G83A 3IAS1 1CY0A 3B9PA 4FUTA 3L06A 1SBZA 3EGWA 1DRWA 4JJFA 3IP1A 3SF0A 1X0VA 1L5SA 1OC4A 1TU3A 3FJOA 1Z26A 4JWTA 4Q9KA 3VFDA 2VRWA 4XOIA 1P9LA 2A9RA 3FNEA 2N75A 2XUKA 4HB4A 1RE0A 2JKVA 3G3EA 1XMPA 1J2JA 2BEVB 3H1GA 3K53A 3PQFA 3ROTA 4MO9A 4M87A 1VCIA 3KEOA 4E5YA 4DR4B 4BECA 5DN9A 2HL6A 3C4JA 4DMLA 2HDHA 2XQKA 4RQTA 1T13A 1VYHA 4JS0A 4ZRNA 5EE9A 4G0XA 2P8SA 1Y1SA 5TF4A 1V16A 2GAJA 3NTXA 1Z4PX 4XFJA 5JZMA 2K7FA 4K9QA 1K98A 3T1OA 2NU8A 3A1VA 2BP7B 2UKDA 5T4EA 4Q7KA 4GI2A 1BG6A 5BSRA 1J90A 1H8EA 1LDBA 3Q8XB 3RTDA 3Q5GA 2BUBA 2JFBA 5K3EA 3ZU5A 1JI3A 1QYRA 3NT5A 3D3EA 2I2AA 3IEVA 1IXSB 4ILKA 2XGJA 3X0DA 1ISJA 4IZ6A 4D4IA 1OWOA 1XNGA 3R3WA 2UZ1B 5EG5A 1NUUA 1E9CA 1XA0A 3G8BA 2PMEA 4BVGA 2QG4A 1UT6A 1ESMA 3FOEC 4JB3A 1MN6A 2XNDA 3A9WA 2YN4A 2X3UA 1DXYA 4IHJA 3VNBA 4C20A 3ZU4A 2FETA 3HXTA 2D3WA 3ZHUA 1G42A 2FZ5A 2CVOA 3JARB 1GL3A 3WNBA 1L5RA 1ZQ1A 4Q5IA 3LVQE 1BXZA 3FROA 3IQEA 3M33A 2JRCA 1QIFA 2J6HA 4MR8A 4MIYA 3ZVKA 1JIIA 3FGNA 4UBLA 4YUVA 4LXIA 4NOMA 5BWBA 3NHUA 4MV9A 3AY7A 3LL7A 4BIMA 2ZVJA 2C8JA 4G9GA 1MCZA 2HMTA 3PNLA 5F5NA 2C58A 4M7PA 1PO7A 2ZJOA 4F86A 3HDVA 4QBHA 3K3PA 4C7VA 2D2FA 4JI7B 1SOWA 3GAAA 3O4FA 2QV7A 3ETEA 3SJCA 2HHAA 1BMTA 4F5WA 5T7BA 5JWRA 2I55A 1XCMA 3OG9A 2JHPA 4OHBA 4O4HA 4KGXA 2I6SA 4WY8A 2NVUB 1P4GA 2P3SA 2HSJA 2PKEA 3VBCA 4YN3A 1FK8A 3QLEA 4EGAA 4B3HA 5A4DA 1EEHA 1M10A 3AYXB 3BF8A 3I12A 3ND7A 5C37A 1EB8A 1U0NA 1WOYA 3A1WA 4CDMA 2FPUA 1C3OA 5IAGA 5JH7F 4A7PA 4MRPA 2LRHA 2ZB8A 4L8LA 3RANA 3H5OA 4ER0A 1X86B 5JVDA 1RZRA 4LUCA 4XSGA 3AVYA 4V0LA 1R15A 3ECSA 4KEAA 1I13A 5G1NA 2WQ7A 2OZEA 1H1DA 4XH9B 2IYPA 3GDHA 2UVDA 2ZWVA 1MQ9A 5TJ9A 3ANXA 4REQB 1Z8HA 1BDHA 3JVDA 3M4YA 1GAWA 4XDHA 2WMNB 3UPUA 3GEDA 4OLBA 3UA4A 1XRPA 1KZHA 4JT9A 2YJ6A 3OY7A 5IS2A 3RUDA 1JJIA 2WYIA 4LYJA 4ENTA 1DWQA 3GFPA 3HNRA 5CK4A 5CVVA 4YONB 3NT2A 5J2TB 4DAEA 1FDWA 4NENA 3PXEA 1E79A 4B4VA 2P78A 3JPYA 3N2KA 4MGEA 3V7WA 1U7PA 3GRFA 4JJKA 4M98A 4DC1A 1BO6A 1F2UA 2GCEA 1RJEA 1MOZA 3EIUA 4NPHA 5F3DA 4QVIA 2BP7A 1MAWA 2G7MC 4YAIA 3DB2A 5DPMA 5EJAA 4B87A 4EYGA 3KL4A 5DGIA 3GLGE 2GPSA 4AWBA 1C9DB 1K27A 1ZIPA 2H1OA 3B1YA 5HCUA 1P29A 4LNAA 2O8NA 5HKKA 2AZ4A 1HC7A 3JATA 2NYRA 2IELA 2YNMD 1JRLA 1ZNQO 3AB7A 3A9UA 3EDMA 3GIWA 3O8QA 4DIMA 4RZXA 3EPJA 4NZ9A 2HPZA 3M8KA 3LUGA 1E66A 4M7RA 4AS2A 3FMOB 4B6EA 3Q7TA 3EGDB 3BSWA 3EWNA 3HKEA 121PA 4DLAA 5IC4A 2RBKA 5LXTA 2FPWA 5FOTA 1IWBB 4U6SA 4ZO9A 2PX0A 3N58A 1U0GA 2AOTB 4ARUA 3GY0A 4C89A 4DB2A 4P86A 1Z0DA 4JC5A 4AXBA 2UV8A 3AOEA 2E2WA 2CVFA 1IEXA 2X5KO 2C9BA 3EEQA 4FDAA 4N7MA 1YBHA 4QRHA 1E2DA 3UCXA 1JHDA 1TD1A 3V4ZA 2QV0A 1YS1X 3DCYA 3MJSA 1NF3A 4OUDB 5C18A 2D59A 3IV7A 3LBIA 3MOIA 3A4LA 2R66A 4XARA 3TLAA 3KSMA 4C0HA 3NONA 1YDMA 4DREA 1JDPA 2XZLA 2B35A 2JFHA 2J8ZA 3FOBA 2IEGA 1HDYA 5H7XA 3ISTA 3RDPA 3VDNB 3SYTA 3SE7A 2WDPA 2Q3LA 1Z74A 1TQ6A 3H87A 1IPFA 4UCXA 4AJHA 1CJCA 1YT5A 1BMFA 4GI5A 1NW5A 1FP2A 3EPRA 4H1HA 2YCBA 4RD6A 5LJIA 1QRSA 1SQSA 3A2MA 4M0EA 1NNEA 4X7MA 5LC1A 3R2JA 1HOXA 3I3OA 1MRZA 3B20A 4XYLA 5EJFA 2NU9B 1AKUA 1ONBA 3UXHA 4ICIA 3LQFA 4PXSA 3U3RA 3E3NA 4FIZA 2IOQA 5IDXA 3S8EA 1WSWA 1RWWA 5F5LA 2A1IA 4I3GA 3ND8A 1GUAA 5EZYA 2VZ9A 3RM3A 3V7FA 3W3AD 4ZTZB 4QUHA 2GN9A 4Y2UA 2X6TA 4TV9A 1HV8A 3LQQA 5IH3A 4RIGA 1JFSA 4Q34A 1ODKA 3E4DA 1LBHA 1ZGHA 3HZHA 3OIUA 4HZUA 2ZUVA 5DO9A 3KKMA 4BVJA 4F9TA 3B8HA 1TC1A 1P33A 4HF7A 4QU0A 1VJTA 1GPUA 4QU5A 3TCXB 4DNFA 1PVOA 2WAOA 3QFFA 2AD5A 2NSYA 4G56A 4OREX 2WV7A 1KTVA 3WLKX 3U5ZB 3JPWA 3U4GA 3GCZA 5K0FA 4HAVA 4IWNA 1NSTA 4PNPA 4LQCA 2CZGA 4YJFA 3U60B 5FI1B 4W63A 1EJ2A 3I1IA 4FFPA 2VLBA 4U0KA 3HKCA 5DV9A 3S6JA 3N59A 3AIOA 4H6VA 4BV2A 3WMXA 4DM4A 3UWKA 3DM9B 1SBNE 1DEKA 2E7ZA 2QE6A 3FCSB 3IDOA 4KX3A 3BHMA 3UGQA 5HP4A 1KI9A 5KYNA 1QCDA 3TZ6A 3ZJTA 4ENRA 1Z2CA 2IQIA 2JKZA 3AH8A 6REQA 3BN3A 5C35A 2IEAA 1R18A 3AXTA 2YWBA 2RHLA 1VECA 3GLFE 7YASA 4XB2A 3NU1A 1K7YA 2AMFA 2BZ1A 1C0KA 1WD5A 3KJEA 3WYNA 1OBFO 3IERA 1TF2A 1DKNA 4EI9A 4FCTA 4AKSA 1P9NA 1D4ZA 1ECBA 1LJLA 2WV9A 2YHIA 3FWYA 3PWTA 4RXTA 3RPEA 3U4QA 1X7WB 1XRMA 1NKTA 3DXFA 3HQ4O 4DBLE 3UUEA 1Q0LA 5A5FA 3IP5A 3GJZA 1JJBA 5HDBB 4Q4HB 4DDWA 4TN5A 5SV2A 5JI2E 4K7JA 3LPNA 2VJCA 4HLCA 3NHJA 4LX8A 1ZH8A 1O97C 4YO8A 2A30A 3K35A 3V1LA 3HY3A 3K9CA 3N39C 2F1OA 1QVWA 3H8JA 3O92A 3SIRA 3VTAA 3LUPA 5IAAA 3C3XA 3PHLA 2XMSA 3CGGA 4HP8A 5IJWA 3R3XA 3FETA 4IMIB 3LOUA 4JDUA 5B6PA 1NMYA 2D5LA 2XR1A 2QUBA 4NZPA 1Q5PA 3BK2A 5DTRA 1VE9A 1CSEE 4PSAA 4ARAA 1GNSA 5LBTA 1G59A 2VH1A 1RWXA 4L3OA 1XZJA 4E1VA 5BSVA 1E2BA 2QTFA 2B8EA 2VBIA 1I9GA 3AOGA 5IT5A 4HDSA 2XOXA 1OX4A 4CM3A 1R0ZA 3QF4B 2H92A 3MM4A 3SJ7A 4OQNA 2CJWB 2VNHA 3UJ6A 4E07A 4YJGA 4G8JA 3ZYCA 1IQUA 4I1PA 3T1VA 4KPYA 4ZV7A 2Q2VA 2LZ0A 3N2NA 4UUBA 3U9LA 3WO0A 1I3MA 1QVRA 1V5GA 4GXTA 1ONPA 1E2LA 1L7QA 1YI8A 2ILTA 2ZCUA 2ZRNA 3GCWA 3RS7A 4A4DA 1W29A 1XHEA 1QS0B 3QKSB 1E62A 2BFDA 1Y8RA 1TO6A 4LHSA 2FEXA 4E11A 1YDGA 2OV8A 1QHFA 2F3RA 2YJZA 3IJRA 3TXAA 4BNTA 2ZBFA 1VKZA 1LLFA 3G7SA 3V2UA 4LJ7A 3FTQA 1XGKA 5FA6A 5IXSA 1FUKA 2IHVA 3KO8A 5FB3A 5B36A 221PA 2C00A 3G68A 4FQ5A 1ENYA 3WYEA 2CYBA 2H31A 2UUOA 2PRSA 5AM5A 4Z2YA 2HT6A 4H7HA 2AK3A 3UJPA 4KO4S 5C32A 1RYNA 1BFDA 1NKSA 3LM8A 3D3JA 2O7NA 3HR4A 4NWIA 4JIGA 1Y6FA 1BXKA 3Q3JB 3T3EA 3ABIA 1O1YA 2E37A 4LHZA 4LF9B 3R9WA 3DAFA 1WQ3A 1ORTA 3BBPA 1RS0A 4UTZA 3M4XA 1VL1A 4M38A 4UHBA 1P1FA 2NMVA 3KZ1E 2C61A 4M8IA 1KZYC 1Z2OX 3DBRA 4CKBB 7REQA 4D0SA 4G5SA 4LZPA 1XJQA 4IMPA 4ZO7A 3GRPA 4HLNA 1WB4A 4IDAA 4YP9A 1VKJA 4J43A 3IPRA 5L51A 1G5FA 1LC3A 2RHGB 2B4YA 2W6CX 4QDJA 5IC6A 2YIVX 4IW3B 4JXJA 4LOIA 2VJMA 4NJOA 4V0NA 4YXFA 1Z63A 2M2IA 1JIKA 4ZVOA 4B4UA 4XM1A 1QCYA 1JMVA 4LJKA 2C03A 2O2GA 3EVTA 1QYDA 2AOUA 2EJTA 1GGJA 3WIBA 4K3VA 3UA3A 1FS5A 1B2RA 1GFIA 2IE8A 3JQAD 2PL5A 4G9EA 4L73A 3P4YA 2G5CA 3VH1A 3VH2A 4JJZA 4EUKA 4HXEB 2BF4A 4PF1A 4I55A 2JIZA 4XWYA 3REQA 4Y1EA 3WGYA 4A5OA 1TVCA 1V8PA 1RBQA 2BKEA 3SIXA 3VA7A 3RQIA 1XD9A 4KKXB 2AR7A 1NUTA 1YZ3A 3EEYA 1NLZA 4YUZA 5CVJA 5AJTA 5TE9A 1B14A 3ACDA 3VDQA 3EDOA 1O2DA 3OE5A 2CT8A 4HVAA 1ZWKA 2PU7A 5CLLA 2CNOA 2GCNA 1AKTA 1SVUA 4KXVA 4CCSA 2Y1DA 3LXRA 4RA9B 1XD2A 4PPFA 4DC0A 3WA7A 4RWZA 3ANMA 2FR1A 1PQWA 1QFJA 1N2CA 4LZOA 2XYVA 3DOJA 4QWWA 4BWYA 4XZ3A 3VR5A 5CIWA 2CKMA 2WVAA 2Q6VA 3RHTA 4A5SA 3GRYA 4JJ4A 4ZCTA 4MPTA 4JLSA 1CR4A 5ELMA 4QJ4A 5HYVA 1GWNA 1PR6A 1LK0A 2LCFA 2WTAA 2XBUA 4DZZA 5IN5A 1PWZA 2FYTA 4HADA 5EHQA 3FE2A 4QXRA 3VR3D 3BCUA 2R3SA 2VF7A 5IVPA 3BD6A 4GGMX 1U11A 4QRDA 1X1RA 4ZIRB 5TX7A 1LVGA 2NXEA 3BL5A 5ICCA 2YMQA 5AJXA 2REBA 3P5BA 1E1QD 4GPTA 2RAVA 3P9IA 3R09A 1OYOA 1MHPA 2IPOA 3U48A 5HKOA 2A94A 5HUHA 3T5AA 2FG5A 4TV8B 3OMWA 1IE3A 1Q7TA 4YAEA 2JLBA 2HDWA 3PPIA 2NXWA 5CB6A 4KO3S 2ZIUB 2NZUG 2PM8A 4DKJA 5AI5A 1G5QA 2VXCA 5K3FB 1I6WA 3MELA 2QM0A 5F7JA 1P0CA 1JHXA 1E9AA 5JMOA 1JH8A 2AN1A 2VSOA 2J67A 1JXQA 1UH5A 4X6XA 5EXSA 3S4YA 1JDTA 1V3UA 2AA3A 2OBYA 4ZOLB 3UJ9A 3WISA 5KTNA 4S1PA 2EJCA 3LU1A 4FDVA 4IJWA 1T36B 4P7JA 5DEIA 3TL2A 2PANA 3ZD9A 3KALA 4UJ5A 2KBEA 3AQIA 4LK3A 3U3KA 1DV1A 3ENVA 1XV5A 5JC8A 2IVFA 3AG5A 5L45A 4PLTA 3LY9A 3TQTA 3QWHA 2OGSA 5EZ6B 3TMAA 3ZIDA 2FKAA 2XT0A 4ZJYA 4K87A 4P35A 1W1WA 2OO5C 2AYXA 4JP8A 4CI0B 3I58A 5AKIA 1MUUA 3DEYX 4LOHA 1LQTA 2VJMB 3M9WA 1T2NA 1XZLA 3STYA 3UATA 4PANA 4CIDA 3ILHA 2ETVA 4OFZA 3V7NA 4A1OA 3WRXC 3AVUA 1Y9JA 1Z5NA 4D8XA 3SC2B 5JMWA 4ENVA 3VKWA 3KD2A 5I9BA 3AJEA 5AVZA 3P9YA 3QA9A 4WZAB 1JBEA 3OBIA 4EB0A 3VTFA 2NO9A 3CLRC 5J9FA 4AS3A 1YC2A 3W4JA 1K6JA 2GF0A 2C3UA 5AVRA 1L1QA 1RWOA 4FYPA 4HB2A 3TQCA 1QYXA 2VPWA 4RHFA 1NPDA 4CMCA 5ECWA 3UWMA 2RI6A 3T3NA 2SNIE 1ZCFA 4BPBA 4LOAA 2HA5A 1QO7A 4CTKA 2J3HA 3LUCA 1R0KA 2HWXA 4MARA 4MVCA 1DO0A 3AM5A 3KP1A 2XQIA 4LCBA 1VB5A 1RLJA 2I7XA 5H9WA 3RVOA 1XJCA 3KJGA 2NZVG 3HLKA 5GVRA 5JDIC 3VOBA 3IILA 1T5SA 3HU1A 4IQ4A 2QKYA 3N2IA 4OQ4A 4RKEA 3RC9A 5BVHA 5IJ0A 1UK8A 2JC3A 3GELA 2OC9A 4I14A 1TYEB 3RVQA 2ZCJA 4TV9B 13PKA 4ZP1A 3VAYA 5LFAA 3RABA 2R6JA 1G5PA 2FW9A 3GUHA 1SC9A 2C82A 3DZDA 2QL9A 1N77A 3WYBA 1QORA 1RXSA 3AI3A 2I6UA 2PYIA 1WVMA 4RWEA 3QI2A 2XUQA 3PHGA 4LQDA 4U8GA 5LQAA 3K5WA 1G8YA 3O47A 3QIVA 4WY5A 2F1KA 2JIBA 4XCVA 2Z2ZA 4JH0A 4JLOA 1LV8A 1QIIA 1YJ8A 1OHHA 4ZODA 4UM7A 3LJKA 3PQEA 3F4KA 1POXA 4RPIA 1UUFA 4U6QA 3KYIB 2C2GA 3MWLA 4R2MA 4ZQBA 2VNKA 3S2GA 1K06A 5IYZA 1UPCA 1V96A 4DYVA 1TLFA 1RXIA 3CCCA 3LRTA 1OFVA 2XDQA 3OLCX 3EIXA 4QYIA 4QBGB 4AMVA 3R6GA 5EKDA 4IMRA 5F7XA 2V6IA 2VDNB 4GDMA 1XTZA 3ORHA 3K31A 2BGNA 2X7HA 3KSZO 3JQ6A 1N78A 5FNVF 1NBEA 4IIHA 4BMDA 3VOSA 4BMXA 6ADHA 4GE0A 4CQMA 3ZCSA 3TI7A 4BHTA 4C4SA 4ZYYA 1Q7EA 1YCHA 1KKUA 2XSZA 2W22A 3WGLA 5ALVA 5AVSA 1JA9A 3GWGA 4KBFA 4B7UA 5HFJA 2W6JD 3KOXA 4AY2A 5CFPA 2YV2A 1MO3A 3SU8A 1JFFA 3OX3A 3DQPA 1G9TA 1L0BA 2DHEA 3O2QB 1OMOA 1VJCA 4JOSA 4QYWA 4RTLA 1MG0A 2H2DA 3KT8A 1FFXA 4S05A 4Y9TA 4YRJA 1KSHA 2EJUA 3AERB 1XN1A 2JI9A 3FSGD 4IDEA 1H69A 1GRVA 5G4KA 4XVCA 2BF7A 2XUDA 4C7JA 2QMOA 3ADPA 1D2CA 1KJ8A 1UJ6A 4JI6B 4B3SB 2C57A 4XLZA 5KHOC 5F9MA 3LNCA 3LPDA 1DAIA 4YP6A 3C5WP 2GHRA 1GQOA 1O0SA 1YBFA 3I2GA 2DTXA 4G1UC 2QXTA 5EKXA 3VR2D 1M2NA 5JAIA 1M5TA 4JELA 1SELA 3L07A 4M54A 2CCKA 2HSDA 3CXUA 5DYTA 3EXHA 2CV1A 1PT7A 4PCUA 1AKEA 4QYMA 1UAYA 5DJ5A 5IANA 4FW8A 4ZCLA 3W5SA 3ORSA 1OAOC 1EBUA 3ZXIA 1IY1A 1EVYA 1XQWA 2GX6A 4B43A 1J1ZA 2QMEA 4HDSB 3N0TA 4IQ8A 2QG9A 2E21A 2J9RA 3IURA 4MUFA 4PC3A 4YUYA 2BT4A 1FDIA 2CDRA 2W4QA 3DA8A 3K1ZA 3TEJA 4RZUA 2HY7A 1WSAA 2PZ8A 3SJZA 3CJQA 4RZ3A 4DSZA 1E6EA 1HZZC 2LR0A 1USWA 2OENG 4R01A 2VCEA 4H9GA 3CINA 5KTPA 2GKGA 1E7RA 3PGMA 1G1MA 3H18A 2ECFA 2OA0A 4S1OA 3S2UA 5AUPB 1R4MA 4IR7A 1QBKC 4HDMA 4Q3NA 5DHAA 4EMUA 5A3QA 1SU6A 3W34A 1MX3A 2WM3A 2BEUB 3DTVA 3PTZA 3L1JA 4GRIA 5A4MS 4WKPA 3A9RA 1OKKA 2ZJ1A 2G63A 3FPHA 1GDHA 1K7CA 2L69A 1DT5A 1O94C 4GRAA 1D4OA 2QOEA 4MXDA 3VMMA 4C03A 5LM3A 3B7WA 3C5CA 4DOMA 1UIMA 1A7UA 1OU4A 3GJYA 2ATXA 2IOFK 3IVRA 5EAIA 5FOWA 1SQ0A 3PITA 2K87A 4PZUA 2X1MA 1V5EA 1DHTA 1VE6A 2M98A 1JQKA 2H7XA 2ZATA 4YUXA 5BR1A 1WU8A 2XNCA 3EB9A 3KTFA 3QYFA 2IU4A 1WHSA 2A88A 4RM3A 4ZICA 3FOFC 1AQLA 3LL4A 3GNTA 4RVCA 1T6NA 2CBGA 2ZRFA 3D4NA 4OFBA 3VZSA 2AOTA 5ISMA 1OROA 5L7YA 5EC8A 3I9NA 3PUZA 3PFCA 3GGCA 1EP2B 1UBOS 3COYA 1K8YB 3L7BA 1AXRA 4R1TA 1L4LA 1FVOA 1Q0HA 1IUOA 1M73E 4LMBA 5DOZA 1NRIA 1SXJD 4K9LA 5HZHA 2XUIA 1RLMA 3PB3A 5EJ5A 1KWKA 1R0XA 3FUUA 3PC4A 4QOSA 3EH2A 4L50A 4NOKA 4ZOEA 1QTNA 2QLTA 3PV0A 4QTTB 4QQRA 4W6QA 2BYTA 4MR8B 2ZYVX 1E0SA 2HTFA 2QU8A 3L7AA 4IF6A 4HSEA 3V4LA 3TTVA 1PI3A 5AOAA 1GNQA 2F8LA 4AJ2A 3DO6A 5E3JA 5AXAA 3EFHA 5FBHA 4FBLA 1RRMA 1GPNA 4CL3A 4PM4A 5IKOA 4Y2JA 5ESXA 1I51A 3B38A 2P4UA 5TF0A 1PJQA 1UQTA 1QONA 3IUBA 2ZUTA 3ROEA 4EUSA 4N9WA 4ZT5A 1EGMB 1PBNA 2BR4A 3MPUA 2GBLC 2QLJA 3FYTA 4MGZR 2EFJA 5HKAA 3SD7A 3VHXB 1GN8A 4HH3C 2C95A 1RKBA 1GOTA 1ZVJA 1PRYA 3GH1A 4J3NA 4BASA 1PUIA 4CM1A 1P8JA 3GO4A 5U4XA 3EPLA 2O1SA 1WXHA 2CSUA 2PUHA 4HAOA 3VSDA 4B3RB 4BZQA 4QFBA 4A2PA 5F1PA 5LP6B 2V6JA 3KHSA 2EAUA 1J56A 3KPUA 4KH1A 3RVMA 4LOKA 1CS0B 2D06A 4CFYA 3CWCA 5KO2A 2EIXA 5BP7A 2GA8A 3R8CA 1X8JA 4XIIA 3N3BC 5IP5A 4ENWA 2NVBA 2XVYA 3W3AA 3R7SA 2PCJA 3EOAI 4UDXX 5LDHA 2HGZA 5AHKA 4V0OA 5KQGA 4JV5B 3H9GA 1FLAA 4DLVA 5C53B 3CLVA 1NBMD 2R4UA 4O33A 4F97A 1JSRA 2GHIA 4REQA 3TX2A 2W2QA 1RPNA 2AD1A 1WZNA 2YVLA 3RUEA 4IY1A 4C5CA 3HDQA 1IN4A 3KT3A 4TTRA 3SS8A 1YVRA 3AR2A 4MCAA 5EJ9A 1TM7E 2J5BA 2Q3FA 3ESQA 3L18A 4O4LB 2ZJYA 2XTJA 2RD2A 1T1JA 2JJ2A 4DMCA 4EHLA 1OLUB 1DAMA 2IXTA 3GT4A 3H9EO 5BV0A 3GYBA 2ZYGA 3WL7A 4ZPXA 4R41A 1RFGE 3AETB 3DC7A 5DRTA 4CF4A 3U7QB 2KQUA 2NTVA 2YH2A 4LZWA 4YHBA 4EB6B 1O9GA 4Y2YA 5JPCA 1ZGCA 5AM2A 2ADOA 1O58A 4CF7A 1Y4DE 1KZ4A 3FI0A 1D2NA 1E7YA 2BLLA 3DJYA 3UAOA 2XUZA 5DTQA 3SEAA 3LPMA 1WSDA 2B69A 2B20A 3D7RA 2I71A 2VDUE 1SQGA 2FUG1 3HS3A 2ORWA 2W4MA 2I3DA 1CRWG 4HNAA 4QXOA 4BQNA 4YAWA 4NG4A 3RSSA 3SICE 4NICA 3F71A 3OCZA 4LYGA 4MRMA 4B6QA 3DBRB 2PUDA 3A70A 2B1RA 2FZKA 3QTLA 4FGLA 4OFXA 4CG2A 2R7KA 3GHYA 3SMQA 4CHTA 4Z2AA 5JJLA 4BJ6A 1TX4B 4UU7A 4B83A 4FMPA 1XA4A 3ONDA 5ALFA 3HUTA 2EW8A 3LHFA 3R6LA 4KWTA 2G4LA 2ATEA 1O3YA 2PSHA 4DLPA 5K0TA 3AW8A 4FBGA 4J2HA 1ISRA 2DQZA 3DZHA 3OIDA 4M9RA 4R8LA 2JFVA 3QRWA 1N4AA 5EJ6A 3ZD7A 4WBNA 1ZUNA 2A5FA 4XIGS 1G60A 2IPAB 4ZVRA 4E31A 3FMIA 1R66A 2UYYA 1KY4A 4WZBE 3I01A 1FFBA 1MA0A 1WQ4A 1MB9A 1ZD8A 4KITB 4Y98A 4YQYA 2YXBA 2PE5A 3ON5A 4BWFB 4WLFA 4O4JF 3O2NA 4PCVA 3H97A 1DJPA 1HG0A 1HT0A 1V8BA 2QP3A 3A3YA 2HQOA 5CT9A 2V8BA 1IEQA 3VJMA 4D3DA 4X1KB 1NULA 1SUSA 1SIOA 1P19A 1PJ4A 1QZ3A 1PHRA 2WILA 3EMKA 3R4CA 5HMMA 4AROA 1R0LA 5JSQA 2HQSA 3QWBA 2Y1XA 4M1YA 1V9SA 2FWBA 4HN9A 2BD0A 1Z25A 1L5LA 3OURA 2C7VA 3HRHA 4RGYA 1ECLA 1U4NA 5H68A 1JGTA 4V38A 3ZHOA 3TW0A 1U99A 1KK1A 1ZPDA 2IZZA 5EIXA 2PU5A 1OX6A 5ALLA 4RTKA 2Q2NA 3WRYA 5AXDA 4LQ4A 1GPKA 2BMJA 4OVKA 4JYPA 4U7JA 1S02A 3NHMA 1JIUA 1GL6A 2JHFA 1V3TA 3EAFA 2FMKA 1NC1A 2OBLA 3GAZA 3IO3A 3LIIA 5IMBA 3WWOA 1UEIA 3ZQ4A 1EK6A 1QR2A 2PAAA 5E3HA 4DM7A 1R0WA 3L7CA 4QGHA 4S1VA 4DEYA 1XYGA 1CD5A 1M6HA 1GGVA 1SN7A 2V7UA 3SIWA 3MK31 5EJMA 4NYIR 3KBOA 4EA8A 5K0EA 3GJ6A 2GXQA 1JQAA 1RWNA 1JQ3A 4C4RA 4O3MA 4JB0A 5IJ9B 4RIIA 2WSBA 4ASUD 5ED4A 2JS7A 5AUNB 3AF6A 1ZKDA 3LYUA 5F35A 2ATCA 4UVHA 2HW8A 3JQAA 4JKYA 2PBLA 1WEKA 4UREA 3FPSA 4LI0A 2J85A 3INNA 1DL5A 1J8DA 1ZL2A 2ZJ8A 4Q6WA 1UXGA 3VPFA 5JD5A 1GP2A 2WYVA 4HLUA 4MEJA 1DKMA 3I09A 3OBBA 4Q4LA 3CPHA 3ZZ0A 4RTRA 2EWMA 4FBMA 3UHFA 1SB8A 2Q5EA 2RHHA 2W8BB 2ZIGA 4HNTA 2WPDD 5EPUA 4PYJA 3VNUA 3OTOB 1BKDR 4OFWA 3K72B 4IIJB 5LNK1 3T1QA 3IKVA 3T8YA 3ZVMA 4W6ZA 3TAHA 1JFRA 5JSUA 3HJBA 3LY8A 2AFVA 1CG6A 1IB6A 3R9IA 3IEUA 3AEXA 3L1VA 4QOJA 4LKOA 1JECA 1CZKA 2IE0A 1OBHA 2QTVA 5AJUA 1YFZA 1RKQA 4J94A 4XXHA 7ABPA 4B3XA 4Z0TA 2HMAA 1IIBA 3CNBA 1VG9B 1V1MB 2ATIA 3FCAA 2JGDA 3HUDA 4U63A 1QWOA 1P0PA 1XRQA 4KQGA 4EDFA 5KTRA 4D81A 3HYLA 3ASVA 4HNVA 2VHVA 4QM7A 4DCVA 1JDBC 4DAOA 4LRUA 1BWSA 4MQMA 5DW0A 3TBHA 4F9GA 5KJFA 1SWWA 4RSHA 5AW7A 4UOEA 2Z2KA 2ZJ6A 5F52A 5JNSA 2I2WA 3WWZA 2A59A 1M2WA 2OGTA 2X1VA 1EK5A 3FAZA 3HXPA 3E53A 4WXMA 2QMHA 3Q41A 1U2TA 3COPA 2JGMA 3W2GA 3FNFA 4C7BA 4BDTA 2ORYA 2GARA 3M4NA 3THXB 4R1LA 4WJZA 1UBLS 5FTNA 2VHUA 2R0QC 3R0IA 3JD4A 4FS3A 1ULUA 2H1CA 1V1JA 2NVWA 4TXLA 4TYWA 1AGRA 1E94E 3FHJA 1R88A 1ZJ5A 3G2MA 2X5OA 1CY4A 3RWOA 5JXGA 1Y1TA 1ZN8A 2R5WA 1NW4A 3MUEA 3OUTA 4I6EA 4IDPA 4U9HS 1GAXA 2OAP1 4RLHA 5GQSA 4RFSA 3VHRA 3ANLA 1ZO8A 1X8XA 3WMGA 3ZIUA 3KHTA 4DLRA 1P7PA 3GF4A 5DYIA 3TGPA 2H4XA 1KI6B 2XI4A 4MVJM 1I7SB 3PEVA 3LX6A 4GO1A 4NSNA 1QSGA 1SXHA 2ZANA 2E4ZA 3A25A 2AVNA 4J9UE 1E2FA 5EGNA 4C7OA 5MN5A 1RMQA 3KSAC 4UM5A 1WMBA 2P90A 3ROXA 3B53X 4Z86A 2WYWA 2EZ4A 3KOWA 4INJA 2ZYUX 4NAUA 3SC3A 1IN1A 1WVGA 4LYHA 3AFHA 5BYAA 3VJLA 1OWMA 1TVMA 4UZFA 4KQIA 1YS7A 3F47A 1OV4A 3ORYA 1GGFA 2OXFA 4IDNA 2OCBA 4Z4EA 3OU7A 4QSHA 1V3VA 4YAFA 5FIUA 4BFYA 2AXQA 1FNMA 3F9IA 4UMVA 1DFGA 4IXNA 4QD3A 5DI3B 3QSGA 4MCIA 2WF5A 621PA 3IQZA 3R41A 4GBED 1HQYE 2QTTA 1XTPA 5GGYA 4DVJA 2ZG6A 1KQPA 2DPLA 4N3GA 3I30X 5AVTA 2HU8A 1QG0A 1SM4A 2Y6VA 4L9RA 3OPQA 2O05A 3WB0A 3WS7A 3E27A 4KO1S 1LBIA 1MTOA 1WB9A 5ARCA 2JJ1A 3K5PA 4LDAA 2I2FA 1CULC 3KZCA 3GCGA 4LXGA 1U9IA 3CF6R 1LWNA 4R7TA 3C7DB 1C14A 1K2VN 1IZ7A 3ZK9A 1JG2A 3L7KA 2LE0A 4PTLA 3UYLA 1F3OA 1Y7IA 4XOUA 5IAEA 3ND9A 5A02A 4FSXA 2J08A 5IM5A 3TFQA 1I7PA 4J1SA 1WLYA 3LZDA 3B51X 4H77A 4DSNA 1LPNA 3EA5A 2XT9A 2L0XA 3GLRA 5HJ2A 1QQBA 1I3NA 2W2NA 3HYTA 1VJ1A 3IIIA 3EOZA 1TQ8A 2QVYX 3OJCA 3VGPA 1PLLA 4B32A 4DIOA 4AJLA 1RI2A 3ZDXB 1C3VA 2O1WA 3EW7A 1K7FB 4I1YA 4LE0A 4MYTA 1YQ9A 2HQ1A 1SD2A 3CVOA 1JJVA 4I9HA 4XGRA 4XJTA 2AXPA 1KNXA 3V1KA 5FLKA 1DAPA 4A8PA 4UTRA 1VE7A 4JJEA 3H5WA 3ML1A 4Q16A 1GA4A 4HCJA 3UTCA 4CG1A 5AUOB 4GLFA 4Z9AA 2RARA 1DBQA 4HZGA 1ADYA 2OCAA 3ZCXA 3AVTA 4J0GA 3AI2A 4EGCB 4C2UA 3WYAA 1ZGAA 3ZW7A 1GG8A 1YL6A 4REOA 4D9JA 4YMLA 2IYOA 4IFEA 2RG7A 1TAGA 1A8SA 2Y9PB 4OSEA 1EWTA 1KMCA 1FX0B 1ONOA 2TMDA 4JMPA 1KFJB 1CJVC 2IOFA 3EODA 4IQ0A 2VHEA 4MWOA 1QOPB 3K1TA 3KXLA 3MSCA 4IHJB 3RYHA 1P9OA 1R4AA 2ZU0C 4LWPA 3GRKA 3ETDA 3W8EA 2ZUEA 3Q15C 4B09A 3OH8A 2GPWA 4ZIRA 4LF5B 3LT5A 4QVGA 4F4CA 1M7BA 5D3ZA 3SLGA 1Y1KE 2HFJA 4ZEVA 4RJ2A 3DEFA 4MDYA 5DX1A 3WRWA 4HDKB 3TQIA 4BGVA 4CQJA 5JTTA 5K6AC 5TARA 1UOQA 3ITKA 4XM2A 1OPRA 4D43A 3QW4B 1P5JA 1U9YA 2AZTA 2VF2A 2RKWA 4YT8A 2ZU6A 3C6BA 3R6WA 3OJXA 5ALDA 5ICMA 1QLWA 5HIMA 1IMJA 5E2BA 4X5OA 3H0CA 3AFNA 3FCOA 4HB0A 2IV7A 2JCGA 3FRJA 1DGQA 2F00A 3HA2A 1O8CA 4JKOA 5AKLA 1I7QB 1QHHA 1SZCA 3FRIA 1L6RA 1PF7E 5KTMA 2KMLA 3LW7A 5EXPA 5CGZA 3WKDA 2M9MA 2ZFUA 4UM8B 3SHOA 5BSFA 2B2CA 2CFRA 3FCCA 5EMNA 2RE8A 1UAGA 2YFHA 3W5BA 2PAFA 2NAFA 3BWCA 1QXSA 1V2GA 4E22A 3MD9A 4DC9A 3PE3A 1BWQA 1UT5A 1YBMA 2Q5FA 1KRXA 3EHEA 2XMPA 1IWOA 2HMUA 4PAGA 3V8EA 3WP1B 1P1CA 2FPGB 2ZJ7A 2F43A 1ZCJA 3EARA 3RJ5A 1YJCA 4U39A 2X13A 1IEVA 4R7ZA 2COEA 2EBUA 1RM5A 5CXSA 5D3KA 5K5EA 3O9ZA 1Y9DA 5C31A 1UKBA 1FQKA 3MWGA 3SAJA 3AEUA 2FRXA 3TAXA 3L6RA 4HNRA 1KAOA 4LDRA 1X1BA 4OQQA 2R2GA 2J5XA 4Y2VA 5EVCA 3SLKA 2JLUA 2J0UA 1MV5A 3DEIA 3K1AA 1PJ8A 1ZUWA 2GS9A 1RBZA 1X6VA 4JT8A 2OORC 1S2MA 5KWEA 4A6XA 5AQ1A 3EG5A 1VPWA 3IDQA 1YOVB 3KTDA 1P77A 4BO0A 1FRZA 1FFDA 2GZAA 4QPZA 1M2FA 2G07A 4LJYA 1O5OA 4Q9NA 3H6KA 3V6MA 4HDMB 3O94A 3CIOA 1XVIA 1QJCA 3FKJA 5DXFA 3FGPA 4ZU3A 4L27A 4NKRA 4ABYA 2DWUA 5EE3A 5A4FS 4FDMA 2JIRA 4YWJA 3RIYA 3IJ5A 2WC1A 5EXTA 3QEBZ 4LJ9A 5KNBH 3A1EA 4DSOA 1E1LA 4HX2A 5KYKA 1F5SA 1O03A 7GPBA 4Z8YA 3PNQA 2XJ9A 4KWHA 1VXOA 1YMVA 2WMDA 1I6LA 5A5GA 1UANA 3W9BA 4TTSA 3VNSA 4PLWA 3VBEA 4C14A 3HP1A 2YFYA 4HR7A 4QUKA 4P5DA 1I6KA 2NSDA 2JZNA 3ZTYA 1OC2A 1M2GA 2KPOA 1JR2A 1U2QA 2V7XA 3KR9A 1KOJA 3NWEA 4V24A 5YASA 1C2YA 2P4QA 1PAUA 1PZEA 3N8IA 4QUJA 2VH5R 3HVJA 3MT8A 2PX3A 4R1OA 4DT1A 2V6FA 2WHQA 3QITA 3B2NA 3IS3A 1DIBA 2FQXA 3OEWA 1N75A 1P3DA 3GI1A 4AX4A 2PG3A 2XTZA 1QWSA 4J0HA 2NADA 1AUQA 1QHSA 1WMEA 2C9ZA 2BGKA 1JG1A 5LQJA 2Z6QA 2WOJA 3MB5A 3ELWA 4AJ9A 5IEJA 4CFSA 4BMYA 1B42A 1V4VA 3ZY6A 1KDYA 1W88A 3PXCX 1EHCA 3ZGYA 4RTPA 2YVUA 4ISBA 4L0DA 1G8FA 4RE5A 2YTZA 4F8JA 1I7NA 3LKDA 2C4WA 1Z34A 1KZGB 2VL7A 1JFFB 2EDAA 2QYSA 3LUJA 4A8JA 3WDLA 1XF1A 3KLMX 1W4RA 3W5JA 1H1LA 1EH5A 2LKCA 2YMLA 3LQ2A 3MCAA 4R2HA 1M34E 2J3EA 3TRIA 4HNUA 4ZRMA 3WLEA 3IE1A 1Z45A 1M2JA 2EZ8A 2BUCA 4TX1A 3N2GB 4EUEA 1SA0B 3U16A 1PG5A 4QO7A 4D92A 1HI9A 3ZWNA 4OHUA 1UBSB 4F3RA 1EIZA 1GZ5A 3LZ6A 1Q57A 5FYQA 2ZI6A 1V7CA 3E1SA 1VBMA 4ZI7A 1L4UA 1SHLA 1Z8NA 5H59A 3WFIA 4B33A 5B7PA 1RVV1 3ABQB 4WNAB 1EUDA 2ZS7A 1DDGA 1F0KA 4ZOBA 4BEJA 1WCIB 1RWPA 1H6AA 5EWLB 3C4VA 3VU0A 1KZ9A 3KV1A 4P4TA 4GXQA 1UMCA 3HE3A 4B17A 4YT2A 1RQRA 4Y6GB 2ONJA 2IGTA 2NSHA 4EH1A 1WZ2A 4Q19A 4H4CA 1QVZA 2CLEB 1NZFA 3K6SB 1EUQA 2ZSKA 3O0DA 2TMKA 4U9UA 3EW9A 1JJ7A 2WU0A 2JFQA 1M74A 3Q98A 4O4LA 1LNSA 3QFSA 3SKVA 2P9EA 5BR4A 3N2ZB 1OOEA 4LEIA 4NZYA 3WA6A 3Q85A 4D1YA 3NDJA 3PQ3A 3ESYA 5TV2A 4OQZA 3KOMA 2WG2A 4E2WA 3KX2A 4QATA 4XX1A 1NW7A 1WZEA 2O8CB 3OOWA 2ACVA 2VPQA 1EK2A