5F3HA

Structure of myostatin in complex with humanized rk35 antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
207
Chain Sequence
LLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISSGGSYTSYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKQDYAMNYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/immune system
molecule keywords humanized RK35 antibody heavy chain
publication title Beyond CDR-grafting: Structure-guided humanization of framework and CDR regions of an anti-myostatin antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 207
sequence length 213
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f3hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f3hA01
1YYMH 3I9GH 2IBZX 2PW1B 5CUSH 4RZCA 3EO1A 5DUBA 4RRPA 4YBQD 5JHDA 2WBJC 1CGSH 3QXAA 4OZHA 3PHSA 2GKIA 5TE7L 2ESVE 1BFSA 1LE5B 1OAZL 4QTIH 4GAYA 1HSBA 1NLBL 5GGRA 1W2KT 4ETYA 2W59A 2W9DL 1FG2A 4UAOC 5FEBA 4DQOL 2EIZA 2PR4L 2OI9B 4F7CA 4EUPA 6CGTA 5EZOH 3V8OA 1G9ML 3NFSL 2IPKB 1NUNB 2V2TA 4ODTH 2QSQA 4CKVX 1RUPH 3SE9L 4QGYA 2YPVL 4Q2ZA 5IGXL 4RAUB 4G8GD 2DWEB 5D1XC 3KDMB 2YXMA 4JDTH 2XKNB 3E8UL 3MO1A 5I2IA 3C5ZB 1I7TA 4G3YH 2MCPL 5DJDB 5HGBA 3HE6B 1JGDA 1OQOA 2H9GA 3L95B 4PJ8B 2W0LA 1U95A 3S96B 4TN9A 2XKUA 4NQUA 1H3PL 2QQNH 4U0RC 4X80L 2P8LB 1WBXB 4I3GA 2YWZA 5DHVB 4PJAA 1VFUA 3V6OE 3NA9L 1AD9B 3FN9A 2YZ8A 4E42A 2XTJC 1DFBH 3P11L 1YQVL 2R0WL 1N5AA 2D31A 3JUYA 1BVKA 3SDXE 4JZNA 1DLHB 2EDRA 3RTQA 3IDYB 3PHOA 1IRAY 1OL0A 5TQ2H 1TZIA 2HTLD 3O6LL 2CRIA 4KKBC 3BZEB 4MA3B 2X4RA 4UV7L 2N1KA 2WUCL 1MHEB 2VABB 2BVTA 4RIRB 2GK2A 4DGVL 3DYMA 4P46C 1HXYB 1A6ZB 1J7VR 5D5MB 5E6IA 3D25B 1AR1D 1AHWB 4UQ3B 4D94A 1F45A 5C0ND 5GGSY 5LXGH 3ARPA 4JQXC 4H88H 4H25A 1U6AL 5GS2H 3LHPH 3ZE2F 2VDPL 4F7PB 1JTOA 1W8OA 5B8CC 2NY5H 3E2HC 1PQZA 1SJEA 3I02B 1QVOB 4O5LH 3T0EC 2IBZY 3QG7H 3R06B 2P8MA 1JUFB 4ZO6A 4NZUH 5FUOL 5B22A 1UG9A 2G9HB 2R56H 4Z6AT 1QFOA 4NCC2 5IBLD 2FCBA 1HHKA 4JRYD 1ACYL 1PX3A 2BSTA 3DETC 3JUZA 4TSCL 5GRVK 2B5IC 4YQXH 1A5FL 1MCFA 3BDYL 1VFOA 3FQRA 4NO2A 4WHDA 5CBEA 2CMRL 1XCQA 4XXCC 5MP6L 2XWJB 1AC6A 1CDIA 3QNXB 3UC0L 3O6FC 4YR6A 3Q3GA 4KJQD 4ZXBB 3DMMA 4M93C 2RFXA 2CKBB 3GSXB 5DD3L 1A6UL 3V8CA 2OLDA 5F97E 5BW7A 2YRZA 5FYJH 3KPOB 1NSNH 2A1WL 3GSOB 3MRKA 5DLML 1P1ZB 4I0PD 3W2DH 1EFXD 2ADJB 4YHIB 1D9KA 5CLWA 1UZ6F 5FM5M 4M5ZL 4Z7OF 3RIFF 3G6DH 4PP2A 3KAAA 4XBGB 1EUTA 5DQJB 2R23A 4XPBL 5D1QD 5GS0H 4LCIL 3ARFA 5IV2A 5D71H 4JZJC 3QEGL 4EN3A 3C9NA 4AK1A 2EDYA 2OXGA 3LS4H 4XMKH 5BV7L 3D0LB 1DBKH 5HY9A 5DUMH 3RBGA 2AABH 3C5JA 1ZMYA 2V5TA 1DQDL 3TBWB 3ULVC 1CXKA 5I8OH 2IH1A 2A6KB 4XNQA 2FSEB 1FZMA 1ZXQA 5D5ME 5BZDA 1MAKA 4MNQA 5FIEA 1F2QA 4R26H 1S5IL 1QYGH 4NUGH 3QIUD 2F58H 1KCVH 5IF0A 5IVOA 1UT9A 3IJSB 3QDJB 3MV7A 4G5ZH 2X4QA 5D8JH 3WNKA 3SKJL 3CCHB 1XGRA 5IFJA 4HDIB 1SYVB 1NC4D 5C0BB 2IAMC 1U3HB 2GT9A 4OD1H 4X6BA 1EZVX 5KVEL 4NO5A 5I75C 3BP6A 4IDLA 5GRUH 3R1GL 1JRHL 2UUDK 4NQEB 2BNQA 5DR5L 3TBVB 4OTXL 3HLAA 5SWZB 4PJDF 5F70A 3S6CA 3AY4A 1Y18A 1C5BL 4X98B 1S9YA 1T04A 4TRPL 5IK3B 4J3UA 5LVEA 1LK3L 4U2ZA 3RWCB 3ZYIA 3UO1H 2BMKA 4LNRA 3U7WL 5J12C 1CTOA 4UQ2A 5GRWA 3VI3E 1YEKL 4Z5RA 1FFPB 2EYSB 2J8UB 5D93C 5FA3B 3IFPB 2EYTB 1WIPA 4ODSH 5C71A 3PWVA 2FLRT 4Y5YC 4YE4L 2VAAB 3NZ8B 3BGMA 4X6CF 2X40A 3LPFA 4W81A 3HZYB 2XZCH 1GOFA 3P77B 5DEFB 1M6OB 3HC3L 3DGGA 4DKEL 4PJBA 4F3FA 3BP5B 1AI1L 3U4BH 4Y1AB 4YHML 1E4XI 3R0MA 3I2CL 4HUXA 4AG4L 5H94B 5JNYA 1XR9B 4X99A 4U1HB 2FEEL 3VRIA 2VDRL 3QCUH 3TVMA 5IOPB 1G7JB 1Q9OB 4JPWH 3SE3C 4NHUB 2NXYD 2Q7YA 3HA0A 2YPKA 3QDJE 3U9UA 4H8WH 2JJSC 5D1ZB 1D5ZB 1NCBH 1UXWA 3BKCH 4PLOB 5C0BE 4WU5B 4P2OC 4G8IA 4JLRA 3VD3A 4FQCH 3W0WA 3T1FB 3QUXA 3D48R 1R3KA 2A74B 2NY1D 2X9YA 3IDGA 3WHE1 4YHNB 4XBPB 1FORL 4JQIH 2UV3A 1TVHA 4KRNA 4PD4J 4NQEE 2C3VA 4IIQB 7CGTA 7FABH 5HPMB 1U8MB 5J4MA 4LSVH 3NGBB 1JP5A 5SWZE 4YBLC 1IEHA 1LP9B 1IARB 2FD6L 3QQ3A 1OT1A 1CF8L 4NDMB 2JCCB 4XCCL 1RIHL 4UTBH 4UOW0 1ORQA 2MKLC 4QHNB 3SY0B 4JY5L 3MLPA 2V7HA 4XPFL 2EE3A 1KN2L 2DLEA 4GG8B 1QSFD 1JHTB 3KJ6L 3GI9L 3VDCA 2J8UE 1VESA 4HF5H 2VOTA 1FP5A 2XZQH 4P3CH 4PRAA 3VWJC 5L2JA 4L8SA 1PG7W 3MRHA 2P46B 4JRXD 3L3KA 3VGHA 5IUSA 1RZ8A 1EZVY 4HK0B 3CSBA 4U1LB 4X4XA 3VU2A 5I71C 4KFZC 2V5YA 4HIIA 2FATH 1ZK9A 1TQBB 1FZJA 4L8CB 4WIQA 1C7TA 3MXVL 4Y1AE 3IYLW 2W0FA 3VGGA 5CLTA 3MRCA 4G8GB 2DICA 1V7NL 3TIDB 3OPZH 1L7IL 2ITCB 1U3ZA 1KIQA 2C3HA 1MLBA 1BMGA 1UWEL 3NACH 5DEZA 4X4YB 4JHAL 5ITFA 1OP3H 3MCLH 1FYTB 4XAWH 4NNXA 5C92A 1N59A 3GBNH 5EFIA 4M8VA 1S78C 3F8UB 4M6NH 1GGTA 4HEME 4KGJA 1J0IA 2DBJA 4LSDA 5T1LA 2X6MA 1YUHB 4U1NA 1A22B 4HH9A 4WEBL 4ZFOL 3LSOA 5E8PA 5MEQB 4UB0L 3FOMB 3ZHLA 4MMXC 4MX7B 4OCYH 3EZJB 1RURL 4XCNA 1WT5A 2CIIA 3HE7C 1NGPH 4G80A 3F7VB 1LP9E 5I9QB 3SDCC 3T3PE 1S7XB 2JCCE 1ZLSH 2PCPB 1AGBA 3OF6D 5IMMB 4BH7B 2DLIA 2R2BA 3X3FL 2F54A 2Y7QA 3O0RH 2FR4A 4NCDA 2Z4QB 1AJ7L 2BDNL 2GTZB 3WSQL 2YA2A 1A4JB 4EDWH 1DBJL 5IROA 4M6OL 2ZKHH 3I75A 5GQBA 4P57B 2XXMB 3TBSA 5KN5B 1E4KC 4YDJA 4JM2D 4KI1A 3MV9A 1ETZB 3CU7A 1A9EB 1Q0XL 1IAOB 4WW2F 2Z31C 1FO0L 5GS1B 4HC1H 5TE4L 3HNTL 3VGFA 3G5XA 5F7EL 4OKVB 2WNGA 3N1GC 2ILLA 4RX4A 1KIRB 5GS0C 1YPZA 1P7KB 2N7BA 5FYLE 2VIRB 4G8FA 1FYTE 4LVOB 3TNNA 4HWBA 1T2QH 1F58L 3IXAB 5FHBL 1Z5LB 4Z77A 4UI2A 2GSGB 3QWOA 4AEFA 5KSAD 4P5MA 3KYOB 1AIFA 3MJ7A 2J8HA 2R8SL 4X8JA 3VFSA 3ARDB 1G7MB 3S5LA 3D87B 4XVTH 1N64H 1BECA 4OLZH 3F58L 1EBPA 5JZ7D 4R6UA 4ODWA 4Y8AA 3IKCA 3B9DA 2HFEB 1CG9B 3V6BR 2EC9U 4JFQB 2FBJH 5F1OB 1HHJA 4XZUB 5EOCJ 4F57H 1EFXB 3WLBA 2I9LB 1ES0A 4YHZL 2C26A 1ZVYA 1K3IA 4MCZB 1FNAA 5TPWL 5BRZE 5D1QB 1INQB 2JB5L 1JZ7A 4WWID 1PG7L 1U2HA 5K93A 4OZFA 3LVEA 2VH5H 1IEAB 2GSIA 5TJWK 3RRQA 3V6FB 3MBEA 3TP4A 2IQAB 3HI6H 4L4TA 1BD2B 3MNVA 4U7MA 4PGZA 5GIRB 4A6YB 4YXLH 4BQ6A 1FBIL 4O58L 3DUUA 3FFCA 3QIUB 4FQXD 3TYFB 3REVA 3C2SA 1NGYA 4YFEA 1BFOA 5BJTA 1J0YA 4G9FD 4PR5B 1KPRA 5EORL 3NIGE 4WU7B 5DJAB 1CN4A 1AGDB 4TTDC 2P45B 4Y4HD 4WI4A 5HDQH 1U0QA 2LU4A 4BZ1L 4Z95H 4ODVH 3V52L 1N0XL 1AQDA 1RJZA 5F7MC 1UZ8A 3OSKA 4XH2A 3HAEB 3FO1A 1OW0C 1VADA 2C7UB 4QRPA 4GRWH 4NRYB 5EDXA 3DYPA 2FNBA 5IJVA 3HCVA 2F5BL 2NXZD 3ILQD 3L5JA 1NFKA 1G7QA 5FHAH 1H3VA 4M9PA 2EDFA 1UC6A 5I1AB 1MJ8L 4PGJA 3WBDA 1JWUB 3C08L 2C3XA 2FB4L 1EHLH 1FPTH 4N8CH 2DQTH 4H8WC 1CBVH 4JG1L 5CP7A 3VXRD 1KJVA 1UWXK 2BSSB 5E6ZA 2QV2A 3Q6GH 3BRFA 4DUVA 2A83B 1HH9A 3JV6A 3BH9B 3ZKXC 3ZE1E 1XGUB 3Q1SH 4WUKH 2ICEA 3W81A 2W0PA 3MCG1 2O93L 5I8KH 5DJ2B 5LQBH 1NCDH 3D2UD 4TVPE 5BO1L 4LHUB 1U2CA 4XPGH 2VDNH 1NGXA 4K3GA 5DMGC 3NCJL 1IM9D 2AJSL 4QRRD 2ZSVA 4QRSB 4EDXB 4V2CB 3WIFB 1MIMH 1BD2E 3WN5C 4Z7WA 4GG6F 2P5WA 3JSSA 1RZ7L 1VERA 4IJ3C 2WM0A 1ACZA 1MCQA 3AB0B 5A16A 1TFHA 2ITDA 4MD5A 2Q1EA 3L6FB 2IG2L 5E00B 3HC0B 4LLUB 4D0BB 2Y9RT 4G6FD 2ZUWA 3VXMD 4N1HB 5MEPB 4RA0C 3WDHA 1NUFA 4NT6B 4QRTA 4WI2A 2BOCA 1NMBH 4N9GB 3MRJA 2DQIL 1NGQL 1F97A 3ME0A 1LDPH 2BC4B 2NY1B 3RTQC 4XP4L 2HLAB 1YQ2A 4G9DA 2DQFA 1Q1JL 3EYQC 3T0WA 5MHSD 2PUQT 3KPSB 2AJVH 4E41A 4LIQL 4KPHH 1CFVL 3GEWB 1BEYH 2CLRA 3ULUL 5LKNA 3A67H 3R0NA 3HR6A 2BY1A 1OB1B 2DM4A 1J0JA 5I8EA 5D7SL 5E2TH 3BN3B 4QRQA 4NGHH 3HTLX 1T1XA 1QRND 5J0BA 4KMLB 1LO3L 2EZ0D 4NHCH 2E8ZA 3SGJA 3DLQR 5D1XD 5EU6E 1PY9A 4WFED 1K4DA 1QSFB 3M17A 1T03L 1K8IA 3G5ZB 4Y16A 2HRPH 2R0KH 4PYHA 3PDDA 1FSKC 2ZG2A 5F6IC 4FQJH 3UBXI 4O2FA 4J4PA 1VFBA 3PXJA 1CGSL 4JRXB 5C0FA 2M1KA 3DVFA 4JY4B 5ANMA 4OF6A 4HPYH 2VXTL 4X6CB 2QSCL 1REIA 2WLYA 2OR8A 4HFUH 5GGVL 2DQHH 4PRIA 1EEYB 2CPCA 3Q5YA 1FNHA 1U42A 4PRPB 1EAJA 5JIKA 2AK1H 3VCLA 4ZQKB 1AY1H 3T3ME 4I9WE 1MRCL 2FHBA 5D72L 1AGCB 4KKAC 4WFHD 2OK0H 3SKNA 2OTWB 3TT1H 2J88H 3U82B 5BW7C 3QIWA 1RUPL 2IAND 1VEPA 3AS2A 1EO8H 1G0YR 5DQ9A 4O2CA 4M5YL 1D9KC 5EN2A 5HD8D 4Y19B 3OAZK 4EIZC 4P5KB 1ZTXH 2BNUB 5FK9B 1DL7H 4R0LC 4G3YL 2FBOJ 4EN3C 3KPSE 1KCSL 1A2YA 4P59L 1D7FA 4HWBH 3NIDF 3V5KA 2MKWA 1QLFB 2QQNL 4FMFA 1RVFH 5BV7B 5HHMB 2JK5A 1NCUA 2BOBA 1LD9A 2OR9L 2F74B 2P8PA 1B0RA 1PZ5B 5IEKA 1KB9J 4WWKA 2CO7B 3MGOA 1JZ3A 1QSFE 3KXFA 2OZ4L 4Y5VA 1IL1B 3ILPA 1MFBL 3WEXA 4UT6L 3D39A 1BBJA 5E99H 1EDQA 1FL5B 1WFTA 3TV3H 2OR7A 2AK4D 3FB8B 1ROWA 2XG4A 4DN4L 4JRXE 2X4SB 5C0AA 4CMHC 4JM2B 8FABB 2E7CA 1ZHBB 3D5OF 1BGXL 5FGBA 3SGKC 5LWYH 4HV8A 1H3WM 3RDTD 3U1SH 2OTUA 3HKFA 5C86A 1FRGL 3BVNB 2H2PD 5EB9A 3ULUF 1NDGB 2IH3A 4R4BB 4PRPE 1LO4H 2X1OA 4NKDB 5E24E 3QIBD 4FQHB 2HT3C 4QXGL 4F7TA 1TMCB 3W11C 4MZ2A 1CU4H 5IESH 4RMUA 4GQ9L 3V0VB 4JAMA 4YHYB 4XWOD 1U9KA 2G60H 1KIUA 2FIKB 5KSAB 1ZAGA 2A6IA 4Q74A 2I25N 1AXSB 3O11B 1QSEA 3HZVA 4Y19E 3STBA 2PTVA 2B1HH 3NAAL 4ODUA 4WV1A 1CE1H 4OZ4A 8CGTA 2AEIT 1MCWW 4GRLA 3VW3L 1CFNB 4PJXA 3M07A 5EO1B 3HR5A 3FN0L 1RZGB 2HJFA 1E6OL 2PYED 1BVLB 4KVCH 4OFDA 4BSWB 4Y4KD 3U48A 1N4XL 3PV6B 3MRFB 5AAMA 3S4SB 1AQKH 1QKZH 5BQ7B 2DJ4A 4JN2A 5HHME 1CL7L 1HNGA 3TVMC 1JN6A 5J1TC 3P4NB 4X0KA 1RUKL 5LG1A 4GXUN 5FCSH 1R5WB 1JHKL 2XFXB 4GOSA 3MRDA 1XF3A 4M00A 4NZRH 1PKQA 2DJSA 4I5BA 3VWKD 3W9EB 1G84A 3LPWA 4MS8C 4GXVH 4PIRF 1JHLL 4FQXB 2D9CA 3VG9B 1EAPA 4JFED 5F96H 5DMJB 2KQNA 4N0FA 3TWCH 3LS4L 3OKDA 3FRPA 1DBKL 4XB7A 4PLNC 3HMWH 4KTEL 5DUML 4ONGH 4JHWH 5T5NF 3KPNB 2VITB 3IF1A 3KPQB 5J56B 3GMPB 5GJSL 1HOCA 3QR2A 1VCAA 1KB5A 4WDIA 4OFPA 1W72L 3UTQA 1K6QH 2AJXH 3ULUD 4K3HA 3MOQA 3TPUB 3OXSB 3PQYD 4EJ1C 2VLLA 2ZPKL 3NCYP 4LVHC 1A3LH 2DTSA 4A2LA 5GZOD 3GJEB 4PLKC 1DJSA 4OLWH 3RWJB 2DQUL 1IBGH 4LP5A 2YK1H 2JF1A 3JTSB 4FFYH 5BS0E 2NXZB 2BCKB 4TTGA 4W6WB 4L8SC 3RKDC 2X4OB 1S7RA 5F7UA 5GRUL 5IB3B 3MBXL 1IGML 4WI6A 5EG6C 5C07A 4Q6IA 1D5BB 3AROA 3U7YH 3KYMA 2ZCLL 1KGCD 3MOAH 4NQCA 1A1NA 3UO1L 1T1ZB 5DWUL 1SJHB 2YEZA 2NW2A 3MOBL 3UTZA 4AIZB 5DC0A 4X7FC 4FHBD 4AMKH 1IM9B 5JORB 4FA8A 4P2RA 1Z9OA 1J05B 5DSCB 5FGSA 3LV3A 3G08B 2AJYH 4S1DD 2ZJSL 4M02A 4NQDA 2LAAA 3B5TA 1KF9B 4BELD 2OP4H 3RPIA 2YBRA 3DO7A 2DTMH 1QFWI 1JK8B 4JR9L 4G6FB 2VLMD 2DM7A 4PJEA 3VXMB 5FO7B 4ZFOB 4EVNB 4ZOAA 1W0WB 3BESR 2DF3A 3T0VA 4LCYB 1T1YB 1YJDL 5FDWA 2X4UB 2XQBH 3ETBF 4JPWL 4NYLA 3Q5TA 4F2MA 3ABZA 5HHVL 1JVKA 5IMOA 4W4OC 3W9DA 5F88B 3RWDB 1UJ3A 3X3GL 4F15C 5DYOB 2Y6SC 4Y2DA 5JOFA 4QHMB 1NAKH 4FP8H 2XWTB 4NIKB 5CINH 1HHGA 3ZE0F 1XGQB 1K4CB 3OR7B 1MVFA 5F1SA 1FNEB 2C9AA 4LKXA 5T1KD 4PS4H 2P42B 3JWNC 1P7QD 3EJZD 3RNKA 5D1XB 4L3ED 4LF3A 1A6AA 2OJZH 1I1AD 4LSVL 5H2BB 1TVBA 2QQLH 5DJ8B 5J9PB 3V4UH 1PY4A 3BIKB 3RHWF 12E8H 1FVEA 1S78D 3HAEG 4UTAH 3V0WH 5JXED 2BXZA 3OGOE 2R39A 1FO0B 4J3XA 4JFPB 2H1PL 4MDJB 3TO2B 5KOVC 1EGJA 1G7PB 4RFNB 1WBYA 4PJ7E 1T3FA 4NNPL 4NO0A 4CJ1A 3MFGB 4GW1A 2WK2A 3RI5K 3BP7A 4F37K 3OX8B 4XGZA 2OL3A 1MLCA 3RGVA 5E9DD 4E5XB 4Q6YA 5ESVA 2N56A 3RIAK 4HIEA 5HI3D 3QDMA 5IMKB 1HYRC 4GG6B 3NCEB 2CKNA 2GK0B 4X5XA 2V17H 1S7QB 5J11C 5C09D 3QHFL 1J8HD 1N5YL 4JG0H 1CXIA 4Z7NF 2IANB 4JFDD 3VXME 3GMNA 2E9JA 5B38B 3TNMA 1PZUB 1BIIB 2Y5TB 4ZPVB 3QAZC 3REWB 5F1IB 3NACL 1V3KA 2F8OA 3KYAA 4P46B 1PAMA 3WS3A 4BK5A 1YNTA 1ZT1A 3KPRD 4BSJA 3I50L 3PGFL 5GSVA 4KGLA 4XAWL 1A6PA 1DDHB 4PJIF 3ZYJA 3WS6A 5MHSE 1AD0A 3C5SA 1DVFA 3R8QA 5JPNB 1U92B 4PRDB 5DJ6B 3V5DB 4TUJB 4HKXB 5FB8A 1N7ML 2E7HA 1IAIL 5E8DL 1MSPA 4OGAC 1QOKA 3P4MB 2AJZB 1JPSH 3CVHA 2O26U 1I8LC 3GIZH 1SJVA 4LSUL 3T0EB 4P5TD 4O4YH 2UWEA 2EIEA 2ZP0T 3N06B 3MLVH 3WHE0 4A2MA 1OTTC 2VLJA 1MEXH 1T22B 3U6RA 4OD2B 4LQ1A 1T5XA 5HGDB 1NCWH 3NFNB 2F15A 4DAGL 3WFEH 1ED3B 4OV5A 2EDOA 1YDPA 2AK4B 1PYWA 1I9RL 3AXLA 2BVOA 4QRUB 5B3JE 4OBSA 2NR6C 3O0RL 5CIPB 2UVFA 3MRRB 5T5FH 4M93B 3K4DA 4XPTH 4CU7A 5CJ5A 2W1NA 3S36H 4ERSL 3CFKB 1IT9H 2ZKHL 5AD0B 3UDWA 2OSLB 4DFIA 1FIEA 3GMQB 3SBWA 3F7RA 5HYQA 1XGPB 4PGCB 2XTJE 2DL2A 5AWNH 1T89A 1A7PH 5KSUB 3F6IA 4WFHE 1MJJA 4P9HL 1CDBA 3FL7A 3TCXA 1JNLL 1OAXH 3L3DA 4HS6A 4YDKH 4HUWB 3U46B 2MQ3A 2LE9A 1SEQH 1IJ9A 2EE9A 4K7PX 3H9HB 1CDYA 4OSUH 4P4KA 2AI0H 1JZ8A 2YUWA 3OKMB 4K23H 4ZUSB 5DJZA 1RI8A 4LPYA 3PE9A 2C3GA 5DMKA 5HBBA 5L8LB 3T09A 4OM1H 2GTWB 1R6VA 4MJID 3RWFB 2PYEB 1VACB 4YX2L 1UWGL 3VRJA 2HFGH 1PD6A 3LN9A 3QQ9D 3ARBA 3NBNA 3ARED 2DWDA 1MVUB 4TTDD 3QQ4A 4ZPTA 1S9XB 3RVUD 1TTGA 5GRXG 3GSUB 4UBDC 3T0EE 3UTTD 3S37X 5TE6H 4NJ9L 3MLWH 3O3BB 3X17A 3C2AL 4MXVF 3ZSSA 4XPAL 1NC2A 4H5SA 4HFWA 3D18A 5F1KC 4KJPD 3KPPB 1NPUA 3VGEA 3H7BB 1UYWH 3RFZC 4YEEA 2PW1A 3VGBA 1KULA 1P4LB 4JFEB 4JHBA 1MCBA 3PIQB 4NWUL 3TEUA 3CXHK 5IQ7H 3GNML 2EICA 3DYOA 4N0YH 1LE5A 2R1XB 2X2YA 3GKWH 5KVDH 3PWPD 4Z7QE 5KSBF 5JHLL 1HSAB 4RMVA 1E6JL 1I3VA 3OKKB 3PQYB 3C6LC 3FOLB 3K2UH 3SGJC 2H3NB 5GRJH 5FUZL 1CDGA 2YKLL 3FQUB 1OGAD 3C6SB 4L9LC 2IPKA 2JJWA 2DIAA 4IS6B 4PRHD 1AGFB 3K8MA 5KVFH 1R3IL 3N1QC 4DEPC 4RAUA 5F44A 3RU8L 3OG4B 2DQCH 2DWEA 3BO8B 3KDMA 3ULVE 2XKNA 2KDGA 1NH6A 2Q86B 2PXYD 2VQ1B 4OIAA 1J5OL 1YEJH 2R4RL 1FV1B 3C5ZA 1BWWA 4NQSB 5DJDA 3HE6A 2E3VA 5FYJU 3L95A 4PJ8A 1TJGH 3S96A 1NBVH 5L2KD 1GSMA 2P8LA 1MCJA 2X5PA 1WBXA 2D9QB 3SPVB 3MACL 4BK4A 1EHLL 2GJ6E 4CADB 1EO7A 5DHVA 3N85L 4GMSL 3OJVC 1FZOB 1AD9A 3QIWC 3VMOA 2AGJL 2Z8RA 5ALBL 3Q1SL 1MCIA 3DVGB 1S7SB 5EZLB 5IVXB 4K7PY 3P30L 2D4FA 4EXPX 1MAML 2MJWA 3JWOH 1YEIH 4YBLB 1DLHA 5KJRH 4GFTB 3BAEH 3S4SG 4JFEE 1KEMH 5K9QG 3BZEA 1NMAL 3U2SB 2GITB 2YD7A 3C60C 4MA3A 4PP1C 1JZ6A 4CN6A 1MHEA 2VABA 2O61B 4LPUA 4RIRA 1NQBA 2EO9A 1MNUH 1XF4B 1HXYA 4MNHB 4OCSL 1A6ZA 5D5MA 1FN4B 3B5HA 3D25A 1AHWA 4UQ3A 4X7DC 5D70L 3SN6N 3QHZL 3QEUB 3DOSA 1OPGL 5I73C 2Z92B 3L3HB 4KK6D 4F7PA 3VRLF 4HK3J 1SBSH 4WWKC 3U30C 1UB6B 3FAXA 4NNYB 3A6CH 5I71B 5EU4B 3T08A 5ACLA 4X9IA 2FECL 4Y5VC 5CJXA 3FT4B 2B2XL 3I02A 3HUJB 1QVOA 5T1KB 1CK0H 1SYSB 1GOGA 2B0SL 3P9LB 3R06A 1JUFA 1UXSB 2QQKL 4GO6B 4PJGB 1P7QB 2G9HA 3TZVC 1VA9A 4MQXD 1I1AB 4N8PA 3A67L 4HPOH 5DRNB 3P40A 2VDQL 5E2TL 4M03A 4I2XE 1YNLL 1MFDH 4EOWH 2XWJA 4Z8FH 5CP3A 5GGTA 3CVHH 3QNXA 5HPOA 5I6XC 1J9CT 4ZXBA 1PVHA 1KN4H 1HYSC 2CKBA 3GSXA 5KW9H 1AXIB 3GBML 2XA8L 4XP5H 3TO4C 3KPOA 4YZFE 3MLSH 4KV5E 3CDGB 3GSOA 1P1ZA 3LQMA 5E9DB 4KY1H 4HQQH 2ADJA 4YHIA 3VI4E 1I7UB 5IVXE 1IQWH 2ZUSA 1GGBH 3W39B 4RSVA 4XBGA 5C09B 5DQJA 2NPLX 2BVQB 2YC1B 1ZVSB 1J8HB 1ZT4B 3SDCB 2AEWA 3TIEB 3K80A 3T2NL 2XRAL 2EC8A 2VLME 4JO2H 5IM7B 3H0TB 5GISL 4OQTA 3D0LA 4AQ1B 3CSPA 1OP3K 5JTWA 4FOMA 3FB6B 1QNZH 3TBWA 4DOHE 2A6KA 3LDBC 2FSEA 3KPRB 4R4ND 3UMTA 2OK0L 4HKJB 3TT1L 2Y06H 1L0QA 3IJSA 3QDJA 5CJ8A 4LCUB 3IT8D 4IRSC 3CCHA 3MV01 4NN6B 4HDIA 1SYVA 3SGEI 3P9MB 2A77H 5C0BA 3GDBA 2H26B 3KLAB 2DI8A 2VISB 1U3HA 1D3CA 1UA6H 3HUJE 4RGOL 2Z31B 3QUYD 4OCWL 4HX1B 3WUWB 2EXYC 1F90H 2DIJA 3L1OH 4YIQB 1DL7L 3G5YB 4PJGE 1I3RB 1OSPH 2CDGB 4GUPB 2G5BB 3QWQB 2EEBA 2HT3D 4NQEA 2NY0D 2WZPD 2NNAB 3I6LD 3TBVA 3AM8A 2CRYA 5SWZA 1OAYL 4X98A 5HYJB 5IK3A 3RWCA 4N0CD 1I3GH 3OAUH 1OY3B 1CGTA 4XX1E 1H15B 1FFPA 2EYSA 2J8UA 4GBXC 3QUML 4HK3N 5FA3A 3IFPA 5E9DE 3PDGA 1G0XA 1UM5L 1XCTB 4Z7UB 1IZJA 1MCWM 3NH7L 2VAAA 3I6KB 3P3YA 3NZ8A 4QOKB 5L9DL 1JF1B 2XACC 3BDBA 3HZYA 1J8HE 3P77A 4D8PB 5DEFA 1M6OA 1H8SA 3BP5A 3C8DA 4Y1AA 1JPTL 4Q6IC 3TM6A 1LO4L 5ISZD 4KI5C 5H94A 4K94L 5ALCL 4U2YA 1XR9A 1KSRA 1GGCL 4U1HA 1HK6A 1CYGA 3FJTA 3BEVB 4WEMB 4M61B 5IOPA 2EDDA 5EU5B 1G7JA 1Q9OA 1A6VH 4ZOBA 4NHUA 4MJIB 4MGXA 1NGWB 2AW2A 2X4TB 4PJIB 4EBQH 5D1ZA 2YSSB 1N2RB 1D5ZA 4OJFH 1DLFL 4DKFH 5EUOB 2BK8A 4WU5A 4LEXL 1OAUL 3AREB 5FYJE 4LQFH 3RUGF 1IC7L 5ILTH 3T1FA 1MJ7H 2CDEB 5B38G 3ZHKA 3QQNA 2A74A 5D7LE 1T83A 2B8OT 4YHNA 1YMMD 4UT9L 4XBPA 5JDJA 4KVCL 4P2QB 1MCLA 4IIQA 4TQEH 3IFNH 1ZWIB 5HPMA 1U8MA 1AO7D 2CK0L 5IEHB 4JPIB 4MAYC 3WKNA 1NKRA 2XI9A 1LP9A 1ODAA 4NDMA 2JCCA 5HYJE 5L7XL 1XFPA 1T7XA 4YC2C 4QHNA 2GHWB 3SY0A 5DHVH 2BY0A 1UJ3C 1UENA 4RGND 3EDDA 4GG8A 5T3XL 3S35X 4LCCC 3TYGH 1JHTA 3PWPB 2IPTL 4XVSL 4QHKI 5ACZB 4Z7UE 1JNJA 4CDHA 1IAIM 4OCNC 3U9PL 4QOKE 3QEQD 4K3JL 4U1LA 4HK0A 5HDOA 3P4LA 1G9NH 1OGAB 4RMRA 4U3XA 4WJ5B 3EHBD 2EXWD 4TNVF 1JWMB 4L8CA 4PJFB 4QCIB 4F9LA 1BREA 1K6QL 2AJXL 1FVDB 3VFRB 4G8GA 3JWOC 1EJOL 3TIDA 2DD8H 3MNZB 2ITCA 3SQOH 3WN5B 1EO5A 3V4VH 5JLZB 4JGMA 1HI6B 4X4YA 1BQUA 3H9YA 4OLWL 1FYTA 1VHPA 4MJIE 1GCFA 3SDYH 1JPST 1MIEH 5I30L 1JNNH 2XICA 1WZMA 2EEAA 1AFVH 4N90D 1CZ8L 1CLZH 4TNWF 5EUOE 1NCAH 1PG7X 5L2KB 1NDMB 1YUHA 4KH2A 3UZVB 4WEUD 1LK2B 3L3GB 2O5YL 4FFZH 3BPOC 5MEQA 3DARA 3FOMA 3MLRH 5HGAB 4DJMA 4P2QE 1Q9WB 5FXCH 5IMLB 4MX7A 3MMEB 32C2B 4ZFGL 3SGDH 4ENEC 3EBAA 3F7VA 4R96B 5CP3H 5GGTH 1KLUB 3M8OH 4DGIL 1S7XA 2PCPA 5IMMA 3RX7A 4BH7A 2XNAB 3CSGA 4CVUA 2IPUK 2J12B 2CKBH 3WS6C 2ARJQ 4U6VH 2OJEB 5DURD 5CD3B 2Z4QA 2PTUA 2GTZA 4ORGB 4KK9D 4LVNC 1A4JA 4PBWD 2ZNXA 3BXNB 4N1CA 1FDLH 5KSBB 1KENH 1FSKB 4P57A 3HZKB 5KN5A 4QNPE 5H8DA 1BOGB 4HIXL 3OKNB 1ETZA 3BKJH 4M48L 1A9EA 4OQTH 3MUHL 1IAOA 4HH8A 5GS1A 4PJFE 2ICWJ 3FCTB 5E8OB 5HDLA 4OKVA 3F62A 1EEUA 3BPNC 4HT1L 5HHNB 1X5KA 1KIRA 1GZPB 1PEWA 1BZ7B 4NZTL 1P7KA 2AEQH 5F9WC 2VIRA 1LVEA 1FLTX 4PGDB 1BBDH 2VLRD 3CMOL 3BW9B 3MODL 3SDAC 4IOIB 5IJKC 3IXAA 1Z5LA 5I1GL 4HUVB 3SDDD 2VZVA 2GSGA 3PP4H 3P0VH 4KDTA 4MA8L 4KKLD 4JKWA 3KYOA 3HG1D 4PS4L 3K1DA 4I4WB 3TJEH 3WMSA 3ARDA 1G7MA 1F6AB 3M45A 3SBWC 4HXBH 4GQPH 5F7YC 1KELH 3EDJA 4XWGH 5JUEH 1HZHH 5D2LF 4FTVD 2HFEA 5CD5C 4F9PA 1CG9A 2AV7B 4JFQA 4R0LB 3E6FB 3MLXL 4PTTB 3MROB 4XZUA 2BHZA 4DGYL 1EFXA 5TGBB 2I9LA 4L3AA 4P4KC 1BLNB 4TSBL 4MCZA 2VQTA 4FQ1L 5D1QA 1INQA 4S1SL 2BRRH 2FJGB 5CEXB 3IAQA 3LY6A 2LVEA 2J6EL 2DJUA 4ODHH 1IEAA 1MCOL 2C4FT 3V6FA 2IQAA 2DDQH 2KH2B 3HPJB 2ATPB 1BD2A 3LKPB 3ARBC 5GIRA 3T0XA 4RISL 4A6YA 5HSFA 4K9EH 1WITA 3QIUA 3TYFA 4M7JL 4OGYL 3O6ML 3L5XL 4PR5A 2M2DA 4CMHB 4WU7A 1QBBA 5A2LH 5K59E 2Z35B 3ZKQD 5DJAA 3STLB 1AGDA 3D9AH 1ADQA 1MFAH 2D0HA 3MRNB 3VXUD 4OCRH 3CMGA 3GBLA 1UM6L 2YPLB 5J57B 2HWZH 3LPGA 4LSRL 5T5NG 3QUZC 1A6TB 1S7TB 3VA2C 4Q9BA 4AEIH 2RB8A 4PD4K 3QCTH 1G7LB 2NY0B 3ZDZF 3HAEA 2C7UA 2Q8BL 4NRYA 2BHYA 3O3UN 3IETB 2VUYA 1DSFH 2HN7B 3EOAB 5IHZB 2UY7A 5C0GB 1TZHB 2E9IA 3MLVL 3VGAB 3HB3C 4KAQH 2WV3A 5T3XD 5I1AA 3O4LD 1JWUA 4LSSH 1MHCB 1X5HA 3MTRA 3D6GA 3GJFB 2VN7A 1NCWL 1PJ9A 2BSSA 1FGNH 3O45B 3WFEL 2GAZB 1CTNA 2BY3A 4LOUC 4WY7H 3LEYL 4Z7VF 3GO1L 3M1BB 2A83A 2CR3A 3BH9A 2D3VA 2Z8SA 5D7IB 1XGUA 4KWUA 3EGSB 4OAWB 5EWIH 3ZTNL 3ZL4L 1FLRL 1RIVH 5JQHC 1IQDB 3LKSB 4KKCD 5DJ2A 4LHUA 4OF3A 3DX7B 1IT9L 1ZGLP 4QRSA 4EDXA 4JO4H 5C0JB 3MV7E 2BSRB 5ISZB 3WIFA 1Y6NR 1VSCA 5C08B 4PJ8C 2GI7A 3QEHB 2C1PB 4L9DA 4JFFD 1BFVL 3L6FA 5E00A 3HC0A 4LLUA 4D0BA 3LKRB 3VRLE 5MEPA 4PB9L 2AI0L 2R29H 4NT6A 4DN3L 4HWNA 4OF0A 5D7KD 5E2WH 1UM4H 3WYRA 3OJDB 4N9GA 3ZT5A 2WUBL 2DMKA 2YPLE 1NEZG 2BC4A 4YXKH 2HLAA 3B2VL 1YMMB 3IDYC 5JW5B 2FGWH 4ELKB 1P7HL 1WEJL 2X4NB 2E6QA 5KSVB 3KPSA 2YRPA 3C6LD 4CVWA 2HFGL 4LVHB 1OB1A 5J89A 3BGAA 2XZAH 3UPRB 1HCFX 3WLWC 2JJTC 1KV3A 5DD6B 4WNQB 2Y07H 1MI5D 4RGNB 3IDUA 4ZTOH 1QSFA 3G5ZA 4BFGA 1JGVL 4ORZC 5CJXC 3MRPB 1OTUC 1AH1A 1L7TL 4B7LA 5D7IE 1TTFA 4JRXA 5FGCB 1D5IH 4JY4A 1U3JA 2GQHA 4NRZB 3KLHD 2B1AL 3C87A 4X6CA 2DI7A 4N0YL 4PJ5D 3PP3K 5TF1H 1EEYA 3VJ6B 4MWFB 4Q0XL 5ISZE 2DYPB 1F4HA 4PRPA 4CVXB 5C08E 4D9RD 4ZQKA 2COQA 1E4WL 2X09A 4Y0GA 5JW4Q 4LLWB 3RI5F 1BVZA 3AVEA 1AGCA 1FFOB 2EYRB 4G6MH 2Y5EA 2OTWA 4IRJC 5KS9F 4OI7A 4JREC 2AQ1A 2ICWI 3RIAF 3CK0H 4OFVA 3U4AA 1JV5B 1GAFL 4PP1D 2DQCL 5CGMA 3AS0A 2VDKH 3HRZB 2YS4A 4Y19A 3UAJD 4YDIL 2DI9A 3DURB 4P5KA 5B21A 4HZAA 2BNUA 5FK9A 2VXQL 3CDFA 1C1EL 5ITBL 5ICXB 4MB5A 2E7LA 5IB2B 1HDMB 5T3ZL 5FCUH 4F15B 1EHNA 2IQ9L 5GGQH 5FYKH 5AYUH 1QLFA 4ZD3H 3MRLB 1J1OH 4KDWA 4RMSA 2YRLA 3U7AA 3OF6A 4MDIB 3PNWB 3TA3D 5FO9B 2F74A 3NCYS 4OBRA 1PZ5A 4LSPH 5DTFB 4X7TB 1YA5A 5DC9B 1UCTA 5DURB 4HG4J 1A1OB 1IL1A 4M1CC 1FL5A 1ZT7B 5BVPL 4D3CL 1RZFH 3FB8A 2KKQA 5FGCE 4OGXH 2X4SA 4G7VH 4M6MH 3DSFL 1MF2L 4JM2A 8FABA 3KLDA 1ZHBA 3RGHA 3MFFB 5E1AB 5CGYD 1H3UA 1HYSD 3CPLB 5DJYB 1LILA 1Y0LB 1WAAE 3LH2H 1FC2D 4YHLH 2NCMA 3BVNA 5DVOA 4FZEH 1NDGA 4JGUA 1U8PB 4R4BA 4BYHA 4ZNCD 4IDJH 1KXTB 4LLMB 1PBYA 1E28B 4NKDA 4A6YH 2JE8A 4FQHA 2PNDA 4MHHG 1N6UA 3BKYL 2VLRB 3V0VA 5TH2B 5J11B 3SDDB 1MFEL 4ZUVB 2FIKA 4YDLC 5KSAA 3HG1B 1JFQL 2F19H 3O11A 4K9EC 5IFAH 3LMJH 3QAZB 2M8XA 1F8TL 5F7LB 1CFNA 1EEQA 4FTVB 4WTXA 5EO1A 3ZZ1A 1RZGA 4NBZB 2WQ8A 4DW2H 3IAGC 4S2SB 2ZZUT 3B83A 1BVLA 4BSWA 2RIKA 4X7CC 4J3OC 3VG0L 3PV6A 3MRFA 4FQLL 4IRSD 3S4SA 3RL2B 2NY7L 2VE6B 5BQ7A 2GY5A 4ZODA 1OAZH 2ZUVA 4M3JA 1NLBH 4NFDA 4P3DB 3B2UC 3P4NA 3AAZB 5SX4I 4GJTB 4KY1L 4HQQL 4X83A 4WTZG 1R5WA 2XFXA 4XVUC 3SKMB 3EOTL 4DQOH 4UDTB 3W9EA 2CH8A 4YEFA 1G9MH 3NFSH 4FQXA 4UINL 4QT5B 4ONFL 1YC8A 3SE9H 2EDLA 2YPVH 5BOZG 5IGXH 3IS0X 3PDOB 4XCFH 4NKIL 1JMZA 3KPNA 2VITA 3KPQA 3VXUB 2EDEA 3VXOB 3E8UH 3GMPA 3NGBC 5IVNA 4EQ3A 4ZOEA 3OWEA 1IMHC 5I8CB 2MCPH 4YBQC 4DUWA 5I66B 3TPUA 1NANI 3DX9B 3OXSA 1CFSB 3QPQD 5IW6B 3K74B 4FQIL 3BQUD 3ARSA 5E7FA 2A77L 4X80H 1T0MB 1ITBB 3GJEA 1HWGB 4LFHD 3RWJA 1NCCL 3MV8D 2ADFL 1UA6L 3JTSA 4PJHF 2YA1A 3HG1E 2BCKA 3L1OL 2YD3A 3NA9H 4JKMA 2X4OA 3V5HB 2P5ED 3O4LB 1K2DB 5FOBB 5CS7A 2FEDC 5IB3A 1YQVH 2R0WH 4TULH 1J1PL 4FTVE 5D2LB 5A1AA 1V3MA 2V2XB 2WMPA 4Z78B 1TQBC 3FMGH 1D5BA 1U8LB 5FA4B 4F9LC 1T0NB 1P84K 3O6LH 2EIBA 1HHHB 4UV7H 1I3GL 3O3EB 4KHTL 1T1ZA 1SJHA 3BN9C 1F3DH 4Y8DC 1KTRL 3RJQB 2DM3A 4AIZA 2EH8H 5K9QI 2JIXD 1IM9A 3U4EB 5JORA 1ORSB 2DM2A 3WD5L 4D9QE 1R3JB 1J05A 3KJ4C 4MA1C 5DSCA 4HMEA 1U6AH 5D7JD 2VDPH 3G08A 1KG0B 1MCNA 4U1GC 4I3SL 2NY3D 3DI2B 5D6DC 4OUOA 5I18L 3MYZA 1K85A 4KROC 1NBQA 4ZUWB 1JK8A 1LNUB 3PWUB 3VXMA 5FO7A 4EVNA 4ZFOA 3NMEA 3BKML 1LDSA 1BP3B 4OZHF 1TIUA 1ACYH 1W0WA 2DS4A 2HKFH 3KLSA 1YEHH 4LCYA 1T1YA 1A5FH 4QXWA 5IB5B 5T3ZD 5I9QC 3BDYH 4DK6A 1CGXA 2EDBA 3F65A 5L6YL 5F88A 3SO5A 5GGRY 5MP6H 3RWDA 2HTLC 3C6LB 5DYOA 2ADGB 5A2JH 3UC0H 1ZA3B 1OT2A 2G75B 4QHMA 2R15A 4F33B 1ZV5A 5ILTL 2XWTA 4L9LB 5DD3H 4WW1B 1A6UH 1CD1B 1K4CA 3OR7A 2YZ1A 3H3BC 1FNEA 4RMTA 2A1WH 4X6EB 4DEPB 4PJCF 1VGKB 5DLMH 1GJIA 2P24B 5C0NC 1MI5B 3IRPX 5D1XA 4YWGH 3FT3B 4M5ZH 3IFNL 4ZAKD 5F89B 1F42A 2EDKA 5D2LE 2X70B 2F5AL 5H2BA 2YOCA 3LKOB 4XPBH 5DJ8A 5J9PA 1V5JA 3BIKA 4LCIH 2APXA 5E2JA 3QEGH 1PSKL 3D3VB 5C3LD 2WIIB 5BV7H 1FO0A 3GK8L 4JFPA 4MDJA 5IBLC 3TO2A 3H9SD 1G7PA 2P5WE 5DZOA 1DQDH 1I1CA 2EKSB 5J8OA 4PJAF 4ZFZB 5HXMA 5D96B 3OX8A 5JO5A 2Q3ZA 4LLYB 4E5XA 3OBAA 1QR1B 4APQD 1Z0NA 5IMKA 3SKJH 1AXTH 1JMXA 4GG6A 2NY2D 1MHPH 2VWEC 2GK0A 3CSYB 3UXFA 1S7QA 4NOFA 3TT3L 1OCWL 2W65B 3NTCL 1J0HA 3QULB 2DLGA 2IANA 1F3JB 4F9PC 3GB7B 5KVEH 3SCMD 5B38A 4I0PC 1BIIA 2Y5TA 4JFZL 4ZPVA 3JV0A 3SQOL 5ECJE 3REWA 3R1GH 1JRHH 5F1IA 4P46A 1DANT 5DR5H 3WJJA 4OTXH 5E4EC 2VZOA 1DDHA 2NY6D 3SDYL 4LPCA 1I8IB 1C5BH 4NFBA 3O3AB 5JPNA 1U92A 4PRDA 5DJ6A 3V5DA 4CBPA 4TUJA 4HKXA 4TRPH 4JQXA 3Q0HA 5I73B 2IC2A 1LK3H 3A6OA 5H35B 2FIRT 4P4RB 3CLEL 3U30B 1X44A 3IU3B 3P4MA 2AJZA 3U7WH 2V9TA 4OZIF 3KYKL 4CN1A 1UQSB 3T0EA 3TA3B 3TGXA 3I6GB 3QIUC 4AEEA 3MLRL 1MI5E 3TZVB 5ANME 4YE4H 1T22A 5I1IL 4OD2A 5EIVA 2OCFD 3L5WB 3MA9L 4XC3L 5HGDA 3NFNA 3EAKA 3SDAD 3WFHB 1ED3A 3HC3H 3M8OL 4DKEH 3QI9C 1X5AA 2AK4A 2HYMA 4XXCA 3D3VE 2C4FU 1AI1H 4QRUA 4ZUUB 3DXAE 5BXFB 4NP4L 3I2CH 2MSPA 3GIVB 4AG4H 4ISVB 5ID1B 5CIPA 3MRRA 2CSPA 4LDLB 3T77B 2FH8A 3QG6B 2PN5A 3CFKA 5AD0A 2OSLA 3QWRD 1UKTA 1NFDF 2AXGB 3GMQA 3TCLB 5IT2L 2JELL 1XGPA 4PGCA 5EBLB 2HAZA 2LU7A 4XB8A 3GSRB 4MA7L 5KSUA 1LHZA 2R9HC 3WFDH 2H32H 3C09B 4HUWA 3U46A 3PGCB 1P5UA 3H9HA 2R0ZL 3NCCB 4PGBB 1G9MC 3OKMA 4ZUSA 1X6LA 4HEPG 1FHGA 3AGVA 1BBDL 2LU3A 4HIJB 3OTTA 4XCYB 2GTWA 2FD6H 1CF8H 3RWFA 4XCCH 2PYEA 1RIHH 4M6AA 3P0VL 1VACA 4IRSB 4JY5H 5E5RB 4V1DD 2FHFA 2ZNWA 1MVUA 4PTUB 3D39E 1KN2H 1S9XA 1HZHL 3GSUA 3KJ6H 3GI9H 4OLVL 1ZANL 2NXYC 5IFHL 3QUZD 4KZDL 3NCMA 1UJTA 3KYNB 4UOJA 3KPPA 1J10A 2Y1VA 1IGFL 1P4IL 3H7BA 2E7BA 3GSNH 4MXWL 1J1XL 1OF2B 2HKHL 1NL0L 2UYLB 2FO1A 1P4LA 2NY1C 4JFEA 3MXVH 3EKCA 3ZLQC 3PIQA 4W6XB 2J4WL 1FL3B 3ZDYE 3VDAA 2NTFB 1V7NH 2PO6C 1L7IH 2XA3A 1DTUA 2X4PB 4GMTL 3UTSD 1UWEH 3DMMD 3BSZH 2R1XA 1IC1A 4JHAH 4K9EL 1RQ5A 5HJ3B 4GBXB 1HSAA 1C8PA 3OKKA 4G6KL 5DVLA 3PQYA 3FOLA 2H3NA 3BQUB 1QSEE 3FQUA 3QO0B 3BRDA 3C6SA 4IS6A 1AGFA 4N8VB 4PJBF 4WEBH 2DIBA 3ARFD 3F5WB 4UB0H 1JCKA 1MRDL 3VXSB 4KK5C 2P5EB 2HG5B 3BO8A 4K8RH 1RURH 2Q86A 3ZSTA 1ZGLM 5CHNB 2VQ1A 4QGTA 5EUKB 4CL7A 1QR4A 1JWSB 4NC0B 5IWLC 5KANI 1FV1A 1L9NA 4MNQD 4NQSA 3VXQB 2JJSA 3HZMB 5DVKA 2ZUQC 2GUOB 2NQCA 3X3FH 3VE0B 1YEDB 5EIQA 4HZLB 2BDNH 3SPVA 5CEZL 3MLTB 3WSQH 5C0EB 1Z0MA 4CADA 4PRBB 1BZQK 1DBJH 4M6OH 3GMLB 1FZOA 3QDGD 1EMTL 5DK2B 3IDXL 1X5GA 3DVGA 1S7SA 2CJUL 5EZLA 5IVXA 2J3SA 4E0RB 2NY3B 4MAYB 1CCZA 1Q0XH 1FO0H 2ATKB 5EOTB 5TE4H 1RZKL 4MB4A 5F7EH 1DUYB 4XP9L 4YC2B 5HTSA 3U2SA 2GITA 2E7LC 5HDBF 2O61A 1XF4A 3JV4B 4MNHA 4LCCB 1N6QL 5BV7C 1FN4A 1F58H 4N0UB 1NUGA 4YGVB 3IJHB 3QEUA 1SBBA 3IGAB 2Z92A 1NAML 2KZWA 4AIOA 2R8SH 1UB6A 4NNYA 1A6WH 5E03A 5EU4A 1QO3B 3F58H 3FT4A 4NO3B 1T7YA 4U7SA 2D7NA 3HUJA 1WCBB 5C07E 5T1KA 4PJHB 1SYSA 3P9LA 4HHAB 1UXSA 3VXSE 4PJGA 2P5EE 1P7QA 4KI5E 1MOEA 1RUQL 1IC5L 1ZGLB 4YHZH 1BQSA 1I1AA 1BIHA 1IZKA 3X14B 2MWCA 2UY6A 2JJUA 4CNIB 3OKYA 5TPWH 4AY0A 2HJKB 1SVCP 2JB5H 5DRNA 1IC4H 2XZAL 5LCVL 1VPOL 4KVNL 3FAWA 3UYRH 3KPMB 4KMQA 2W91A 1YYLL 3LKNB 2GFBB 1K3ZA 1J11A 2W0KA 2Y07L 4ZTOL 4K7FB 3W0WD 5FV1L 4NQDE 3GRWL 3BPOB 1FBIH 3QUXD 4YHYC 4O58H 3G9AB 3CDGA 4IEFB 5E9DA 4JZOB 4APQB 5KSAC 4PJEE 1D5IL 1I7UA 4RQQB 4UU9B 5EORH 4J1UB 4PREB 1B88A 2NY2B 2CIKB 2XT1B 3W39A 1FJ1B 5JIHA 5C09A 1NMCB 2BVQA 2YC1A 1ZVSA 5JZ7C 1Y6MR 3NCBB 1J8HA 1ZT4A 3SDCA 3TIEA 5CIPH 3VXPB 1KJMB 4BZ1H 3DHJA 3QFJB 5IM7A 3VFTB 3SCMB 4GAFB 1KTDB 4RA3A 4ELMF 5JR1L 3FB6A 1I4FB 1N0XH 3MJ8B 4LVNB 3ZYZA 2DQEL 3G6JF 3KPRA 4N0UE 2EKJA 3KR3H 4U6TA 4HKJA 4HGKC 3L5HA 4DTGL 5L0QC 2F5BH 1LO5B 4LCUA 1E4KA 5I1KL 1ND0B 1RK0B 1MJ8H 3P9MA 2H26A 3KLAA 2VISA 2FB4H 4X6DF 4EUPB 4JG1H 2Z31A 4HX1A 1RFDH 1S8DB 3WUWA 4NKQB 4YIQA 3G5YA 4R8WL 3BPNB 2E6JA 1JI2A 2EC9T 4PJCB 4YHKL 1I3RA 2CDGA 4GUPA 2G5BA 4AM0B 1R0AL 1YPZF 2E7MA 4S1QL 4D0CB 5FYKL 5AYUL 1FC1A 2NNAA 1J1OL 4ONHB 3VFNB 3SDAB 4Y4HC 3OXRB 4KHXL 5HVHC 3LS5L 4WW2C 3IVKB 3NCJH 1INDL 2AJSH 5HYJA 5DUPL 4JB9L 5F71A 3ESVF 2B20A 2ED7A 3QDME 3CNKA 4DZ8B 4LDOB 5T1LD 1RZ7H 4BZ2L 3BPCB 3SGEH 1O5DT 1H15A 3RZWA 1EA9C 2NXZC 3ILQC 4FQ2H 4Z7UA 1XCTA 1UKSA 2IG2H 5F9JB 3I6KA 4QOKA 1JF1A 4XAKE 1S7VB 4UUJB 5DI8B 4D8PA 4Q97A 2DQIH 1NGQH 5FKAB 1CGYA 4YHLL 4GSDL 3QFJE 4NM8L 3S88H 1KLFA 3V2AR 4XP4H 3AMLA 4UDUB 1Q1JH 3E3QC 3T4AB 4L1HA 5DRWB 3WDIA 3LN4B 1OLLA 4LIQH 4XVUD 5F7DB 4D0DB 1CFVH 5EOCL 3ULUH 4EIGB 3BEVA 2QSTA 4M61A 5EU5A 3ALXA 1N3NB 4XP1L 4CU6A 5D7SH 1ZHLB 4MJIA 1NGWA 1QFUH 3EYUL 4AENA 2X4TA 4PJIA 2YSSA 1N2RA 4Z76B 5KTEL 1LO3H 5EUOA 4LCWD 4V1DB 3AREA 1WSST 2VC2H 1X4YA 1CDJA 4OZIB 3OGCB 2CDEA 1T03H 2ORBL 2ZCHH 5E2VL 4LARH 4DW2L 1X4ZA 5KOMC 3QUZB 2NX5D 3WHXB 4J3TA 3EDKA 4P2QA 4RX4D 3W5MA 1ZWIA 5A2KH 1KXVC 4BFEA 2VXTH 5IEHA 4JPIA 1OW0A 2QSCH 2OM5A 5K9OB 5GGVH 2WP3O 4XNUH 4K8RC 5TFSL 1LE9B 1OOAA 3CJJA 4O9HL 3A6BL 3Q3GB 2FEDD 3T0AA 3UTSB 5DO2C 5DQDL 5EC1B 5I1HH 1MRCH 2K7PA 5D72H 3LQAL 3PWPA 1JPFB 1GOHA 1VGEL 5DS8B 2VZ3A 5ACZA 5K9KB 1NFDB 5DD1H 2EZ0C 4G42B 4M5YH 4XCFL 1OGAA 4WJ5A 3BN9D 2P44B 1I8MB 3OJ2C 1JWMA 2VL4A 4PJFA 1WF5A 2ADIB 2IALB 4QCIA 4WO4D 4KUCF 1FVDA 4LRNL 2FDBP 3VFRA 2ARJB 3MNZA 3UJIL 2J5LC 1KCSH 4P59H 3WN5A 4EQ2A 5JLZA 4Z7WF 5SWSB 4RMQA 1HI6A 3LKQB 5LGJB 3MRBB 3T0BA 3QCVH 4RFNC 1IKFL 2Z91B 4KROD 3FFCD 2OR9H 4KKNA 5TQ0L 3LEXB 1TJIL 3B9EA 2LTQC 5L2KA 1NDMA 1D6VL 1IAKB 5F7NC 1QSZA 3BP4B 4X6FB 4HXAL 2OZ4H 2R2EB 1A3QA 1MFBH 3O8XD 4TULL 1LK2A 4J7RA 4UT6H 3L3GA 4RDQG 4WTZA 1XGTB 3INUL 2YXFA 3BISA 5C70A 4U3CA 3FMGL 3QDGB 2QQQA 5HGAA 4DN4H 1I1FB 1Q9WA 5IMLA 3MMEA 1FYHB 2WINB 32C2A 1P4BL 4ZTPL 3L3OB 4CDGC 5AZ2H 1BHGA 1BGXH 5HD8C 3HMXL 4R96A 1SQ2N 1TQCC 1KLUA 1FRGH 2EH8L 4QRPD 3WJJC 5FFLA 1C5DB 2XNAA 1QA9B 2R1WB 5LGHL 4Y7MA 4C4KT 2OJEA 5CD3A 1TTUA 4QXGH 5J13C 4ORGA 2XN9D 4LNRB 5JDSB 4AEHH 1YECH 2D0GA 2PYFB 4GQ9H 5T1DL 3BXNA 5KSBA 4K71C 1ZEAH 1T4KB 3HZKA 4R2GC 3IFLH 1WC7B 2YWYA 3FQXB 4AZ8A 5EULV 1BOGA 3NAAH 2HKFL 1GGIL 3OKNA 1DANU 1YEHL 4JJ5B 4M7KL 3VW3H 4H0GA 3FCTA 3PL6D 5ABDE 3FN0H 1EBAA 5DF0A 4TUKL 5FYKD 1E6OH 5HHNA 3PWNB 3EYSL 3BRGC 1N4XH 1GZPA 3OHXB 1BZ7A 5SWSE 3PABB 3DBXB 3K1KC 1WGOA 4PGDA 1S5HB 3BW9A 3RDTC 5MEND 2KL6A 4IOIA 1I7RB 1CL7H 4HUVA 1DEDA 2Z8VC 4IRJB 4LBEB 2H2PC 2N4IA 4JREB 4M9OA 1L0YA 1A7RL 5FF6B 1RUKH 4LFHG 2BXYA 2VR5A 4I4WA 3S36X 4KJYB 1QBML 3R8BB 1F6AA 4PGEB 4N8VG 3QIBC 1JHKH 3S9DB 1QFWL 4YWGL 1CS6A 3GM0A 2LAGB 4Z0XB 3KGRA 1IGYB 3W0WB 4M8QB 1FCGA 3VFVB 1JZ4A 1JHLH 3D1MC 4XWOC 5MEOB 2AV7A 3B3IB 2EDJA 4R0LA 3E6FA 4PTTA 3MROA 1SHMA 5TGBA 2FX8L 4LSQL 5JW4R 1KB5L 1BLNA 3D85D 4HC1A 4KTEH 1JYNA 2J2ZA 3WFCH 4AJ0A 4QXUL 1G9EA 1LO2L 1FVCB 1BOYA 5GJSH 2FJGA 5CEXA 1U58B 1RAMA 5ENWB 1W72H 1EX0A 4HWUA 4LL9A 4H20L 4YDVB 4Y4KC 3HPJA 2ATPA 2ZPKH 3LKPA 1AXTL 1MHPL 3MUJA 5AZEH 2MNUA 5I17B 2DQUH 3BZFB 4Y16D 3QI9D 3DRTB 2E5EA 4YO0B 1PLGL 5SV4A 5F8QC 4J4PD 4QKXB 1RIUH 4R4FL 2Z35A 3STLA 3WIIL 4QYOB 3SGKA 2FO4B 3VWKC 2CLZB 3MRNA 1IVLA 3MBXH 1IGMH 2YPLA 1DZBA 5F9OL 4I18B 4PRID 1MCPL 1ZHNB 1A6TA 4FN0A 1S7TA 2CUMA 2D7QA 2ZCLH 3I84A 1G7LA 3SKOB 4JKPH 2UZIH 5DWUH 5C2BL 4L4VD 3MOBH 5JW4M 4MLSA 2R9HD 2DQGL 4KU1A 5I0ZA 3IETA 2XPGB 3EOAA 2HN7A 5IHZA 1CR9L 5C0GA 1TZHA 4YDLB 3ULUC 4WFGE 3NFPB 1MHCA 3O9WC 4LEOB 2VL5B 3CFCH 4BM7A 4U49A 4N1EA 3GJFA 3FTGB 5GZOC 1C5CL 2ZJSH 3O45A 3NPSC 4MXQC 4PJXF 2GAZA 5KAQG 4GLRH 1UCBL 1OTSD 3M1BA 3VD4A 4G6AD 5D7IA 4JPVL 4JR9H 1Y6KR 3EGSA 4OAWA 3N0PB 4WI8A 2BJML 5DT1L 2VZUA 1P9MC 3Q6FB 1IQDA 3LKSA 4MVBD 1YJDH 5SV3A 1TVDA 3DX7A 2UUDH 4OI9A 2QKIB 5HHVH 3DX6B 5ISZA 5C0JA 2BSRA 3SJVD 3K8KA 3EOBB 5LBSL 5C08A 3X3GH 4ELMB 2DOCA 1MY5A 3QEHA 2C1PA 3G6JB 3ARRA 3QUKB 2APFA 4G6JL 3WFDL 4M1DL 4FQPA 3LKRA 1CFBA 4LCWB 2GJJA 2PO6D 3GMRB 5HI4D 3OJDA 1LWRA 4S1DC 4X6DB 4OIIL 5FYKU 2VR9A 2G2RB 1YMMA 5JW5A 1J8KA 4ELKA 2NX5B 3V7MA 1KCKA 1YN7B 5KSVA 5ETUB 4N5EC 5CBAB 2H1PH 1PW3A 4R3SB 2OL3L 1J87A 4L8DB 2HA1A 3UPRA 4NNPH 2F53D 4MSWB 5DD6A 1KFAH 4WNQA 4P5MB 4EUPG 5IR1B 4KK5D 3QPXL 1H5BC 1MCDA 2WW8A 3MV11 4PLJD 3GSNL 5DDHB 5EIIB 3QHFH 1NAMB 2EDTA 3MRPA 3WJLA 1FIGL 1N5YH 3N1MC 2WLZA 1QSVA 1GL4B 4MCYB 3ZDXE 2QADC 3EJZC 2NY4D 2V9RA 2WWMC 3DV4B 4NRZA 2KBGA 1F02I 1I1AC 3TN0D 4BSVB 3C8KB 3BSZL 1WAAA 4NJAL 1SJXA 3VJ6A 3I50H 3PGFH 4MWFA 4WO4B 1IM3B 2DYPA 2FJFB 2GSIB 3KJ4B 1JGEB 4CVXA 4MA1B 3DTXB 4U4BA 1N7MH 5JXEC 1IAIH 3MYJB 5E8DH 3G6JE 5DHYB 4LLWA 4U1GB 1NBZB 2EYRA 1FFOA 4OD3H 4G43B 5BMFL 1XF5B 1ZE3C 1IKNA 4KROB 4DFHA 4LSUH 1P2CB 4ZYKB 3B6SB 4LCWE 5HGHB 5CZVL 5IHLB 4IHOB 3HRZA 5HI3C 4K8RL 1AKJD 4JHZA 2AJ3B 3B9KD 3O8XB 3DURA 1CFQB 4WFFD 1P53A 4DAGH 3ES6B 4PRNB 2C1OB 2FRGP 4ZS7H 5DRZB 4W4OA 5ICXA 1I9RH 1D6EB 1S3KL 4NN5C 2Q20A 5IB2A 1SY6L 1HDMA 3AC0A 2WWKT 2YMXH 3H3PL 1MFCL 4XPHH 3MRLA 4GKOA 1M1SA 3ELAT 4ERSH 4MDIA 5IKCB 3PNWA 5FO9A 2A9MH 5DTFA 1TDQA 3UTPD 3VMPA 1T20B 4X7TA 4HIHB 2HH0L 5IBTH 3FO2B 1A1OA 5C0RL 4NN6C 2XN9B 3QRGL 1EVUA 3T2PA 1JJUA 1ZT7A 4P9HH 1EH9A 5BOPA 1H0DB 1JNLH 1MCHA 1OP9A 3DVIA 3UBXB 3VXTB 3ECBB 4NBXB 3UCRA 3ZO0A 1XGYL 5E5MB 2HRLA 4P5TC 1U8OB 1KIPB 3FKUS 5FV2A 4B7IA 4G8GE 3MFFA 4LKCB 5E1AA 3ROLB 4JRYB 3O41B 4NQCD 1UVQB 3CPLA 5DJYA 4JPKH 1Y0LA 1QLEL 3UTOA 3CH1B 4D2NA 1EJ6A 1QZ1A 3FO9B 1FL6B 3PL6B 1U8PA 4LLMA 5JIIA 4TUOB 1E28A 1QHOA 4P2RD 4YX2H 2DLFL 1UWGH 2O5XH 4M7ZC 5DVNA 1A6WL 2VLRA 1B2WL 5MENB 5TH2A 5DJCB 2R0LH 3SDDA 4ZUVA 2ITDB 4NJ9H 3C2AH 5FAAA 3HG1A 4XPAH 4XC1L 4I0PB 3QP3A 4XNXL 3CAFA 4WI3A 5JXAL 4OFIA 1BF2A 4GS7B 3U0WL 4FTVA 5E4EB 1IC4L 5ESQB 4S2SA 3UYRL 4JFHD 2N7AA 4N68A 1RMFL 5D2NC 4NWUH 3D85B 1F4XL 3RL2A 4FS0A 4ACPA 2VE6A 4CRPA 1JE6A 4Y2DD 5IW1B 3GNMH 1TCMA 1R3LB 1I8LA 2DAVA 1CIDA 4P3DA 5GHWH 3MRIB 3AAZA 5JHLH 3GHEL 5GGSB 1B0GB 1E6JH 5I1EL 3GJFH 2ZOKA 3SKMA 1G7IB 3UP1A 4UDTA 2XN9E 3T4YB 3QQ9C 1XIWD 3AREC 1NC4B 5FUZH 5HYEA 2YKLH 3H42L 4YLQT 4NM4L 4U1MB 3RVUC 3T04D 3BEWB 5HVWA 4QT5A 3QI9B 1FAIH 1R3IH 3PWLB 1ZLUH 4BUGA 3MRMB 3RU8H 5ICZB 3PDOA 4JRYE 4KJPC 4WHCA 1LEIB 3VXUA 4PV9B 3VXOA 4NKMB 1FE8L 1CXFA 3UEZA 2CDFB 1J5OH 1RSFA 3KR3L 1UKQA 2R4RH 5I8CA 5FYKE 1VKXB 5I66A 3DX9A 1CFSA 4KMTL 4P0DA 5IW6A 5JMOC 1YJDC 2VWEE 1BQLL 5MENE 3IDIB 1T0MA 3OKOB 1NGZB 4L4VB 3MACH 2V2WB 3L3IB 1RFDL 4FABL 2VLKD 3N85H 4GMSH 1INEL 3J7HA 4TOYL 3U0TB 4S1RL 1KYOJ 3V5HA 3QXVA 2AGJH 3BDXA 5ALBH 3O4LA 1K2DA 5FOBA 1G0DA 1U3YA 3MREB 2XYCA 3P30H 1MAMH 5D2LA 4J23A 4QHLB 2V2XA 3TC9A 3ZT7A 3NOIA 4Z78A 1U8LA 5FA4A 1T0NA 3OAYK 1DVFD 1NMAH 1HHHA 1NANH 3O3EA 4MZ3A 2X41A 1F13A 4YFLI 2GY7B 2PXYC 1ZS8B 5IVZB 4L29B 4M4PA 4OCSH 3U4EA 1ORSA 2NXYB 5D70H 1R3JA 1YY9D 3QHZH 2XTLA 1VENA 1B0RB 3SJVB 4FQ2L 5DFTA 35C8H 1OPGH 5KVGL 3ZE2E 3AU1B 4JVPA 1KG0A 4GRMB 3RWEB 1BBJB 3L9RB 3SDXF 2B2XH 1I9IL 4K8RD 2B0SH 3S88L 4ZUWA 1UWXH 4B5EA 1LNUA 3PWUA 2QQKH 2PO6B 2X1QA 2RCSL 2MPAL 5J3HD 4M62L 5C6TL 5DO2D 2ESVD 3QH3B 5IB5A 1T1WB 2VDLL 1RHHB 2VDQH 1QFUL 2VZTA 4PJDB 1YNLH 2LVCA 4HS8L 4IOSD 3ARVA 3C6LA 2ADGA 4AH2B 4BQ8A 3DVNB 1I7ZB 1ZA3A 2G75A 2VC2L 2YD1A 4L4VE 4F33A 1EERB 4L9LA 3GBMH 2XA8H 4WW1A 2F53B 5B4MD 2NTSP 2ZCHL 1CD1A 4K2UL 1Z9SA 4LARL 4CVZB 3S8WA 4X6EA 5EZJB 1VGKA 2RQ8A 1P84J 4LRIA 2P24A 1MI5A 4KK6C 2FYYB 1UZ6E 3FT3A 4HG4K 4DUXA 4NKOB 4Z7OE 5F89A 4CN4A 1ULVA 2X70A 4GW4B 3N1FC 5DGQA 3LKOA 4OLXL 2I9TB 4XNUL 3T2NH 2XRAH 2P4AB 3D3VA 2WIIA 2ZUQB 5EC2B 5GISH 3DXAA 1IE5A 5L8JB 3DHMA 4MQXC 3GI8L 3TN0B 5I1HL 5DJXB 2EKSA 4ZFZA 2E8YA 2ENSA 4UT7L 3SJVE 1NCNA 4LLYA 3QFDB 3UPAA 1EK3A 1Z6JT 1QR1A 1NC2D 5DD1L 2BP3A 1DQJB 4NCC1 3B43A 3CSYA 4MQTB 4Z9KB 2W65A 5CSZB 4PY7B 1Q0YL 1A7OL 5I1JL 2A6JB 4RGOH 3BJLA 3QULA 4OCWH 1F3JA 3GB7A 3C60A 4P9HC 2HT4D 1AKJB 4XHJD 4ZSOB 3B9KB 15C8L 1MPAH 1CICC 4MJ2A 3EJYD 3ARUA 1ZLVK 3QCVL 5HYFA 1OAYH 4PJDE 4MYWB 4XNYL 3TH4T 3MLUL 1I8IA 3O3AA 4R2GD 2X44D 2WAHA 1BZ9B 2NLJB 3RVWD 4L3CB 5H35A 4P4RA 2J6EA 3IU3A 4RBPK 3L7EB 1G1CA 5DFVD 3VFMB 4ZFFB 1S9VB 2F53E 4O02L 3ISWA 4ZDHB 1PFCA 1UQSA 4R4NC 3TA3A 3WNLA 43C9B 3I6GA 3QUMH 1UM5H 3TZVA 5JPMB 4ZNEE 3NH7H 4J8RB 4I0CC 5AZ2L 5L9DH 3QB7C 3L5WA 3JVGC 1GHFH 4X6CE 2ZOLB 4MJ6B 3RVVD 3EYFB 5CMAB 3WFHA 1HKLL 3QUYC 3IDMB 4YHOL 2GCYB 4ZUUA 5BXFA 1JPTH 3GIVA 1CWVA 5ID1A 4ISVA 1YEFL 2Z0BA 4K94H 5ALCH 3VDBA 2ICES 3T77A 1GGCH 2ED9A 2NY0C 3QG6A 4ONOA 4AEHL 1YECL 4OB5L 3VI3F 3SEPA 2HMID 3TO4A 1ZEAL 5EU3B 1DQQB 1WTGT 3QISA 2AXGA 1U8QB 3TCLA 4AT6B 3IFLL 1DLFH 5EBLA 3LIZL 3VGAC 4G8EB 3O6KH 4N0CC 4LEXH 1OAUH 3GSRA 5HI5C 1ZHKB 1IC7H 5E94B 3PGCA 1HILA 1HEZB 4UT9H 3TF7C 1KBGL 3KWWB 4S11A 4PGBA 4JEGB 3AFLA 2EECA 1MAJA 3QDHA 1BWMA 4W6YB 3GSVB 4QXTB 4OZFG 1ZVHA 3WE6B 2CK0H 2A73B 4HIJA 3CFJB 5JW3L 3WL9B 5L0QB 4HUUB 4BQCA 5L7XH 5DMIL 1RU9L 5IHBA 4IRSA 2IADB 5EO0B 5HVFB 5JIPA 3DRQB 4PTUA 1OD9A 1A14L 2MTPA 5T3XH 3MUZ1 3WXVL 2D7TL 2IPTH 4XVSH 3MC0A 2VXUL 1FG9C 3KYNA 4G9FB 3MUY1 3U9PH 1IGIL 2H32B 4K3JH 1XIWB 1G7HB 3MLYH 1OF2A 1NLDL 2J8OA 2UYLA 3BD4A 3QXTA 4Y4HB 3WFCL 3HNVL 4BZYA 5GRVL 5HVHB 4WW2B 5E56A 1WIOA 5FYLL 4HKZB 1FL3A 4YNYB 2NTFA 1F4WH 1EJOH 2R2CA 3MXWL 4PJ9D 2X4PA 1KNOB 4ZXBD 3O9WD 2K7QA 3LB6D 5AZEL 4HKBB 1HWHB 1IEBB 3OR6B 4MXQD 5HJ3A 4GBXA 1B6UA 2J8UF 5I30H 5CJOL 1N6VA 5MI0B 5HHXL 1W0VB 1CZ8H 2CUIA 4JY6B 3BQUA 4KUZL 1V7MH 1RIUL 3UBXG 4NQTA 3QO0A 2YR3A 4RGNC 4L4JA 2AP2A 4EI5D 2XG5A 4N8VA 2O5YH 3IS1X 3VXRB 2VLKB 3WJLC 3F5WA 3VXSA 1RULL 3GSNB 2P5EA 2YN5A 2HG5A 4ZS6C 1WBZB 4H26B 4ZFGH 1NCTA 2H8PB 5CHNA 4JKPL 5EUKA 3T2QA 2UZIL 1JWSA 1KJ2L 3D2UB 1BJ1H 4JDZB 3EHBC 2EXWC 4DGIH 1FH5L 3VXQA 3HZMA 4QRRB 1HKFA 2GUOA 5BCAA 4K3DL 3VE0A 1RZIB 1YEDA 4JFYB 1NFIB 3QZWB 4HZLA 1LEKB 3MLTA 5C0BD 5C0EA 3CFCL 4PRBA 3WIHL 1HINH 1JPGB 3GMLA 4M7LL 3H2WA 1RY7B 1IKNC 3F12B 2VTFA 5DK2A 4G9FE 4OLUL 3A0OA 2E6PA 5GRZA 5C9JB 3ZTJG 4N5ED 3CFBB 4E0RA 3ALPA 3TESA 5F72S 4NQED 2IGFL 4HIXH 4MAYA 2ZUYA 2AXJA 4M48H 3EIFA 3BPLC 4N5UA 1LP9F 2ATKA 4XMPL 5SWZD 5EOTA 3T3PF 2JCCF 1DUYA 3EUUA 4HT1H 1UH3A 1AP2B 1GGUA 3S34L 3QNYB 4NZTH 2WANA 5F7HA 2ESVB 1DQML 3JV4A 4LCCA 3MODH 3CMOH 3VA6A 5CAYB 2Q87A 4N0UA 5I15L 2AXHA 5I1GH 5HHQB 4YGVA 3IJHA 3VH8B 2BVUA 4D9LL 4MA8H 3IGAA 1CIUA 1QRNB 1L4IA 3ESUF 2QADD 2WWMD 4TPRL 2HFFB 4Z18A 1MHHB 1I1YB 3OB8A 4KK9C 1QO3A 4NO3A 3VXRE 1A64A 1CI5A 1WCBA 1EPFA 4PJHA 2LV4A 4HHAA 1GIGH 3MLXH 3E3QE 3T0DA 1HQ4B 3EFFB 4DGYH 4Q7DA 2J5LB 4TVPL 1ZGLA 1DCLA 3BT2H 1ZA6B 3X14A 4TSBH 1MCKA 1MCSA 4CNIA 4FQ1H 2HJKA 1N26A 4S1SH 2EH7L 2R4SL 3KPMA 4QRRE 2J6EH 5D9SB 3F7YB 1KFAL 1MCOH 1F11B 2H41A 5D1ZD 3LKNA 2GFBA 2LTQB 3ET9F 1LO0H 3HFML 4LP4A 4K7FA 4DVRL 3CC5B 3I3EA 5FO8B 4RISH 1HN1A 1TETL 3SDDC 4O2EB 4M7JH 1H8OA 4QF1B 1W8NA 4OGYH 4MD0B 5GSRB 4KKLC 2EE6A 4JZOA 2CXGA 3TPKA 4APQA 3O6MH 3L5XH 4RQQA 4UU9A 2VDML 4J1UA 4PREA 4H1LB 4YBHA 3O2WH 2CIKA 4AL8L 1CLYL 3KPTA 1FJ1A 4NQXB 2HP4A 1TQCB 3QRFM 5DHXB 2BY2A 5C0IB 5E1HB 3SDXB 4JE4B 1UM6H 4RWYH 5DK3A 3ZKND 5HHOD 3VXPA 1KJMA 3QFJA 2APTA 4LSRH 3VFTA 3IU4L 3SCMA 1D5XB 2P7TB 3FZUD 1KTDA 5GXBB 3H7LA 3CVIH 4JVUA 1I4FA 5J13B 3MJ8A 4RGMC 5J06A 4HGWB 3UZQA 4OD3L 3MLZL 2Q8BH 1JYWA 2Q8AH 3DJ9A 3BD3A 4K71B 4K94C 3HNSL 4BUHA 1WVZA 4WHTB 1QRNE 4R2GB 3CX5J 1LO5A 2FX7L 1R5VB 2X1XR 4QY8B 1ND0A 1RK0A 2OX5A 3NIGF 4WFEE 1OAKL 4ZMAT 5E08L 2NW3B 1KC5L 1S8DA 2CQVA 4GAGL 3LEYH 4JKLA 4ZS7L 3GO1H 4X7SL 3E1F1 3ZHDA 1I9EA 3RAJL 2QR0B 3MGTB 4PJCA 1X6NA 1CGVA 4AM0A 3PGDB 3ZTNH 1JL8A 3ZL4H 1FLRH 2YMXL 2MHAB 5CGTA 4D0CA 1K5NB 4XPHL 4HCRL 3EFDL 4ONHA 5FYLD 1I9JL 3RDTB 3RVXD 3SDAA 4UV4L 3OXRA 3VFNA 5IJKA 1FYTD 3IVKA 3LOWA 1SM3L 4U3HA 3U0PB 2A9ML 4U1IA 2AEPH 5TDOA 3QIBB 5IBTL 4GG6E 4DZ8A 3VFGH 3BPCA 3GMOB 1T6WA 3NVQA 4K7PL 2UZXB 1BFVH 3QWRA 4PB0L 2AXFB 2IANE 3PJSB 5F9JA 3PG2A 4PBXA 1KCRL 5ERWB 3ZE1F 4FXGB 4PB9H 1S7VA 4UUJA 1X5IA 4DN3H 4U1KB 5DI8A 3LEVL 4JPKL 2WUBH 3K2MC 5FKAA 1A3RH 3HC4L 5BRZD 4UIKH 5GZND 1XF2B 4GT7A 1HXMB 3B2VH 2IMMA 2V6HA 3HN3A 4H0IA 4UDUA 1WEJH 3T4AA 4TSAL 5DRWA 3LN4A 4Y4KB 5DD0L 2O5XL 5F7DA 4D0DA 4EI6A 3ROOB 3S37L 4JO1L 3JWDC 3UZEA 1T66D 4KKCC 1N3NA 1T21B 2R0LL 4CW1B 1EXUB 1ZHLA 3ARGD 4RAVB 4OT1L 4Z76A 1RJCA 1WWCA 4V1DA 4Y4FC 2D7MA 4UILL 1BM3L 1BAFL 2D03L 3VWKB 4FG6D 4OZIA 3OGCA 4BQ9A 1JGVH 2X9WA 3FRPG 4R90L 5I1CL 2AK4E 3QUZA 1L7TH 25C8L 3WHXA 3IDNB 5FM8A 4X9HA 5AG8A 3RHWK 1MRFH 2B1AH 3HI5L 3S3JA 4HWEL 1E27B 5K9OA 2FL5B 5GHWL 2H45A 4Q0XH 1TENA 2QL1A 1LE9A 1MWAL 4HUKB 5DC4B 2DMCA 1SEBB 3MRQB 1B4JL 2BX5A 3ARDD 3BGFC 4PJ9B 5E95B 3UTSA 3O9WB 3CH8A 4GKSB 5EC1A 3U79A 1E4WH 2OYPA 5DEGB 2E27L 3NPSB 2RGSA 1JPFA 1M71B 5GPRA 5DS8A 1S7WB 1ONQB 1FAIL 3B4NA 5K9KA 1WCQA 4B53A 1NFDA 4PV8B 1A4KB 1GAFH 4LRIC 4G42A 4JN1L 3THML 1KXQE 4YDIH 1I8MA 1A9BB 4EI5B 1A7QL 4J12A 1RZJL 2ADIA 2DB8A 2IALA 4TVPD 5I1DB 5C6PB 1Q9LB 2PYEE 2VXQH 1C1EH 5JOPD 5ITBH 5IG7B 4WCYL 2ARJA 2ZUTA 1TXKA 3FQTB 5T3ZH 1A0QL 4NC2B 3NIDE 2IQ9H 3DV6B 5SWSA 3KLHC 3LKQA 1CGWA 1BD2D 3LCYA 3VD5A 4BFBD 3MRBA 5LGJA 3T3MF 2CXKA 2VXSL 2Z91A 3FQWB 4W68A 3GGWB 4YHPB 3DUSB 3N9GL 5D96C 1G1YA 3LEXA 5ICYB 1IAKA 5H37H 3BP4A 4X6FA 1UEMA 2R2EA 2F8XC 4X9BA 4FFVD 1XGTA 1OSZB 4U6HB 4XCEB 5BVPH 3V79C 4D3CH 5C3TA 3QDGA 1DE4B 1JGUL 2ERJB 4HJGB 1I1FA 2WINA 1MY7A 1RUAL 3L3OA 4AYFA 3RZCD 3DSFH 1MF2H 5DA0B 1RD6A 1RK1B 1AC0A 2P47B 5D6CB 3UAJC 1FNLA 3DUHA 4LIQE 1EV2E 1C5DA 1QA9A 2JJTA 2AJUL 1ZLWH 3ULUE 4LASL 2Y36L 2R1WA 3BE1L 3PQYE 35C8L 5HHPB 3FQNB 1JZ2A 3RX5A 1H5BB 3V0AC 2X9XA 3LQZB 5EU6D 2C3WA 3BKYH 4OFYD 5JDSA 1Q72H 2PYFA 1FCCA 4I13B 3OV6A 1VFAB 1MFEH 3JTTB 3TBYB 1T4KA 3TA3C 4I8DA 1JFQH 1WC7A 3QO1B 1T0PB 1ZKAA 2QADB 3T1WA 2R2HB 3FQXA 4IMKC 4FFWD 4LPVA 2J1KA 3HS0B 4L3EB 3VGDA 3ARYA 1JGLL 4JJ5A 5EO9B 4Y88A 1KTKE 1F8TH 1U8JB 5F7FA 4LHUD 4OLYH 3EW3B 4RNRB 3PWNA 1OQXA 1KGCE 3VG0H 3OHXA 4K3EH 3GHBH 4FQLH 4KQ4L 3PABA 2NY7H 4MB3A 2BZDA 3DBXA 1RJLB 5CCKL 1S5HA 3BUYB 1V3LA 5CGYC 4XMLL 4I9WD 3X12B 4Z0BL 1I7RA 4IRJA 4LBEA 3QJFB 5EBWB 5GGUB 3SOBL 3KNBB 2F8VA 5FF6A 2BFVL 1JNHB 4KJYA 4EUPH 4PGEA 1TJHH 3KVQA 3EOTH 1KEGL 1YEEL 3RVTD 3VFOB 1ZSDB 5ESAB 2I60L 4Z0XA 5CILL 1IGYA 3SKUD 1CICD 4M8QA 3VFVA 1JYVA 5HGGS 5MEOA 3B3IA 3UYOD 4HLZG 4UINH 2CK2A 3C09C 4BFIB 4JFDB 4ONFH 4NN5B 2I5YL 3BHBB 2VYRE 3KPSD 3T8XB 1NEZB 4OM0L 3NABL 1GC1H 4NKIH 1MJUL 3QYCA 3FO0L 1FVCA 4ODXB 3BX7C 4L5FL 1U58A 3CZFB 2VXVL 5ENWA 5HHOB 3QZWG 1FFRA 4YDVA 2WQRA 3LD8C 4FQIH 5E2UL 2FJHB 2A0LC 2NYYD 1OM3H 5I17A 1XMWA 1NCCH 4LMQE 3EO9L 1QG3A 3BZFA 3HPLB 2ADFH 1KPVB 3DRTA 1UACL 4YO0A 4P5TB 4U1JB 4JM2F 4L3EE 4B0MM 4QYOA 2FO4A 2CLZA 1MPAL 2R69L 2I07B 3OQ3B 4POYA 5K9JL 1J1PH 4JANB 2FWOB 3UJTL 4I18A 1ZHNA 1GGYA 3MJ9L 4PRPD 3SGDI 1I85A 4M7ZB 4FZ8L 4P23C 2XY1A 3SKOA 5HI5D 4KHTH 1W72B 3VH8G 3O4OB 2CGRL 4R7DB 5I16B 1OGTB 2XPGA 1TZGL 3KHQA 1NJ9B 4M1GL 4PG2C 3WD5H 2EYTA 1X3DA 3NFPA 2DQDL 3QPQC 4X4ZA 4QEGA 5C0CD 3BQUC 2XQYK 4L8BB 4LLQB 4LEOA 1JIBA 2VL5A 1GHFL 4Y19D 2VB5A 5C09E 4KTDH 1H3GA 3FTGA 4I3SH 5I18H 3GUTB 3JBG7 4JFDE 4K07A 1H3XA 4KRPC 3V4PL 3RPKA 5D2NB 3WKML 4J3VA 2NY5C 5E6YA 1MREL 3BKMH 3RWGB 3Q6FA 3T2OA 4F7EB 1XR8B 2OQJB 1G6RL 4HJ0C 3KPRE 1O0VA 3BFOA 4YGAB 5HHMD 3HHRB 5HHOE 5BRZB 2QKIA 1WICA 1XH3B 2IMNA 5LAXB 5L6YH 5I1LB 3DX6A 1KJ2B 3EOBA 1U36A 2X10A 1MCRA 2ARWA 4LAQH 1CLOH 4WHYG 4ELMA 3O6KL 3G6JA 3QUKA 5GRYA 4IM8A 1WQVT 3ZE0E 4H1LG 3E6HB 3RWHB 4HJJL 2X7LB 3ARGB 3UTTB 4XNMB 1C7SA 4FNLL 4LCWA 1DBAL 3O2DL 5JW4N 3GMRA 5D7JC 1E4XH 1QBLL 4U6XB 4KC3B 4NPYB 3WXWL 4X6DA 5IBUB 2F5AH 2NY3C 5INCB 4DZBB 2G2RA 4GAJL 5DZNA 5J6GB 1WZ1L 2NX5A 1EEZB 1PSKH 1YN7A 5T33L 5ETUA 1T5WB 3S35L 5CBAA 1YEGL 3GK8H 4PUBL