5F3JA

Crystal structure of dbp in complex with inhibitory monoclonal antibody 2d10
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
251
Chain Sequence
b'YKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKITDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Broadly neutralizing epitopes in the Plasmodium vivax vaccine candidate Duffy Binding Protein.
pubmed doi rcsb
source organism Plasmodium vivax (strain salvador i)
molecule tags Immune system
total genus 88
structure length 251
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5f3jA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 5f3jA01
3C64A 2YK0A 3CMLA 3CPZA 4NUVA 3RRCA 5F3JA 4NUUA 3BQKA 3BQLA 2Y8DA 2WAUA 2XU0A 3BQIA 4YFSA
chains in the Genus database with same CATH superfamily
2FBWA 2XTLA 2OA5A 4HFEA 5FVKA 5LB7B 2PFVA 3U78A 4TNVA 2WZKA 2WBLA 2V7JA 1SE7A 4CN1A 1N36T 1LRZA 2IDOB 3PV0F 2IHR1 2CHNA 2E2AA 2BS3A 3C64A 4HFHA 3OBVE 4DO0A 3NRXA 2G0UA 2UXNB 2X68A 3BQIA 3HL6A 5FKYA 5AQHB 2XQ9A 1KFYA 4OX9T 1OEDE 5AQVB 2WU5A 4ANJA 3ABVA 5LMUT 5CJ5A 4EEDA 3HA4A 2L9QA 4OYKA 5AQNB 4KI0F 2WDQA 2BS2A 5IUXA 3B13A 3ZYMA 4K0UA 3Q5XA 1NENA 4ZI2D 1XZYA 4YSYA 2WMOA 4C91A 1I94T 2A2FX 3ONXA 2VKJA 1HG2A 3PE0A 2CXDA 4U72A 4BJNA 2JMKA 2YEVC 2VKDA 2NTYA 4CXWA 3RYHE 2YINA 1HFAA 2X66A 2CWOA 4NUVA 4DR5T 1MMAA 2H7OA 4KX6A 4HKAA 2ZM8A 5AQPB 3MXZA 2KT9A 3FHNA 1QLBA 1D1AA 3RYIE 5JQGE 4AKGA 3T1YT 3EAMA 4QHOA 4WNKA 3DQVC 1O3XA 3A5XA 3IHRA 3PJAA 5LOVE 2EHOA 4H63H 4UR9A 4TV9E 4GYRA 3E0ZA 5ABFA 2Y6XA 5LCYA 3AA7B 1NWMX 2PTFA 4H9PC 2WDRA 2A3DA 5E0OA 4DR6T 2KMFA 2W2UA 5C8YE 1HNWT 4YHHT 5AQOB 3ZEFB 3JC6C 1W9RA 3RYFE 2VQFT 1V9DA 3ZC1A 2LSGA 2XU0A 4B6XA 1NAFA 4ZI3C 3RIFA 1WYCA 5L3GB 3WAKA 3KVBA 2RPAA 4HWCA 3R84B 3KV5A 2LEHA 1QSDA 4N78D 3I0OA 2DHRA 2WP9A 2J1DG 4DV0T 5AQKB 3ZSTA 3EI0A 5AQQB 2LSIA 5J0ZA 1IBKT 4IDOA 5HCMA 2V6YB 3MKDA 2N1GA 1SUMB 3UU3A 5HEJA 3PUZF 3ZPOA 4I0UA 1WFDA 2IIUA 5AFUL 2W63A 2EHOD 4CN4A 2J62A 3F57A 2LRLA 1L0VA 4JLEA 3KFWX 4TWDA 2MBGA 4ZEYA 5ABHA 2LE8A 2X67A 5JREA 5JR9A 3PUGA 3UU6A 4O4JE 4QXCB 2H3RA 2K9AA 3ZSSA 5JVDE 2D5UA 4X64T 4JI2T 5LP6E 3K3OA 4JI8T 4B3ST 4TWHA 2AXDS 4H9RC 3ZCIA 2FJAA 5A1LA 4WQOD 5DQWA 3ZLIA 3AE2A 3C4WA 2CM0A 5ETWA 3AEEA 3KVAA 2K5BB 3LG7A 1Z0PA 3C4ZA 4ZS3A 5DABA 5IYZE 2XAFB 2LSJA 3CWZB 4IDZA 1E7PA 3FZLB 1KF6A 3EDUA 3H3MA 3AE7A 2VVNA 5HXSA 4YJ2E 4LF5T 3CVRA 3J7Yq 4X66T 2KLQA 5F8PA 4UVCB 2KXPB 1IJ5A 3H37A 3RI5A 2H88A 3C51A 3X1DA 5JDQA 3ZT5A 2LOPA 4P0BA 3RHWA 3LK2B 4DMWA 3TLTA 3OPCA 4EAHA 2VWAA 5L3EB 1X9BA 4DR4T 2BDEA 2CRBA 4ERRA 3EUHA 5LNKA 2NW9A 4YY3T 2X0HA 3PUVF 4DR1T 4B3TT 2J4GA 2BG9C 4JI3T 3MJXA 4MLKA 2UUCT 4GKKT 1QUUA 4NXMT 3UTKA 3P7IA 1KK7A 4HWDA 2XUEA 3PUQA 3J9X1 2XJ7A 4LMKA 4A98A 1Y01A 2YOEA 3ANWA 4IE6A 5LXTE 1FEWA 2JPFA 3JC6D 4U31A 2CLYC 2N9DA 5BR8T 5FXXA 3QUJA 5HXEA 2W67A 4IDQA 5HEHA 2W0GA 3RQUA 2XQ4A 5FL1A 4UV9B 4HXIB 4ZI3D 4AIUA 3Q5WA 4ILCA 2LJLA 4JEUB 2UXBT 4IDNA 5FXVA 4PAGA 3TLSA 3M3ZB 2E9XA 2VKOA 4QWNB 2KNDA 3RIUC 3H3AA 4WZXA 2W4XA 1ZEEA 4BJMA 2BG9B 4I55E 4FJOA 3OVUA 4ISSA 2WQYA 3JADA 5JDHA 4K0KT 3MK7C 4KP3C 2C5KT 2HN2A 3AEDA 1X79A 4DBQA 2DCFA 4AP2B 2LOSA 1MIVA 2DWKA 1IAPA 1IBLT 1UUSA 4AKIA 3ZCJA 5HXHA 2CLYB 5L4HA 2A72A 4EV6A 3WAJA 2FJEA 4YTNA 3JAFA 4DBRA 3ZT7A 4MHCA 1M62A 4U33A 4AQYT 2FJDA 4QX8B 1VRBA 1UCUA 2ZM2A 1MNEA 4MALA 2XM1A 1B7TA 2ACZA 5LJNA 2C5JA 4TN7B 4EOZB 4PJNA 3ZKRA 4YHJA 3UU5A 3D0TA 3KDSE 4AI6A 4G2AA 3RYCE 3N9QA 4JI0T 3N9LA 3ZJ2A 1MIWA 2IC9A 2EHOC 3B5MA 2KWHA 2NOXA 3MZKB 3UT5E 3KV4A 2UU9T 4HTEA 2D0UA 2IW5B 4O2BE 5HWYA 2WY2A 4IGUA 1ZV4X 4HGAA 2NR4A 1JNRA 3BQLA 4XBFB 2YN6A 4QXHB 4ZHQE 5L3CB 3MACA 4E7ZA 2Q9QD 3I0QA 4H63V 3PU8A 3P4RA 2E5VA 3K8PC 3PDYA 4NPPA 2WZHA 2LSYA 4JBWF 3I9WA 1OEDA 4TNWA 2XQ5A 3VR8A 4P5OA 2WAUA 2XM2A 3IEEA 4ZZBA 5AQMB 2W00A 2LM9A 2XASB 1OWAA 1G73A 5L2LA 3NRYA 2XAQB 1XNQT 2AE9A 5FY0A 3AEFA 3QB5K 1N34T 3GN5A 2K3WA 2VQET 2EHOB 5LHIB 4EYYR 4JI6T 2ES0A 2V5CA 2B76A 2VKHA 3CX7B 1HS7A 3LSVA 2UUAT 3EVYA 3AE9A 4ILAA 3F2EA 3SS1A 2WWVA 3FZHB 1LVFA 3UUNA 1XMQT 3PUXF 4TV8E 4A64A 3TLUA 4P0AA 2V7LA 2QVAA 2VVSA 3K3NA 2LT3A 3OJAA 4YTMA 5FMNA 2DLRA 5KMGP 4LF8T 3OKQA 4EXTA 4DUYT 1CUNA 4A97A 3P4PA 4LFCT 4Z90A 2XY8B 5JR9C 3ETUA 4HN9A 5ABEA 5TAOA 3GWHA 3T1HT 5FXZA 3AE5A 4UELA 3QB5A 5HEGA 5L3DB 2NW8A 5M4YA 2QGSA 4AXPA 3P50A 5AQFB 2NP9A 4ZXLA 2V6XA 1D1CA 4L0RA 4TWFA 4CQIA 4XAXB 1YKEB 1KEYA 3VU7H 5HEOA 4KBMB 3U3IA 1UURA 4ASKA 4E7SA 3B57A 4YXDA 3PTRB 4JI7T 2LRKA 3PUYF 4U74A 5J2TE 4H9OC 3O1HA 5FNVE 2CMRA 5L4EA 4LF4T 2IUBA 2HPJA 4CZZB 4MFRA 1ZP0A 5EK4A 4UEMA 3BK9A 5JR9B 3VHLA 1HR0T 4C90A 2LLYA 1T72A 1W09A 3LFMA 4J2CA 4CI2B 1WRDA 2C0SA 4PW8A 3RC3A 3AE3A 2V1DB 2YU2A 3ETVA 4LF6T 4HFIA 3UFGA 4X1IE 4XZCA 2L3LA 3RF1A 5BMVE 3KINB 3NZQA 3SRZA 5LGTB 4GKJT 3QK6A 2ODUA 3AXJA 3PUWF 1U5PA 2ZM0A 4QXBB 4WBNE 4KHZF 4UF0A 3SWHA 5JDGA 4QH5A 3FBLA 4Z8XA 3DP7A 1E1HB 3R6NA 1YQ4A 3Q5EA 2YKSA 3PURA 4OYJA 2OLTA 2VASA 4PK5A 1WR6A 3AA0B 3UQ7A 1J1JA 3AVSA 5C2TA 3HR0A 3P4WA 3S4UA 3L09A 4PJJA 5HXRA 3N2GE 5EK2A 3OYXA 2BBJA 5CGMA 4BAYB 4DV4T 4WW0A 2XAGB 4ADZA 1UK5A 4COFA 4N9F3 3VKGA 3ZC0A 2V6YA 3ONLC 4UVBB 1LDJA 4O8SA 4IL9A 3ZMTB 2LHRA 1FMVA 3RKOA 4PK4A 3LK3B 5KDMC 2JQQA 2VL0A 4LMLA 1SHZC 3VR9A 2XQ3A 5ADXL 3ZT6A 2Q9QC 2BVLA 3LBXA 3C50A 4PFPA 3ANWB 4I43B 4GK5E 1E2AA 5AQSB 3O1IA 5JTGA 3FBZA 5JRCB 1D0ZA 2MTQA 1BR1A 2PG8A 4O4LE 4IE7A 1IBMT 4NXNT 4IE5A 2YDRA 4DUZT 2DL1A 3GMIA 4JYAT 3OYZA 3I1AA 5H6RB 4AQFC 2LHNA 3I9YA 4ZS2A 1FMWA 1VOMA 2WU2A 1G8XA 1FIOA 3RC8A 3L3PA 5CB4E 4YSXA 2V7IA 2HH7A 1J5WA 1LDKB 4DR3T 4P1NA 5HYAA 3RIAA 2D2SA 4AISA 4IIJE 1BR0A 4DIDB 4UV8B 4B3MT 2M67A 4YJ3E 3NWIA 4HFBA 1R8IA 3C4XA 1KNPA 3ZMZB 2Q9QB 2C5IT 4O4HE 4LMJA 2Z6EA 2ACXA 3NBXX 2BVMA 4O2AE 4QH1A 3CQCB 2E5LT 1D1BA 4GIWA 1FJGT 5HEUA 1KNZA 4I50E 2JQHA 3ZN0B 3QNUA 2Y8DA 2E8IA 3UU8A 4CI1B 5CFBA 4ISTA 3AE1A 2FUPA 2VURA 1XWMA 2CBIA 2DI4A 2WB5A 2WM9A 2IC6A 1T7SA 3OTOT 3A8YC 2VB6A 5ABGA 1OEDC 4DV1T 2WSSV 4OK0A 3TLVA 4ZI7E 1HX1B 4HE8A 4DV5T 1WCRA 1KNRA 3CMLA 3UQ4A 3CK6A 1VCTA 2XQAA 3EABA 4JEHB 5LHGB 2W61A 2HN1A 3MA9A 1YW0A 4U7IA 4FI5A 4EB6E 5JDNA 3SOLA 4HWFA 1HTJF 4LFBT 2KWIB 4GOUA 4X65T 2XZEA 2XQ8A 3TKLB 1UGOA 1MNDA 5FL0A 3N5LA 2WWUA 2XQ6A 5HAXA 2XSBA 1OEDB 2XQ7A 1OXZA 3AAAB 1SA0E 2CBJA 2BG9A 3N2OA 4EYUA 3AECA 2CA5A 4H9QC 4QX7B 3TLWA 4ILBA 3L8RA 2E9XD 5AQGB 1XMOT 3P8CD 1N32T 2BG9E 2CHOA 4NIQA 3GN5B 4YSZA 4IDPA 4EEBA 1MMNA 4X1KE 5FVLA 2D9DA 4PFOA 3AE4A 3NZPA 3CIRA 3DTOA 2BZBA 3IBPA 2N2NA 3HKBE 3RH3A 4DV3T 1IJ6A 5LGUB 5AQLB 2BKNA 4HEAA 3PUSA 3RIUA 4JI4T 5EZYE 2BKPA 2XAHB 3UULA 2K24A 2NTXA 3ZMSB 4AQGA 2B1EA 4Q25A 3QC9A 4H9NC 2BS4A 5FP3A 4QKNA 3LK42 3V5SA 4ZZCA 2ODVA 2QYWA 3Q2MA 4O4IE 2BBHA 3N9PA 5DJQC 4LF7T 3CQXC 3LDQB 5ABFB 2YU1A 1W0AA 3KBUA 4AKRB 3FXDB 1D0XA 1DU2A 5FY1A 1W0BA 1MMDA 2LKGA 2MYSA 3P4QA 3AE8A 4PJLA 5FY7A 4DVDA 3ESLA 2KZ7B 2K48A 3CPZA 4H9SE 2HPLA 3N9OA 1J5ET 4HWHA 1N33T 2X0YA 2X0LB 2W62A 1GQEA 3G06A 2JJ9A 2XPKA 2CE7A 4TUYE 2XSAA 4AKLA 2A9UA 2JRKA 4X1YE 1D0YA 2VL8A 4X20E 4U2YA 2QRXA 4I4TE 2CEAA 1WLXA 3IF8B 1LKXA 1U4QA 2M6IA 3Q5DA 4X62T 2SPCA 3FXEB 4JI5T 4UIGA 1T8BA 3AXJB 1HNZT 4UXNB 1JNZA 1IZNB 2WZIA 2WCAA 2D0TA 1VCSA 3K3QC 1ZHCA 4DV2T 4UF0B 2YK0A 4EGWA 3QOFA 5AQRB 3FZFB 3ONJA 3VKHA 2NW7A 3CX6B 4KMCA 3W15B 1AJ3A 4HFDA 1S94A 4P09A 5GONE 2M6BA 5L47A 4IE0A 2X9WA 3AAIA 5LHHB 4U2ZA 4DV6T 2R6GF 5EK3A 4OFZA 4AKHA 1NEKA 5AQTB 1HG5A 4MBQA 3FZMB 4A5XA 2V5DA 4HFCA 3ZJ1A 4X5TA 3L39A 1HX8A 4EZ4A 2IAKA 3WI3A 4CXXA 4WBOA 3K1SA 3PUAA 2JQ9A 2XQYA 4APFB 3KV6A 4GK0E 1Z8UA 3HKEE 5CA0E 5IWAT 2V8SV 4IE4A 2UXDT 2LKHA 5DQVA 2CPTA 5JH7E 3ZMUB 3AE6A 3BQKA 3LBXB 3UUXB 4L9IA 5HXCA 5F3JA 2X9YA 2WDVA 4DV7T 1CHUA 3C98B 1ZOYA 1Y64B 2E9XC 3AVRA 3LJCA 2KSRA 2YDQA 2V7MA 3DPLC 4YTPA 1HCIA 4LFAT 5F5WA 5J2UE 1WYBA 2BKOA 2H7VC 2WS3A 2OV9A 4U3CA 2ZMAA 2PBIA 4QH4A 2YDSA 4TZ4C 3VRBA 3DJBA 5LA6E 5CA1E 3RPUA 4CN6A 3AEGA 2MAWA 1MIYA 4DNDA 3E08A 5KXJA 3VRAA 1YQ3A 1I6ZA 5LG3A 2CXLA 3AB3B 3AA6B 2MOZA 3Q9DA 3UFEA 4GYSA 3ZN1B 3EDVA 4M1PA 5AQUB 1S35A 2RP4A 3T8OA 5JDFA 1HF8A 4PK6A 3AEAA 2V26A 2E9XB 2RA1A 2X51A 2L8KA 4JUYA 2WMNA 2NWBA 4WYVA 5LBMA 3NKZA 3ZYLA 3UUMA 2P9BA 3EHZA 2CXFA 3O1JA 5LGNB 3ZMVB 3F31A 3JAEA 4F6RC 4A56A 3E22E 3UUBA 4ZI2C 4F8HA 5AQIB 4L5GA 3KBTA 5HWXA 2W66A 2CWYA 4F52A 3CQGB 1LVKA 4HFVA 5LG4A 1XNRT 3HKDE 5HCJA 2I0MA 2V7KA 5FXWA 4UVAB 1YXRA 3PJAJ 4EZHA 2Y48B 3HKCE 5H6QB 3N2KE 4DR2T 2J47A 1XDOA 5J1GA 3AAEB 5JRCA 5LBQB 2X9XA 3HI2A 5L3BB 3SFEA 3IA3A 4JI1T 2JMHA 3RRCA 3FB2A 5C3JA 4DR7T 3RLFF 3CX8B 3V5UA 2DNXA 3M65A 3SFDA 3N9NA 1US7B 4JGHD 4KHPT 3GA8A 1H7CA 1EZ3A 2VK9A 5JDLA 4U7YA 2IMLA 3AEBA 2I6HA 1M7KA 3P4SA 1LDKA 1BR4A 5LMNT 4G63A 3RGLA 1ZKEA 3AA1B 4TX5A 2PJQA 4YT0A 3KV9A 4OHFA 3RKGA 3N9MA 2Q9QA 5LJMA 4B3RT 4YLHA 4IREA 4DMVA 2X9HA 4YFSA 3ZYKA 5IHYA 5L3FB 2FJBA 5LYJE 5FYMA 2DWGA 1YKHB 2H89A 4JV5T 4BA9A 3O9XA 1UX4A 2UUBT 4KUMB 2KINB 4AQFA 4LF9T 5KX5E 4ILUA 2I59A 1WR0A 2QA7A 4IL4A 2XAJB 3RQWA 2MPKA 2LM2A 2JQKA 1U6GA 4HWIB 1UX5A 4IT4A 2F4VT 2HHHT 2UXCT 4CXYA 4IHJE 3RRWA 4ZOLE 3PU3A 3RTRA 4NUUA 4V1Av 4Z91A 3A7MA 4PNIA 1YD8G 1BR2A 3O4XE 3FZKB 3NVOA 4CI3B 4PJMA 1MMGA 3UU4A 1XDPA 4EIWA 3CKDA 2ZM6T 2GK9A 1HNXT 3JCFA 2LSKA 2CCQA 5JDMA 3RX6A 1T98A 5AQJB 2JIWA 2UXXB 2XHEB 2ZLYA
chains in the Genus database with same CATH topology
2XTLA 5FXVA 2OA5A 2XAGB 4PAGA 4UIGA 2E9XA 4ADZA 2VKOA 4QWNB 2KNDA 4UXNB 3H3AA 2PFVA 3VKGA 3ZC0A 1IZNB 3U78A 2D0TA 2LJLA 2WBLA 2V7JA 4UVBB 1ZEEA 4O8SA 1LRZA 4BJMA 3K3QC 1ZHCA 4I55E 3ZMTB 2LHRA 4FJOA 1FMVA 4UF0B 3C64A 2YK0A 4ISSA 3RKOA 5JDHA 3OBVE 4DO0A 3NRXA 3MK7C 4PK4A 3VKHA 4KP3C 2C5KT 3LK3B 2G0UA 5KDMC 2JQQA 2UXNB 1SHZC 1X79A 5ADXL 2X68A 3BQIA 4DBQA 2NW7A 3HL6A 2Q9QC 3CX6B 2DCFA 4KMCA 3W15B 1AJ3A 2BVLA 3LBXA 2LOSA 1S94A 3C50A 1MIVA 2DWKA 4P09A 4PFPA 5GONE 1IAPA 3ANWB 4I43B 4IE0A 2X9WA 4AKIA 4ANJA 4GK5E 3AAIA 3ZCJA 5LHHB 5HXHA 3HA4A 2CLYB 2L9QA 4OYKA 3O1IA 3FBZA 5JRCB 1D0ZA 2A72A 2MTQA 1BR1A 2PG8A 5EK3A 3WAJA 4OFZA 4AKHA 3B13A 4IE7A 4O4LE 3ZYMA 4IE5A 4K0UA 3Q5WA 3Q5XA 4ZI2D 1HG5A 2WMOA 4DBRA 4C91A 4MBQA 4MHCA 3GMIA 2A2FX 3I1AA 3OYZA 5H6RB 4AQFC 3ONXA 2LHNA 2VKJA 1HG2A 3PE0A 2CXDA 3I9YA 4U72A 4BJNA 2JMKA 4QX8B 4ZS2A 1FMWA 1VOMA 2NTYA 2VKDA 1VRBA 2YEVC 3ZJ1A 4CXWA 1G8XA 1HX8A 3RYHE 1FIOA 4EZ4A 3RC8A 2IAKA 2YINA 1UCUA 3WI3A 4CXXA 2ZM2A 1MNEA 3L3PA 5CB4E 2V7IA 4WBOA 2HH7A 1HFAA 4MALA 3PUAA 2X66A 1B7TA 2CWOA 2XQYA 5LJNA 4NUVA 3KV6A 1MMAA 4GK0E 5HYAA 2C5JA 2D2SA 2H7OA 4TN7B 4EOZB 3HKEE 5CA0E 4IIJE 4PJNA 1BR0A 4HKAA 2ZM8A 4UV8B 4YHJA 2M67A 3D0TA 3KDSE 4YJ3E 4AI6A 3MXZA 4IE4A 2KT9A 5DQVA 3FHNA 3C4XA 5JH7E 1D1AA 3RYIE 3ZMUB 5JQGE 4G2AA 3RYCE 3ZMZB 2Q9QB 2C5IT 4AKGA 4O4HE 3BQKA 3LBXB 3N9QA 3UUXB 4L9IA 2Z6EA 4QHOA 4WNKA 2ACXA 3N9LA 1MIWA 5HXCA 1O3XA 3A5XA 3IHRA 3NBXX 5LOVE 3ZJ2A 5F3JA 2BVMA 2IC9A 4O2AE 3CQCB 2EHOC 2EHOA 4H63H 2KWHA 1D1BA 4GIWA 2NOXA 3MZKB 3UT5E 4TV9E 3KV4A 4GYRA 4HTEA 1KNZA 2D0UA 3E0ZA 4I50E 2IW5B 2X9YA 4O2BE 5HWYA 2Y6XA 3ZN0B 4IGUA 5LCYA 3AA7B 2Y8DA 2E8IA 3C98B 1ZV4X 1NWMX 1Y64B 4HGAA 4CI1B 4H9PC 4XBFB 3BQLA 2E9XC 3AVRA 3LJCA 4QXHB 4ZHQE 2V7MA 5L3CB 1HCIA 4ISTA 3MACA 2A3DA 5J2UE 4E7ZA 5E0OA 2DI4A 1WYBA 2Q9QD 3I0QA 2H7VC 2WM9A 4H63V 2KMFA 2IC6A 3PU8A 3K8PC 3PDYA 2VB6A 5C8YE 3ZEFB 2ZMAA 2LSYA 3JC6C 3I9WA 2PBIA 3RYFE 4TZ4C 1V9DA 3ZC1A 3DJBA 2WSSV 2WAUA 2LSGA 2XU0A 5LA6E 4OK0A 5CA1E 4B6XA 1NAFA 4ZI7E 4ZI3C 3RPUA 1WYCA 3IEEA 5L3GB 2W00A 2LM9A 3WAKA 4HE8A 2XASB 1OWAA 1G73A 1MIYA 5L2LA 3NRYA 2XAQB 4DNDA 3KVBA 3E08A 5FY0A 3R84B 3KV5A 3GN5A 2LEHA 3CMLA 1QSDA 4N78D 2EHOB 2CXLA 5LHIB 3I0OA 3AB3B 2DHRA 3AA6B 2MOZA 3Q9DA 3UFEA 2J1DG 4GYSA 4EYYR 4JEHB 3ZN1B 2ES0A 5LHGB 2VKHA 3CX7B 2W61A 3EDVA 4M1PA 1HS7A 1S35A 2RP4A 3MA9A 3T8OA 3EVYA 1YW0A 3F2EA 5JDFA 3SS1A 1HF8A 4FI5A 4PK6A 2LSIA 4EB6E 2V26A 2E9XB 2RA1A 5JDNA 3SOLA 1LVFA 3UUNA 2X51A 2L8KA 4JUYA 2WMNA 4TV8E 1HTJF 2NWBA 3MKDA 4P0AA 2N1GA 2KWIB 5LBMA 4GOUA 3ZYLA 3UUMA 2V7LA 2P9BA 2CXFA 3O1JA 5LGNB 3K3NA 3TKLB 3ZPOA 2LT3A 1MNDA 3N5LA 2WWUA 3ZMVB 3F31A 3OJAA 5FMNA 5HAXA 5AFUL 2W63A 4F6RC 2DLRA 2EHOD 1OXZA 4A56A 3AAAB 5KMGP 3OKQA 1SA0E 4EXTA 3F57A 3E22E 3N2OA 4JLEA 4EYUA 4ZI2C 3KFWX 1CUNA 4L5GA 2MBGA 2CA5A 3KBTA 5HWXA 2LE8A 2CWYA 2X67A 4H9QC 5JR9C 4QX7B 5JR9A 5JREA 3ETUA 3PUGA 2E9XD 4HN9A 3CQGB 1LVKA 4HFVA 5LG4A 3P8CD 5TAOA 3HKDE 3GWHA 3GN5B 5FXZA 2V7KA 4O4JE 5FXWA 4UVAB 4UELA 4EZHA 4QXCB 2Y48B 2H3RA 2K9AA 5L3DB 2NW8A 2D5UA 5JVDE 1MMNA 3HKCE 4X1KE 5H6QB 5M4YA 2QGSA 4AXPA 3N2KE 4PFOA 3NZPA 2NP9A 5LP6E 3K3OA 5J1GA 3AAEB 2BZBA 3DTOA 3IBPA 5LBQB 1D1CA 2X9XA 4L0RA 3HI2A 4H9RC 5JRCA 2N2NA 3HKBE 3ZCIA 4CQIA 5A1LA 5L3BB 4XAXB 5DQWA 3ZLIA 1YKEB 2JMHA 3RRCA 3VU7H 3FB2A 3RH3A 3C4WA 2CM0A 4KBMB 3CX8B 5ETWA 3U3IA 3KVAA 3V5UA 2K5BB 4ASKA 2DNXA 4E7SA 3B57A 3PTRB 3LG7A 1IJ6A 3M65A 3N9NA 1US7B 1Z0PA 5LGUB 3C4ZA 4ZS3A 5DABA 5IYZE 3GA8A 4U74A 1H7CA 4HEAA 3PUSA 1EZ3A 2LSJA 2XAFB 3CWZB 5J2TE 2VK9A 4H9OC 4IDZA 5EZYE 5JDLA 3O1HA 5FNVE 2XAHB 3UULA 2K24A 2NTXA 3ZMSB 4AQGA 3EDUA 2CMRA 2B1EA 3QC9A 4H9NC 5HXSA 4YJ2E 5FP3A 3CVRA 1BR4A 3J7Yq 4QKNA 4G63A 2HPJA 1ZKEA 3AA1B 3LK42 4MFRA 4CZZB 2KLQA 3V5SA 5EK4A 4UEMA 3BK9A 5JR9B 2ODVA 3VHLA 5F8PA 4TX5A 4UVCB 4O4IE 3Q2MA 2PJQA 4C90A 2KXPB 1IJ5A 3KV9A 4OHFA 3H37A 3N9PA 3N9MA 2Q9QA 3C51A 3LFMA 5JDQA 5DJQC 4J2CA 5LJMA 3CQXC 4CI2B 4YLHA 2YU1A 2LOPA 4P0BA 3KBUA 4AKRB 1WRDA 3FXDB 1D0XA 2C0SA 4PW8A 3RC3A 5FY1A 2V1DB 2YU2A 1MMDA 2X9HA 4YFSA 4DMVA 3ZYKA 3LK2B 3ETVA 4DMWA 5IHYA 2MYSA 5L3FB 4EAHA 4X1IE 2VWAA 5L3EB 4XZCA 5LYJE 5FYMA 2DWGA 2L3LA 1YKHB 4PJLA 5BMVE 2BDEA 4BA9A 3O9XA 5FY7A 3KINB 3NZQA 3SRZA 3ESLA 4DVDA 5LGTB 4ERRA 1UX4A 4KUMB 3QK6A 2KZ7B 2ODUA 2KINB 4AQFA 2K48A 3EUHA 3CPZA 4H9SE 2HPLA 5KX5E 4ILUA 2I59A 1U5PA 3N9OA 2NW9A 5LNKA 2QA7A 2X0LB 2W62A 2XAJB 2ZM0A 4QXBB 4WBNE 4UF0A 3SWHA 5JDGA 3MJXA 3FBLA 4Z8XA 4MLKA 2JJ9A 1UX5A 3DP7A 1E1HB 2CE7A 3R6NA 4TUYE 1QUUA 3UTKA 3P7IA 1KK7A 2XUEA 3PURA 3PUQA 4OYJA 4CXYA 4AKLA 3J9X1 4IHJE 2VASA 4PK5A 1WR6A 3AA0B 3RRWA 4ZOLE 3PU3A 2JRKA 4X1YE 1D0YA 3AVSA 4NUUA 4V1Av 2VL8A 4X20E 3ANWA 4IE6A 4PNIA 4I4TE 5LXTE 2CEAA 1YD8G 1FEWA 1BR2A 2JPFA 3O4XE 1WLXA 3IF8B 3HR0A 3JC6D 4CI3B 4PJMA 1MMGA 3S4UA 2CLYC 3L09A 4PJJA 5HXRA 4EIWA 1LKXA 3N2GE 2N9DA 1U4QA 3CKDA 5FXXA 5EK2A 3OYXA 3QUJA 5HXEA 2W0GA 2SPCA 2GK9A 4UV9B 3FXEB 4ZI3D 4BAYB 2LSKA 2CCQA 5JDMA 3RX6A 1T98A 2UXXB 2XHEB 4WW0A 2ZLYA 4JEUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C64 A;  2YK0 A;  3CML A;  3CPZ A;  4NUV A;  3RRC A;  5F3J A;  4NUU A;  3BQK A;  3BQL A;  2Y8D A;  2WAU A;  2XU0 A;  3BQI A;  4YFS A; 
#chains in the Genus database with same CATH topology
 2FBW A;  2XTL A;  2OA5 A;  4HFE A;  5FVK A;  5LB7 B;  2PFV A;  3U78 A;  4TNV A;  2WZK A;  2WBL A;  2V7J A;  1SE7 A;  4CN1 A;  1N36 T;  1LRZ A;  2IDO B;  3PV0 F;  2IHR 1;  2CHN A;  2E2A A;  2BS3 A;  3C64 A;  4HFH A;  3OBV E;  4DO0 A;  3NRX A;  2G0U A;  2UXN B;  2X68 A;  3BQI A;  3HL6 A;  5FKY A;  5AQH B;  2XQ9 A;  1KFY A;  4OX9 T;  1OED E;  5AQV B;  2WU5 A;  4ANJ A;  3ABV A;  5LMU T;  5CJ5 A;  4EED A;  3HA4 A;  2L9Q A;  4OYK A;  5AQN B;  4KI0 F;  2WDQ A;  2BS2 A;  5IUX A;  3B13 A;  3ZYM A;  4K0U A;  3Q5X A;  1NEN A;  4ZI2 D;  1XZY A;  4YSY A;  2WMO A;  4C91 A;  1I94 T;  2A2F X;  3ONX A;  2VKJ A;  1HG2 A;  3PE0 A;  2CXD A;  4U72 A;  4BJN A;  2JMK A;  2YEV C;  2VKD A;  2NTY A;  4CXW A;  3RYH E;  2YIN A;  1HFA A;  2X66 A;  2CWO A;  4NUV A;  4DR5 T;  1MMA A;  2H7O A;  4KX6 A;  4HKA A;  2ZM8 A;  5AQP B;  3MXZ A;  2KT9 A;  3FHN A;  1QLB A;  1D1A A;  3RYI E;  5JQG E;  4AKG A;  3T1Y T;  3EAM A;  4QHO A;  4WNK A;  3DQV C;  1O3X A;  3A5X A;  3IHR A;  3PJA A;  5LOV E;  2EHO A;  4H63 H;  4UR9 A;  4TV9 E;  4GYR A;  3E0Z A;  5ABF A;  2Y6X A;  5LCY A;  3AA7 B;  1NWM X;  2PTF A;  4H9P C;  2WDR A;  2A3D A;  5E0O A;  4DR6 T;  2KMF A;  2W2U A;  5C8Y E;  1HNW T;  4YHH T;  5AQO B;  3ZEF B;  3JC6 C;  1W9R A;  3RYF E;  2VQF T;  1V9D A;  3ZC1 A;  2LSG A;  2XU0 A;  4B6X A;  1NAF A;  4ZI3 C;  3RIF A;  1WYC A;  5L3G B;  3WAK A;  3KVB A;  2RPA A;  4HWC A;  3R84 B;  3KV5 A;  2LEH A;  1QSD A;  4N78 D;  3I0O A;  2DHR A;  2WP9 A;  2J1D G;  4DV0 T;  5AQK B;  3ZST A;  3EI0 A;  5AQQ B;  2LSI A;  5J0Z A;  1IBK T;  4IDO A;  5HCM A;  2V6Y B;  3MKD A;  2N1G A;  1SUM B;  3UU3 A;  5HEJ A;  3PUZ F;  3ZPO A;  4I0U A;  1WFD A;  2IIU A;  5AFU L;  2W63 A;  2EHO D;  4CN4 A;  2J62 A;  3F57 A;  2LRL A;  1L0V A;  4JLE A;  3KFW X;  4TWD A;  2MBG A;  4ZEY A;  5ABH A;  2LE8 A;  2X67 A;  5JRE A;  5JR9 A;  3PUG A;  3UU6 A;  4O4J E;  4QXC B;  2H3R A;  2K9A A;  3ZSS A;  5JVD E;  2D5U A;  4X64 T;  4JI2 T;  5LP6 E;  3K3O A;  4JI8 T;  4B3S T;  4TWH A;  2AXD S;  4H9R C;  3ZCI A;  2FJA A;  5A1L A;  4WQO D;  5DQW A;  3ZLI A;  3AE2 A;  3C4W A;  2CM0 A;  5ETW A;  3AEE A;  3KVA A;  2K5B B;  3LG7 A;  1Z0P A;  3C4Z A;  4ZS3 A;  5DAB A;  5IYZ E;  2XAF B;  2LSJ A;  3CWZ B;  4IDZ A;  1E7P A;  3FZL B;  1KF6 A;  3EDU A;  3H3M A;  3AE7 A;  2VVN A;  5HXS A;  4YJ2 E;  4LF5 T;  3CVR A;  3J7Y q;  4X66 T;  2KLQ A;  5F8P A;  4UVC B;  2KXP B;  1IJ5 A;  3H37 A;  3RI5 A;  2H88 A;  3C51 A;  3X1D A;  5JDQ A;  3ZT5 A;  2LOP A;  4P0B A;  3RHW A;  3LK2 B;  4DMW A;  3TLT A;  3OPC A;  4EAH A;  2VWA A;  5L3E B;  1X9B A;  4DR4 T;  2BDE A;  2CRB A;  4ERR A;  3EUH A;  5LNK A;  2NW9 A;  4YY3 T;  2X0H A;  3PUV F;  4DR1 T;  4B3T T;  2J4G A;  2BG9 C;  4JI3 T;  3MJX A;  4MLK A;  2UUC T;  4GKK T;  1QUU A;  4NXM T;  3UTK A;  3P7I A;  1KK7 A;  4HWD A;  2XUE A;  3PUQ A;  3J9X 1;  2XJ7 A;  4LMK A;  4A98 A;  1Y01 A;  2YOE A;  3ANW A;  4IE6 A;  5LXT E;  1FEW A;  2JPF A;  3JC6 D;  4U31 A;  2CLY C;  2N9D A;  5BR8 T;  5FXX A;  3QUJ A;  5HXE A;  2W67 A;  4IDQ A;  5HEH A;  2W0G A;  3RQU A;  2XQ4 A;  5FL1 A;  4UV9 B;  4HXI B;  4ZI3 D;  4AIU A;  3Q5W A;  4ILC A;  2LJL A;  4JEU B;  2UXB T;  4IDN A;  5FXV A;  4PAG A;  3TLS A;  3M3Z B;  2E9X A;  2VKO A;  4QWN B;  2KND A;  3RIU C;  3H3A A;  4WZX A;  2W4X A;  1ZEE A;  4BJM A;  2BG9 B;  4I55 E;  4FJO A;  3OVU A;  4ISS A;  2WQY A;  3JAD A;  5JDH A;  4K0K T;  3MK7 C;  4KP3 C;  2C5K T;  2HN2 A;  3AED A;  1X79 A;  4DBQ A;  2DCF A;  4AP2 B;  2LOS A;  1MIV A;  2DWK A;  1IAP A;  1IBL T;  1UUS A;  4AKI A;  3ZCJ A;  5HXH A;  2CLY B;  5L4H A;  2A72 A;  4EV6 A;  3WAJ A;  2FJE A;  4YTN A;  3JAF A;  4DBR A;  3ZT7 A;  4MHC A;  1M62 A;  4U33 A;  4AQY T;  2FJD A;  4QX8 B;  1VRB A;  1UCU A;  2ZM2 A;  1MNE A;  4MAL A;  2XM1 A;  1B7T A;  2ACZ A;  5LJN A;  2C5J A;  4TN7 B;  4EOZ B;  4PJN A;  3ZKR A;  4YHJ A;  3UU5 A;  3D0T A;  3KDS E;  4AI6 A;  4G2A A;  3RYC E;  3N9Q A;  4JI0 T;  3N9L A;  3ZJ2 A;  1MIW A;  2IC9 A;  2EHO C;  3B5M A;  2KWH A;  2NOX A;  3MZK B;  3UT5 E;  3KV4 A;  2UU9 T;  4HTE A;  2D0U A;  2IW5 B;  4O2B E;  5HWY A;  2WY2 A;  4IGU A;  1ZV4 X;  4HGA A;  2NR4 A;  1JNR A;  3BQL A;  4XBF B;  2YN6 A;  4QXH B;  4ZHQ E;  5L3C B;  3MAC A;  4E7Z A;  2Q9Q D;  3I0Q A;  4H63 V;  3PU8 A;  3P4R A;  2E5V A;  3K8P C;  3PDY A;  4NPP A;  2WZH A;  2LSY A;  4JBW F;  3I9W A;  1OED A;  4TNW A;  2XQ5 A;  3VR8 A;  4P5O A;  2WAU A;  2XM2 A;  3IEE A;  4ZZB A;  5AQM B;  2W00 A;  2LM9 A;  2XAS B;  1OWA A;  1G73 A;  5L2L A;  3NRY A;  2XAQ B;  1XNQ T;  2AE9 A;  5FY0 A;  3AEF A;  3QB5 K;  1N34 T;  3GN5 A;  2K3W A;  2VQE T;  2EHO B;  5LHI B;  4EYY R;  4JI6 T;  2ES0 A;  2V5C A;  2B76 A;  2VKH A;  3CX7 B;  1HS7 A;  3LSV A;  2UUA T;  3EVY A;  3AE9 A;  4ILA A;  3F2E A;  3SS1 A;  2WWV A;  3FZH B;  1LVF A;  3UUN A;  1XMQ T;  3PUX F;  4TV8 E;  4A64 A;  3TLU A;  4P0A A;  2V7L A;  2QVA A;  2VVS A;  3K3N A;  2LT3 A;  3OJA A;  4YTM A;  5FMN A;  2DLR A;  5KMG P;  4LF8 T;  3OKQ A;  4EXT A;  4DUY T;  1CUN A;  4A97 A;  3P4P A;  4LFC T;  4Z90 A;  2XY8 B;  5JR9 C;  3ETU A;  4HN9 A;  5ABE A;  5TAO A;  3GWH A;  3T1H T;  5FXZ A;  3AE5 A;  4UEL A;  3QB5 A;  5HEG A;  5L3D B;  2NW8 A;  5M4Y A;  2QGS A;  4AXP A;  3P50 A;  5AQF B;  2NP9 A;  4ZXL A;  2V6X A;  1D1C A;  4L0R A;  4TWF A;  4CQI A;  4XAX B;  1YKE B;  1KEY A;  3VU7 H;  5HEO A;  4KBM B;  3U3I A;  1UUR A;  4ASK A;  4E7S A;  3B57 A;  4YXD A;  3PTR B;  4JI7 T;  2LRK A;  3PUY F;  4U74 A;  5J2T E;  4H9O C;  3O1H A;  5FNV E;  2CMR A;  5L4E A;  4LF4 T;  2IUB A;  2HPJ A;  4CZZ B;  4MFR A;  1ZP0 A;  5EK4 A;  4UEM A;  3BK9 A;  5JR9 B;  3VHL A;  1HR0 T;  4C90 A;  2LLY A;  1T72 A;  1W09 A;  3LFM A;  4J2C A;  4CI2 B;  1WRD A;  2C0S A;  4PW8 A;  3RC3 A;  3AE3 A;  2V1D B;  2YU2 A;  3ETV A;  4LF6 T;  4HFI A;  3UFG A;  4X1I E;  4XZC A;  2L3L A;  3RF1 A;  5BMV E;  3KIN B;  3NZQ A;  3SRZ A;  5LGT B;  4GKJ T;  3QK6 A;  2ODU A;  3AXJ A;  3PUW F;  1U5P A;  2ZM0 A;  4QXB B;  4WBN E;  4KHZ F;  4UF0 A;  3SWH A;  5JDG A;  4QH5 A;  3FBL A;  4Z8X A;  3DP7 A;  1E1H B;  3R6N A;  1YQ4 A;  3Q5E A;  2YKS A;  3PUR A;  4OYJ A;  2OLT A;  2VAS A;  4PK5 A;  1WR6 A;  3AA0 B;  3UQ7 A;  1J1J A;  3AVS A;  5C2T A;  3HR0 A;  3P4W A;  3S4U A;  3L09 A;  4PJJ A;  5HXR A;  3N2G E;  5EK2 A;  3OYX A;  2BBJ A;  5CGM A;  4BAY B;  4DV4 T;  4WW0 A;  2XAG B;  4ADZ A;  1UK5 A;  4COF A;  4N9F 3;  3VKG A;  3ZC0 A;  2V6Y A;  3ONL C;  4UVB B;  1LDJ A;  4O8S A;  4IL9 A;  3ZMT B;  2LHR A;  1FMV A;  3RKO A;  4PK4 A;  3LK3 B;  5KDM C;  2JQQ A;  2VL0 A;  4LML A;  1SHZ C;  3VR9 A;  2XQ3 A;  5ADX L;  3ZT6 A;  2Q9Q C;  2BVL A;  3LBX A;  3C50 A;  4PFP A;  3ANW B;  4I43 B;  4GK5 E;  1E2A A;  5AQS B;  3O1I A;  5JTG A;  3FBZ A;  5JRC B;  1D0Z A;  2MTQ A;  1BR1 A;  2PG8 A;  4O4L E;  4IE7 A;  1IBM T;  4NXN T;  4IE5 A;  2YDR A;  4DUZ T;  2DL1 A;  3GMI A;  4JYA T;  3OYZ A;  3I1A A;  5H6R B;  4AQF C;  2LHN A;  3I9Y A;  4ZS2 A;  1FMW A;  1VOM A;  2WU2 A;  1G8X A;  1FIO A;  3RC8 A;  3L3P A;  5CB4 E;  4YSX A;  2V7I A;  2HH7 A;  1J5W A;  1LDK B;  4DR3 T;  4P1N A;  5HYA A;  3RIA A;  2D2S A;  4AIS A;  4IIJ E;  1BR0 A;  4DID B;  4UV8 B;  4B3M T;  2M67 A;  4YJ3 E;  3NWI A;  4HFB A;  1R8I A;  3C4X A;  1KNP A;  3ZMZ B;  2Q9Q B;  2C5I T;  4O4H E;  4LMJ A;  2Z6E A;  2ACX A;  3NBX X;  2BVM A;  4O2A E;  4QH1 A;  3CQC B;  2E5L T;  1D1B A;  4GIW A;  1FJG T;  5HEU A;  1KNZ A;  4I50 E;  2JQH A;  3ZN0 B;  3QNU A;  2Y8D A;  2E8I A;  3UU8 A;  4CI1 B;  5CFB A;  4IST A;  3AE1 A;  2FUP A;  2VUR A;  1XWM A;  2CBI A;  2DI4 A;  2WB5 A;  2WM9 A;  2IC6 A;  1T7S A;  3OTO T;  3A8Y C;  2VB6 A;  5ABG A;  1OED C;  4DV1 T;  2WSS V;  4OK0 A;  3TLV A;  4ZI7 E;  1HX1 B;  4HE8 A;  4DV5 T;  1WCR A;  1KNR A;  3CML A;  3UQ4 A;  3CK6 A;  1VCT A;  2XQA A;  3EAB A;  4JEH B;  5LHG B;  2W61 A;  2HN1 A;  3MA9 A;  1YW0 A;  4U7I A;  4FI5 A;  4EB6 E;  5JDN A;  3SOL A;  4HWF A;  1HTJ F;  4LFB T;  2KWI B;  4GOU A;  4X65 T;  2XZE A;  2XQ8 A;  3TKL B;  1UGO A;  1MND A;  5FL0 A;  3N5L A;  2WWU A;  2XQ6 A;  5HAX A;  2XSB A;  1OED B;  2XQ7 A;  1OXZ A;  3AAA B;  1SA0 E;  2CBJ A;  2BG9 A;  3N2O A;  4EYU A;  3AEC A;  2CA5 A;  4H9Q C;  4QX7 B;  3TLW A;  4ILB A;  3L8R A;  2E9X D;  5AQG B;  1XMO T;  3P8C D;  1N32 T;  2BG9 E;  2CHO A;  4NIQ A;  3GN5 B;  4YSZ A;  4IDP A;  4EEB A;  1MMN A;  4X1K E;  5FVL A;  2D9D A;  4PFO A;  3AE4 A;  3NZP A;  3CIR A;  3DTO A;  2BZB A;  3IBP A;  2N2N A;  3HKB E;  3RH3 A;  4DV3 T;  1IJ6 A;  5LGU B;  5AQL B;  2BKN A;  4HEA A;  3PUS A;  3RIU A;  4JI4 T;  5EZY E;  2BKP A;  2XAH B;  3UUL A;  2K24 A;  2NTX A;  3ZMS B;  4AQG A;  2B1E A;  4Q25 A;  3QC9 A;  4H9N C;  2BS4 A;  5FP3 A;  4QKN A;  3LK4 2;  3V5S A;  4ZZC A;  2ODV A;  2QYW A;  3Q2M A;  4O4I E;  2BBH A;  3N9P A;  5DJQ C;  4LF7 T;  3CQX C;  3LDQ B;  5ABF B;  2YU1 A;  1W0A A;  3KBU A;  4AKR B;  3FXD B;  1D0X A;  1DU2 A;  5FY1 A;  1W0B A;  1MMD A;  2LKG A;  2MYS A;  3P4Q A;  3AE8 A;  4PJL A;  5FY7 A;  4DVD A;  3ESL A;  2KZ7 B;  2K48 A;  3CPZ A;  4H9S E;  2HPL A;  3N9O A;  1J5E T;  4HWH A;  1N33 T;  2X0Y A;  2X0L B;  2W62 A;  1GQE A;  3G06 A;  2JJ9 A;  2XPK A;  2CE7 A;  4TUY E;  2XSA A;  4AKL A;  2A9U A;  2JRK A;  4X1Y E;  1D0Y A;  2VL8 A;  4X20 E;  4U2Y A;  2QRX A;  4I4T E;  2CEA A;  1WLX A;  3IF8 B;  1LKX A;  1U4Q A;  2M6I A;  3Q5D A;  4X62 T;  2SPC A;  3FXE B;  4JI5 T;  4UIG A;  1T8B A;  3AXJ B;  1HNZ T;  4UXN B;  1JNZ A;  1IZN B;  2WZI A;  2WCA A;  2D0T A;  1VCS A;  3K3Q C;  1ZHC A;  4DV2 T;  4UF0 B;  2YK0 A;  4EGW A;  3QOF A;  5AQR B;  3FZF B;  3ONJ A;  3VKH A;  2NW7 A;  3CX6 B;  4KMC A;  3W15 B;  1AJ3 A;  4HFD A;  1S94 A;  4P09 A;  5GON E;  2M6B A;  5L47 A;  4IE0 A;  2X9W A;  3AAI A;  5LHH B;  4U2Z A;  4DV6 T;  2R6G F;  5EK3 A;  4OFZ A;  4AKH A;  1NEK A;  5AQT B;  1HG5 A;  4MBQ A;  3FZM B;  4A5X A;  2V5D A;  4HFC A;  3ZJ1 A;  4X5T A;  3L39 A;  1HX8 A;  4EZ4 A;  2IAK A;  3WI3 A;  4CXX A;  4WBO A;  3K1S A;  3PUA A;  2JQ9 A;  2XQY A;  4APF B;  3KV6 A;  4GK0 E;  1Z8U A;  3HKE E;  5CA0 E;  5IWA T;  2V8S V;  4IE4 A;  2UXD T;  2LKH A;  5DQV A;  2CPT A;  5JH7 E;  3ZMU B;  3AE6 A;  3BQK A;  3LBX B;  3UUX B;  4L9I A;  5HXC A;  5F3J A;  2X9Y A;  2WDV A;  4DV7 T;  1CHU A;  3C98 B;  1ZOY A;  1Y64 B;  2E9X C;  3AVR A;  3LJC A;  2KSR A;  2YDQ A;  2V7M A;  3DPL C;  4YTP A;  1HCI A;  4LFA T;  5F5W A;  5J2U E;  1WYB A;  2BKO A;  2H7V C;  2WS3 A;  2OV9 A;  4U3C A;  2ZMA A;  2PBI A;  4QH4 A;  2YDS A;  4TZ4 C;  3VRB A;  3DJB A;  5LA6 E;  5CA1 E;  3RPU A;  4CN6 A;  3AEG A;  2MAW A;  1MIY A;  4DND A;  3E08 A;  5KXJ A;  3VRA A;  1YQ3 A;  1I6Z A;  5LG3 A;  2CXL A;  3AB3 B;  3AA6 B;  2MOZ A;  3Q9D A;  3UFE A;  4GYS A;  3ZN1 B;  3EDV A;  4M1P A;  5AQU B;  1S35 A;  2RP4 A;  3T8O A;  5JDF A;  1HF8 A;  4PK6 A;  3AEA A;  2V26 A;  2E9X B;  2RA1 A;  2X51 A;  2L8K A;  4JUY A;  2WMN A;  2NWB A;  4WYV A;  5LBM A;  3NKZ A;  3ZYL A;  3UUM A;  2P9B A;  3EHZ A;  2CXF A;  3O1J A;  5LGN B;  3ZMV B;  3F31 A;  3JAE A;  4F6R C;  4A56 A;  3E22 E;  3UUB A;  4ZI2 C;  4F8H A;  5AQI B;  4L5G A;  3KBT A;  5HWX A;  2W66 A;  2CWY A;  4F52 A;  3CQG B;  1LVK A;  4HFV A;  5LG4 A;  1XNR T;  3HKD E;  5HCJ A;  2I0M A;  2V7K A;  5FXW A;  4UVA B;  1YXR A;  3PJA J;  4EZH A;  2Y48 B;  3HKC E;  5H6Q B;  3N2K E;  4DR2 T;  2J47 A;  1XDO A;  5J1G A;  3AAE B;  5JRC A;  5LBQ B;  2X9X A;  3HI2 A;  5L3B B;  3SFE A;  3IA3 A;  4JI1 T;  2JMH A;  3RRC A;  3FB2 A;  5C3J A;  4DR7 T;  3RLF F;  3CX8 B;  3V5U A;  2DNX A;  3M65 A;  3SFD A;  3N9N A;  1US7 B;  4JGH D;  4KHP T;  3GA8 A;  1H7C A;  1EZ3 A;  2VK9 A;  5JDL A;  4U7Y A;  2IML A;  3AEB A;  2I6H A;  1M7K A;  3P4S A;  1LDK A;  1BR4 A;  5LMN T;  4G63 A;  3RGL A;  1ZKE A;  3AA1 B;  4TX5 A;  2PJQ A;  4YT0 A;  3KV9 A;  4OHF A;  3RKG A;  3N9M A;  2Q9Q A;  5LJM A;  4B3R T;  4YLH A;  4IRE A;  4DMV A;  2X9H A;  4YFS A;  3ZYK A;  5IHY A;  5L3F B;  2FJB A;  5LYJ E;  5FYM A;  2DWG A;  1YKH B;  2H89 A;  4JV5 T;  4BA9 A;  3O9X A;  1UX4 A;  2UUB T;  4KUM B;  2KIN B;  4AQF A;  4LF9 T;  5KX5 E;  4ILU A;  2I59 A;  1WR0 A;  2QA7 A;  4IL4 A;  2XAJ B;  3RQW A;  2MPK A;  2LM2 A;  2JQK A;  1U6G A;  4HWI B;  1UX5 A;  4IT4 A;  2F4V T;  2HHH T;  2UXC T;  4CXY A;  4IHJ E;  3RRW A;  4ZOL E;  3PU3 A;  3RTR A;  4NUU A;  4V1A v;  4Z91 A;  3A7M A;  4PNI A;  1YD8 G;  1BR2 A;  3O4X E;  3FZK B;  3NVO A;  4CI3 B;  4PJM A;  1MMG A;  3UU4 A;  1XDP A;  4EIW A;  3CKD A;  2ZM6 T;  2GK9 A;  1HNX T;  3JCF A;  2LSK A;  2CCQ A;  5JDM A;  3RX6 A;  1T98 A;  5AQJ B;  2JIW A;  2UXX B;  2XHE B;  2ZLY A; 
#chains in the Genus database with same CATH homology
 2XTL A;  5FXV A;  2OA5 A;  2XAG B;  4PAG A;  4UIG A;  2E9X A;  4ADZ A;  2VKO A;  4QWN B;  2KND A;  4UXN B;  3H3A A;  2PFV A;  3VKG A;  3ZC0 A;  1IZN B;  3U78 A;  2D0T A;  2LJL A;  2WBL A;  2V7J A;  4UVB B;  1ZEE A;  4O8S A;  1LRZ A;  4BJM A;  3K3Q C;  1ZHC A;  4I55 E;  3ZMT B;  2LHR A;  4FJO A;  1FMV A;  4UF0 B;  3C64 A;  2YK0 A;  4ISS A;  3RKO A;  5JDH A;  3OBV E;  4DO0 A;  3NRX A;  3MK7 C;  4PK4 A;  3VKH A;  4KP3 C;  2C5K T;  3LK3 B;  2G0U A;  5KDM C;  2JQQ A;  2UXN B;  1SHZ C;  1X79 A;  5ADX L;  2X68 A;  3BQI A;  4DBQ A;  2NW7 A;  3HL6 A;  2Q9Q C;  3CX6 B;  2DCF A;  4KMC A;  3W15 B;  1AJ3 A;  2BVL A;  3LBX A;  2LOS A;  1S94 A;  3C50 A;  1MIV A;  2DWK A;  4P09 A;  4PFP A;  5GON E;  1IAP A;  3ANW B;  4I43 B;  4IE0 A;  2X9W A;  4AKI A;  4ANJ A;  4GK5 E;  3AAI A;  3ZCJ A;  5LHH B;  5HXH A;  3HA4 A;  2CLY B;  2L9Q A;  4OYK A;  3O1I A;  3FBZ A;  5JRC B;  1D0Z A;  2A72 A;  2MTQ A;  1BR1 A;  2PG8 A;  5EK3 A;  3WAJ A;  4OFZ A;  4AKH A;  3B13 A;  4IE7 A;  4O4L E;  3ZYM A;  4IE5 A;  4K0U A;  3Q5W A;  3Q5X A;  4ZI2 D;  1HG5 A;  2WMO A;  4DBR A;  4C91 A;  4MBQ A;  4MHC A;  3GMI A;  2A2F X;  3I1A A;  3OYZ A;  5H6R B;  4AQF C;  3ONX A;  2LHN A;  2VKJ A;  1HG2 A;  3PE0 A;  2CXD A;  3I9Y A;  4U72 A;  4BJN A;  2JMK A;  4QX8 B;  4ZS2 A;  1FMW A;  1VOM A;  2NTY A;  2VKD A;  1VRB A;  2YEV C;  3ZJ1 A;  4CXW A;  1G8X A;  1HX8 A;  3RYH E;  1FIO A;  4EZ4 A;  3RC8 A;  2IAK A;  2YIN A;  1UCU A;  3WI3 A;  4CXX A;  2ZM2 A;  1MNE A;  3L3P A;  5CB4 E;  2V7I A;  4WBO A;  2HH7 A;  1HFA A;  4MAL A;  3PUA A;  2X66 A;  1B7T A;  2CWO A;  2XQY A;  5LJN A;  4NUV A;  3KV6 A;  1MMA A;  4GK0 E;  5HYA A;  2C5J A;  2D2S A;  2H7O A;  4TN7 B;  4EOZ B;  3HKE E;  5CA0 E;  4IIJ E;  4PJN A;  1BR0 A;  4HKA A;  2ZM8 A;  4UV8 B;  4YHJ A;  2M67 A;  3D0T A;  3KDS E;  4YJ3 E;  4AI6 A;  3MXZ A;  4IE4 A;  2KT9 A;  5DQV A;  3FHN A;  3C4X A;  5JH7 E;  1D1A A;  3RYI E;  3ZMU B;  5JQG E;  4G2A A;  3RYC E;  3ZMZ B;  2Q9Q B;  2C5I T;  4AKG A;  4O4H E;  3BQK A;  3LBX B;  3N9Q A;  3UUX B;  4L9I A;  2Z6E A;  4QHO A;  4WNK A;  2ACX A;  3N9L A;  1MIW A;  5HXC A;  1O3X A;  3A5X A;  3IHR A;  3NBX X;  5LOV E;  3ZJ2 A;  5F3J A;  2BVM A;  2IC9 A;  4O2A E;  3CQC B;  2EHO C;  2EHO A;  4H63 H;  2KWH A;  1D1B A;  4GIW A;  2NOX A;  3MZK B;  3UT5 E;  4TV9 E;  3KV4 A;  4GYR A;  4HTE A;  1KNZ A;  2D0U A;  3E0Z A;  4I50 E;  2IW5 B;  2X9Y A;  4O2B E;  5HWY A;  2Y6X A;  3ZN0 B;  4IGU A;  5LCY A;  3AA7 B;  2Y8D A;  2E8I A;  3C98 B;  1ZV4 X;  1NWM X;  1Y64 B;  4HGA A;  4CI1 B;  4H9P C;  4XBF B;  3BQL A;  2E9X C;  3AVR A;  3LJC A;  4QXH B;  4ZHQ E;  2V7M A;  5L3C B;  1HCI A;  4IST A;  3MAC A;  2A3D A;  5J2U E;  4E7Z A;  5E0O A;  2DI4 A;  1WYB A;  2Q9Q D;  3I0Q A;  2H7V C;  2WM9 A;  4H63 V;  2KMF A;  2IC6 A;  3PU8 A;  3K8P C;  3PDY A;  2VB6 A;  5C8Y E;  3ZEF B;  2ZMA A;  2LSY A;  3JC6 C;  3I9W A;  2PBI A;  3RYF E;  4TZ4 C;  1V9D A;  3ZC1 A;  3DJB A;  2WSS V;  2WAU A;  2LSG A;  2XU0 A;  5LA6 E;  4OK0 A;  5CA1 E;  4B6X A;  1NAF A;  4ZI7 E;  4ZI3 C;  3RPU A;  1WYC A;  3IEE A;  5L3G B;  2W00 A;  2LM9 A;  3WAK A;  4HE8 A;  2XAS B;  1OWA A;  1G73 A;  1MIY A;  5L2L A;  3NRY A;  2XAQ B;  4DND A;  3KVB A;  3E08 A;  5FY0 A;  3R84 B;  3KV5 A;  3GN5 A;  2LEH A;  3CML A;  1QSD A;  4N78 D;  2EHO B;  2CXL A;  5LHI B;  3I0O A;  3AB3 B;  2DHR A;  3AA6 B;  2MOZ A;  3Q9D A;  3UFE A;  2J1D G;  4GYS A;  4EYY R;  4JEH B;  3ZN1 B;  2ES0 A;  5LHG B;  2VKH A;  3CX7 B;  2W61 A;  3EDV A;  4M1P A;  1HS7 A;  1S35 A;  2RP4 A;  3MA9 A;  3T8O A;  3EVY A;  1YW0 A;  3F2E A;  5JDF A;  3SS1 A;  1HF8 A;  4FI5 A;  4PK6 A;  2LSI A;  4EB6 E;  2V26 A;  2E9X B;  2RA1 A;  5JDN A;  3SOL A;  1LVF A;  3UUN A;  2X51 A;  2L8K A;  4JUY A;  2WMN A;  4TV8 E;  1HTJ F;  2NWB A;  3MKD A;  4P0A A;  2N1G A;  2KWI B;  5LBM A;  4GOU A;  3ZYL A;  3UUM A;  2V7L A;  2P9B A;  2CXF A;  3O1J A;  5LGN B;  3K3N A;  3TKL B;  3ZPO A;  2LT3 A;  1MND A;  3N5L A;  2WWU A;  3ZMV B;  3F31 A;  3OJA A;  5FMN A;  5HAX A;  5AFU L;  2W63 A;  4F6R C;  2DLR A;  2EHO D;  1OXZ A;  4A56 A;  3AAA B;  5KMG P;  3OKQ A;  1SA0 E;  4EXT A;  3F57 A;  3E22 E;  3N2O A;  4JLE A;  4EYU A;  4ZI2 C;  3KFW X;  1CUN A;  4L5G A;  2MBG A;  2CA5 A;  3KBT A;  5HWX A;  2LE8 A;  2CWY A;  2X67 A;  4H9Q C;  5JR9 C;  4QX7 B;  5JR9 A;  5JRE A;  3ETU A;  3PUG A;  2E9X D;  4HN9 A;  3CQG B;  1LVK A;  4HFV A;  5LG4 A;  3P8C D;  5TAO A;  3HKD E;  3GWH A;  3GN5 B;  5FXZ A;  2V7K A;  4O4J E;  5FXW A;  4UVA B;  4UEL A;  4EZH A;  4QXC B;  2Y48 B;  2H3R A;  2K9A A;  5L3D B;  2NW8 A;  2D5U A;  5JVD E;  1MMN A;  3HKC E;  4X1K E;  5H6Q B;  5M4Y A;  2QGS A;  4AXP A;  3N2K E;  4PFO A;  3NZP A;  2NP9 A;  5LP6 E;  3K3O A;  5J1G A;  3AAE B;  2BZB A;  3DTO A;  3IBP A;  5LBQ B;  1D1C A;  2X9X A;  4L0R A;  3HI2 A;  4H9R C;  5JRC A;  2N2N A;  3HKB E;  3ZCI A;  4CQI A;  5A1L A;  5L3B B;  4XAX B;  5DQW A;  3ZLI A;  1YKE B;  2JMH A;  3RRC A;  3VU7 H;  3FB2 A;  3RH3 A;  3C4W A;  2CM0 A;  4KBM B;  3CX8 B;  5ETW A;  3U3I A;  3KVA A;  3V5U A;  2K5B B;  4ASK A;  2DNX A;  4E7S A;  3B57 A;  3PTR B;  3LG7 A;  1IJ6 A;  3M65 A;  3N9N A;  1US7 B;  1Z0P A;  5LGU B;  3C4Z A;  4ZS3 A;  5DAB A;  5IYZ E;  3GA8 A;  4U74 A;  1H7C A;  4HEA A;  3PUS A;  1EZ3 A;  2LSJ A;  2XAF B;  3CWZ B;  5J2T E;  2VK9 A;  4H9O C;  4IDZ A;  5EZY E;  5JDL A;  3O1H A;  5FNV E;  2XAH B;  3UUL A;  2K24 A;  2NTX A;  3ZMS B;  4AQG A;  3EDU A;  2CMR A;  2B1E A;  3QC9 A;  4H9N C;  5HXS A;  4YJ2 E;  5FP3 A;  3CVR A;  1BR4 A;  3J7Y q;  4QKN A;  4G63 A;  2HPJ A;  1ZKE A;  3AA1 B;  3LK4 2;  4MFR A;  4CZZ B;  2KLQ A;  3V5S A;  5EK4 A;  4UEM A;  3BK9 A;  5JR9 B;  2ODV A;  3VHL A;  5F8P A;  4TX5 A;  4UVC B;  4O4I E;  3Q2M A;  2PJQ A;  4C90 A;  2KXP B;  1IJ5 A;  3KV9 A;  4OHF A;  3H37 A;  3N9P A;  3N9M A;  2Q9Q A;  3C51 A;  3LFM A;  5JDQ A;  5DJQ C;  4J2C A;  5LJM A;  3CQX C;  4CI2 B;  4YLH A;  2YU1 A;  2LOP A;  4P0B A;  3KBU A;  4AKR B;  1WRD A;  3FXD B;  1D0X A;  2C0S A;  4PW8 A;  3RC3 A;  5FY1 A;  2V1D B;  2YU2 A;  1MMD A;  2X9H A;  4YFS A;  4DMV A;  3ZYK A;  3LK2 B;  3ETV A;  4DMW A;  5IHY A;  2MYS A;  5L3F B;  4EAH A;  4X1I E;  2VWA A;  5L3E B;  4XZC A;  5LYJ E;  5FYM A;  2DWG A;  2L3L A;  1YKH B;  4PJL A;  5BMV E;  2BDE A;  4BA9 A;  3O9X A;  5FY7 A;  3KIN B;  3NZQ A;  3SRZ A;  3ESL A;  4DVD A;  5LGT B;  4ERR A;  1UX4 A;  4KUM B;  3QK6 A;  2KZ7 B;  2ODU A;  2KIN B;  4AQF A;  2K48 A;  3EUH A;  3CPZ A;  4H9S E;  2HPL A;  5KX5 E;  4ILU A;  2I59 A;  1U5P A;  3N9O A;  2NW9 A;  5LNK A;  2QA7 A;  2X0L B;  2W62 A;  2XAJ B;  2ZM0 A;  4QXB B;  4WBN E;  4UF0 A;  3SWH A;  5JDG A;  3MJX A;  3FBL A;  4Z8X A;  4MLK A;  2JJ9 A;  1UX5 A;  3DP7 A;  1E1H B;  2CE7 A;  3R6N A;  4TUY E;  1QUU A;  3UTK A;  3P7I A;  1KK7 A;  2XUE A;  3PUR A;  3PUQ A;  4OYJ A;  4CXY A;  4AKL A;  3J9X 1;  4IHJ E;  2VAS A;  4PK5 A;  1WR6 A;  3AA0 B;  3RRW A;  4ZOL E;  3PU3 A;  2JRK A;  4X1Y E;  1D0Y A;  3AVS A;  4NUU A;  4V1A v;  2VL8 A;  4X20 E;  3ANW A;  4IE6 A;  4PNI A;  4I4T E;  5LXT E;  2CEA A;  1YD8 G;  1FEW A;  1BR2 A;  2JPF A;  3O4X E;  1WLX A;  3IF8 B;  3HR0 A;  3JC6 D;  4CI3 B;  4PJM A;  1MMG A;  3S4U A;  2CLY C;  3L09 A;  4PJJ A;  5HXR A;  4EIW A;  1LKX A;  3N2G E;  2N9D A;  1U4Q A;  3CKD A;  5FXX A;  5EK2 A;  3OYX A;  3QUJ A;  5HXE A;  2W0G A;  2SPC A;  2GK9 A;  4UV9 B;  3FXE B;  4ZI3 D;  4BAY B;  2LSK A;  2CCQ A;  5JDM A;  3RX6 A;  1T98 A;  2UXX B;  2XHE B;  4WW0 A;  2ZLY A;  4JEU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...