5F3JA

Crystal structure of dbp in complex with inhibitory monoclonal antibody 2d10
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
251
Chain Sequence
YKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKITDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broadly neutralizing epitopes in the Plasmodium vivax vaccine candidate Duffy Binding Protein.
pubmed doi rcsb
source organism Plasmodium vivax (strain salvador i)
molecule tags Immune system
molecule keywords Duffy receptor
total genus 88
structure length 251
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5f3jA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 5f3jA01
3BQLA 3CMLA 3BQIA 4NUVA 4NUUA 2Y8DA 3RRCA 3BQKA 3CPZA 2XU0A 3C64A 4YFSA 2YK0A 5F3JA 2WAUA
chains in the Genus database with same CATH superfamily
3ZMUB 5JREA 3BQIA 5BMVE 3CQCB 5JDLA 2L8KA 1OEDA 3C4WA 1D0XA 3EDVA 3OVUA 2X66A 1G8XA 3QOFA 3L8RA 1UX4A 2ZM2A 3CX6B 5DABA 4L5GA 4BJNA 3F57A 4KP3C 1WLXA 4G2AA 2YKSA 3AEGA 3Q5EA 4O8SA 5AQLB 5HEGA 3H37A 4ZI3C 3RIAA 1XMQT 4QHOA 5E0OA 1BR1A 3TLWA 4JGHD 2UXNB 2BBHA 4TWDA 5L3DB 4JLEA 1MNEA 2G0UA 5JTGA 4ANJA 4PFOA 1OEDE 4GYRA 1HG2A 2IDOB 2FJEA 4GK0E 3UFGA 4GYSA 3C4XA 3I0QA 4QX8B 5AQIB 3T8OA 2Q9QB 3P50A 3UQ4A 5ABHA 5CGMA 3D0TA 4TUYE 1BR2A 1UUSA 2MYSA 4APFB 2MAWA 1G73A 2WDRA 3CMLA 3PUSA 4UF0B 2WDQA 3ZN0B 3O4XE 3TLSA 4DIDB 5AQNB 5KXJA 1UK5A 2MPKA 2CBIA 4WBOA 2UUAT 2W0GA 1NAFA 2XHEB 4QH1A 3F31A 3L39A 2FJBA 5H6QB 2CBJA 3EUHA 1XNQT 2QVAA 2ACXA 3OPCA 4EIWA 3RRWA 4GKKT 3B57A 1HF8A 2JQHA 3G06A 3KV6A 1XDOA 2YDQA 3P8CD 4LFAT 5JVDE 3RYIE 2PFVA 4NIQA 1V9DA 4HTEA 2W2UA 4U3CA 2WY2A 5CJ5A 3CPZA 2ZMAA 2VWAA 4HFIA 4WQOD 2LSKA 2UXDT 3FHNA 5JQGE 4JUYA 3O9XA 3PUQA 3PTRB 2V6YA 4V1Av 3NRXA 3AE7A 4JEUB 5HEUA 3MK7C 4I50E 5FY1A 1OEDB 1GQEA 3LSVA 4UVBB 3SWHA 3UUMA 4JI7T 2X9YA 3LK3B 4IDNA 3N9NA 1EZ3A 2I6HA 2YDRA 2LJLA 3GWHA 4DR1T 2NOXA 4PJNA 4IE6A 2ODVA 3N2GE 3OYXA 4U74A 4HKAA 3Q5DA 1HG5A 3ZCIA 4DR2T 4AQYT 5AQSB 5HCJA 2Y6XA 5AFUL 1LRZA 4AKRB 4DBRA 1LDKB 1ZP0A 5EK4A 4AI6A 4U7YA 1OWAA 2A9UA 1MIWA 1U4QA 4JI3T 4O2BE 3AE1A 3QC9A 4AKHA 4LF9T 4UV9B 1IJ6A 4TNVA 4YJ2E 1AJ3A 4A64A 3C51A 1E1HB 4ADZA 1HNWT 3LDQB 2E9XD 4G63A 5FL0A 4E7ZA 2WU2A 4ZZBA 2X0YA 2VB6A 5FXXA 5LHIB 2WAUA 3LG7A 4JI2T 5J0ZA 1FJGT 3K1SA 1MMGA 3VKHA 3P4WA 2KZ7B 3JCFA 4EAHA 3VKGA 3C50A 2HPJA 1T72A 1LVFA 3NVOA 2V5DA 5LB7B 3SOLA 5F8PA 1IBKT 1D0YA 2HHHT 1NEKA 3ZMTB 2Q9QC 1MIVA 3N9LA 5HCMA 2HN1A 3ZKRA 3ZMSB 4ISTA 4AKGA 3FXDB 3AAEB 4O2AE 5DQVA 3J7Yq 2W4XA 2PJQA 2IMLA 3ABVA 3PUWF 2JQKA 2W66A 3AA0B 5AQGB 3KVBA 4OX9T 4UXNB 1YD8G 2KT9A 4I4TE 4ILAA 5LA6E 5J2UE 1HS7A 2LSGA 4YSZA 2LLYA 3PUGA 2WCAA 2XQ5A 1O3XA 4QXCB 4TWFA 1T7SA 3CVRA 5HAXA 4TN7B 2BVLA 3U78A 3HA4A 2KLQA 3PDYA 3UU5A 4NUVA 2CA5A 3IA3A 3JC6C 5HEOA 4HGAA 5IUXA 4HFHA 3VRAA 4DV4T 2UUBT 4PJLA 3AB3B 2YDSA 5HXEA 5FKYA 4B3ST 4E7SA 3RI5A 4A56A 2HH7A 3S4UA 5JDNA 4ASKA 3LFMA 2LOPA 3ZC0A 2ZM0A 5FMNA 4DO0A 2E9XB 4CXXA 1BR4A 4KX6A 4LF4T 3UTKA 3AE4A 2KXPB 2SPCA 1HFAA 1UX5A 5JR9B 2WSSV 4PK4A 2UXCT 3I1AA 4Z90A 3N9PA 3AEAA 4U7IA 4F8HA 4EB6E 1JNRA 2A72A 3GMIA 2MBGA 3FZFB 2N1GA 3AE2A 3RYCE 3MKDA 5FXWA 4UV8B 3EDUA 2E5VA 3PU8A 4A97A 4C90A 4QXHB 3ZEFB 3L09A 1FMWA 4QXBB 4IT4A 1CUNA 2BS2A 3JAEA 4ZZCA 3AA6B 3UU3A 5EK3A 2KNDA 2XPKA 3AE5A 1MMDA 2D2SA 5IYZE 3ZCJA 5J2TE 2D0TA 4JI6T 3RH3A 4F52A 2XAQB 3ZMZB 3UUNA 3E08A 4IL4A 4X1KE 4EYYR 1W0AA 2X9HA 1UURA 4HEAA 4TV8E 2LSYA 2Z6EA 4CN6A 5LGUB 4DUZT 2CHNA 3HKDE 2BG9B 2ODUA 2W00A 3TKLB 2UUCT 4NPPA 2N9DA 4K0KT 1SA0E 4A98A 4HE8A 4Q25A 4I43B 2VL0A 4ILUA 3CQXC 1J5WA 2QA7A 2V7JA 3CKDA 3C98B 3I0OA 1ZEEA 3P4SA 4H9PC 5F5WA 4AKLA 5HWXA 3V5SA 1YXRA 3N9MA 5LBMA 2I59A 3AVRA 3ZT5A 5LGNB 2XQ7A 2OA5A 3ETVA 1SE7A 2D5UA 3WAJA 4GIWA 2XM2A 4QWNB 2XU0A 5LXTE 3AE9A 3DJBA 3DP7A 3N5LA 5TAOA 3FZKB 3FB2A 3UU4A 2M6IA 5HYAA 3RGLA 5LYJE 4TV9E 5FY7A 4UELA 4WZXA 4LFBT 3R84B 1YQ3A 2B1EA 2E5LT 2EHOB 3LBXA 4DV2T 4NXNT 5FNVE 4CQIA 3ZYKA 4H63H 2X0LB 5HEHA 3UUBA 2LRKA 3UUXB 2LHRA 3TLTA 2E9XC 4CN1A 2Q9QD 3EAMA 2EHOC 4IDZA 1D0ZA 4PFPA 2AE9A 4MBQA 2K24A 4U31A 3AXJB 2XAHB 4YTNA 4TWHA 2BS4A 1XMOT 5AQQB 1W0BA 5JRCA 1US7B 3QK6A 3PJAJ 4GOUA 3WAKA 4B6XA 4EOZB 3ZYMA 4MFRA 2NP9A 5DJQC 3CQGB 3JAFA 4YT0A 4ZS2A 4ZXLA 2CLYB 3AEBA 3FXEB 5H6RB 5IHYA 2V7LA 5AQPB 4HFDA 4DV6T 5AQVB 1MMAA 4U2YA 5LG3A 2FJAA 1L0VA 4IGUA 5KX5E 4OFZA 3LBXB 5C3JA 4HFCA 4JI0T 2A2FX 3AVSA 1OXZA 2VKOA 2ACZA 5JDFA 3RYFE 2IHR1 3KFWX 1IJ5A 1S94A 4JEHB 1LVKA 1WR6A 4ZS3A 4YSYA 4CI2B 2I0MA 4PAGA 5FXZA 5JDMA 4AISA 2CXFA 3CWZB 4TZ4C 3UU6A 4COFA 3MACA 2PBIA 4YLHA 4WBNE 2M67A 4DV7T 5LJNA 2X9WA 4PK5A 3FBLA 5JH7E 3M3ZB 1WFDA 2XQ8A 2BG9A 4KI0F 4X65T 5AQHB 3ZC1A 4DV5T 4O4IE 4KHZF 2YK0A 2K9AA 1E2AA 3IHRA 1Y01A 3O1JA 2E2AA 3OYZA 3P4QA 4I55E 2YOEA 3VR9A 2H88A 2XSBA 2NTXA 4O4LE 3GA8A 2VKHA 4HFEA 1QLBA 2XAGB 3Q9DA 1VRBA 4L0RA 5LJMA 3WI3A 2CCQA 2KWHA 4EV6A 4DV1T 2XM1A 2X9XA 3AAIA 3E0ZA 3IBPA 4C91A 3RPUA 3I9WA 3RIUA 2V1DB 5JR9A 4HFVA 3MJXA 4ILBA 1E7PA 4AQFA 4DNDA 5AQTB 1W9RA 3Q5WA 2PG8A 2F4VT 1M62A 1VCTA 3H3AA 3C4ZA 4EEBA 4U33A 3NZQA 2XTLA 2DLRA 1J5ET 5AQRB 4JYAT 5LNKA 2VVSA 1D1BA 3KINB 3O1IA 4HWCA 4IDPA 1OEDC 2RP4A 4MHCA 2EHOD 2YU1A 3R6NA 4DBQA 3PUZF 4IDQA 1N36T 4UIGA 2XQYA 3DQVC 2VK9A 3ZN1B 2JPFA 5M4YA 1HNZT 2DNXA 3EVYA 3CK6A 3TLUA 3UU8A 3KV5A 1WCRA 2YINA 4NXMT 3PJAA 2NTYA 4X64T 3PE0A 4X62T 4ZEYA 2J1DG 3E22E 3SS1A 3UT5E 5LGTB 2RA1A 4H9NC 3W15B 2V6XA 2XAJB 2JRKA 4B3RT 2ES0A 3BQKA 4B3MT 1SUMB 4IE4A 5FVKA 3VRBA 2LT3A 3A8YC 3RLFF 4CI3B 2DWGA 2KINB 2FBWA 2LM9A 3V5UA 5HWYA 4GK5E 4DMVA 2K3WA 3VR8A 4YY3T 3NBXX 1IAPA 1VOMA 4IHJE 3IEEA 2XQ3A 4YFSA 4EZ4A 3RC3A 5EK2A 5JRCB 4O4JE 3RTRA 1D1CA 4BAYB 2K48A 2VKDA 1JNZA 2BBJA 2W62A 3DTOA 3ONLC 2KMFA 1XDPA 2XASB 4K0UA 5JR9C 3FBZA 2W61A 2LSJA 4DR5T 2IAKA 4IIJE 4M1PA 5HXCA 2D9DA 2YN6A 2V26A 4YTPA 2WDVA 3I9YA 3JC6D 3OKQA 3QNUA 5L4HA 5HEJA 1FEWA 5LOVE 5FP3A 4BJMA 4ILCA 3OTOT 1WYBA 3UFEA 2V7MA 3BK9A 3ZJ2A 1LDJA 3HR0A 3FZHB 3EABA 3QUJA 4LF6T 5HXSA 1W09A 3PUXF 4JI4T 3DPLC 4J2CA 4X1YE 1HX8A 4N78D 1XZYA 3VHLA 2WWVA 5CFBA 1HTJF 2PTFA 3RRCA 5ABEA 1LDKA 2H7OA 2LRLA 3IF8B 2VQFT 2WBLA 4U72A 5L2LA 3RKGA 2CRBA 4PW8A 5ETWA 5L3EB 1SHZC 4EXTA 5L4EA 3LK2B 2OV9A 3KBUA 2BS3A 1S35A 4LMLA 2GK9A 1IBLT 2D0UA 2Q9QA 4ISSA 3ZMVB 3N2OA 3P4PA 4HWFA 5AQOB 3CX8B 2IC6A 3ZSSA 3N9QA 3AA1B 4IE5A 4QX7B 4L9IA 1UGOA 5KMGP 2KSRA 4P09A 5CB4E 5DQWA 2BKNA 2V6YB 2X0HA 4HFBA 4UR9A 2BZBA 5CA0E 2QGSA 3PU3A 5ABFA 4OYJA 5L3GB 4CI1B 5L3CB 1FIOA 3KV9A 3SRZA 5FYMA 2FJDA 2LSIA 1M7KA 2CHOA 2ZLYA 4H9OC 2XY8B 2QRXA 4Z8XA 4EEDA 3CIRA 3A7MA 5LMUT 3AECA 4YHJA 1I94T 1KF6A 2WS3A 3NRYA 2EHOA 2C5IT 2RPAA 5LG4A 2E9XA 2FUPA 3KVAA 1H7CA 1U5PA 1Y64B 1HNXT 4WNKA 2VQET 2LKHA 2LOSA 3AE3A 3ZPOA 2B76A 3A5XA 3AEDA 3MA9A 2JMKA 2XAFB 4ZOLE 2JQQA 3ZSTA 2WZHA 3N2KE 4KBMB 1BR0A 1X79A 3OJAA 3NKZA 2ZM6T 2WZIA 3X1DA 4HWDA 2XZEA 3C64A 4P1NA 2CXDA 3N9OA 4CXWA 2ZM8A 4X5TA 4HXIB 2DL1A 5C2TA 3ONJA 4P5OA 4WYVA 5JDHA 1KEYA 3HL6A 1UCUA 3KDSE 5AQJB 4YXDA 4AP2B 4B3TT 4DR4T 4FI5A 2AXDS 2DI4A 3RHWA 1J1JA 2LHNA 3KBTA 4JV5T 2JJ9A 2V7IA 2LEHA 4H9SE 4F6RC 2CWYA 4H9RC 2LKGA 4HWIB 1N34T 2XQ9A 4LF5T 1D1AA 4LMKA 1HX1B 3MZKB 1KK7A 4OYKA 3T1HT 2UXBT 2JQ9A 2MOZA 4U2ZA 5ABFB 5LHHB 3PURA 1VCSA 2IIUA 1X9BA 3FZLB 4O4HE 4QH5A 1FMVA 4JI1T 2J4GA 3QB5K 2BKOA 2XJ7A 3EHZA 5AQKB 2Y48B 3ZLIA 4EZHA 3ANWA 2XQAA 4ZI3D 3K3QC 4JI8T 5LBQB 3UQ7A 4DV3T 4XBFB 2XSAA 2JIWA 4FJOA 2VASA 4XZCA 2LE8A 2HN2A 4IREA 2CEAA 3FZMB 2CXLA 5FVLA 2VKJA 5L3FB 4LF7T 5BR8T 4X20E 3NZPA 3B13A 3O1HA 4P0AA 1XNRT 1U6GA 4BA9A 1N33T 2BKPA 4IE7A 4KUMB 3M65A 4H63V 3P7IA 2UU9T 3TLVA 3ZJ1A 4UF0A 4Z91A 3QB5A 5HXRA 3SFEA 3RIUC 4AQGA 1IBMT 1HCIA 4P0BA 2J47A 2JMHA 1WR0A 4A5XA 4PK6A 4PJJA 5AQUB 3AXJA 2VL8A 3PUVF 1MMNA 4PJMA 4DMWA 2XUEA 4DVDA 4DV0T 3RC8A 2CLYC 1MNDA 2CE7A 2IUBA 5IWAT 2WZKA 3PUAA 2VVNA 4IDOA 4JI5T 1B7TA 3B5MA 4YHHT 4OK0A 2E8IA 3K3OA 1ZV4X 3SFDA 4DUYT 1QSDA 2WMNA 2M6BA 1YQ4A 2CWOA 3NWIA 2J62A 3CX7B 4X1IE 1KNRA 2WQYA 3VU7H 3HI2A 5FL1A 5J1GA 2A3DA 2DHRA 4DR7T 1R8IA 5EZYE 3U3IA 2IC9A 3RQUA 4AXPA 1YKHB 1Z8UA 4XAXB 5FXVA 5GONE 4PNIA 4ERRA 2W63A 2C5KT 2NW7A 5JDQA 5LP6E 1N32T 1T8BA 2BVMA 3AE6A 3P4RA 2XQ4A 1IZNB 3T1YT 3HKBE 3KV4A 4MLKA 5F3JA 4CN4A 3ZT6A 1I6ZA 1XWMA 3GN5B 1ZKEA 4LMJA 4AQFC 3AA7B 5L3BB 2CMRA 1HR0T 3LK42 3RQWA 2V8SV 2L3LA 2V5CA 2DWKA 3PUYF 1T98A 2KWIB 2W67A 3H3MA 3ONXA 4ZI2D 1YW0A 2H7VC 3RKOA 4EYUA 5A1LA 2VURA 3RF1A 4DR6T 1ZOYA 4ZI2C 1QUUA 3ANWB 2OLTA 4KMCA 2X68A 4JBWF 1NENA 2HPLA 2NW8A 4HN9A 4WW0A 2NWBA 3AE8A 4GKJT 1WYCA 2H3RA 3AAAB 4CXYA 4LF8T 4ZI7E 4NUUA 2IW5B 2X67A 2WB5A 1ZHCA 2YEVC 2BG9C 5KDMC 5JDGA 5AQFB 2WU5A 4IL9A 1LKXA 4KHPT 2C0SA 3LJCA 5LHGB 4AKIA 4QH4A 4MALA 5CA1E 1CHUA 5HXHA 2WMOA 4YJ3E 4UVCB 3L3PA 5AQMB 4H9QC 4HWHA 4OHFA 4CZZB 3Q2MA 2MTQA 3RYHE 2Y8DA 2X51A 3Q5XA 2XQ6A 3EI0A 3MXZA 3HKEE 3RX6A 2R6GF 2NW9A 4YTMA 5FY0A 4LFCT 4DR3T 4X66T 4QKNA 3AEFA 3K8PC 1WRDA 4UVAB 3ZYLA 2WM9A 3JADA 1MIYA 4TNWA 1Z0PA 1KFYA 2BDEA 4AIUA 3AEEA 4EGWA 2WWUA 2UXXB 3HKCE 4UEMA 2V7KA 2DCFA 2P9BA 2NR4A 3PV0F 4IE0A 4TX5A 4N9F3 1NWMX 3F2EA 3GN5A 1KNPA 1DU2A 4I0UA 2K5BB 1YKEB 3K3NA 2BG9E 2H89A 3OBVE 3RIFA 2L9QA 2N2NA 5LCYA 5ABGA 3J9X1 3BQLA 3UULA 2CPTA 4YSXA 4ZHQE 5C8YE 5ADXL 5LMNT 2CM0A 2C5JA 2LM2A 2YU2A 3ESLA 5L47A 3ZT7A 3ETUA 2QYWA 2WP9A 1KNZA
chains in the Genus database with same CATH topology
3ZMUB 5JREA 3BQIA 5BMVE 3CQCB 5JDLA 2L8KA 3C4WA 1D0XA 3EDVA 5DABA 2X66A 1G8XA 4BJNA 1UX4A 2ZM2A 3CX6B 4L5GA 3F57A 4KP3C 1WLXA 4G2AA 4O8SA 4ZI3C 3H37A 4QHOA 5E0OA 1BR1A 2UXNB 5L3DB 4JLEA 1MNEA 2G0UA 4ANJA 4PFOA 4GYRA 1HG2A 4GK0E 4GYSA 3C4XA 3I0QA 4QX8B 3T8OA 2Q9QB 3D0TA 4TUYE 1BR2A 2MYSA 1G73A 4UF0B 3CMLA 3PUSA 3ZN0B 3O4XE 4WBOA 2W0GA 1NAFA 2XHEB 3F31A 5H6QB 3EUHA 2ACXA 4EIWA 3RRWA 3B57A 1HF8A 3KV6A 3P8CD 5JVDE 3RYIE 2PFVA 1V9DA 4HTEA 3CPZA 2ZMAA 2VWAA 2LSKA 3FHNA 5JQGE 4JUYA 3O9XA 3PUQA 3PTRB 4V1Av 3NRXA 4JEUB 3MK7C 4I50E 5FY1A 3SWHA 4UVBB 3UUMA 2X9YA 3LK3B 3N9NA 1EZ3A 2LJLA 3GWHA 2NOXA 4PJNA 4IE6A 2ODVA 3N2GE 3OYXA 4U74A 4HKAA 1HG5A 3ZCIA 2Y6XA 5AFUL 1LRZA 4AKRB 4DBRA 5EK4A 4AI6A 1OWAA 1MIWA 1U4QA 4AKHA 4O2BE 3QC9A 4UV9B 1IJ6A 4YJ2E 1AJ3A 3C51A 1E1HB 4ADZA 4G63A 2E9XD 4E7ZA 2VB6A 5FXXA 5LHIB 2WAUA 3LG7A 1MMGA 3VKHA 2KZ7B 4EAHA 3C50A 2HPJA 3SOLA 1LVFA 5F8PA 1D0YA 3ZMTB 2Q9QC 1MIVA 3N9LA 3ZMSB 4ISTA 4AKGA 3FXDB 3AAEB 4O2AE 5DQVA 3J7Yq 2PJQA 3AA0B 3KVBA 4UXNB 1YD8G 2KT9A 4I4TE 5J2UE 5LA6E 1HS7A 2LSGA 3PUGA 4CXYA 1O3XA 4QXCB 3CVRA 5HAXA 4TN7B 2BVLA 3U78A 3HA4A 2KLQA 3PDYA 4NUVA 2CA5A 3JC6C 4HGAA 4PJLA 3AB3B 5HXEA 4E7SA 4A56A 3ZC0A 2HH7A 3S4UA 5JDNA 4ASKA 3LFMA 2LOPA 2ZM0A 5FMNA 4DO0A 2E9XB 4CXXA 1BR4A 3UTKA 2KXPB 2SPCA 1HFAA 1UX5A 2WSSV 4PK4A 3I1AA 3N9PA 4EB6E 2A72A 3GMIA 2MBGA 2N1GA 3RYCE 3MKDA 5FXWA 4UV8B 3EDUA 3PU8A 4C90A 4QXHB 3ZEFB 3L09A 1FMWA 4QXBB 1CUNA 3AA6B 5EK3A 2KNDA 3ZCJA 1MMDA 2D2SA 5IYZE 5J2TE 2D0TA 3RH3A 2XAQB 3ZMZB 3UUNA 3E08A 4X1KE 4EYYR 2X9HA 4HEAA 4TV8E 5LGUB 2LSYA 2Z6EA 3HKDE 3TKLB 2ODUA 2W00A 2N9DA 1SA0E 4HE8A 4I43B 4ILUA 3CQXC 2QA7A 2V7JA 5HWXA 3CKDA 3C98B 3I0OA 1ZEEA 4H9PC 4AKLA 3V5SA 5LBMA 3N9MA 2I59A 3AVRA 5LGNB 2OA5A 3ETVA 2D5UA 3WAJA 4GIWA 4QWNB 2XU0A 5LXTE 3DP7A 3DJBA 3N5LA 5TAOA 3FB2A 5HYAA 5LYJE 4TV9E 5FY7A 4UELA 3R84B 2B1EA 2EHOB 3LBXA 5FNVE 4CQIA 3ZYKA 4H63H 2X0LB 3UUXB 2LHRA 2E9XC 2Q9QD 4IDZA 2EHOC 1D0ZA 4PFPA 4MBQA 2K24A 2XAHB 5JRCA 1US7B 3QK6A 4GOUA 3WAKA 4B6XA 4EOZB 3ZYMA 4MFRA 2NP9A 5DJQC 3CQGB 4ZS2A 5IHYA 2CLYB 3FXEB 5H6RB 2V7LA 1MMAA 4IGUA 5KX5E 4OFZA 3LBXB 3VKGA 2A2FX 3AVSA 1OXZA 2VKOA 5JDFA 3RYFE 3KFWX 1IJ5A 1S94A 4JEHB 1LVKA 1WR6A 4ZS3A 4CI2B 4PAGA 5FXZA 5JDMA 2CXFA 3CWZB 4TZ4C 4WBNE 3MACA 2PBIA 4YLHA 2M67A 5LJNA 2X9WA 4PK5A 3FBLA 5JH7E 3ZC1A 4O4IE 2YK0A 2K9AA 3IHRA 3O1JA 3OYZA 4I55E 4O4LE 2NTXA 3GA8A 2VKHA 2XAGB 3Q9DA 1VRBA 4L0RA 5LJMA 3WI3A 2CCQA 2KWHA 3AAIA 2X9XA 3E0ZA 3IBPA 4C91A 3RPUA 3I9WA 2V1DB 5JR9A 4HFVA 3MJXA 4AQFA 4DNDA 3Q5WA 2PG8A 3H3AA 3C4ZA 3NZQA 2XTLA 2DLRA 5LNKA 3KINB 1D1BA 4MHCA 3O1IA 3R6NA 2RP4A 2EHOD 2YU1A 4DBQA 4UIGA 2XQYA 2VK9A 3ZN1B 2JPFA 5M4YA 2DNXA 3EVYA 3KV5A 2YINA 2NTYA 3PE0A 2J1DG 3E22E 3SS1A 3UT5E 5LGTB 2RA1A 4H9NC 3W15B 2XAJB 2JRKA 2ES0A 3BQKA 4IE4A 5JR9B 2LT3A 4CI3B 2DWGA 2KINB 2LM9A 3V5UA 4DMVA 5HWYA 4GK5E 3NBXX 1IAPA 1VOMA 4IHJE 3IEEA 4EZ4A 4YFSA 5JRCB 3RC3A 5EK2A 4O4JE 1D1CA 4BAYB 2K48A 2VKDA 2W62A 3DTOA 2KMFA 2XASB 4K0UA 5JR9C 3FBZA 2W61A 2LSJA 2IAKA 4IIJE 4M1PA 5HXCA 2V26A 3JC6D 3I9YA 3OKQA 1FEWA 5LOVE 5FP3A 4BJMA 1WYBA 3UFEA 2V7MA 3BK9A 3ZJ2A 3HR0A 3QUJA 5HXSA 4J2CA 4X1YE 1HX8A 4N78D 3VHLA 1HTJF 3RRCA 2H7OA 3IF8B 2WBLA 4U72A 5L2LA 4PW8A 5ETWA 5L3EB 1SHZC 4EXTA 3LK2B 3KBUA 1S35A 2GK9A 2D0UA 2Q9QA 4ISSA 3ZMVB 3N2OA 3CX8B 2IC6A 3N9QA 3AA1B 4IE5A 4QX7B 4L9IA 5KMGP 4P09A 5CB4E 5DQWA 2BZBA 5CA0E 2QGSA 3PU3A 4OYJA 5L3GB 4CI1B 5L3CB 1FIOA 3KV9A 3SRZA 5FYMA 2LSIA 2ZLYA 4H9OC 4Z8XA 4YHJA 3NRYA 2EHOA 2C5IT 5LG4A 2E9XA 3KVAA 1H7CA 1Y64B 1U5PA 4WNKA 2LOSA 3ZPOA 3A5XA 3MA9A 4ZOLE 2JMKA 2XAFB 2JQQA 3N2KE 1BR0A 4KBMB 1X79A 3OJAA 3C64A 2CXDA 3N9OA 4CXWA 2ZM8A 5JDHA 3HL6A 1UCUA 3KDSE 4FI5A 2DI4A 2LHNA 3KBTA 2JJ9A 2V7IA 2LEHA 4H9SE 4F6RC 2CWYA 4H9RC 1D1AA 3MZKB 1KK7A 4OYKA 2MOZA 5LHHB 3PURA 4O4HE 1FMVA 4EZHA 3ZLIA 2Y48B 3ANWA 4ZI3D 3K3QC 5LBQB 4XBFB 4FJOA 2VASA 4XZCA 2LE8A 2CEAA 2CXLA 5L3FB 2VKJA 4X20E 3NZPA 3B13A 3O1HA 4P0AA 4BA9A 4IE7A 4KUMB 3M65A 4H63V 3P7IA 3ZJ1A 4UF0A 5HXRA 4AQGA 1HCIA 4P0BA 2JMHA 4PK6A 4PJJA 2VL8A 1MMNA 4PJMA 4DMWA 2XUEA 4DVDA 3RC8A 2CLYC 1MNDA 2CE7A 3PUAA 1B7TA 4OK0A 2E8IA 3K3OA 1ZV4X 1QSDA 2WMNA 4X1IE 2CWOA 3CX7B 3VU7H 3HI2A 5J1GA 2A3DA 2DHRA 3U3IA 5EZYE 4AXPA 2IC9A 1YKHB 4XAXB 5FXVA 5GONE 4PNIA 4ERRA 2W63A 2C5KT 2NW7A 5JDQA 5LP6E 2BVMA 1IZNB 3HKBE 3KV4A 4MLKA 5F3JA 5L3BB 3GN5B 1ZKEA 4AQFC 3AA7B 2CMRA 3LK42 2L3LA 2DWKA 1T98A 2KWIB 3ONXA 4ZI2D 1YW0A 2H7VC 3RKOA 4EYUA 5A1LA 4ZI2C 1QUUA 3ANWB 4KMCA 2X68A 2NW8A 2HPLA 4HN9A 4WW0A 2NWBA 1WYCA 2H3RA 3AAAB 4ZI7E 4NUUA 2IW5B 2X67A 1ZHCA 2YEVC 5KDMC 5JDGA 1LKXA 2C0SA 3LJCA 5LHGB 4AKIA 4MALA 5CA1E 5HXHA 2WMOA 4YJ3E 4UVCB 3L3PA 4H9QC 4CZZB 4OHFA 3Q2MA 2MTQA 3RYHE 2Y8DA 2X51A 3Q5XA 3MXZA 3HKEE 3RX6A 2NW9A 5FY0A 4QKNA 3K8PC 3ZYLA 1WRDA 4UVAB 2WM9A 1MIYA 1Z0PA 2BDEA 2WWUA 2UXXB 3HKCE 4UEMA 2V7KA 2DCFA 2P9BA 4IE0A 4TX5A 1NWMX 3F2EA 3GN5A 2K5BB 1YKEB 3K3NA 3OBVE 2L9QA 2N2NA 5LCYA 3J9X1 3BQLA 3UULA 4ZHQE 5C8YE 5ADXL 2CM0A 2C5JA 2YU2A 3ESLA 3ETUA 1KNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQL A;  3CML A;  3BQI A;  4NUV A;  4NUU A;  2Y8D A;  3RRC A;  3BQK A;  3CPZ A;  2XU0 A;  3C64 A;  4YFS A;  2YK0 A;  5F3J A;  2WAU A; 
#chains in the Genus database with same CATH topology
 3ZMU B;  5JRE A;  3BQI A;  5BMV E;  3CQC B;  5JDL A;  2L8K A;  1OED A;  3C4W A;  1D0X A;  3EDV A;  3OVU A;  2X66 A;  1G8X A;  3QOF A;  3L8R A;  1UX4 A;  2ZM2 A;  3CX6 B;  5DAB A;  4L5G A;  4BJN A;  3F57 A;  4KP3 C;  1WLX A;  4G2A A;  2YKS A;  3AEG A;  3Q5E A;  4O8S A;  5AQL B;  5HEG A;  3H37 A;  4ZI3 C;  3RIA A;  1XMQ T;  4QHO A;  5E0O A;  1BR1 A;  3TLW A;  4JGH D;  2UXN B;  2BBH A;  4TWD A;  5L3D B;  4JLE A;  1MNE A;  2G0U A;  5JTG A;  4ANJ A;  4PFO A;  1OED E;  4GYR A;  1HG2 A;  2IDO B;  2FJE A;  4GK0 E;  3UFG A;  4GYS A;  3C4X A;  3I0Q A;  4QX8 B;  5AQI B;  3T8O A;  2Q9Q B;  3P50 A;  3UQ4 A;  5ABH A;  5CGM A;  3D0T A;  4TUY E;  1BR2 A;  1UUS A;  2MYS A;  4APF B;  2MAW A;  1G73 A;  2WDR A;  3CML A;  3PUS A;  4UF0 B;  2WDQ A;  3ZN0 B;  3O4X E;  3TLS A;  4DID B;  5AQN B;  5KXJ A;  1UK5 A;  2MPK A;  2CBI A;  4WBO A;  2UUA T;  2W0G A;  1NAF A;  2XHE B;  4QH1 A;  3F31 A;  3L39 A;  2FJB A;  5H6Q B;  2CBJ A;  3EUH A;  1XNQ T;  2QVA A;  2ACX A;  3OPC A;  4EIW A;  3RRW A;  4GKK T;  3B57 A;  1HF8 A;  2JQH A;  3G06 A;  3KV6 A;  1XDO A;  2YDQ A;  3P8C D;  4LFA T;  5JVD E;  3RYI E;  2PFV A;  4NIQ A;  1V9D A;  4HTE A;  2W2U A;  4U3C A;  2WY2 A;  5CJ5 A;  3CPZ A;  2ZMA A;  2VWA A;  4HFI A;  4WQO D;  2LSK A;  2UXD T;  3FHN A;  5JQG E;  4JUY A;  3O9X A;  3PUQ A;  3PTR B;  2V6Y A;  4V1A v;  3NRX A;  3AE7 A;  4JEU B;  5HEU A;  3MK7 C;  4I50 E;  5FY1 A;  1OED B;  1GQE A;  3LSV A;  4UVB B;  3SWH A;  3UUM A;  4JI7 T;  2X9Y A;  3LK3 B;  4IDN A;  3N9N A;  1EZ3 A;  2I6H A;  2YDR A;  2LJL A;  3GWH A;  4DR1 T;  2NOX A;  4PJN A;  4IE6 A;  2ODV A;  3N2G E;  3OYX A;  4U74 A;  4HKA A;  3Q5D A;  1HG5 A;  3ZCI A;  4DR2 T;  4AQY T;  5AQS B;  5HCJ A;  2Y6X A;  5AFU L;  1LRZ A;  4AKR B;  4DBR A;  1LDK B;  1ZP0 A;  5EK4 A;  4AI6 A;  4U7Y A;  1OWA A;  2A9U A;  1MIW A;  1U4Q A;  4JI3 T;  4O2B E;  3AE1 A;  3QC9 A;  4AKH A;  4LF9 T;  4UV9 B;  1IJ6 A;  4TNV A;  4YJ2 E;  1AJ3 A;  4A64 A;  3C51 A;  1E1H B;  4ADZ A;  1HNW T;  3LDQ B;  2E9X D;  4G63 A;  5FL0 A;  4E7Z A;  2WU2 A;  4ZZB A;  2X0Y A;  2VB6 A;  5FXX A;  5LHI B;  2WAU A;  3LG7 A;  4JI2 T;  5J0Z A;  1FJG T;  3K1S A;  1MMG A;  3VKH A;  3P4W A;  2KZ7 B;  3JCF A;  4EAH A;  3VKG A;  3C50 A;  2HPJ A;  1T72 A;  1LVF A;  3NVO A;  2V5D A;  5LB7 B;  3SOL A;  5F8P A;  1IBK T;  1D0Y A;  2HHH T;  1NEK A;  3ZMT B;  2Q9Q C;  1MIV A;  3N9L A;  5HCM A;  2HN1 A;  3ZKR A;  3ZMS B;  4IST A;  4AKG A;  3FXD B;  3AAE B;  4O2A E;  5DQV A;  3J7Y q;  2W4X A;  2PJQ A;  2IML A;  3ABV A;  3PUW F;  2JQK A;  2W66 A;  3AA0 B;  5AQG B;  3KVB A;  4OX9 T;  4UXN B;  1YD8 G;  2KT9 A;  4I4T E;  4ILA A;  5LA6 E;  5J2U E;  1HS7 A;  2LSG A;  4YSZ A;  2LLY A;  3PUG A;  2WCA A;  2XQ5 A;  1O3X A;  4QXC B;  4TWF A;  1T7S A;  3CVR A;  5HAX A;  4TN7 B;  2BVL A;  3U78 A;  3HA4 A;  2KLQ A;  3PDY A;  3UU5 A;  4NUV A;  2CA5 A;  3IA3 A;  3JC6 C;  5HEO A;  4HGA A;  5IUX A;  4HFH A;  3VRA A;  4DV4 T;  2UUB T;  4PJL A;  3AB3 B;  2YDS A;  5HXE A;  5FKY A;  4B3S T;  4E7S A;  3RI5 A;  4A56 A;  2HH7 A;  3S4U A;  5JDN A;  4ASK A;  3LFM A;  2LOP A;  3ZC0 A;  2ZM0 A;  5FMN A;  4DO0 A;  2E9X B;  4CXX A;  1BR4 A;  4KX6 A;  4LF4 T;  3UTK A;  3AE4 A;  2KXP B;  2SPC A;  1HFA A;  1UX5 A;  5JR9 B;  2WSS V;  4PK4 A;  2UXC T;  3I1A A;  4Z90 A;  3N9P A;  3AEA A;  4U7I A;  4F8H A;  4EB6 E;  1JNR A;  2A72 A;  3GMI A;  2MBG A;  3FZF B;  2N1G A;  3AE2 A;  3RYC E;  3MKD A;  5FXW A;  4UV8 B;  3EDU A;  2E5V A;  3PU8 A;  4A97 A;  4C90 A;  4QXH B;  3ZEF B;  3L09 A;  1FMW A;  4QXB B;  4IT4 A;  1CUN A;  2BS2 A;  3JAE A;  4ZZC A;  3AA6 B;  3UU3 A;  5EK3 A;  2KND A;  2XPK A;  3AE5 A;  1MMD A;  2D2S A;  5IYZ E;  3ZCJ A;  5J2T E;  2D0T A;  4JI6 T;  3RH3 A;  4F52 A;  2XAQ B;  3ZMZ B;  3UUN A;  3E08 A;  4IL4 A;  4X1K E;  4EYY R;  1W0A A;  2X9H A;  1UUR A;  4HEA A;  4TV8 E;  2LSY A;  2Z6E A;  4CN6 A;  5LGU B;  4DUZ T;  2CHN A;  3HKD E;  2BG9 B;  2ODU A;  2W00 A;  3TKL B;  2UUC T;  4NPP A;  2N9D A;  4K0K T;  1SA0 E;  4A98 A;  4HE8 A;  4Q25 A;  4I43 B;  2VL0 A;  4ILU A;  3CQX C;  1J5W A;  2QA7 A;  2V7J A;  3CKD A;  3C98 B;  3I0O A;  1ZEE A;  3P4S A;  4H9P C;  5F5W A;  4AKL A;  5HWX A;  3V5S A;  1YXR A;  3N9M A;  5LBM A;  2I59 A;  3AVR A;  3ZT5 A;  5LGN B;  2XQ7 A;  2OA5 A;  3ETV A;  1SE7 A;  2D5U A;  3WAJ A;  4GIW A;  2XM2 A;  4QWN B;  2XU0 A;  5LXT E;  3AE9 A;  3DJB A;  3DP7 A;  3N5L A;  5TAO A;  3FZK B;  3FB2 A;  3UU4 A;  2M6I A;  5HYA A;  3RGL A;  5LYJ E;  4TV9 E;  5FY7 A;  4UEL A;  4WZX A;  4LFB T;  3R84 B;  1YQ3 A;  2B1E A;  2E5L T;  2EHO B;  3LBX A;  4DV2 T;  4NXN T;  5FNV E;  4CQI A;  3ZYK A;  4H63 H;  2X0L B;  5HEH A;  3UUB A;  2LRK A;  3UUX B;  2LHR A;  3TLT A;  2E9X C;  4CN1 A;  2Q9Q D;  3EAM A;  2EHO C;  4IDZ A;  1D0Z A;  4PFP A;  2AE9 A;  4MBQ A;  2K24 A;  4U31 A;  3AXJ B;  2XAH B;  4YTN A;  4TWH A;  2BS4 A;  1XMO T;  5AQQ B;  1W0B A;  5JRC A;  1US7 B;  3QK6 A;  3PJA J;  4GOU A;  3WAK A;  4B6X A;  4EOZ B;  3ZYM A;  4MFR A;  2NP9 A;  5DJQ C;  3CQG B;  3JAF A;  4YT0 A;  4ZS2 A;  4ZXL A;  2CLY B;  3AEB A;  3FXE B;  5H6R B;  5IHY A;  2V7L A;  5AQP B;  4HFD A;  4DV6 T;  5AQV B;  1MMA A;  4U2Y A;  5LG3 A;  2FJA A;  1L0V A;  4IGU A;  5KX5 E;  4OFZ A;  3LBX B;  5C3J A;  4HFC A;  4JI0 T;  2A2F X;  3AVS A;  1OXZ A;  2VKO A;  2ACZ A;  5JDF A;  3RYF E;  2IHR 1;  3KFW X;  1IJ5 A;  1S94 A;  4JEH B;  1LVK A;  1WR6 A;  4ZS3 A;  4YSY A;  4CI2 B;  2I0M A;  4PAG A;  5FXZ A;  5JDM A;  4AIS A;  2CXF A;  3CWZ B;  4TZ4 C;  3UU6 A;  4COF A;  3MAC A;  2PBI A;  4YLH A;  4WBN E;  2M67 A;  4DV7 T;  5LJN A;  2X9W A;  4PK5 A;  3FBL A;  5JH7 E;  3M3Z B;  1WFD A;  2XQ8 A;  2BG9 A;  4KI0 F;  4X65 T;  5AQH B;  3ZC1 A;  4DV5 T;  4O4I E;  4KHZ F;  2YK0 A;  2K9A A;  1E2A A;  3IHR A;  1Y01 A;  3O1J A;  2E2A A;  3OYZ A;  3P4Q A;  4I55 E;  2YOE A;  3VR9 A;  2H88 A;  2XSB A;  2NTX A;  4O4L E;  3GA8 A;  2VKH A;  4HFE A;  1QLB A;  2XAG B;  3Q9D A;  1VRB A;  4L0R A;  5LJM A;  3WI3 A;  2CCQ A;  2KWH A;  4EV6 A;  4DV1 T;  2XM1 A;  2X9X A;  3AAI A;  3E0Z A;  3IBP A;  4C91 A;  3RPU A;  3I9W A;  3RIU A;  2V1D B;  5JR9 A;  4HFV A;  3MJX A;  4ILB A;  1E7P A;  4AQF A;  4DND A;  5AQT B;  1W9R A;  3Q5W A;  2PG8 A;  2F4V T;  1M62 A;  1VCT A;  3H3A A;  3C4Z A;  4EEB A;  4U33 A;  3NZQ A;  2XTL A;  2DLR A;  1J5E T;  5AQR B;  4JYA T;  5LNK A;  2VVS A;  1D1B A;  3KIN B;  3O1I A;  4HWC A;  4IDP A;  1OED C;  2RP4 A;  4MHC A;  2EHO D;  2YU1 A;  3R6N A;  4DBQ A;  3PUZ F;  4IDQ A;  1N36 T;  4UIG A;  2XQY A;  3DQV C;  2VK9 A;  3ZN1 B;  2JPF A;  5M4Y A;  1HNZ T;  2DNX A;  3EVY A;  3CK6 A;  3TLU A;  3UU8 A;  3KV5 A;  1WCR A;  2YIN A;  4NXM T;  3PJA A;  2NTY A;  4X64 T;  3PE0 A;  4X62 T;  4ZEY A;  2J1D G;  3E22 E;  3SS1 A;  3UT5 E;  5LGT B;  2RA1 A;  4H9N C;  3W15 B;  2V6X A;  2XAJ B;  2JRK A;  4B3R T;  2ES0 A;  3BQK A;  4B3M T;  1SUM B;  4IE4 A;  5FVK A;  3VRB A;  2LT3 A;  3A8Y C;  3RLF F;  4CI3 B;  2DWG A;  2KIN B;  2FBW A;  2LM9 A;  3V5U A;  5HWY A;  4GK5 E;  4DMV A;  2K3W A;  3VR8 A;  4YY3 T;  3NBX X;  1IAP A;  1VOM A;  4IHJ E;  3IEE A;  2XQ3 A;  4YFS A;  4EZ4 A;  3RC3 A;  5EK2 A;  5JRC B;  4O4J E;  3RTR A;  1D1C A;  4BAY B;  2K48 A;  2VKD A;  1JNZ A;  2BBJ A;  2W62 A;  3DTO A;  3ONL C;  2KMF A;  1XDP A;  2XAS B;  4K0U A;  5JR9 C;  3FBZ A;  2W61 A;  2LSJ A;  4DR5 T;  2IAK A;  4IIJ E;  4M1P A;  5HXC A;  2D9D A;  2YN6 A;  2V26 A;  4YTP A;  2WDV A;  3I9Y A;  3JC6 D;  3OKQ A;  3QNU A;  5L4H A;  5HEJ A;  1FEW A;  5LOV E;  5FP3 A;  4BJM A;  4ILC A;  3OTO T;  1WYB A;  3UFE A;  2V7M A;  3BK9 A;  3ZJ2 A;  1LDJ A;  3HR0 A;  3FZH B;  3EAB A;  3QUJ A;  4LF6 T;  5HXS A;  1W09 A;  3PUX F;  4JI4 T;  3DPL C;  4J2C A;  4X1Y E;  1HX8 A;  4N78 D;  1XZY A;  3VHL A;  2WWV A;  5CFB A;  1HTJ F;  2PTF A;  3RRC A;  5ABE A;  1LDK A;  2H7O A;  2LRL A;  3IF8 B;  2VQF T;  2WBL A;  4U72 A;  5L2L A;  3RKG A;  2CRB A;  4PW8 A;  5ETW A;  5L3E B;  1SHZ C;  4EXT A;  5L4E A;  3LK2 B;  2OV9 A;  3KBU A;  2BS3 A;  1S35 A;  4LML A;  2GK9 A;  1IBL T;  2D0U A;  2Q9Q A;  4ISS A;  3ZMV B;  3N2O A;  3P4P A;  4HWF A;  5AQO B;  3CX8 B;  2IC6 A;  3ZSS A;  3N9Q A;  3AA1 B;  4IE5 A;  4QX7 B;  4L9I A;  1UGO A;  5KMG P;  2KSR A;  4P09 A;  5CB4 E;  5DQW A;  2BKN A;  2V6Y B;  2X0H A;  4HFB A;  4UR9 A;  2BZB A;  5CA0 E;  2QGS A;  3PU3 A;  5ABF A;  4OYJ A;  5L3G B;  4CI1 B;  5L3C B;  1FIO A;  3KV9 A;  3SRZ A;  5FYM A;  2FJD A;  2LSI A;  1M7K A;  2CHO A;  2ZLY A;  4H9O C;  2XY8 B;  2QRX A;  4Z8X A;  4EED A;  3CIR A;  3A7M A;  5LMU T;  3AEC A;  4YHJ A;  1I94 T;  1KF6 A;  2WS3 A;  3NRY A;  2EHO A;  2C5I T;  2RPA A;  5LG4 A;  2E9X A;  2FUP A;  3KVA A;  1H7C A;  1U5P A;  1Y64 B;  1HNX T;  4WNK A;  2VQE T;  2LKH A;  2LOS A;  3AE3 A;  3ZPO A;  2B76 A;  3A5X A;  3AED A;  3MA9 A;  2JMK A;  2XAF B;  4ZOL E;  2JQQ A;  3ZST A;  2WZH A;  3N2K E;  4KBM B;  1BR0 A;  1X79 A;  3OJA A;  3NKZ A;  2ZM6 T;  2WZI A;  3X1D A;  4HWD A;  2XZE A;  3C64 A;  4P1N A;  2CXD A;  3N9O A;  4CXW A;  2ZM8 A;  4X5T A;  4HXI B;  2DL1 A;  5C2T A;  3ONJ A;  4P5O A;  4WYV A;  5JDH A;  1KEY A;  3HL6 A;  1UCU A;  3KDS E;  5AQJ B;  4YXD A;  4AP2 B;  4B3T T;  4DR4 T;  4FI5 A;  2AXD S;  2DI4 A;  3RHW A;  1J1J A;  2LHN A;  3KBT A;  4JV5 T;  2JJ9 A;  2V7I A;  2LEH A;  4H9S E;  4F6R C;  2CWY A;  4H9R C;  2LKG A;  4HWI B;  1N34 T;  2XQ9 A;  4LF5 T;  1D1A A;  4LMK A;  1HX1 B;  3MZK B;  1KK7 A;  4OYK A;  3T1H T;  2UXB T;  2JQ9 A;  2MOZ A;  4U2Z A;  5ABF B;  5LHH B;  3PUR A;  1VCS A;  2IIU A;  1X9B A;  3FZL B;  4O4H E;  4QH5 A;  1FMV A;  4JI1 T;  2J4G A;  3QB5 K;  2BKO A;  2XJ7 A;  3EHZ A;  5AQK B;  2Y48 B;  3ZLI A;  4EZH A;  3ANW A;  2XQA A;  4ZI3 D;  3K3Q C;  4JI8 T;  5LBQ B;  3UQ7 A;  4DV3 T;  4XBF B;  2XSA A;  2JIW A;  4FJO A;  2VAS A;  4XZC A;  2LE8 A;  2HN2 A;  4IRE A;  2CEA A;  3FZM B;  2CXL A;  5FVL A;  2VKJ A;  5L3F B;  4LF7 T;  5BR8 T;  4X20 E;  3NZP A;  3B13 A;  3O1H A;  4P0A A;  1XNR T;  1U6G A;  4BA9 A;  1N33 T;  2BKP A;  4IE7 A;  4KUM B;  3M65 A;  4H63 V;  3P7I A;  2UU9 T;  3TLV A;  3ZJ1 A;  4UF0 A;  4Z91 A;  3QB5 A;  5HXR A;  3SFE A;  3RIU C;  4AQG A;  1IBM T;  1HCI A;  4P0B A;  2J47 A;  2JMH A;  1WR0 A;  4A5X A;  4PK6 A;  4PJJ A;  5AQU B;  3AXJ A;  2VL8 A;  3PUV F;  1MMN A;  4PJM A;  4DMW A;  2XUE A;  4DVD A;  4DV0 T;  3RC8 A;  2CLY C;  1MND A;  2CE7 A;  2IUB A;  5IWA T;  2WZK A;  3PUA A;  2VVN A;  4IDO A;  4JI5 T;  1B7T A;  3B5M A;  4YHH T;  4OK0 A;  2E8I A;  3K3O A;  1ZV4 X;  3SFD A;  4DUY T;  1QSD A;  2WMN A;  2M6B A;  1YQ4 A;  2CWO A;  3NWI A;  2J62 A;  3CX7 B;  4X1I E;  1KNR A;  2WQY A;  3VU7 H;  3HI2 A;  5FL1 A;  5J1G A;  2A3D A;  2DHR A;  4DR7 T;  1R8I A;  5EZY E;  3U3I A;  2IC9 A;  3RQU A;  4AXP A;  1YKH B;  1Z8U A;  4XAX B;  5FXV A;  5GON E;  4PNI A;  4ERR A;  2W63 A;  2C5K T;  2NW7 A;  5JDQ A;  5LP6 E;  1N32 T;  1T8B A;  2BVM A;  3AE6 A;  3P4R A;  2XQ4 A;  1IZN B;  3T1Y T;  3HKB E;  3KV4 A;  4MLK A;  5F3J A;  4CN4 A;  3ZT6 A;  1I6Z A;  1XWM A;  3GN5 B;  1ZKE A;  4LMJ A;  4AQF C;  3AA7 B;  5L3B B;  2CMR A;  1HR0 T;  3LK4 2;  3RQW A;  2V8S V;  2L3L A;  2V5C A;  2DWK A;  3PUY F;  1T98 A;  2KWI B;  2W67 A;  3H3M A;  3ONX A;  4ZI2 D;  1YW0 A;  2H7V C;  3RKO A;  4EYU A;  5A1L A;  2VUR A;  3RF1 A;  4DR6 T;  1ZOY A;  4ZI2 C;  1QUU A;  3ANW B;  2OLT A;  4KMC A;  2X68 A;  4JBW F;  1NEN A;  2HPL A;  2NW8 A;  4HN9 A;  4WW0 A;  2NWB A;  3AE8 A;  4GKJ T;  1WYC A;  2H3R A;  3AAA B;  4CXY A;  4LF8 T;  4ZI7 E;  4NUU A;  2IW5 B;  2X67 A;  2WB5 A;  1ZHC A;  2YEV C;  2BG9 C;  5KDM C;  5JDG A;  5AQF B;  2WU5 A;  4IL9 A;  1LKX A;  4KHP T;  2C0S A;  3LJC A;  5LHG B;  4AKI A;  4QH4 A;  4MAL A;  5CA1 E;  1CHU A;  5HXH A;  2WMO A;  4YJ3 E;  4UVC B;  3L3P A;  5AQM B;  4H9Q C;  4HWH A;  4OHF A;  4CZZ B;  3Q2M A;  2MTQ A;  3RYH E;  2Y8D A;  2X51 A;  3Q5X A;  2XQ6 A;  3EI0 A;  3MXZ A;  3HKE E;  3RX6 A;  2R6G F;  2NW9 A;  4YTM A;  5FY0 A;  4LFC T;  4DR3 T;  4X66 T;  4QKN A;  3AEF A;  3K8P C;  1WRD A;  4UVA B;  3ZYL A;  2WM9 A;  3JAD A;  1MIY A;  4TNW A;  1Z0P A;  1KFY A;  2BDE A;  4AIU A;  3AEE A;  4EGW A;  2WWU A;  2UXX B;  3HKC E;  4UEM A;  2V7K A;  2DCF A;  2P9B A;  2NR4 A;  3PV0 F;  4IE0 A;  4TX5 A;  4N9F 3;  1NWM X;  3F2E A;  3GN5 A;  1KNP A;  1DU2 A;  4I0U A;  2K5B B;  1YKE B;  3K3N A;  2BG9 E;  2H89 A;  3OBV E;  3RIF A;  2L9Q A;  2N2N A;  5LCY A;  5ABG A;  3J9X 1;  3BQL A;  3UUL A;  2CPT A;  4YSX A;  4ZHQ E;  5C8Y E;  5ADX L;  5LMN T;  2CM0 A;  2C5J A;  2LM2 A;  2YU2 A;  3ESL A;  5L47 A;  3ZT7 A;  3ETU A;  2QYW A;  2WP9 A;  1KNZ A; 
#chains in the Genus database with same CATH homology
 3ZMU B;  5JRE A;  3BQI A;  5BMV E;  3CQC B;  5JDL A;  2L8K A;  3C4W A;  1D0X A;  3EDV A;  5DAB A;  2X66 A;  1G8X A;  4BJN A;  1UX4 A;  2ZM2 A;  3CX6 B;  4L5G A;  3F57 A;  4KP3 C;  1WLX A;  4G2A A;  4O8S A;  4ZI3 C;  3H37 A;  4QHO A;  5E0O A;  1BR1 A;  2UXN B;  5L3D B;  4JLE A;  1MNE A;  2G0U A;  4ANJ A;  4PFO A;  4GYR A;  1HG2 A;  4GK0 E;  4GYS A;  3C4X A;  3I0Q A;  4QX8 B;  3T8O A;  2Q9Q B;  3D0T A;  4TUY E;  1BR2 A;  2MYS A;  1G73 A;  4UF0 B;  3CML A;  3PUS A;  3ZN0 B;  3O4X E;  4WBO A;  2W0G A;  1NAF A;  2XHE B;  3F31 A;  5H6Q B;  3EUH A;  2ACX A;  4EIW A;  3RRW A;  3B57 A;  1HF8 A;  3KV6 A;  3P8C D;  5JVD E;  3RYI E;  2PFV A;  1V9D A;  4HTE A;  3CPZ A;  2ZMA A;  2VWA A;  2LSK A;  3FHN A;  5JQG E;  4JUY A;  3O9X A;  3PUQ A;  3PTR B;  4V1A v;  3NRX A;  4JEU B;  3MK7 C;  4I50 E;  5FY1 A;  3SWH A;  4UVB B;  3UUM A;  2X9Y A;  3LK3 B;  3N9N A;  1EZ3 A;  2LJL A;  3GWH A;  2NOX A;  4PJN A;  4IE6 A;  2ODV A;  3N2G E;  3OYX A;  4U74 A;  4HKA A;  1HG5 A;  3ZCI A;  2Y6X A;  5AFU L;  1LRZ A;  4AKR B;  4DBR A;  5EK4 A;  4AI6 A;  1OWA A;  1MIW A;  1U4Q A;  4AKH A;  4O2B E;  3QC9 A;  4UV9 B;  1IJ6 A;  4YJ2 E;  1AJ3 A;  3C51 A;  1E1H B;  4ADZ A;  4G63 A;  2E9X D;  4E7Z A;  2VB6 A;  5FXX A;  5LHI B;  2WAU A;  3LG7 A;  1MMG A;  3VKH A;  2KZ7 B;  4EAH A;  3C50 A;  2HPJ A;  3SOL A;  1LVF A;  5F8P A;  1D0Y A;  3ZMT B;  2Q9Q C;  1MIV A;  3N9L A;  3ZMS B;  4IST A;  4AKG A;  3FXD B;  3AAE B;  4O2A E;  5DQV A;  3J7Y q;  2PJQ A;  3AA0 B;  3KVB A;  4UXN B;  1YD8 G;  2KT9 A;  4I4T E;  5J2U E;  5LA6 E;  1HS7 A;  2LSG A;  3PUG A;  4CXY A;  1O3X A;  4QXC B;  3CVR A;  5HAX A;  4TN7 B;  2BVL A;  3U78 A;  3HA4 A;  2KLQ A;  3PDY A;  4NUV A;  2CA5 A;  3JC6 C;  4HGA A;  4PJL A;  3AB3 B;  5HXE A;  4E7S A;  4A56 A;  3ZC0 A;  2HH7 A;  3S4U A;  5JDN A;  4ASK A;  3LFM A;  2LOP A;  2ZM0 A;  5FMN A;  4DO0 A;  2E9X B;  4CXX A;  1BR4 A;  3UTK A;  2KXP B;  2SPC A;  1HFA A;  1UX5 A;  2WSS V;  4PK4 A;  3I1A A;  3N9P A;  4EB6 E;  2A72 A;  3GMI A;  2MBG A;  2N1G A;  3RYC E;  3MKD A;  5FXW A;  4UV8 B;  3EDU A;  3PU8 A;  4C90 A;  4QXH B;  3ZEF B;  3L09 A;  1FMW A;  4QXB B;  1CUN A;  3AA6 B;  5EK3 A;  2KND A;  3ZCJ A;  1MMD A;  2D2S A;  5IYZ E;  5J2T E;  2D0T A;  3RH3 A;  2XAQ B;  3ZMZ B;  3UUN A;  3E08 A;  4X1K E;  4EYY R;  2X9H A;  4HEA A;  4TV8 E;  5LGU B;  2LSY A;  2Z6E A;  3HKD E;  3TKL B;  2ODU A;  2W00 A;  2N9D A;  1SA0 E;  4HE8 A;  4I43 B;  4ILU A;  3CQX C;  2QA7 A;  2V7J A;  5HWX A;  3CKD A;  3C98 B;  3I0O A;  1ZEE A;  4H9P C;  4AKL A;  3V5S A;  5LBM A;  3N9M A;  2I59 A;  3AVR A;  5LGN B;  2OA5 A;  3ETV A;  2D5U A;  3WAJ A;  4GIW A;  4QWN B;  2XU0 A;  5LXT E;  3DP7 A;  3DJB A;  3N5L A;  5TAO A;  3FB2 A;  5HYA A;  5LYJ E;  4TV9 E;  5FY7 A;  4UEL A;  3R84 B;  2B1E A;  2EHO B;  3LBX A;  5FNV E;  4CQI A;  3ZYK A;  4H63 H;  2X0L B;  3UUX B;  2LHR A;  2E9X C;  2Q9Q D;  4IDZ A;  2EHO C;  1D0Z A;  4PFP A;  4MBQ A;  2K24 A;  2XAH B;  5JRC A;  1US7 B;  3QK6 A;  4GOU A;  3WAK A;  4B6X A;  4EOZ B;  3ZYM A;  4MFR A;  2NP9 A;  5DJQ C;  3CQG B;  4ZS2 A;  5IHY A;  2CLY B;  3FXE B;  5H6R B;  2V7L A;  1MMA A;  4IGU A;  5KX5 E;  4OFZ A;  3LBX B;  3VKG A;  2A2F X;  3AVS A;  1OXZ A;  2VKO A;  5JDF A;  3RYF E;  3KFW X;  1IJ5 A;  1S94 A;  4JEH B;  1LVK A;  1WR6 A;  4ZS3 A;  4CI2 B;  4PAG A;  5FXZ A;  5JDM A;  2CXF A;  3CWZ B;  4TZ4 C;  4WBN E;  3MAC A;  2PBI A;  4YLH A;  2M67 A;  5LJN A;  2X9W A;  4PK5 A;  3FBL A;  5JH7 E;  3ZC1 A;  4O4I E;  2YK0 A;  2K9A A;  3IHR A;  3O1J A;  3OYZ A;  4I55 E;  4O4L E;  2NTX A;  3GA8 A;  2VKH A;  2XAG B;  3Q9D A;  1VRB A;  4L0R A;  5LJM A;  3WI3 A;  2CCQ A;  2KWH A;  3AAI A;  2X9X A;  3E0Z A;  3IBP A;  4C91 A;  3RPU A;  3I9W A;  2V1D B;  5JR9 A;  4HFV A;  3MJX A;  4AQF A;  4DND A;  3Q5W A;  2PG8 A;  3H3A A;  3C4Z A;  3NZQ A;  2XTL A;  2DLR A;  5LNK A;  3KIN B;  1D1B A;  4MHC A;  3O1I A;  3R6N A;  2RP4 A;  2EHO D;  2YU1 A;  4DBQ A;  4UIG A;  2XQY A;  2VK9 A;  3ZN1 B;  2JPF A;  5M4Y A;  2DNX A;  3EVY A;  3KV5 A;  2YIN A;  2NTY A;  3PE0 A;  2J1D G;  3E22 E;  3SS1 A;  3UT5 E;  5LGT B;  2RA1 A;  4H9N C;  3W15 B;  2XAJ B;  2JRK A;  2ES0 A;  3BQK A;  4IE4 A;  5JR9 B;  2LT3 A;  4CI3 B;  2DWG A;  2KIN B;  2LM9 A;  3V5U A;  4DMV A;  5HWY A;  4GK5 E;  3NBX X;  1IAP A;  1VOM A;  4IHJ E;  3IEE A;  4EZ4 A;  4YFS A;  5JRC B;  3RC3 A;  5EK2 A;  4O4J E;  1D1C A;  4BAY B;  2K48 A;  2VKD A;  2W62 A;  3DTO A;  2KMF A;  2XAS B;  4K0U A;  5JR9 C;  3FBZ A;  2W61 A;  2LSJ A;  2IAK A;  4IIJ E;  4M1P A;  5HXC A;  2V26 A;  3JC6 D;  3I9Y A;  3OKQ A;  1FEW A;  5LOV E;  5FP3 A;  4BJM A;  1WYB A;  3UFE A;  2V7M A;  3BK9 A;  3ZJ2 A;  3HR0 A;  3QUJ A;  5HXS A;  4J2C A;  4X1Y E;  1HX8 A;  4N78 D;  3VHL A;  1HTJ F;  3RRC A;  2H7O A;  3IF8 B;  2WBL A;  4U72 A;  5L2L A;  4PW8 A;  5ETW A;  5L3E B;  1SHZ C;  4EXT A;  3LK2 B;  3KBU A;  1S35 A;  2GK9 A;  2D0U A;  2Q9Q A;  4ISS A;  3ZMV B;  3N2O A;  3CX8 B;  2IC6 A;  3N9Q A;  3AA1 B;  4IE5 A;  4QX7 B;  4L9I A;  5KMG P;  4P09 A;  5CB4 E;  5DQW A;  2BZB A;  5CA0 E;  2QGS A;  3PU3 A;  4OYJ A;  5L3G B;  4CI1 B;  5L3C B;  1FIO A;  3KV9 A;  3SRZ A;  5FYM A;  2LSI A;  2ZLY A;  4H9O C;  4Z8X A;  4YHJ A;  3NRY A;  2EHO A;  2C5I T;  5LG4 A;  2E9X A;  3KVA A;  1H7C A;  1Y64 B;  1U5P A;  4WNK A;  2LOS A;  3ZPO A;  3A5X A;  3MA9 A;  4ZOL E;  2JMK A;  2XAF B;  2JQQ A;  3N2K E;  1BR0 A;  4KBM B;  1X79 A;  3OJA A;  3C64 A;  2CXD A;  3N9O A;  4CXW A;  2ZM8 A;  5JDH A;  3HL6 A;  1UCU A;  3KDS E;  4FI5 A;  2DI4 A;  2LHN A;  3KBT A;  2JJ9 A;  2V7I A;  2LEH A;  4H9S E;  4F6R C;  2CWY A;  4H9R C;  1D1A A;  3MZK B;  1KK7 A;  4OYK A;  2MOZ A;  5LHH B;  3PUR A;  4O4H E;  1FMV A;  4EZH A;  3ZLI A;  2Y48 B;  3ANW A;  4ZI3 D;  3K3Q C;  5LBQ B;  4XBF B;  4FJO A;  2VAS A;  4XZC A;  2LE8 A;  2CEA A;  2CXL A;  5L3F B;  2VKJ A;  4X20 E;  3NZP A;  3B13 A;  3O1H A;  4P0A A;  4BA9 A;  4IE7 A;  4KUM B;  3M65 A;  4H63 V;  3P7I A;  3ZJ1 A;  4UF0 A;  5HXR A;  4AQG A;  1HCI A;  4P0B A;  2JMH A;  4PK6 A;  4PJJ A;  2VL8 A;  1MMN A;  4PJM A;  4DMW A;  2XUE A;  4DVD A;  3RC8 A;  2CLY C;  1MND A;  2CE7 A;  3PUA A;  1B7T A;  4OK0 A;  2E8I A;  3K3O A;  1ZV4 X;  1QSD A;  2WMN A;  4X1I E;  2CWO A;  3CX7 B;  3VU7 H;  3HI2 A;  5J1G A;  2A3D A;  2DHR A;  3U3I A;  5EZY E;  4AXP A;  2IC9 A;  1YKH B;  4XAX B;  5FXV A;  5GON E;  4PNI A;  4ERR A;  2W63 A;  2C5K T;  2NW7 A;  5JDQ A;  5LP6 E;  2BVM A;  1IZN B;  3HKB E;  3KV4 A;  4MLK A;  5F3J A;  5L3B B;  3GN5 B;  1ZKE A;  4AQF C;  3AA7 B;  2CMR A;  3LK4 2;  2L3L A;  2DWK A;  1T98 A;  2KWI B;  3ONX A;  4ZI2 D;  1YW0 A;  2H7V C;  3RKO A;  4EYU A;  5A1L A;  4ZI2 C;  1QUU A;  3ANW B;  4KMC A;  2X68 A;  2NW8 A;  2HPL A;  4HN9 A;  4WW0 A;  2NWB A;  1WYC A;  2H3R A;  3AAA B;  4ZI7 E;  4NUU A;  2IW5 B;  2X67 A;  1ZHC A;  2YEV C;  5KDM C;  5JDG A;  1LKX A;  2C0S A;  3LJC A;  5LHG B;  4AKI A;  4MAL A;  5CA1 E;  5HXH A;  2WMO A;  4YJ3 E;  4UVC B;  3L3P A;  4H9Q C;  4CZZ B;  4OHF A;  3Q2M A;  2MTQ A;  3RYH E;  2Y8D A;  2X51 A;  3Q5X A;  3MXZ A;  3HKE E;  3RX6 A;  2NW9 A;  5FY0 A;  4QKN A;  3K8P C;  3ZYL A;  1WRD A;  4UVA B;  2WM9 A;  1MIY A;  1Z0P A;  2BDE A;  2WWU A;  2UXX B;  3HKC E;  4UEM A;  2V7K A;  2DCF A;  2P9B A;  4IE0 A;  4TX5 A;  1NWM X;  3F2E A;  3GN5 A;  2K5B B;  1YKE B;  3K3N A;  3OBV E;  2L9Q A;  2N2N A;  5LCY A;  3J9X 1;  3BQL A;  3UUL A;  4ZHQ E;  5C8Y E;  5ADX L;  2CM0 A;  2C5J A;  2YU2 A;  3ESL A;  3ETU A;  1KNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...