5F3JA

Crystal structure of dbp in complex with inhibitory monoclonal antibody 2d10
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
251
Chain Sequence
YKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKITDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Broadly neutralizing epitopes in the Plasmodium vivax vaccine candidate Duffy Binding Protein.
pubmed doi rcsb
source organism Plasmodium vivax (strain salvador i)
molecule tags Immune system
total genus 88
structure length 251
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5f3jA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 5f3jA01
5F3JA 4NUUA 2Y8DA 2WAUA 2XU0A 3BQLA 4YFSA 3RRCA 3C64A 3BQIA 3CPZA 3CMLA 2YK0A 4NUVA 3BQKA
chains in the Genus database with same CATH superfamily
5F3JA 3RHWA 5HXEA 2KT9A 3L09A 2W61A 2CXFA 3GN5B 4KI0F 2VKOA 3DQVC 2N1GA 4DVDA 3UUNA 1ZP0A 4ISTA 2H88A 3ANWA 3BQKA 4TN7B 5A1LA 3DPLC 4UF0B 5HEUA 3K3OA 4IE6A 4OK0A 4ZI2D 2X9XA 4DIDB 4ZI3C 4QH4A 2K5BB 2HN2A 1SA0E 4LFAT 3AVSA 2JPFA 4NXNT 3C98B 3NKZA 1VCTA 4I0UA 2MTQA 2WMNA 1UUSA 2CHNA 4TX5A 5AQPB 1VCSA 2BG9B 2WB5A 4KX6A 3UTKA 3HKCE 3VR8A 3ZT7A 3ZMTB 4HE8A 1WRDA 4A98A 2XM2A 5C3JA 5L4EA 3IEEA 2CE7A 3FHNA 2KNDA 2QA7A 1NAFA 4WYVA 3VU7H 4DR7T 1N36T 2UXBT 2A72A 5LGUB 1SE7A 1FMVA 4X62T 2IUBA 2ZM2A 2LEHA 2XSBA 4EAHA 3Q9DA 1U6GA 3I9WA 4E7SA 5FL1A 2BKPA 2WWUA 5LXTE 3AECA 1NENA 4OHFA 2Q9QD 3ABVA 3VRAA 3CVRA 5HWXA 2L9QA 5IYZE 1U5PA 2H3RA 2PJQA 2NW8A 2ODUA 1NEKA 2XAHB 1FJGT 2BZBA 2XQYA 3FBZA 3RTRA 2E9XB 2FJBA 5HEGA 4M1PA 3E08A 2RPAA 3QNUA 5ETWA 1ZOYA 2EHOD 5LHGB 1YXRA 4ILUA 3AE4A 2VL8A 2JQKA 4KP3C 4ZS3A 4ILCA 5AQLB 3PURA 4CI3B 1E7PA 3O1IA 5L3EB 2WU2A 2FJDA 1BR1A 2YDSA 5KXJA 3ZYLA 1XNRT 3AE3A 3B5MA 3V5UA 2AXDS 2R6GF 4DBQA 1BR0A 1Z8UA 4DV1T 2A3DA 2E8IA 4U2YA 4DR4T 4PJLA 5HXCA 4MALA 4U2ZA 2X0HA 4PFOA 1D1AA 2I59A 2X66A 1FEWA 2K3WA 2KSRA 3VKHA 4EZHA 3AVRA 4O2BE 3K3NA 2L8KA 3ZT5A 4IIJE 1W09A 4CN1A 3AEBA 3ESLA 3EUHA 1IJ6A 5LBQB 3C51A 4N78D 4EZ4A 1D0XA 4P1NA 4DV4T 1MNDA 3UUMA 1LRZA 2VKDA 1W0AA 4B3MT 3N9MA 3EVYA 5IHYA 4AKIA 2CWYA 4QX8B 2YEVC 4YTMA 1N34T 1WLXA 2XHEB 3PDYA 4IDQA 4YJ2E 3LBXB 3RRCA 4AP2B 3C4XA 4ZZBA 2W62A 4L9IA 1H7CA 2CBJA 2XM1A 4X1YE 1ZV4X 4K0UA 1E1HB 5JDHA 4IHJE 2D0UA 2XAFB 4X20E 4HN9A 5AQJB 4HKAA 5F5WA 2KINB 4YFSA 4U7IA 2X9HA 5CJ5A 4ZI2C 5JDNA 2FBWA 4NUVA 1ZEEA 4JI1T 2W67A 3LK2B 2ZM0A 2VB6A 3W15B 4P0AA 2A2FX 3AE9A 1UURA 4TZ4C 2MAWA 3ZLIA 1J5WA 3O9XA 2J62A 4QX7B 1D1CA 4ZI3D 5JRCB 2LLYA 3IBPA 4H63H 4L0RA 4UVBB 3KV4A 4EB6E 2CEAA 4KMCA 3ZMUB 2WBLA 3ZMVB 4YLHA 1ZKEA 5JH7E 1SUMB 5JDGA 2YOEA 4PJMA 2BS2A 5LJMA 3VR9A 5JDFA 2CLYC 1HCIA 2XQ3A 1WYCA 3ONXA 2Q9QB 2WU5A 2J47A 3KV9A 3CKDA 2LRLA 5BR8T 5LJNA 5AQGB 5JR9B 4DV5T 2WM9A 3B57A 2WAUA 2BVMA 2JMKA 4FI5A 4WQOD 5LB7B 2JQ9A 1AJ3A 3AEFA 3P4PA 3QOFA 2EHOB 2UU9T 1XZYA 4L5GA 4FJOA 4P09A 3J9X1 5GONE 2WDVA 3R6NA 3PUSA 1XNQT 3CWZB 2PBIA 4PFPA 3FBLA 4P0BA 5EZYE 1OXZA 3A5XA 2V5DA 3ZSTA 5BMVE 3I0OA 1MIWA 3N2GE 1Y01A 3LSVA 1WFDA 3UFGA 2IC9A 5JTGA 3MK7C 4B3ST 4KUMB 1KFYA 2CHOA 3ZPOA 3JAEA 2NR4A 2WZIA 1QSDA 5EK3A 2F4VT 4F52A 2JQQA 3PUWF 5ABGA 3OTOT 2SPCA 1HTJF 1EZ3A 5FMNA 5DQVA 2W66A 4K0KT 4HWHA 2IHR1 1XDOA 4A64A 3CX7B 4HTEA 2IW5B 3AE8A 3F2EA 2FUPA 1FIOA 2RP4A 3UU6A 4IDZA 3G06A 2RA1A 3ZKRA 4JI5T 3K3QC 4HWDA 5FY1A 4DUZT 1HX1B 2NW9A 3QC9A 2IDOB 2W2UA 4JI2T 5LOVE 4JI3T 1OEDA 2C5JA 3P4SA 3UT5E 3MZKB 4X64T 1KNZA 2PTFA 2XQ6A 3RIUA 2WZKA 4PJJA 5AQRB 2QGSA 2XQ9A 3RC3A 5LCYA 2LM2A 4EEBA 4IGUA 4YTPA 2UUAT 1N32T 5LMNT 3EAMA 3PU8A 4GOUA 2PFVA 2CMRA 5HCJA 2D2SA 3PV0F 5EK2A 3UUBA 3RI5A 3AA1B 2QYWA 4TWHA 3RLFF 3N5LA 2LKHA 4DV6T 2IC6A 5FL0A 4Z91A 4AIUA 4UXNB 2C0SA 3RYFE 2JIWA 4CXXA 4YHJA 4AKRB 3HL6A 3FZHB 3MA9A 1LDKB 2KWHA 4BJNA 4H9OC 3SS1A 5LGTB 2I6HA 3CMLA 3M65A 2BS3A 4ZEYA 4H63V 3OYXA 3AA6B 1HF8A 3P4WA 2NW7A 2V6YB 3AE5A 4DR1T 2CPTA 5LMUT 3AE7A 2WS3A 2BS4A 3IA3A 4UR9A 1R8IA 1QUUA 2V7LA 4WNKA 3PU3A 2H7OA 3N2OA 2AE9A 3F31A 4YT0A 3GWHA 5IWAT 1HG5A 4PJNA 2ES0A 4ZHQE 4QH1A 2Y8DA 5HEOA 3S4UA 4A56A 4LF5T 3ZMSB 5JDQA 2YKSA 2V26A 4YSZA 4IL9A 4IDOA 2BVLA 3OKQA 2KWIB 4H9PC 2N9DA 4ZS2A 2BBJA 4EYYR 3H37A 4YHHT 1YKHB 4JBWF 2V5CA 1IBMT 2XAJB 1IBKT 4PK6A 4DV7T 3AA0B 3EI0A 4H9SE 1T98A 4QXHB 4BA9A 3PUQA 4NUUA 1V9DA 4A5XA 3TKLB 2JMHA 5FKYA 4LF8T 1JNZA 4PK5A 2IIUA 4B3TT 5AQUB 1VOMA 4U72A 4YJ3E 3DTOA 3HR0A 2V7IA 4C91A 5DJQC 4BAYB 5C8YE 3EHZA 1SHZC 3IHRA 2K9AA 3N9QA 4AI6A 3NWIA 4TNVA 4AQFC 1CUNA 3BQIA 2LE8A 2G0UA 2CA5A 4LF9T 3PUVF 3HKEE 2UUCT 2X0LB 1YQ4A 3PUXF 5FY7A 3SRZA 2XQAA 4CI1B 4X1KE 4JGHD 5KMGP 2VVSA 5H6QB 1T8BA 3UU8A 3I0QA 3RH3A 3Q5DA 3T8OA 3UULA 1N33T 3ZSSA 2P9BA 2H89A 4UF0A 2FJAA 2Y6XA 4JI6T 1Y64B 2QVAA 2NTYA 4CN6A 3PE0A 3E0ZA 4AISA 4JUYA 2XQ8A 4Z90A 1BR2A 1ZHCA 1NWMX 5ABHA 4DV3T 4GKKT 5CA0E 2IAKA 3CPZA 2LOPA 3NZQA 5L2LA 3AE1A 3QK6A 5JVDE 2V7KA 3KFWX 4C90A 4EEDA 3B13A 4ADZA 3ZYKA 4H9NC 3VHLA 3O4XE 5L3BB 4XBFB 2BG9A 3AEDA 4WZXA 2XUEA 2XAQB 4HEAA 4X5TA 1IAPA 4ERRA 4AQYT 1YD8G 5L3DB 3ETUA 4TV8E 4EXTA 3UQ7A 5CA1E 4DR2T 4ASKA 3EDVA 4IE7A 4JI0T 1DU2A 1G73A 2VQET 3LFMA 2C5IT 3PJAA 3SWHA 3KBUA 3AXJB 4V1Av 3FXEB 4LF4T 3ONJA 3P4QA 2X68A 1UK5A 2WWVA 3D0TA 5FP3A 4CI2B 3UFEA 4DR5T 2CRBA 1D0YA 5JDMA 4TWFA 2ODVA 3FZMB 3RC8A 4QH5A 3RGLA 2UUBT 1WR6A 1KEYA 3RYIE 4G63A 4U74A 4LMJA 4ZOLE 4DV0T 4AQFA 4ISSA 1LKXA 3AEGA 2X9YA 4I55E 3FB2A 2W4XA 2E9XA 5AFUL 2BDEA 2XQ7A 3X1DA 1OEDC 5LNKA 4DUYT 2OV9A 3RIUC 3N9LA 2CLYB 5FXVA 3AAAB 5CB4E 2X0YA 4XZCA 3TLUA 4MHCA 2J1DG 5JDLA 3IF8B 5ABEA 2WZHA 1MMAA 4HFCA 4EGWA 3PUYF 4OFZA 3L39A 5F8PA 3O1HA 4DMWA 3ZC1A 4NXMT 3FZKB 1HR0T 4IL4A 4LFCT 4LMKA 2NOXA 3RX6A 2K24A 5J2TE 3PUGA 5HXHA 2Y48B 1B7TA 3Q2MA 3ANWB 4H9RC 3RPUA 4QHOA 4QWNB 3I9YA 3N9PA 3RYHE 2C5KT 3HI2A 4KHZF 5L4HA 1MMGA 4U31A 4ANJA 3K1SA 3UUXB 5CGMA 1S94A 3DJBA 3ZN1B 2ACZA 2DLRA 2BKOA 2MYSA 5L47A 4DV2T 4HFHA 3C50A 3WAKA 3T1YT 4YXDA 3LK3B 2YK0A 3LBXA 4UVCB 2XU0A 4TNWA 4JEUB 4JEHB 2DI4A 2CCQA 2J4GA 3TLTA 3M3ZB 3V5SA 2DWGA 5AQIB 2E9XD 5KX5E 4CXWA 4CXYA 3MXZA 2CM0A 3C4WA 4IE4A 4E7ZA 3ETVA 3AAEB 2UXXB 4HWFA 4UIGA 3SOLA 5HEHA 2HPLA 4UELA 3SFEA 4HWIB 5LYJE 3PUZF 2YINA 4B3RT 4ZXLA 1HNWT 3AA7B 3P4RA 4WBNE 4YY3T 5FXZA 4COFA 4DO0A 5L3GB 5IUXA 4P5OA 4GKJT 3UU4A 4CZZB 1US7B 2LHNA 3CQCB 2Q9QA 3KVBA 1I6ZA 5LG4A 2VL0A 5C2TA 1UX5A 1IJ5A 3RRWA 3UU5A 4HFIA 1IBLT 4TUYE 3ZCJA 3A8YC 2CBIA 5JR9A 3QB5K 4KHPT 2WCAA 4NPPA 3HA4A 2YDRA 3H3MA 2W0GA 5HAXA 2CWOA 5M4YA 2DHRA 2L3LA 1W9RA 4EOZB 2EHOA 3KDSE 4MFRA 2M6IA 3GA8A 4AXPA 4HXIB 5LBMA 1UGOA 2YU2A 4U3CA 4U33A 4G2AA 1M62A 1WCRA 3JC6D 2K48A 2NTXA 2LJLA 4HFVA 4GK5E 2M67A 4QKNA 3GMIA 5EK4A 4QXBB 1X79A 2KLQA 5LP6E 2MBGA 1MIVA 2UXNB 4YTNA 3Q5EA 2OLTA 5AQSB 2XJ7A 2VURA 3WI3A 2BG9C 3ZN0B 5HCMA 3EDUA 3JCFA 1T72A 5ABFA 1UX4A 2B1EA 5FXXA 1JNRA 5L3CB 3I1AA 4LMLA 3AEEA 2DWKA 2MOZA 1KNRA 3FZLB 4YSXA 1T7SA 2NP9A 2VKJA 4X66T 5DQWA 2X9WA 2WDRA 5LHHB 2JRKA 3UU3A 1X9BA 1L0VA 5AQQB 4UVAB 2LOSA 1UCUA 2FJEA 2XQ4A 2A9UA 3WAJA 4HGAA 4WW0A 5HXRA 4F8HA 5HEJA 1BR4A 2WQYA 1GQEA 3O1JA 4GYRA 3OBVE 5AQNB 3ZYMA 2XAGB 3KV5A 2Z6EA 2V7JA 1KK7A 4OX9T 3TLSA 2XASB 2E9XC 3N2KE 2H7VC 4X1IE 4EYUA 1WYBA 1MIYA 2NWBA 4BJMA 2PG8A 1LVKA 2CXDA 5AQOB 2M6BA 2LSGA 3OPCA 4GYSA 1LDKA 3AE2A 2KMFA 5TAOA 1J1JA 5DABA 5AQFB 3OYZA 5LG3A 3GN5A 3EABA 2B76A 3CIRA 4B6XA 5FXWA 4YSYA 4PAGA 3RKGA 1YKEB 3NBXX 1KF6A 5CFBA 2V6YA 4ZI7E 2YU1A 2CXLA 2YN6A 3ZJ2A 4Z8XA 5HWYA 1LVFA 3R84B 4EV6A 5LA6E 2VKHA 1OEDE 4MBQA 4UV8B 2W00A 2JQHA 4UEMA 5L3FB 3L8RA 4Q25A 4U7YA 2XSAA 4LFBT 1HNZT 2XZEA 1VRBA 2N2NA 5AQMB 1XMQT 1XDPA 4TWDA 4CN4A 2LT3A 3NZPA 1QLBA 1MMDA 3C64A 4UV9B 2LSKA 3CK6A 3RIAA 4XAXB 2V6XA 2VWAA 3PTRB 4O8SA 3NRYA 4LF6T 3OVUA 4O4IE 2MPKA 2WSSV 3BQLA 4NIQA 4DMVA 1HX8A 2XY8B 2LKGA 4WBOA 1Z0PA 3ZT6A 4QXCB 2WP9A 3KV6A 5HXSA 3ZCIA 1U4QA 1HG2A 2WDQA 5FYMA 2ZMAA 4GIWA 3JC6C 5J2UE 1OEDB 5LGNB 1HNXT 3QB5A 3VRBA 3JAFA 1D0ZA 2QRXA 3AE6A 3UQ4A 4X65T 5AQHB 3H3AA 5LHIB 2D9DA 3JADA 4AKLA 3DP7A 2DL1A 2HH7A 3ZJ1A 2W63A 2BBHA 4IDNA 4OYKA 4JYAT 1S35A 4O4LE 3RKOA 4DNDA 3E22E 4F6RC 3LG7A 3PUAA 2XPKA 2KZ7B 3N9OA 3FZFB 1MNEA 5AQVB 2HN1A 1XMOT 3A7MA 5J0ZA 4O2AE 3P7IA 1HFAA 3KBTA 1FMWA 1HS7A 3OJAA 5ADXL 4I50E 2V7MA 3Q5WA 3QUJA 4O4JE 4ZZCA 4JI4T 5JQGE 3PJAJ 1E2AA 4APFB 3RIFA 4HFEA 1D1BA 3K8PC 4IDPA 5E0OA 3MKDA 3HKBE 3LDQB 4I43B 2Q9QC 5AQTB 4KBMB 2VASA 2V1DB 3J7Yq 2HHHT 3MACA 4EIWA 2I0MA 3AB3B 2LRKA 4I4TE 4JI8T 2KXPB 5JR9C 2XQ5A 1YQ3A 2E2AA 2ACXA 2V8SV 3ZMZB 5FY0A 5FVKA 2LSYA 3BK9A 1LDJA 3ONLC 4J2CA 1IZNB 4DR3T 2EHOC 4HWCA 4OYJA 3SFDA 1O3XA 2WY2A 3N9NA 4CQIA 3TLWA 2GK9A 2UXDT 4H9QC 2LHRA 3CX8B 2X67A 3HKDE 2DCFA 4IT4A 3P8CD 2JJ9A 3C4ZA 3NRXA 2E5VA 4AQGA 5FNVE 5FVLA 4AKHA 4N9F3 1M7KA 3KVAA 1W0BA 3ZC0A 2BKNA 2VVNA 4O4HE 2D5UA 2ZLYA 1MMNA 3KINB 2OA5A 3Q5XA 2UXCT 3AXJA 5JREA 1CHUA 5ABFB 2IMLA 2VQFT 3AEAA 2XTLA 4JI7T 2LSIA 1YW0A 1I94T 3L3PA 4MLKA 3ZEFB 2HPJA 2WMOA 3U78A 5J1GA 4LF7T 4JV5T 4PW8A 4TV9E 1KNPA 4JLEA 4ILBA 3CX6B 3LJCA 2ZM6T 5H6RB 3RYCE 3MJXA 5AQKB 5JRCA 3RF1A 4HFBA 5HYAA 3RQWA 4IE0A 4HFDA 3CQGB 4IE5A 3CQXC 2DNXA 1WR0A 3U3IA 4PNIA 3RQUA 3AAIA 1G8XA 3F57A 3NVOA 4A97A 4GK0E 4ILAA 4DR6T 2ZM8A 5KDMC 1J5ET 3FXDB 2BG9E 2VK9A 1OWAA 2E5LT 3T1HT 3LK42 4DBRA 3P50A 2X51A 4IREA 4AKGA 3VKGA 2LSJA 2D0TA 2LM9A 3TLVA 2YDQA 1XWMA 4PK4A
chains in the Genus database with same CATH topology
5F3JA 3SWHA 5HXEA 3KBUA 2KT9A 1BR4A 2PBIA 3L09A 4V1Av 3FXEB 2W61A 2CXFA 4PFPA 3FBLA 3O1JA 4GYRA 4P0BA 3OBVE 5EZYE 3GN5B 1OXZA 2VKOA 2XAGB 2N1GA 3A5XA 3ZYMA 4DVDA 2X68A 5BMVE 3I0OA 3KV5A 1MIWA 2V7JA 2Z6EA 1KK7A 3D0TA 3N2GE 5FP3A 4CI2B 3UUNA 3UFEA 1D0YA 4ISTA 5JDMA 3ANWA 3BQKA 4TN7B 5A1LA 2IC9A 3MK7C 2XASB 2E9XC 4KUMB 3N2KE 2ODVA 4UF0B 3RC8A 2H7VC 4X1IE 4EYUA 3K3OA 1WYBA 3ZPOA 1MIYA 4IE6A 4OK0A 2NWBA 4ZI2D 2X9XA 1QSDA 1WR6A 5EK3A 4ZI3C 3RYIE 4BJMA 4G63A 2PG8A 1LVKA 4U74A 2CXDA 2JQQA 4ZOLE 4AQFA 2LSGA 4GYSA 4ISSA 1LKXA 2K5BB 2SPCA 1HTJF 2KMFA 1EZ3A 2X9YA 5FMNA 5TAOA 1SA0E 4I55E 5DABA 3FB2A 3AVSA 3OYZA 2JPFA 5DQVA 3GN5A 2E9XA 5AFUL 2BDEA 3C98B 3CX7B 4HTEA 4B6XA 2IW5B 5LNKA 5FXWA 3F2EA 4PAGA 1FIOA 1YKEB 3NBXX 2RP4A 2MTQA 2WMNA 4TX5A 3N9LA 4IDZA 4ZI7E 2CLYB 2RA1A 5FXVA 3UTKA 3HKCE 3AAAB 3K3QC 2YU1A 5FY1A 5CB4E 2CXLA 3ZMTB 4XZCA 3ZJ2A 4HE8A 4Z8XA 1WRDA 5HWYA 3QC9A 4MHCA 2NW9A 1LVFA 2J1DG 5JDLA 3IF8B 3R84B 5LOVE 5LA6E 1MMAA 2VKHA 2C5JA 3IEEA 2CE7A 3UT5E 3MZKB 4MBQA 4UV8B 1KNZA 3FHNA 4OFZA 2W00A 4UEMA 5F8PA 2KNDA 4PJJA 2QA7A 3O1HA 1NAFA 2QGSA 3RC3A 5LCYA 4DMWA 3ZC1A 5L3FB 4IGUA 3VU7H 2A72A 5LGUB 1FMVA 2ZM2A 3PU8A 2LEHA 4GOUA 4EAHA 2NOXA 1VRBA 3RX6A 2K24A 2PFVA 5J2TE 2N2NA 3PUGA 2CMRA 3Q9DA 5HXHA 2D2SA 3I9WA 4E7SA 5EK2A 2Y48B 1B7TA 2WWUA 3Q2MA 5LXTE 3ANWB 4H9RC 3RPUA 3AA1B 4QHOA 4QWNB 2LT3A 4OHFA 3N5LA 2Q9QD 3NZPA 1MMDA 2IC6A 3C64A 3I9YA 3N9PA 3RYHE 3CVRA 4UV9B 5HWXA 2L9QA 5IYZE 2C5KT 1U5PA 2H3RA 2LSKA 2PJQA 2NW8A 4XAXB 2VWAA 3PTRB 4O8SA 3HI2A 4UXNB 2C0SA 3RYFE 1MMGA 4CXXA 2ODUA 4YHJA 3NRYA 4AKRB 3HL6A 4ANJA 3MA9A 3UUXB 2KWHA 4BJNA 1S94A 3DJBA 4O4IE 2XAHB 4H9OC 2WSSV 3ZN1B 2BZBA 3BQLA 2XQYA 3FBZA 2E9XB 2DLRA 3SS1A 4DMVA 5LGTB 1HX8A 3CMLA 2MYSA 4M1PA 3M65A 3E08A 3C50A 4H63V 3OYXA 3WAKA 3AA6B 1HF8A 1Z0PA 4WBOA 5ETWA 2NW7A 3LK3B 4QXCB 2YK0A 2EHOD 5LHGB 4ILUA 2VL8A 3KV6A 3LBXA 4KP3C 4ZS3A 5HXSA 4UVCB 2XU0A 3ZCIA 4JEUB 1QUUA 1U4QA 2V7LA 2DI4A 4JEHB 3PU3A 1HG2A 4WNKA 2CCQA 5FYMA 2H7OA 3N2OA 2ZMAA 4GIWA 3JC6C 5J2UE 3PURA 4CI3B 5LGNB 3F31A 3O1IA 3V5SA 1D0ZA 3GWHA 5L3EB 2DWGA 2E9XD 1HG5A 1BR1A 4PJNA 3ZYLA 5KX5E 2ES0A 4ZHQE 2Y8DA 4CXWA 4CXYA 3H3AA 3S4UA 4A56A 5LHIB 3MXZA 2CM0A 3C4WA 4AKLA 3DP7A 3V5UA 4IE4A 2HH7A 4E7ZA 4DBQA 1BR0A 3ZMSB 3ZJ1A 3ETVA 2W63A 5JDQA 3AAEB 2A3DA 2E8IA 2V26A 4PJLA 5HXCA 4MALA 2UXXB 4OYKA 1S35A 4O4LE 3RKOA 4DNDA 3E22E 4F6RC 4PFOA 1D1AA 3LG7A 2I59A 4UIGA 3SOLA 3PUAA 2X66A 2BVLA 2HPLA 2KZ7B 3N9OA 3OKQA 2KWIB 4UELA 1FEWA 4H9PC 2N9DA 1MNEA 4ZS2A 4EYYR 3H37A 1YKHB 4O2AE 3P7IA 3VKHA 4EZHA 1HFAA 3AVRA 4O2BE 3K3NA 5LYJE 2L8KA 3KBTA 1FMWA 4IIJE 2YINA 3ESLA 3EUHA 1IJ6A 1HS7A 5LBQB 3C51A 2XAJB 3OJAA 5ADXL 4I50E 2V7MA 3Q5WA 3QUJA 4N78D 4PK6A 4O4JE 4EZ4A 5JQGE 3AA0B 1D0XA 4H9SE 1T98A 3AA7B 1D1BA 4QXHB 1MNDA 3UUMA 1LRZA 4WBNE 3K8PC 5E0OA 3MKDA 3HKBE 4BA9A 3PUQA 2VKDA 4NUUA 1V9DA 3N9MA 3EVYA 5FXZA 4I43B 2Q9QC 5IHYA 3TKLB 4AKIA 2CWYA 4DO0A 2JMHA 4KBMB 2VASA 4QX8B 2V1DB 2YEVC 5L3GB 1WLXA 2XHEB 3PDYA 3J7Yq 4YJ2E 3MACA 4EIWA 4PK5A 3LBXB 3AB3B 3RRCA 1VOMA 3C4XA 2W62A 4CZZB 4I4TE 4L9IA 1US7B 1H7CA 2KXPB 4U72A 4YJ3E 5JR9C 2LHNA 3DTOA 4X1YE 1ZV4X 3CQCB 2ACXA 3HR0A 2V7IA 4K0UA 1E1HB 4C91A 3ZMZB 5DJQC 2Q9QA 3KVBA 5FY0A 5JDHA 4IHJE 5LG4A 4BAYB 2LSYA 2D0UA 2XAFB 1UX5A 1IJ5A 4X20E 4HN9A 3RRWA 3BK9A 5C8YE 4HKAA 2KINB 4J2CA 4YFSA 1SHZC 1IZNB 2EHOC 4TUYE 4OYJA 3ZCJA 3IHRA 1O3XA 2X9HA 2K9AA 3N9QA 3N9NA 4CQIA 4ZI2C 5JR9A 2GK9A 5JDNA 3HA4A 4NUVA 4AI6A 4H9QC 1ZEEA 2LHRA 4AQFC 1CUNA 3LK2B 3CX8B 3BQIA 2ZM0A 2LE8A 2X67A 3HKDE 2G0UA 2W0GA 2DCFA 2CA5A 5HAXA 2CWOA 3P8CD 2VB6A 3W15B 2JJ9A 5M4YA 2DHRA 3C4ZA 4P0AA 2L3LA 2A2FX 3NRXA 4AQGA 4EOZB 4TZ4C 3ZLIA 5FNVE 2EHOA 3KDSE 4AKHA 3KVAA 4MFRA 3O9XA 3HKEE 4QX7B 3ZC0A 2X0LB 1D1CA 3GA8A 4AXPA 4ZI3D 4O4HE 2D5UA 2ZLYA 5FY7A 3SRZA 5JRCB 5LBMA 1MMNA 2YU2A 3IBPA 3KINB 4H63H 4G2AA 2OA5A 4L0RA 3Q5XA 4CI1B 3JC6D 4X1KE 4UVBB 2K48A 5JREA 5KMGP 3KV4A 2NTXA 4EB6E 2CEAA 2LJLA 5H6QB 2XTLA 4HFVA 2LSIA 4KMCA 3I0QA 4GK5E 2WBLA 3RH3A 1YW0A 2M67A 4QKNA 3ZMUB 3L3PA 3T8OA 3UULA 3GMIA 4MLKA 3ZEFB 3ZMVB 5EK4A 2HPJA 4QXBB 1X79A 2KLQA 4YLHA 2P9BA 5LP6E 2WMOA 1ZKEA 4UF0A 2Y6XA 5JH7E 3U78A 5J1GA 5JDGA 2MBGA 1Y64B 1MIVA 2NTYA 2UXNB 4PW8A 4JLEA 4TV9E 3CX6B 3LJCA 4PJMA 3PE0A 3E0ZA 4JUYA 5H6RB 1BR2A 3RYCE 3MJXA 5LJMA 5JRCA 5JDFA 3WI3A 1ZHCA 1NWMX 2CLYC 1HCIA 1WYCA 3ZN0B 3ONXA 3EDUA 2Q9QB 5HYAA 5CA0E 2IAKA 3CPZA 2LOPA 4IE0A 3NZQA 3CQGB 4IE5A 5L2LA 3CQXC 3KV9A 1UX4A 3QK6A 3CKDA 2DNXA 2B1EA 5JVDE 5FXXA 3U3IA 4PNIA 5L3CB 2V7KA 3I1AA 3KFWX 3AAIA 1G8XA 4C90A 3F57A 5LJNA 5JR9B 2DWKA 3B13A 4ADZA 2MOZA 2WM9A 3B57A 4H9NC 3ZYKA 3VHLA 2WAUA 3O4XE 4GK0E 2BVMA 5L3BB 4XBFB 2JMKA 2NP9A 2VKJA 4FI5A 2ZM8A 5DQWA 2XUEA 5KDMC 2X9WA 2XAQB 4HEAA 3FXDB 2VK9A 1AJ3A 1OWAA 1IAPA 5LHHB 2JRKA 4ERRA 3LK42 4DBRA 4UVAB 2X51A 1YD8G 2LOSA 5L3DB 1UCUA 2EHOB 4AKGA 2LSJA 3VKGA 3ETUA 4L5GA 4FJOA 4TV8E 4EXTA 4P09A 3J9X1 5GONE 5CA1E 2D0TA 2LM9A 4ASKA 3EDVA 4IE7A 3WAJA 3R6NA 4HGAA 3PUSA 4WW0A 1G73A 5HXRA 4PK4A 3LFMA 3CWZB 2C5IT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3J A;  4NUU A;  2Y8D A;  2WAU A;  2XU0 A;  3BQL A;  4YFS A;  3RRC A;  3C64 A;  3BQI A;  3CPZ A;  3CML A;  2YK0 A;  4NUV A;  3BQK A; 
#chains in the Genus database with same CATH topology
 5F3J A;  3RHW A;  5HXE A;  2KT9 A;  3L09 A;  2W61 A;  2CXF A;  3GN5 B;  4KI0 F;  2VKO A;  3DQV C;  2N1G A;  4DVD A;  3UUN A;  1ZP0 A;  4IST A;  2H88 A;  3ANW A;  3BQK A;  4TN7 B;  5A1L A;  3DPL C;  4UF0 B;  5HEU A;  3K3O A;  4IE6 A;  4OK0 A;  4ZI2 D;  2X9X A;  4DID B;  4ZI3 C;  4QH4 A;  2K5B B;  2HN2 A;  1SA0 E;  4LFA T;  3AVS A;  2JPF A;  4NXN T;  3C98 B;  3NKZ A;  1VCT A;  4I0U A;  2MTQ A;  2WMN A;  1UUS A;  2CHN A;  4TX5 A;  5AQP B;  1VCS A;  2BG9 B;  2WB5 A;  4KX6 A;  3UTK A;  3HKC E;  3VR8 A;  3ZT7 A;  3ZMT B;  4HE8 A;  1WRD A;  4A98 A;  2XM2 A;  5C3J A;  5L4E A;  3IEE A;  2CE7 A;  3FHN A;  2KND A;  2QA7 A;  1NAF A;  4WYV A;  3VU7 H;  4DR7 T;  1N36 T;  2UXB T;  2A72 A;  5LGU B;  1SE7 A;  1FMV A;  4X62 T;  2IUB A;  2ZM2 A;  2LEH A;  2XSB A;  4EAH A;  3Q9D A;  1U6G A;  3I9W A;  4E7S A;  5FL1 A;  2BKP A;  2WWU A;  5LXT E;  3AEC A;  1NEN A;  4OHF A;  2Q9Q D;  3ABV A;  3VRA A;  3CVR A;  5HWX A;  2L9Q A;  5IYZ E;  1U5P A;  2H3R A;  2PJQ A;  2NW8 A;  2ODU A;  1NEK A;  2XAH B;  1FJG T;  2BZB A;  2XQY A;  3FBZ A;  3RTR A;  2E9X B;  2FJB A;  5HEG A;  4M1P A;  3E08 A;  2RPA A;  3QNU A;  5ETW A;  1ZOY A;  2EHO D;  5LHG B;  1YXR A;  4ILU A;  3AE4 A;  2VL8 A;  2JQK A;  4KP3 C;  4ZS3 A;  4ILC A;  5AQL B;  3PUR A;  4CI3 B;  1E7P A;  3O1I A;  5L3E B;  2WU2 A;  2FJD A;  1BR1 A;  2YDS A;  5KXJ A;  3ZYL A;  1XNR T;  3AE3 A;  3B5M A;  3V5U A;  2AXD S;  2R6G F;  4DBQ A;  1BR0 A;  1Z8U A;  4DV1 T;  2A3D A;  2E8I A;  4U2Y A;  4DR4 T;  4PJL A;  5HXC A;  4MAL A;  4U2Z A;  2X0H A;  4PFO A;  1D1A A;  2I59 A;  2X66 A;  1FEW A;  2K3W A;  2KSR A;  3VKH A;  4EZH A;  3AVR A;  4O2B E;  3K3N A;  2L8K A;  3ZT5 A;  4IIJ E;  1W09 A;  4CN1 A;  3AEB A;  3ESL A;  3EUH A;  1IJ6 A;  5LBQ B;  3C51 A;  4N78 D;  4EZ4 A;  1D0X A;  4P1N A;  4DV4 T;  1MND A;  3UUM A;  1LRZ A;  2VKD A;  1W0A A;  4B3M T;  3N9M A;  3EVY A;  5IHY A;  4AKI A;  2CWY A;  4QX8 B;  2YEV C;  4YTM A;  1N34 T;  1WLX A;  2XHE B;  3PDY A;  4IDQ A;  4YJ2 E;  3LBX B;  3RRC A;  4AP2 B;  3C4X A;  4ZZB A;  2W62 A;  4L9I A;  1H7C A;  2CBJ A;  2XM1 A;  4X1Y E;  1ZV4 X;  4K0U A;  1E1H B;  5JDH A;  4IHJ E;  2D0U A;  2XAF B;  4X20 E;  4HN9 A;  5AQJ B;  4HKA A;  5F5W A;  2KIN B;  4YFS A;  4U7I A;  2X9H A;  5CJ5 A;  4ZI2 C;  5JDN A;  2FBW A;  4NUV A;  1ZEE A;  4JI1 T;  2W67 A;  3LK2 B;  2ZM0 A;  2VB6 A;  3W15 B;  4P0A A;  2A2F X;  3AE9 A;  1UUR A;  4TZ4 C;  2MAW A;  3ZLI A;  1J5W A;  3O9X A;  2J62 A;  4QX7 B;  1D1C A;  4ZI3 D;  5JRC B;  2LLY A;  3IBP A;  4H63 H;  4L0R A;  4UVB B;  3KV4 A;  4EB6 E;  2CEA A;  4KMC A;  3ZMU B;  2WBL A;  3ZMV B;  4YLH A;  1ZKE A;  5JH7 E;  1SUM B;  5JDG A;  2YOE A;  4PJM A;  2BS2 A;  5LJM A;  3VR9 A;  5JDF A;  2CLY C;  1HCI A;  2XQ3 A;  1WYC A;  3ONX A;  2Q9Q B;  2WU5 A;  2J47 A;  3KV9 A;  3CKD A;  2LRL A;  5BR8 T;  5LJN A;  5AQG B;  5JR9 B;  4DV5 T;  2WM9 A;  3B57 A;  2WAU A;  2BVM A;  2JMK A;  4FI5 A;  4WQO D;  5LB7 B;  2JQ9 A;  1AJ3 A;  3AEF A;  3P4P A;  3QOF A;  2EHO B;  2UU9 T;  1XZY A;  4L5G A;  4FJO A;  4P09 A;  3J9X 1;  5GON E;  2WDV A;  3R6N A;  3PUS A;  1XNQ T;  3CWZ B;  2PBI A;  4PFP A;  3FBL A;  4P0B A;  5EZY E;  1OXZ A;  3A5X A;  2V5D A;  3ZST A;  5BMV E;  3I0O A;  1MIW A;  3N2G E;  1Y01 A;  3LSV A;  1WFD A;  3UFG A;  2IC9 A;  5JTG A;  3MK7 C;  4B3S T;  4KUM B;  1KFY A;  2CHO A;  3ZPO A;  3JAE A;  2NR4 A;  2WZI A;  1QSD A;  5EK3 A;  2F4V T;  4F52 A;  2JQQ A;  3PUW F;  5ABG A;  3OTO T;  2SPC A;  1HTJ F;  1EZ3 A;  5FMN A;  5DQV A;  2W66 A;  4K0K T;  4HWH A;  2IHR 1;  1XDO A;  4A64 A;  3CX7 B;  4HTE A;  2IW5 B;  3AE8 A;  3F2E A;  2FUP A;  1FIO A;  2RP4 A;  3UU6 A;  4IDZ A;  3G06 A;  2RA1 A;  3ZKR A;  4JI5 T;  3K3Q C;  4HWD A;  5FY1 A;  4DUZ T;  1HX1 B;  2NW9 A;  3QC9 A;  2IDO B;  2W2U A;  4JI2 T;  5LOV E;  4JI3 T;  1OED A;  2C5J A;  3P4S A;  3UT5 E;  3MZK B;  4X64 T;  1KNZ A;  2PTF A;  2XQ6 A;  3RIU A;  2WZK A;  4PJJ A;  5AQR B;  2QGS A;  2XQ9 A;  3RC3 A;  5LCY A;  2LM2 A;  4EEB A;  4IGU A;  4YTP A;  2UUA T;  1N32 T;  5LMN T;  3EAM A;  3PU8 A;  4GOU A;  2PFV A;  2CMR A;  5HCJ A;  2D2S A;  3PV0 F;  5EK2 A;  3UUB A;  3RI5 A;  3AA1 B;  2QYW A;  4TWH A;  3RLF F;  3N5L A;  2LKH A;  4DV6 T;  2IC6 A;  5FL0 A;  4Z91 A;  4AIU A;  4UXN B;  2C0S A;  3RYF E;  2JIW A;  4CXX A;  4YHJ A;  4AKR B;  3HL6 A;  3FZH B;  3MA9 A;  1LDK B;  2KWH A;  4BJN A;  4H9O C;  3SS1 A;  5LGT B;  2I6H A;  3CML A;  3M65 A;  2BS3 A;  4ZEY A;  4H63 V;  3OYX A;  3AA6 B;  1HF8 A;  3P4W A;  2NW7 A;  2V6Y B;  3AE5 A;  4DR1 T;  2CPT A;  5LMU T;  3AE7 A;  2WS3 A;  2BS4 A;  3IA3 A;  4UR9 A;  1R8I A;  1QUU A;  2V7L A;  4WNK A;  3PU3 A;  2H7O A;  3N2O A;  2AE9 A;  3F31 A;  4YT0 A;  3GWH A;  5IWA T;  1HG5 A;  4PJN A;  2ES0 A;  4ZHQ E;  4QH1 A;  2Y8D A;  5HEO A;  3S4U A;  4A56 A;  4LF5 T;  3ZMS B;  5JDQ A;  2YKS A;  2V26 A;  4YSZ A;  4IL9 A;  4IDO A;  2BVL A;  3OKQ A;  2KWI B;  4H9P C;  2N9D A;  4ZS2 A;  2BBJ A;  4EYY R;  3H37 A;  4YHH T;  1YKH B;  4JBW F;  2V5C A;  1IBM T;  2XAJ B;  1IBK T;  4PK6 A;  4DV7 T;  3AA0 B;  3EI0 A;  4H9S E;  1T98 A;  4QXH B;  4BA9 A;  3PUQ A;  4NUU A;  1V9D A;  4A5X A;  3TKL B;  2JMH A;  5FKY A;  4LF8 T;  1JNZ A;  4PK5 A;  2IIU A;  4B3T T;  5AQU B;  1VOM A;  4U72 A;  4YJ3 E;  3DTO A;  3HR0 A;  2V7I A;  4C91 A;  5DJQ C;  4BAY B;  5C8Y E;  3EHZ A;  1SHZ C;  3IHR A;  2K9A A;  3N9Q A;  4AI6 A;  3NWI A;  4TNV A;  4AQF C;  1CUN A;  3BQI A;  2LE8 A;  2G0U A;  2CA5 A;  4LF9 T;  3PUV F;  3HKE E;  2UUC T;  2X0L B;  1YQ4 A;  3PUX F;  5FY7 A;  3SRZ A;  2XQA A;  4CI1 B;  4X1K E;  4JGH D;  5KMG P;  2VVS A;  5H6Q B;  1T8B A;  3UU8 A;  3I0Q A;  3RH3 A;  3Q5D A;  3T8O A;  3UUL A;  1N33 T;  3ZSS A;  2P9B A;  2H89 A;  4UF0 A;  2FJA A;  2Y6X A;  4JI6 T;  1Y64 B;  2QVA A;  2NTY A;  4CN6 A;  3PE0 A;  3E0Z A;  4AIS A;  4JUY A;  2XQ8 A;  4Z90 A;  1BR2 A;  1ZHC A;  1NWM X;  5ABH A;  4DV3 T;  4GKK T;  5CA0 E;  2IAK A;  3CPZ A;  2LOP A;  3NZQ A;  5L2L A;  3AE1 A;  3QK6 A;  5JVD E;  2V7K A;  3KFW X;  4C90 A;  4EED A;  3B13 A;  4ADZ A;  3ZYK A;  4H9N C;  3VHL A;  3O4X E;  5L3B B;  4XBF B;  2BG9 A;  3AED A;  4WZX A;  2XUE A;  2XAQ B;  4HEA A;  4X5T A;  1IAP A;  4ERR A;  4AQY T;  1YD8 G;  5L3D B;  3ETU A;  4TV8 E;  4EXT A;  3UQ7 A;  5CA1 E;  4DR2 T;  4ASK A;  3EDV A;  4IE7 A;  4JI0 T;  1DU2 A;  1G73 A;  2VQE T;  3LFM A;  2C5I T;  3PJA A;  3SWH A;  3KBU A;  3AXJ B;  4V1A v;  3FXE B;  4LF4 T;  3ONJ A;  3P4Q A;  2X68 A;  1UK5 A;  2WWV A;  3D0T A;  5FP3 A;  4CI2 B;  3UFE A;  4DR5 T;  2CRB A;  1D0Y A;  5JDM A;  4TWF A;  2ODV A;  3FZM B;  3RC8 A;  4QH5 A;  3RGL A;  2UUB T;  1WR6 A;  1KEY A;  3RYI E;  4G63 A;  4U74 A;  4LMJ A;  4ZOL E;  4DV0 T;  4AQF A;  4ISS A;  1LKX A;  3AEG A;  2X9Y A;  4I55 E;  3FB2 A;  2W4X A;  2E9X A;  5AFU L;  2BDE A;  2XQ7 A;  3X1D A;  1OED C;  5LNK A;  4DUY T;  2OV9 A;  3RIU C;  3N9L A;  2CLY B;  5FXV A;  3AAA B;  5CB4 E;  2X0Y A;  4XZC A;  3TLU A;  4MHC A;  2J1D G;  5JDL A;  3IF8 B;  5ABE A;  2WZH A;  1MMA A;  4HFC A;  4EGW A;  3PUY F;  4OFZ A;  3L39 A;  5F8P A;  3O1H A;  4DMW A;  3ZC1 A;  4NXM T;  3FZK B;  1HR0 T;  4IL4 A;  4LFC T;  4LMK A;  2NOX A;  3RX6 A;  2K24 A;  5J2T E;  3PUG A;  5HXH A;  2Y48 B;  1B7T A;  3Q2M A;  3ANW B;  4H9R C;  3RPU A;  4QHO A;  4QWN B;  3I9Y A;  3N9P A;  3RYH E;  2C5K T;  3HI2 A;  4KHZ F;  5L4H A;  1MMG A;  4U31 A;  4ANJ A;  3K1S A;  3UUX B;  5CGM A;  1S94 A;  3DJB A;  3ZN1 B;  2ACZ A;  2DLR A;  2BKO A;  2MYS A;  5L47 A;  4DV2 T;  4HFH A;  3C50 A;  3WAK A;  3T1Y T;  4YXD A;  3LK3 B;  2YK0 A;  3LBX A;  4UVC B;  2XU0 A;  4TNW A;  4JEU B;  4JEH B;  2DI4 A;  2CCQ A;  2J4G A;  3TLT A;  3M3Z B;  3V5S A;  2DWG A;  5AQI B;  2E9X D;  5KX5 E;  4CXW A;  4CXY A;  3MXZ A;  2CM0 A;  3C4W A;  4IE4 A;  4E7Z A;  3ETV A;  3AAE B;  2UXX B;  4HWF A;  4UIG A;  3SOL A;  5HEH A;  2HPL A;  4UEL A;  3SFE A;  4HWI B;  5LYJ E;  3PUZ F;  2YIN A;  4B3R T;  4ZXL A;  1HNW T;  3AA7 B;  3P4R A;  4WBN E;  4YY3 T;  5FXZ A;  4COF A;  4DO0 A;  5L3G B;  5IUX A;  4P5O A;  4GKJ T;  3UU4 A;  4CZZ B;  1US7 B;  2LHN A;  3CQC B;  2Q9Q A;  3KVB A;  1I6Z A;  5LG4 A;  2VL0 A;  5C2T A;  1UX5 A;  1IJ5 A;  3RRW A;  3UU5 A;  4HFI A;  1IBL T;  4TUY E;  3ZCJ A;  3A8Y C;  2CBI A;  5JR9 A;  3QB5 K;  4KHP T;  2WCA A;  4NPP A;  3HA4 A;  2YDR A;  3H3M A;  2W0G A;  5HAX A;  2CWO A;  5M4Y A;  2DHR A;  2L3L A;  1W9R A;  4EOZ B;  2EHO A;  3KDS E;  4MFR A;  2M6I A;  3GA8 A;  4AXP A;  4HXI B;  5LBM A;  1UGO A;  2YU2 A;  4U3C A;  4U33 A;  4G2A A;  1M62 A;  1WCR A;  3JC6 D;  2K48 A;  2NTX A;  2LJL A;  4HFV A;  4GK5 E;  2M67 A;  4QKN A;  3GMI A;  5EK4 A;  4QXB B;  1X79 A;  2KLQ A;  5LP6 E;  2MBG A;  1MIV A;  2UXN B;  4YTN A;  3Q5E A;  2OLT A;  5AQS B;  2XJ7 A;  2VUR A;  3WI3 A;  2BG9 C;  3ZN0 B;  5HCM A;  3EDU A;  3JCF A;  1T72 A;  5ABF A;  1UX4 A;  2B1E A;  5FXX A;  1JNR A;  5L3C B;  3I1A A;  4LML A;  3AEE A;  2DWK A;  2MOZ A;  1KNR A;  3FZL B;  4YSX A;  1T7S A;  2NP9 A;  2VKJ A;  4X66 T;  5DQW A;  2X9W A;  2WDR A;  5LHH B;  2JRK A;  3UU3 A;  1X9B A;  1L0V A;  5AQQ B;  4UVA B;  2LOS A;  1UCU A;  2FJE A;  2XQ4 A;  2A9U A;  3WAJ A;  4HGA A;  4WW0 A;  5HXR A;  4F8H A;  5HEJ A;  1BR4 A;  2WQY A;  1GQE A;  3O1J A;  4GYR A;  3OBV E;  5AQN B;  3ZYM A;  2XAG B;  3KV5 A;  2Z6E A;  2V7J A;  1KK7 A;  4OX9 T;  3TLS A;  2XAS B;  2E9X C;  3N2K E;  2H7V C;  4X1I E;  4EYU A;  1WYB A;  1MIY A;  2NWB A;  4BJM A;  2PG8 A;  1LVK A;  2CXD A;  5AQO B;  2M6B A;  2LSG A;  3OPC A;  4GYS A;  1LDK A;  3AE2 A;  2KMF A;  5TAO A;  1J1J A;  5DAB A;  5AQF B;  3OYZ A;  5LG3 A;  3GN5 A;  3EAB A;  2B76 A;  3CIR A;  4B6X A;  5FXW A;  4YSY A;  4PAG A;  3RKG A;  1YKE B;  3NBX X;  1KF6 A;  5CFB A;  2V6Y A;  4ZI7 E;  2YU1 A;  2CXL A;  2YN6 A;  3ZJ2 A;  4Z8X A;  5HWY A;  1LVF A;  3R84 B;  4EV6 A;  5LA6 E;  2VKH A;  1OED E;  4MBQ A;  4UV8 B;  2W00 A;  2JQH A;  4UEM A;  5L3F B;  3L8R A;  4Q25 A;  4U7Y A;  2XSA A;  4LFB T;  1HNZ T;  2XZE A;  1VRB A;  2N2N A;  5AQM B;  1XMQ T;  1XDP A;  4TWD A;  4CN4 A;  2LT3 A;  3NZP A;  1QLB A;  1MMD A;  3C64 A;  4UV9 B;  2LSK A;  3CK6 A;  3RIA A;  4XAX B;  2V6X A;  2VWA A;  3PTR B;  4O8S A;  3NRY A;  4LF6 T;  3OVU A;  4O4I E;  2MPK A;  2WSS V;  3BQL A;  4NIQ A;  4DMV A;  1HX8 A;  2XY8 B;  2LKG A;  4WBO A;  1Z0P A;  3ZT6 A;  4QXC B;  2WP9 A;  3KV6 A;  5HXS A;  3ZCI A;  1U4Q A;  1HG2 A;  2WDQ A;  5FYM A;  2ZMA A;  4GIW A;  3JC6 C;  5J2U E;  1OED B;  5LGN B;  1HNX T;  3QB5 A;  3VRB A;  3JAF A;  1D0Z A;  2QRX A;  3AE6 A;  3UQ4 A;  4X65 T;  5AQH B;  3H3A A;  5LHI B;  2D9D A;  3JAD A;  4AKL A;  3DP7 A;  2DL1 A;  2HH7 A;  3ZJ1 A;  2W63 A;  2BBH A;  4IDN A;  4OYK A;  4JYA T;  1S35 A;  4O4L E;  3RKO A;  4DND A;  3E22 E;  4F6R C;  3LG7 A;  3PUA A;  2XPK A;  2KZ7 B;  3N9O A;  3FZF B;  1MNE A;  5AQV B;  2HN1 A;  1XMO T;  3A7M A;  5J0Z A;  4O2A E;  3P7I A;  1HFA A;  3KBT A;  1FMW A;  1HS7 A;  3OJA A;  5ADX L;  4I50 E;  2V7M A;  3Q5W A;  3QUJ A;  4O4J E;  4ZZC A;  4JI4 T;  5JQG E;  3PJA J;  1E2A A;  4APF B;  3RIF A;  4HFE A;  1D1B A;  3K8P C;  4IDP A;  5E0O A;  3MKD A;  3HKB E;  3LDQ B;  4I43 B;  2Q9Q C;  5AQT B;  4KBM B;  2VAS A;  2V1D B;  3J7Y q;  2HHH T;  3MAC A;  4EIW A;  2I0M A;  3AB3 B;  2LRK A;  4I4T E;  4JI8 T;  2KXP B;  5JR9 C;  2XQ5 A;  1YQ3 A;  2E2A A;  2ACX A;  2V8S V;  3ZMZ B;  5FY0 A;  5FVK A;  2LSY A;  3BK9 A;  1LDJ A;  3ONL C;  4J2C A;  1IZN B;  4DR3 T;  2EHO C;  4HWC A;  4OYJ A;  3SFD A;  1O3X A;  2WY2 A;  3N9N A;  4CQI A;  3TLW A;  2GK9 A;  2UXD T;  4H9Q C;  2LHR A;  3CX8 B;  2X67 A;  3HKD E;  2DCF A;  4IT4 A;  3P8C D;  2JJ9 A;  3C4Z A;  3NRX A;  2E5V A;  4AQG A;  5FNV E;  5FVL A;  4AKH A;  4N9F 3;  1M7K A;  3KVA A;  1W0B A;  3ZC0 A;  2BKN A;  2VVN A;  4O4H E;  2D5U A;  2ZLY A;  1MMN A;  3KIN B;  2OA5 A;  3Q5X A;  2UXC T;  3AXJ A;  5JRE A;  1CHU A;  5ABF B;  2IML A;  2VQF T;  3AEA A;  2XTL A;  4JI7 T;  2LSI A;  1YW0 A;  1I94 T;  3L3P A;  4MLK A;  3ZEF B;  2HPJ A;  2WMO A;  3U78 A;  5J1G A;  4LF7 T;  4JV5 T;  4PW8 A;  4TV9 E;  1KNP A;  4JLE A;  4ILB A;  3CX6 B;  3LJC A;  2ZM6 T;  5H6R B;  3RYC E;  3MJX A;  5AQK B;  5JRC A;  3RF1 A;  4HFB A;  5HYA A;  3RQW A;  4IE0 A;  4HFD A;  3CQG B;  4IE5 A;  3CQX C;  2DNX A;  1WR0 A;  3U3I A;  4PNI A;  3RQU A;  3AAI A;  1G8X A;  3F57 A;  3NVO A;  4A97 A;  4GK0 E;  4ILA A;  4DR6 T;  2ZM8 A;  5KDM C;  1J5E T;  3FXD B;  2BG9 E;  2VK9 A;  1OWA A;  2E5L T;  3T1H T;  3LK4 2;  4DBR A;  3P50 A;  2X51 A;  4IRE A;  4AKG A;  3VKG A;  2LSJ A;  2D0T A;  2LM9 A;  3TLV A;  2YDQ A;  1XWM A;  4PK4 A; 
#chains in the Genus database with same CATH homology
 5F3J A;  3SWH A;  5HXE A;  3KBU A;  2KT9 A;  1BR4 A;  2PBI A;  3L09 A;  4V1A v;  3FXE B;  2W61 A;  2CXF A;  4PFP A;  3FBL A;  3O1J A;  4GYR A;  4P0B A;  3OBV E;  5EZY E;  3GN5 B;  1OXZ A;  2VKO A;  2XAG B;  2N1G A;  3A5X A;  3ZYM A;  4DVD A;  2X68 A;  5BMV E;  3I0O A;  3KV5 A;  1MIW A;  2V7J A;  2Z6E A;  1KK7 A;  3D0T A;  3N2G E;  5FP3 A;  4CI2 B;  3UUN A;  3UFE A;  1D0Y A;  4IST A;  5JDM A;  3ANW A;  3BQK A;  4TN7 B;  5A1L A;  2IC9 A;  3MK7 C;  2XAS B;  2E9X C;  4KUM B;  3N2K E;  2ODV A;  4UF0 B;  3RC8 A;  2H7V C;  4X1I E;  4EYU A;  3K3O A;  1WYB A;  3ZPO A;  1MIY A;  4IE6 A;  4OK0 A;  2NWB A;  4ZI2 D;  2X9X A;  1QSD A;  1WR6 A;  5EK3 A;  4ZI3 C;  3RYI E;  4BJM A;  4G63 A;  2PG8 A;  1LVK A;  4U74 A;  2CXD A;  2JQQ A;  4ZOL E;  4AQF A;  2LSG A;  4GYS A;  4ISS A;  1LKX A;  2K5B B;  2SPC A;  1HTJ F;  2KMF A;  1EZ3 A;  2X9Y A;  5FMN A;  5TAO A;  1SA0 E;  4I55 E;  5DAB A;  3FB2 A;  3AVS A;  3OYZ A;  2JPF A;  5DQV A;  3GN5 A;  2E9X A;  5AFU L;  2BDE A;  3C98 B;  3CX7 B;  4HTE A;  4B6X A;  2IW5 B;  5LNK A;  5FXW A;  3F2E A;  4PAG A;  1FIO A;  1YKE B;  3NBX X;  2RP4 A;  2MTQ A;  2WMN A;  4TX5 A;  3N9L A;  4IDZ A;  4ZI7 E;  2CLY B;  2RA1 A;  5FXV A;  3UTK A;  3HKC E;  3AAA B;  3K3Q C;  2YU1 A;  5FY1 A;  5CB4 E;  2CXL A;  3ZMT B;  4XZC A;  3ZJ2 A;  4HE8 A;  4Z8X A;  1WRD A;  5HWY A;  3QC9 A;  4MHC A;  2NW9 A;  1LVF A;  2J1D G;  5JDL A;  3IF8 B;  3R84 B;  5LOV E;  5LA6 E;  1MMA A;  2VKH A;  2C5J A;  3IEE A;  2CE7 A;  3UT5 E;  3MZK B;  4MBQ A;  4UV8 B;  1KNZ A;  3FHN A;  4OFZ A;  2W00 A;  4UEM A;  5F8P A;  2KND A;  4PJJ A;  2QA7 A;  3O1H A;  1NAF A;  2QGS A;  3RC3 A;  5LCY A;  4DMW A;  3ZC1 A;  5L3F B;  4IGU A;  3VU7 H;  2A72 A;  5LGU B;  1FMV A;  2ZM2 A;  3PU8 A;  2LEH A;  4GOU A;  4EAH A;  2NOX A;  1VRB A;  3RX6 A;  2K24 A;  2PFV A;  5J2T E;  2N2N A;  3PUG A;  2CMR A;  3Q9D A;  5HXH A;  2D2S A;  3I9W A;  4E7S A;  5EK2 A;  2Y48 B;  1B7T A;  2WWU A;  3Q2M A;  5LXT E;  3ANW B;  4H9R C;  3RPU A;  3AA1 B;  4QHO A;  4QWN B;  2LT3 A;  4OHF A;  3N5L A;  2Q9Q D;  3NZP A;  1MMD A;  2IC6 A;  3C64 A;  3I9Y A;  3N9P A;  3RYH E;  3CVR A;  4UV9 B;  5HWX A;  2L9Q A;  5IYZ E;  2C5K T;  1U5P A;  2H3R A;  2LSK A;  2PJQ A;  2NW8 A;  4XAX B;  2VWA A;  3PTR B;  4O8S A;  3HI2 A;  4UXN B;  2C0S A;  3RYF E;  1MMG A;  4CXX A;  2ODU A;  4YHJ A;  3NRY A;  4AKR B;  3HL6 A;  4ANJ A;  3MA9 A;  3UUX B;  2KWH A;  4BJN A;  1S94 A;  3DJB A;  4O4I E;  2XAH B;  4H9O C;  2WSS V;  3ZN1 B;  2BZB A;  3BQL A;  2XQY A;  3FBZ A;  2E9X B;  2DLR A;  3SS1 A;  4DMV A;  5LGT B;  1HX8 A;  3CML A;  2MYS A;  4M1P A;  3M65 A;  3E08 A;  3C50 A;  4H63 V;  3OYX A;  3WAK A;  3AA6 B;  1HF8 A;  1Z0P A;  4WBO A;  5ETW A;  2NW7 A;  3LK3 B;  4QXC B;  2YK0 A;  2EHO D;  5LHG B;  4ILU A;  2VL8 A;  3KV6 A;  3LBX A;  4KP3 C;  4ZS3 A;  5HXS A;  4UVC B;  2XU0 A;  3ZCI A;  4JEU B;  1QUU A;  1U4Q A;  2V7L A;  2DI4 A;  4JEH B;  3PU3 A;  1HG2 A;  4WNK A;  2CCQ A;  5FYM A;  2H7O A;  3N2O A;  2ZMA A;  4GIW A;  3JC6 C;  5J2U E;  3PUR A;  4CI3 B;  5LGN B;  3F31 A;  3O1I A;  3V5S A;  1D0Z A;  3GWH A;  5L3E B;  2DWG A;  2E9X D;  1HG5 A;  1BR1 A;  4PJN A;  3ZYL A;  5KX5 E;  2ES0 A;  4ZHQ E;  2Y8D A;  4CXW A;  4CXY A;  3H3A A;  3S4U A;  4A56 A;  5LHI B;  3MXZ A;  2CM0 A;  3C4W A;  4AKL A;  3DP7 A;  3V5U A;  4IE4 A;  2HH7 A;  4E7Z A;  4DBQ A;  1BR0 A;  3ZMS B;  3ZJ1 A;  3ETV A;  2W63 A;  5JDQ A;  3AAE B;  2A3D A;  2E8I A;  2V26 A;  4PJL A;  5HXC A;  4MAL A;  2UXX B;  4OYK A;  1S35 A;  4O4L E;  3RKO A;  4DND A;  3E22 E;  4F6R C;  4PFO A;  1D1A A;  3LG7 A;  2I59 A;  4UIG A;  3SOL A;  3PUA A;  2X66 A;  2BVL A;  2HPL A;  2KZ7 B;  3N9O A;  3OKQ A;  2KWI B;  4UEL A;  1FEW A;  4H9P C;  2N9D A;  1MNE A;  4ZS2 A;  4EYY R;  3H37 A;  1YKH B;  4O2A E;  3P7I A;  3VKH A;  4EZH A;  1HFA A;  3AVR A;  4O2B E;  3K3N A;  5LYJ E;  2L8K A;  3KBT A;  1FMW A;  4IIJ E;  2YIN A;  3ESL A;  3EUH A;  1IJ6 A;  1HS7 A;  5LBQ B;  3C51 A;  2XAJ B;  3OJA A;  5ADX L;  4I50 E;  2V7M A;  3Q5W A;  3QUJ A;  4N78 D;  4PK6 A;  4O4J E;  4EZ4 A;  5JQG E;  3AA0 B;  1D0X A;  4H9S E;  1T98 A;  3AA7 B;  1D1B A;  4QXH B;  1MND A;  3UUM A;  1LRZ A;  4WBN E;  3K8P C;  5E0O A;  3MKD A;  3HKB E;  4BA9 A;  3PUQ A;  2VKD A;  4NUU A;  1V9D A;  3N9M A;  3EVY A;  5FXZ A;  4I43 B;  2Q9Q C;  5IHY A;  3TKL B;  4AKI A;  2CWY A;  4DO0 A;  2JMH A;  4KBM B;  2VAS A;  4QX8 B;  2V1D B;  2YEV C;  5L3G B;  1WLX A;  2XHE B;  3PDY A;  3J7Y q;  4YJ2 E;  3MAC A;  4EIW A;  4PK5 A;  3LBX B;  3AB3 B;  3RRC A;  1VOM A;  3C4X A;  2W62 A;  4CZZ B;  4I4T E;  4L9I A;  1US7 B;  1H7C A;  2KXP B;  4U72 A;  4YJ3 E;  5JR9 C;  2LHN A;  3DTO A;  4X1Y E;  1ZV4 X;  3CQC B;  2ACX A;  3HR0 A;  2V7I A;  4K0U A;  1E1H B;  4C91 A;  3ZMZ B;  5DJQ C;  2Q9Q A;  3KVB A;  5FY0 A;  5JDH A;  4IHJ E;  5LG4 A;  4BAY B;  2LSY A;  2D0U A;  2XAF B;  1UX5 A;  1IJ5 A;  4X20 E;  4HN9 A;  3RRW A;  3BK9 A;  5C8Y E;  4HKA A;  2KIN B;  4J2C A;  4YFS A;  1SHZ C;  1IZN B;  2EHO C;  4TUY E;  4OYJ A;  3ZCJ A;  3IHR A;  1O3X A;  2X9H A;  2K9A A;  3N9Q A;  3N9N A;  4CQI A;  4ZI2 C;  5JR9 A;  2GK9 A;  5JDN A;  3HA4 A;  4NUV A;  4AI6 A;  4H9Q C;  1ZEE A;  2LHR A;  4AQF C;  1CUN A;  3LK2 B;  3CX8 B;  3BQI A;  2ZM0 A;  2LE8 A;  2X67 A;  3HKD E;  2G0U A;  2W0G A;  2DCF A;  2CA5 A;  5HAX A;  2CWO A;  3P8C D;  2VB6 A;  3W15 B;  2JJ9 A;  5M4Y A;  2DHR A;  3C4Z A;  4P0A A;  2L3L A;  2A2F X;  3NRX A;  4AQG A;  4EOZ B;  4TZ4 C;  3ZLI A;  5FNV E;  2EHO A;  3KDS E;  4AKH A;  3KVA A;  4MFR A;  3O9X A;  3HKE E;  4QX7 B;  3ZC0 A;  2X0L B;  1D1C A;  3GA8 A;  4AXP A;  4ZI3 D;  4O4H E;  2D5U A;  2ZLY A;  5FY7 A;  3SRZ A;  5JRC B;  5LBM A;  1MMN A;  2YU2 A;  3IBP A;  3KIN B;  4H63 H;  4G2A A;  2OA5 A;  4L0R A;  3Q5X A;  4CI1 B;  3JC6 D;  4X1K E;  4UVB B;  2K48 A;  5JRE A;  5KMG P;  3KV4 A;  2NTX A;  4EB6 E;  2CEA A;  2LJL A;  5H6Q B;  2XTL A;  4HFV A;  2LSI A;  4KMC A;  3I0Q A;  4GK5 E;  2WBL A;  3RH3 A;  1YW0 A;  2M67 A;  4QKN A;  3ZMU B;  3L3P A;  3T8O A;  3UUL A;  3GMI A;  4MLK A;  3ZEF B;  3ZMV B;  5EK4 A;  2HPJ A;  4QXB B;  1X79 A;  2KLQ A;  4YLH A;  2P9B A;  5LP6 E;  2WMO A;  1ZKE A;  4UF0 A;  2Y6X A;  5JH7 E;  3U78 A;  5J1G A;  5JDG A;  2MBG A;  1Y64 B;  1MIV A;  2NTY A;  2UXN B;  4PW8 A;  4JLE A;  4TV9 E;  3CX6 B;  3LJC A;  4PJM A;  3PE0 A;  3E0Z A;  4JUY A;  5H6R B;  1BR2 A;  3RYC E;  3MJX A;  5LJM A;  5JRC A;  5JDF A;  3WI3 A;  1ZHC A;  1NWM X;  2CLY C;  1HCI A;  1WYC A;  3ZN0 B;  3ONX A;  3EDU A;  2Q9Q B;  5HYA A;  5CA0 E;  2IAK A;  3CPZ A;  2LOP A;  4IE0 A;  3NZQ A;  3CQG B;  4IE5 A;  5L2L A;  3CQX C;  3KV9 A;  1UX4 A;  3QK6 A;  3CKD A;  2DNX A;  2B1E A;  5JVD E;  5FXX A;  3U3I A;  4PNI A;  5L3C B;  2V7K A;  3I1A A;  3KFW X;  3AAI A;  1G8X A;  4C90 A;  3F57 A;  5LJN A;  5JR9 B;  2DWK A;  3B13 A;  4ADZ A;  2MOZ A;  2WM9 A;  3B57 A;  4H9N C;  3ZYK A;  3VHL A;  2WAU A;  3O4X E;  4GK0 E;  2BVM A;  5L3B B;  4XBF B;  2JMK A;  2NP9 A;  2VKJ A;  4FI5 A;  2ZM8 A;  5DQW A;  2XUE A;  5KDM C;  2X9W A;  2XAQ B;  4HEA A;  3FXD B;  2VK9 A;  1AJ3 A;  1OWA A;  1IAP A;  5LHH B;  2JRK A;  4ERR A;  3LK4 2;  4DBR A;  4UVA B;  2X51 A;  1YD8 G;  2LOS A;  5L3D B;  1UCU A;  2EHO B;  4AKG A;  2LSJ A;  3VKG A;  3ETU A;  4L5G A;  4FJO A;  4TV8 E;  4EXT A;  4P09 A;  3J9X 1;  5GON E;  5CA1 E;  2D0T A;  2LM9 A;  4ASK A;  3EDV A;  4IE7 A;  3WAJ A;  3R6N A;  4HGA A;  3PUS A;  4WW0 A;  1G73 A;  5HXR A;  4PK4 A;  3LFM A;  3CWZ B;  2C5I T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...