5F3JA

Crystal structure of dbp in complex with inhibitory monoclonal antibody 2d10
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
251
Chain Sequence
YKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKITDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Broadly neutralizing epitopes in the Plasmodium vivax vaccine candidate Duffy Binding Protein.
pubmed doi rcsb
source organism Plasmodium vivax (strain salvador i)
molecule tags Immune system
total genus 88
structure length 251
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5f3jA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 5f3jA01
4YFSA 3BQIA 2XU0A 4NUVA 2YK0A 3BQKA 4NUUA 2WAUA 3C64A 3RRCA 2Y8DA 5F3JA 3BQLA 3CPZA 3CMLA
chains in the Genus database with same CATH superfamily
4U3CA 1UURA 2XQ4A 2XSAA 3PURA 3ZSTA 1WLXA 5BMVE 3L39A 4HGAA 5JR9A 3E0ZA 3RYHE 4ILUA 4DUZT 4JYAT 1HFAA 3SOLA 2ZM8A 4TWDA 1N32T 3CQCB 4L9IA 3AEFA 5CA1E 3ETUA 3AE7A 4UVAB 4AISA 5LXTE 5L47A 2OV9A 5J2UE 2UXNB 5LGTB 3FHNA 2CHNA 1S35A 4UV9B 2CEAA 4EV6A 2JMKA 4OK0A 1XDPA 2YKSA 2VQET 2QVAA 3EUHA 3DQVC 2M6BA 4WZXA 1KEYA 1HF8A 2H3RA 2CXDA 1VCTA 1HNXT 2V5CA 5ABFB 4P1NA 2ODVA 5JTGA 3UU5A 2JIWA 4A5XA 3ZMTB 5HWYA 4CI2B 4U7IA 3VR9A 2CLYB 4G2AA 3AA7B 3GWHA 3D0TA 2XZEA 2N2NA 2LHRA 4IE6A 2SPCA 4JI1T 1N34T 3NKZA 4TZ4C 2OLTA 3PJAA 3HKBE 1HR0T 4A98A 2CHOA 1NENA 5LJNA 4LFAT 2LSJA 4AKRB 1HTJF 4B3RT 1YKHB 4PAGA 3KFWX 1UUSA 2IIUA 3AEBA 3QOFA 1Z8UA 1ZP0A 4N9F3 5JQGE 1WCRA 4QH5A 2UXXB 3S4UA 3UFGA 4EEBA 2DI4A 2K5BB 5FNVE 2DL1A 4DR3T 3BK9A 5LMNT 3RQWA 3J9X1 2BKOA 2EHOC 3WAKA 4MFRA 3MACA 3J7Yq 3F57A 3PUWF 4OX9T 5FKYA 4YSZA 5J1GA 2VASA 3BQIA 2LM2A 1YW0A 4YSXA 4KHPT 3SWHA 4B3TT 2AXDS 2H7VC 3UUBA 2DWGA 2WZKA 5HXSA 4UF0B 2FJDA 2LM9A 4P5OA 3P4WA 4EGWA 4TN7B 2CCQA 4FI5A 2WDVA 1NAFA 3ZCIA 4CI3B 2JQ9A 4NUUA 4QH1A 2E9XA 3H3AA 2CE7A 3ZT7A 2WSSV 3T1YT 2DNXA 2LSKA 3ZN0B 4KI0F 2LT3A 4LF5T 2Q9QD 5HCMA 3EDVA 5FP3A 1EZ3A 1X79A 3JADA 4O2AE 2VB6A 1BR1A 5M4YA 4ZZCA 3I0QA 2HPJA 2CBIA 5LHHB 3I9YA 4DNDA 3N9OA 2K24A 2YINA 1WFDA 3C51A 2D0TA 4PFPA 4IE4A 3RIUC 4B3MT 2FJEA 2VL8A 1ZEEA 5CJ5A 3U3IA 3AB3B 4V1Av 4ZXLA 2V6YB 5KX5E 2XQ9A 2UXCT 2VQFT 1IBMT 1LRZA 1W0AA 4ILCA 5FXXA 2UUBT 5LA6E 1W0BA 4EYUA 4QH4A 4IT4A 3GMIA 2VL0A 2YK0A 2K3WA 4O4JE 2WDQA 1IJ6A 5L3FB 2CXLA 3PUZF 2YDSA 4N78D 2UU9T 2LKGA 1T8BA 2WCAA 4H9OC 5FMNA 2KINB 4YT0A 4XAXB 3TLVA 3AXJB 4JI0T 3KINB 2PTFA 1QUUA 4H9SE 2KWIB 2LKHA 1IJ5A 3P7IA 2FJAA 3PUYF 3ANWA 3OPCA 3R6NA 3CX7B 3F31A 1OXZA 2V7MA 1Z0PA 3ONJA 2XASB 3QB5K 2YEVC 4ISTA 3AA1B 4DV3T 2WMOA 3ZN1B 1ZKEA 1BR0A 1D0ZA 3I0OA 1HX8A 5KMGP 1N36T 3NWIA 2EHOA 1MNDA 4TUYE 1T7SA 3KVBA 5IHYA 4YJ2E 5C2TA 3ONLC 5TAOA 5FXWA 4ILAA 4YTPA 4JV5T 2LOPA 4ZI3C 4DBQA 4QXHB 5ETWA 5AQKB 5FY7A 5F3JA 3UU8A 4HFEA 3PU8A 2M6IA 3PUVF 1WR6A 1ZOYA 2CXFA 4TV8E 5CA0E 2JMHA 3WI3A 1YXRA 1T72A 1D1AA 4DV6T 2VVNA 5FL0A 2L8KA 4H63V 5LMUT 2V6XA 4ZI7E 3AEAA 4IIJE 3RF1A 2Z6EA 2PFVA 2J1DG 4IGUA 1S94A 3ZCJA 3EI0A 3CMLA 3G06A 3VR8A 4CXXA 1X9BA 4LMJA 3OBVE 4L0RA 1YD8G 4YJ3E 1SHZC 4NXMT 3ZPOA 1QSDA 2H89A 3UQ7A 2BVLA 3KV9A 3RPUA 2LOSA 3ZC0A 3ZMVB 5AQTB 3UQ4A 2ES0A 3UU3A 3RI5A 5ABFA 4ILBA 3OYZA 2MAWA 3H37A 3Q5DA 3T8OA 1OEDB 4ZEYA 2VWAA 2XAFB 3PUAA 4I55E 3P4RA 1FEWA 4NXNT 2W00A 4A64A 2V26A 4ZI2C 4AKIA 5FXVA 5EZYE 3SFEA 3QC9A 2H7OA 1HX1B 2J62A 3NZPA 2I0MA 3C64A 1GQEA 3PUXF 2QRXA 4DR2T 2X51A 4TNVA 5LG4A 2CA5A 2I59A 2XQ5A 4YHHT 5AQNB 3KBUA 1J1JA 4YFSA 4XZCA 4AQFA 4AP2B 4DR6T 1KNPA 3L3PA 2P9BA 3B57A 4ZS3A 4WQOD 5DABA 4X1IE 4CN4A 5AQMB 1IBKT 3L09A 5JH7E 2VKDA 2V8SV 3NRYA 3C4XA 3ESLA 1G73A 2NWBA 2DHRA 4EOZB 1VCSA 2WU2A 3DPLC 4I0UA 4FJOA 3I1AA 4PW8A 3ZMUB 3K3NA 4JUYA 1D0XA 2C5IT 4EYYR 5HAXA 3AVSA 1J5ET 1UCUA 1ZHCA 3MKDA 2WMNA 4HFHA 1UK5A 4APFB 2E9XC 3P4QA 1O3XA 3VRAA 4UF0A 4LFBT 2NR4A 2VVSA 2X68A 4GKKT 3O4XE 3SS1A 3ZJ2A 3PE0A 4X65T 2W0GA 4MLKA 3IF8B 3UU6A 5L2LA 4CXWA 2KNDA 4H63H 1MMNA 2C5KT 3AEEA 3VU7H 5LGUB 2E5LT 2X9YA 2V1DB 3FXEB 3C50A 4LF6T 1FIOA 4GYRA 2CMRA 4DV4T 3RTRA 3LFMA 4A56A 4LF8T 4NUVA 4KBMB 4IE0A 3P8CD 1SE7A 3K1SA 2KMFA 2I6HA 4WYVA 2IAKA 4U2YA 4E7SA 4DMWA 4X1YE 2D5UA 2V6YA 3CQGB 1OEDC 4Z90A 2XM2A 2QYWA 4AKLA 3VKHA 3ZKRA 4YSYA 3PUQA 1D1CA 4C91A 3OJAA 4PNIA 4BJNA 4GK5E 1VRBA 4COFA 4PJLA 4EZ4A 1XWMA 5F5WA 4ANJA 5ABEA 2F4VT 4JI6T 4K0KT 3ZYMA 4EIWA 2LEHA 4CI1B 4PK4A 1HG2A 5AQQB 5AQUB 3RC3A 3ZJ1A 3PUGA 3AXJA 3I9WA 2BG9E 3HA4A 3GA8A 2KLQA 3AAAB 3FZLB 3IBPA 5EK3A 2JQKA 3CQXC 1D0YA 5HCJA 2LLYA 3RQUA 2MBGA 4CZZB 1SUMB 2ZLYA 3EVYA 1LDJA 5JDGA 4I43B 2B76A 5JDNA 2PBIA 1XZYA 4B6XA 1NEKA 4EEDA 5JRCB 3UU4A 4QX7B 4AI6A 3OVUA 2ACXA 2RA1A 1I94T 1B7TA 2XM1A 3RC8A 4WBOA 3JCFA 3VHLA 2BBJA 4HTEA 3CVRA 1MMAA 2HHHT 2Y8DA 3PU3A 2ODUA 2ZM2A 5L4EA 4IDQA 5H6RB 3AA0B 2WB5A 5LHGB 1MNEA 4KX6A 1YKEB 4EB6E 3ZYLA 5C8YE 5DQWA 3RLFF 1MMDA 4ZI3D 2HN1A 4DMVA 4YY3T 4HWDA 2IHR1 3O1JA 2XQAA 4YTNA 2WDRA 5LBMA 4EXTA 4TV9E 4CN6A 2V5DA 1MIYA 3PV0F 2Q9QB 4PJNA 2LSGA 2B1EA 5LYJE 3EABA 4YLHA 5ABHA 2L3LA 4BAYB 3ETVA 2W61A 4C90A 3PDYA 3N9MA 3IA3A 4G63A 2YDQA 1HCIA 2WU5A 4MALA 5LBQB 2X0HA 2L9QA 3N2OA 2YOEA 1XNQT 4X1KE 3ZT5A 4U2ZA 5BR8T 5FVLA 4IDOA 2UXDT 3MZKB 1G8XA 5JDFA 2G0UA 2CLYC 4O4IE 2NW7A 4GOUA 3V5SA 3FBLA 4YHJA 2IC6A 2W62A 3LBXB 2MTQA 5E0OA 1V9DA 5LP6E 2GK9A 4PK6A 3ABVA 3LDQB 4LFCT 5JREA 4B3ST 4JGHD 2JRKA 3N9NA 3UUNA 1OEDA 3CIRA 3K3OA 3JC6C 2LE8A 3MJXA 1LKXA 3DJBA 2CWOA 4U7YA 4DBRA 3N2GE 4AQFC 3LG7A 4ZI2D 3A7MA 4CXYA 2WM9A 5GONE 5HXHA 1FMVA 5JDLA 1I6ZA 1XNRT 3HKEE 1SA0E 1U6GA 3LK3B 1NWMX 4H9NC 2NOXA 2X0YA 2VKHA 3AA6B 1XMOT 3RX6A 5HWXA 5JDHA 5AFUL 2XAJB 1E2AA 4JI4T 5EK4A 1VOMA 1W9RA 4U31A 2YU2A 4ASKA 5AQGB 2YN6A 4NIQA 3RYIE 3TLUA 1LDKB 1LVKA 3HI2A 2V7LA 5IUXA 3W15B 4X20E 4DO0A 3DTOA 3QK6A 3UT5E 4H9RC 5AQHB 1WYCA 5JDMA 4TWFA 3FZKB 4HKAA 2LHNA 1JNRA 4M1PA 1WRDA 2QA7A 2X67A 2E9XD 3A5XA 4GYSA 4TWHA 4DVDA 2LRKA 2IDOB 2DCFA 3T1HT 3O1IA 5LOVE 1N33T 1KK7A 5F8PA 1FJGT 4ZHQE 2FJBA 4ZS2A 3AE8A 1UGOA 4HWIB 5L3DB 4O2BE 4QXCB 4CQIA 4IDPA 4KHZF 1J5WA 3KV4A 2D9DA 4WNKA 3CKDA 3N2KE 4GIWA 2JQHA 4QWNB 5EK2A 1D1BA 4DR5T 2W4XA 2E2AA 2BVMA 2KZ7B 3TLSA 3N9LA 2N9DA 4HWCA 3FXDB 2DLRA 4WW0A 2WQYA 4KMCA 1HG5A 3EDUA 4IL9A 2VKJA 4QXBB 1T98A 2C5JA 4JI3T 2JJ9A 5FL1A 2KWHA 2X9XA 4DV1T 4HXIB 1XMQT 2HN2A 1IZNB 3HR0A 4JLEA 3NRXA 2CM0A 1YQ4A 4DV7T 2VURA 2WP9A 3DP7A 2BS2A 2WBLA 3AEGA 5LG3A 4EZHA 3F2EA 3HL6A 1M62A 3UFEA 4TX5A 4UEMA 3O9XA 3CX6B 1US7B 2R6GF 3KDSE 4DR7T 3GN5B 4YXDA 4TNWA 3LSVA 4X62T 3UUMA 5J2TE 2EHOD 3L8RA 3NZQA 1W09A 1BR2A 3AE4A 2NP9A 2WWVA 3B5MA 4UVCB 2HPLA 4AIUA 5JRCA 3TKLB 4XBFB 2XU0A 3QNUA 5HYAA 3H3MA 2C0SA 1LVFA 4WBNE 1KNZA 2XY8B 2XJ7A 3FZFB 3ZYKA 3TLWA 1U4QA 3AE2A 4P09A 3LJCA 5LNKA 3AEDA 5L3EB 2V7JA 4IE7A 3ZC1A 5FVKA 4EAHA 3KV5A 2FUPA 4HWHA 4AXPA 3PJAJ 2PJQA 4UV8B 4LMKA 3MA9A 5L3BB 3AE6A 2ACZA 4HEAA 1U5PA 1FMWA 5KDMC 4MBQA 3RKGA 2RP4A 3AE3A 2Q9QA 3X1DA 2D2SA 2H88A 4IDZA 2XAQB 4DR4T 1JNZA 2A72A 4H9PC 3U78A 2LRLA 2MOZA 4ADZA 2ZM0A 2NTYA 4ERRA 3K3QC 3FB2A 1QLBA 3RRWA 3AECA 3AE1A 4HWFA 4NPPA 3JAFA 4KP3C 3ZT6A 1MIVA 4QKNA 4JBWF 3AAEB 3A8YC 2XHEB 4IHJE 4MHCA 4ZOLE 4UIGA 4F8HA 3LBXA 4LF9T 1CHUA 1KNRA 2VK9A 1KFYA 4Z91A 4HFDA 3C4ZA 5AQJB 3KVAA 4O8SA 3JC6D 4Q25A 4PK5A 2V7IA 1ZV4X 3E08A 3LK42 3VRBA 3M3ZB 4HFVA 3RHWA 4JI5T 3P4PA 3PTRB 5CGMA 1HNZT 3RGLA 2CWYA 3CX8B 5ADXL 2XAGB 3AAIA 4GK0E 4JEUB 3HKCE 2NW9A 4UVBB 3C4WA 3OKQA 5IWAT 2RPAA 3K8PC 2BZBA 3R84B 2XQ8A 2X66A 2IMLA 2YDRA 2CRBA 4A97A 2JQQA 4OYJA 1HNWT 2BG9B 3TLTA 5CFBA 4DV0T 5FYMA 2J4GA 5ABGA 3WAJA 4AKGA 4HFBA 5L4HA 1BR4A 3AE5A 4DV2T 1LDKA 2XAHB 5JR9B 5CB4E 1OWAA 5HXRA 2UUAT 3N9PA 2OA5A 2X0LB 5HEJA 4DIDB 1Y64B 2W66A 3Q5WA 4LMLA 2WY2A 2CBJA 1E1HB 4QHOA 3O1HA 3SRZA 3Q9DA 4UELA 2V7KA 3CPZA 2D0UA 2XUEA 4ZZBA 2JPFA 4IDNA 2XQ6A 4DR1T 2YU1A 4DV5T 1WYBA 3M65A 1UX5A 3EHZA 5AQRB 4L5GA 4AQGA 2WWUA 5AQPB 4O4LE 1MMGA 2XSBA 3VKGA 1UX4A 3IEEA 2XTLA 2WAUA 3BQLA 4OHFA 4HE8A 3RIAA 4PFOA 3NBXX 3EAMA 1R8IA 2K9AA 3N9QA 1M7KA 3CK6A 2ZM6T 2X9WA 2KXPB 3Q5XA 2XQYA 3RRCA 2E8IA 3RYFE 3UULA 2N1GA 4X64T 3JAEA 3RIFA 4AQYT 1H7CA 4LF7T 3RYCE 4LF4T 4JEHB 4U33A 3MK7C 4BA9A 2XQ7A 1WR0A 1KF6A 3FZHB 4DUYT 2X9HA 2ZMAA 4HN9A 4PJJA 4I50E 4Z8XA 5AQIB 3E22E 2W2UA 2E5VA 3GN5A 4F6RC 4HFIA 2IC9A 2Y6XA 2BG9C 3OTOT 2UUCT 4J2CA 1IBLT 1HS7A 5FY1A 3P50A 4U72A 2W67A 4E7ZA 5JR9C 3ZMZB 2J47A 2MYSA 3HKDE 2XPKA 1IAPA 2XQ3A 2BS4A 1Y01A 2E9XB 5LHIB 1XDOA 2BKPA 2NW8A 4IREA 2FBWA 5L3GB 4GKJT 2BBHA 2Q9QC 4PJMA 3ZMSB 3NVOA 2K48A 1L0VA 3SFDA 3FZMB 4O4HE 5AQSB 2LSYA 5IYZE 4I4TE 4K0UA 5LJMA 1AJ3A 2CPTA 3ZEFB 3UTKA 2PG8A 2WZIA 2Y48B 5JDQA 2M67A 3UUXB 5AQLB 2A3DA 1OEDE 4OYKA 4IE5A 3Q5EA 2IUBA 2W63A 4H9QC 4JI7T 2A9UA 3Q2MA 2LSIA 3KV6A 2WZHA 1E7PA 5AQFB 5FXZA 3ZSSA 2MPKA 2IW5B 2VKOA 5KXJA 5H6QB 5HXCA 5JVDE 5HEHA 3RIUA 4UR9A 5AQVB 4OFZA 4ISSA 4P0BA 2BDEA 2AE9A 5HXEA 4X5TA 3MXZA 1DU2A 2LJLA 3B13A 3PUSA 4CN1A 3N5LA 3IHRA 3QB5A 3V5UA 3RH3A 3P4SA 2WS3A 5HEOA 2NTXA 2A2FX 3AE9A 4JI8T 3CWZB 5AQOB 2KSRA 3LK2B 3OYXA 2BS3A 3BQKA 4QX8B 1CUNA 5A1LA 3C98B 4BJMA 5J0ZA 3ANWB 2QGSA 1MIWA 2DWKA 4JI2T 5DQVA 5C3JA 5LCYA 4IL4A 4KUMB 4UXNB 3KBTA 3QUJA 5LGNB 2BKNA 3ZLIA 2EHOB 4P0AA 3AVRA 4U74A 4F52A 1YQ3A 4HFCA 3FBZA 4YTMA 5L3CB 4X66T 5HEUA 3ONXA 2HH7A 4AKHA 3RKOA 5LB7B 2UXBT 5HEGA 2KT9A 2BG9A 5DJQC 5FY0A
chains in the Genus database with same CATH topology
2Z6EA 2CWYA 2PFVA 2J1DG 4IGUA 5JREA 3CX8B 2JRKA 1S94A 3N9NA 3UUNA 3PURA 5ADXL 3ZCJA 1WLXA 3CMLA 5BMVE 4CXXA 3K3OA 2XAGB 3JC6C 2LE8A 3AAIA 4HGAA 3MJXA 4GK0E 3OBVE 4JEUB 5JR9A 3E0ZA 4L0RA 1LKXA 3DJBA 3RYHE 2CWOA 4ILUA 1YD8G 3HKCE 2NW9A 1HFAA 4YJ3E 1SHZC 3SOLA 3ZPOA 1QSDA 4UVBB 2ZM8A 3C4WA 3OKQA 4DBRA 3N2GE 3CQCB 4AQFC 3LG7A 4L9IA 2BVLA 4ZI2D 3K8PC 2BZBA 3R84B 5CA1E 3KV9A 2X66A 3RPUA 4CXYA 2WM9A 5GONE 2LOSA 5HXHA 3ZC0A 3ETUA 4UVAB 1FMVA 5JDLA 3ZMVB 2JQQA 5LXTE 3HKEE 4OYJA 2ES0A 1SA0E 5FYMA 5J2UE 3OYZA 3WAJA 3LK3B 1NWMX 4H9NC 4AKGA 2UXNB 3H37A 5LGTB 3T8OA 2NOXA 3FHNA 1BR4A 1S35A 2CEAA 2VKHA 4UV9B 3AA6B 2XAHB 2VWAA 2JMKA 4OK0A 2XAFB 3RX6A 5JR9B 5HWXA 5JDHA 3PUAA 2XAJB 3EUHA 4I55E 5CB4E 5AFUL 1OWAA 1FEWA 2W00A 5HXRA 2V26A 3N9PA 4ZI2C 4AKIA 5FXVA 5EK4A 5EZYE 2OA5A 1VOMA 1HF8A 2H3RA 3QC9A 2H7OA 2CXDA 2X0LB 2YU2A 3NZPA 4ASKA 3C64A 1Y64B 3Q5WA 3RYIE 2ODVA 2X51A 5LG4A 3ZMTB 1LVKA 2CA5A 2I59A 2V7LA 3HI2A 5HWYA 3KBUA 4CI2B 4YFSA 2CLYB 4XZCA 1E1HB 4X20E 3DTOA 3W15B 4AQFA 4DO0A 3QK6A 4G2AA 4QHOA 3AA7B 3UT5E 4H9RC 3GWHA 3O1HA 3L3PA 3SRZA 3D0TA 2P9BA 3B57A 3Q9DA 2N2NA 4UELA 2V7KA 4ZS3A 2LHRA 1WYCA 3CPZA 4IE6A 5DABA 4X1IE 2D0UA 5JDMA 2XUEA 3L09A 4HKAA 5JH7E 2LHNA 2SPCA 2VKDA 4M1PA 1WRDA 2X67A 2QA7A 2JPFA 3NRYA 2E9XD 3C4XA 4TZ4C 3A5XA 4GYSA 3ESLA 2YU1A 1G73A 4DVDA 2NWBA 2DHRA 4EOZB 3HKBE 1WYBA 3M65A 5LJNA 2DCFA 1UX5A 4FJOA 3I1AA 4PW8A 2LSJA 4AKRB 3ZMUB 3O1IA 3K3NA 4L5GA 1HTJF 5LOVE 4AQGA 4JUYA 1D0XA 2WWUA 2C5IT 4EYYR 5HAXA 1YKHB 3AVSA 1KK7A 4PAGA 5F8PA 3KFWX 4ZHQE 4O4LE 4ZS2A 1UCUA 1ZHCA 3MKDA 1MMGA 5JQGE 2UXXB 2WMNA 3S4UA 2DI4A 2K5BB 5FNVE 4O2BE 5L3DB 4QXCB 3VKGA 4CQIA 1UX4A 3IEEA 3KV4A 2E9XC 2XTLA 2WAUA 3BQLA 4OHFA 1O3XA 4WNKA 3CKDA 3N2KE 4HE8A 3BK9A 4GIWA 4QWNB 4UF0A 4PFOA 3NBXX 3J9X1 5EK2A 2EHOC 2K9AA 2X68A 3N9QA 3WAKA 4MFRA 3MACA 3J7Yq 1D1BA 3F57A 3O4XE 2X9WA 2KXPB 3Q5XA 2XQYA 5J1GA 3RRCA 3SS1A 2VASA 2E8IA 3ZJ2A 3PE0A 3RYFE 3UULA 2BVMA 3BQIA 2N1GA 2W0GA 2KZ7B 4MLKA 3IF8B 1YW0A 3N9LA 5L2LA 4CXWA 3SWHA 2N9DA 1H7CA 3FXDB 2DLRA 2KNDA 4WW0A 4H63H 2H7VC 1MMNA 3RYCE 2C5KT 3VU7H 4KMCA 1HG5A 2DWGA 3EDUA 4JEHB 5LGUB 2VKJA 3MK7C 2X9YA 4QXBB 4BA9A 5HXSA 1T98A 4UF0B 2C5JA 2V1DB 3FXEB 3C50A 2JJ9A 2LM9A 2X9HA 2KWHA 2X9XA 4TN7B 1FIOA 2CCQA 4FI5A 4GYRA 2CMRA 2ZMAA 3LFMA 4A56A 4HN9A 1NAFA 3ZCIA 4PJJA 4CI3B 4NUVA 1IZNB 4I50E 4KBMB 4IE0A 4NUUA 3HR0A 4Z8XA 3P8CD 4JLEA 3E22E 3NRXA 2CM0A 2E9XA 3GN5A 4F6RC 3H3AA 2KMFA 2CE7A 3DP7A 2IC9A 2WSSV 2DNXA 2IAKA 2LSKA 2WBLA 4E7SA 3ZN0B 2Y6XA 4DMWA 2LT3A 2Q9QD 3EDVA 4J2CA 1HS7A 5FY1A 5FP3A 4EZHA 1EZ3A 1X79A 4X1YE 2D5UA 4O2AE 3F2EA 2VB6A 3CQGB 3HL6A 4U72A 3UFEA 1BR1A 4TX5A 4UEMA 5M4YA 4E7ZA 5JR9C 3ZMZB 3O9XA 3I0QA 2MYSA 4AKLA 3VKHA 2HPJA 3HKDE 5LHHB 3I9YA 1IAPA 3PUQA 1D1CA 4C91A 3OJAA 4PNIA 4DNDA 4BJNA 3CX6B 1US7B 3KDSE 3N9OA 2K24A 4GK5E 1VRBA 2E9XB 5LHIB 3GN5B 2YINA 2NW8A 3C51A 4PJLA 3UUMA 4EZ4A 2D0TA 4PFPA 4IE4A 5J2TE 4ANJA 2EHOD 5L3GB 3NZQA 2VL8A 1BR2A 2Q9QC 4PJMA 1ZEEA 3ZYMA 2NP9A 3ZMSB 4EIWA 2K48A 2LEHA 4UVCB 3U3IA 4CI1B 3AB3B 4V1Av 2HPLA 4PK4A 1HG2A 4O4HE 5JRCA 2LSYA 5IYZE 3RC3A 3TKLB 4I4TE 3ZJ1A 5KX5E 4XBFB 3PUGA 1LRZA 2XU0A 4K0UA 5HYAA 5LJMA 1AJ3A 3I9WA 3ZEFB 3UTKA 2C0SA 1LVFA 3HA4A 4WBNE 3GA8A 2KLQA 2PG8A 3AAAB 5FXXA 2Y48B 1KNZA 3IBPA 5EK3A 5LA6E 3ZYKA 5JDQA 3CQXC 4EYUA 2M67A 3UUXB 1D0YA 2A3DA 1U4QA 3GMIA 2MBGA 4CZZB 4OYKA 4P09A 2YK0A 3LJCA 2ZLYA 3EVYA 5LNKA 4O4JE 4IE5A 5L3EB 5JDGA 1IJ6A 2V7JA 4IE7A 5L3FB 3ZC1A 2CXLA 4I43B 2W63A 4H9QC 5JDNA 3Q2MA 2LSIA 2PBIA 4EAHA 3KV6A 3KV5A 4B6XA 4N78D 4AXPA 5JRCB 4H9OC 5FMNA 4QX7B 5FXZA 4AI6A 2KINB 2ACXA 2PJQA 2RA1A 4UV8B 2IW5B 1B7TA 3MA9A 4XAXB 5L3BB 3RC8A 4HEAA 4WBOA 1U5PA 2VKOA 5H6QB 3KINB 5HXCA 3VHLA 1FMWA 5JVDE 1QUUA 4HTEA 5KDMC 3CVRA 1MMAA 4MBQA 2RP4A 4H9SE 4OFZA 2Y8DA 2KWIB 2Q9QA 3PU3A 2ODUA 2ZM2A 4ISSA 1IJ5A 2D2SA 4IDZA 3P7IA 5H6RB 3AA0B 4P0BA 5LHGB 1MNEA 1YKEB 4EB6E 3ZYLA 5C8YE 2BDEA 2XAQB 5DQWA 5HXEA 3ANWA 3MXZA 3R6NA 2LJLA 3CX7B 2A72A 3F31A 3B13A 1MMDA 4H9PC 3U78A 4ZI3D 3PUSA 1OXZA 2V7MA 1Z0PA 4DMVA 2MOZA 2XASB 3O1JA 3N5LA 2YEVC 4ISTA 4ADZA 2ZM0A 3AA1B 3IHRA 2NTYA 4ERRA 3K3QC 5LBMA 2WMOA 3RH3A 1ZKEA 3V5UA 3ZN1B 1BR0A 1D0ZA 3FB2A 3I0OA 2NTXA 4EXTA 1HX8A 5KMGP 4TV9E 3RRWA 2A2FX 1MIYA 1MNDA 2EHOA 4TUYE 3KVBA 5IHYA 4YJ2E 3CWZB 2Q9QB 4PJNA 4KP3C 3LK2B 2LSGA 5TAOA 2B1EA 1MIVA 3OYXA 5LYJE 3BQKA 5FXWA 4QKNA 4QX8B 3AAEB 1CUNA 2XHEB 4IHJE 4YLHA 5A1LA 3C98B 4BJMA 2L3LA 3ANWB 4MHCA 4BAYB 2LOPA 2QGSA 1MIWA 2DWKA 3ETVA 4ZOLE 5DQVA 4ZI3C 4UIGA 4DBQA 2W61A 3LBXA 4QXHB 4C90A 3PDYA 3N9MA 5ETWA 4G63A 5FY7A 5F3JA 5LCYA 4KUMB 4UXNB 1HCIA 3KBTA 3QUJA 4MALA 5LBQB 2VK9A 5LGNB 3PU8A 3ZLIA 2L9QA 3C4ZA 3N2OA 3KVAA 2EHOB 4O8SA 1WR6A 3JC6D 4X1KE 4PK5A 4P0AA 3AVRA 2CXFA 2V7IA 4TV8E 5CA0E 2JMHA 3WI3A 4U74A 1ZV4X 3MZKB 1G8XA 5JDFA 3E08A 2G0UA 2CLYC 4O4IE 1D1AA 3FBZA 3LK42 2NW7A 4GOUA 3V5SA 3FBLA 4YHJA 5L3CB 4HFVA 2IC6A 2W62A 2L8KA 3ONXA 2HH7A 3PTRB 3LBXB 4AKHA 2MTQA 3RKOA 4H63V 5E0OA 1V9DA 2KT9A 5DJQC 4ZI7E 2GK9A 4PK6A 5FY0A 5LP6E 4IIJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFS A;  3BQI A;  2XU0 A;  4NUV A;  2YK0 A;  3BQK A;  4NUU A;  2WAU A;  3C64 A;  3RRC A;  2Y8D A;  5F3J A;  3BQL A;  3CPZ A;  3CML A; 
#chains in the Genus database with same CATH topology
 4U3C A;  1UUR A;  2XQ4 A;  2XSA A;  3PUR A;  3ZST A;  1WLX A;  5BMV E;  3L39 A;  4HGA A;  5JR9 A;  3E0Z A;  3RYH E;  4ILU A;  4DUZ T;  4JYA T;  1HFA A;  3SOL A;  2ZM8 A;  4TWD A;  1N32 T;  3CQC B;  4L9I A;  3AEF A;  5CA1 E;  3ETU A;  3AE7 A;  4UVA B;  4AIS A;  5LXT E;  5L47 A;  2OV9 A;  5J2U E;  2UXN B;  5LGT B;  3FHN A;  2CHN A;  1S35 A;  4UV9 B;  2CEA A;  4EV6 A;  2JMK A;  4OK0 A;  1XDP A;  2YKS A;  2VQE T;  2QVA A;  3EUH A;  3DQV C;  2M6B A;  4WZX A;  1KEY A;  1HF8 A;  2H3R A;  2CXD A;  1VCT A;  1HNX T;  2V5C A;  5ABF B;  4P1N A;  2ODV A;  5JTG A;  3UU5 A;  2JIW A;  4A5X A;  3ZMT B;  5HWY A;  4CI2 B;  4U7I A;  3VR9 A;  2CLY B;  4G2A A;  3AA7 B;  3GWH A;  3D0T A;  2XZE A;  2N2N A;  2LHR A;  4IE6 A;  2SPC A;  4JI1 T;  1N34 T;  3NKZ A;  4TZ4 C;  2OLT A;  3PJA A;  3HKB E;  1HR0 T;  4A98 A;  2CHO A;  1NEN A;  5LJN A;  4LFA T;  2LSJ A;  4AKR B;  1HTJ F;  4B3R T;  1YKH B;  4PAG A;  3KFW X;  1UUS A;  2IIU A;  3AEB A;  3QOF A;  1Z8U A;  1ZP0 A;  4N9F 3;  5JQG E;  1WCR A;  4QH5 A;  2UXX B;  3S4U A;  3UFG A;  4EEB A;  2DI4 A;  2K5B B;  5FNV E;  2DL1 A;  4DR3 T;  3BK9 A;  5LMN T;  3RQW A;  3J9X 1;  2BKO A;  2EHO C;  3WAK A;  4MFR A;  3MAC A;  3J7Y q;  3F57 A;  3PUW F;  4OX9 T;  5FKY A;  4YSZ A;  5J1G A;  2VAS A;  3BQI A;  2LM2 A;  1YW0 A;  4YSX A;  4KHP T;  3SWH A;  4B3T T;  2AXD S;  2H7V C;  3UUB A;  2DWG A;  2WZK A;  5HXS A;  4UF0 B;  2FJD A;  2LM9 A;  4P5O A;  3P4W A;  4EGW A;  4TN7 B;  2CCQ A;  4FI5 A;  2WDV A;  1NAF A;  3ZCI A;  4CI3 B;  2JQ9 A;  4NUU A;  4QH1 A;  2E9X A;  3H3A A;  2CE7 A;  3ZT7 A;  2WSS V;  3T1Y T;  2DNX A;  2LSK A;  3ZN0 B;  4KI0 F;  2LT3 A;  4LF5 T;  2Q9Q D;  5HCM A;  3EDV A;  5FP3 A;  1EZ3 A;  1X79 A;  3JAD A;  4O2A E;  2VB6 A;  1BR1 A;  5M4Y A;  4ZZC A;  3I0Q A;  2HPJ A;  2CBI A;  5LHH B;  3I9Y A;  4DND A;  3N9O A;  2K24 A;  2YIN A;  1WFD A;  3C51 A;  2D0T A;  4PFP A;  4IE4 A;  3RIU C;  4B3M T;  2FJE A;  2VL8 A;  1ZEE A;  5CJ5 A;  3U3I A;  3AB3 B;  4V1A v;  4ZXL A;  2V6Y B;  5KX5 E;  2XQ9 A;  2UXC T;  2VQF T;  1IBM T;  1LRZ A;  1W0A A;  4ILC A;  5FXX A;  2UUB T;  5LA6 E;  1W0B A;  4EYU A;  4QH4 A;  4IT4 A;  3GMI A;  2VL0 A;  2YK0 A;  2K3W A;  4O4J E;  2WDQ A;  1IJ6 A;  5L3F B;  2CXL A;  3PUZ F;  2YDS A;  4N78 D;  2UU9 T;  2LKG A;  1T8B A;  2WCA A;  4H9O C;  5FMN A;  2KIN B;  4YT0 A;  4XAX B;  3TLV A;  3AXJ B;  4JI0 T;  3KIN B;  2PTF A;  1QUU A;  4H9S E;  2KWI B;  2LKH A;  1IJ5 A;  3P7I A;  2FJA A;  3PUY F;  3ANW A;  3OPC A;  3R6N A;  3CX7 B;  3F31 A;  1OXZ A;  2V7M A;  1Z0P A;  3ONJ A;  2XAS B;  3QB5 K;  2YEV C;  4IST A;  3AA1 B;  4DV3 T;  2WMO A;  3ZN1 B;  1ZKE A;  1BR0 A;  1D0Z A;  3I0O A;  1HX8 A;  5KMG P;  1N36 T;  3NWI A;  2EHO A;  1MND A;  4TUY E;  1T7S A;  3KVB A;  5IHY A;  4YJ2 E;  5C2T A;  3ONL C;  5TAO A;  5FXW A;  4ILA A;  4YTP A;  4JV5 T;  2LOP A;  4ZI3 C;  4DBQ A;  4QXH B;  5ETW A;  5AQK B;  5FY7 A;  5F3J A;  3UU8 A;  4HFE A;  3PU8 A;  2M6I A;  3PUV F;  1WR6 A;  1ZOY A;  2CXF A;  4TV8 E;  5CA0 E;  2JMH A;  3WI3 A;  1YXR A;  1T72 A;  1D1A A;  4DV6 T;  2VVN A;  5FL0 A;  2L8K A;  4H63 V;  5LMU T;  2V6X A;  4ZI7 E;  3AEA A;  4IIJ E;  3RF1 A;  2Z6E A;  2PFV A;  2J1D G;  4IGU A;  1S94 A;  3ZCJ A;  3EI0 A;  3CML A;  3G06 A;  3VR8 A;  4CXX A;  1X9B A;  4LMJ A;  3OBV E;  4L0R A;  1YD8 G;  4YJ3 E;  1SHZ C;  4NXM T;  3ZPO A;  1QSD A;  2H89 A;  3UQ7 A;  2BVL A;  3KV9 A;  3RPU A;  2LOS A;  3ZC0 A;  3ZMV B;  5AQT B;  3UQ4 A;  2ES0 A;  3UU3 A;  3RI5 A;  5ABF A;  4ILB A;  3OYZ A;  2MAW A;  3H37 A;  3Q5D A;  3T8O A;  1OED B;  4ZEY A;  2VWA A;  2XAF B;  3PUA A;  4I55 E;  3P4R A;  1FEW A;  4NXN T;  2W00 A;  4A64 A;  2V26 A;  4ZI2 C;  4AKI A;  5FXV A;  5EZY E;  3SFE A;  3QC9 A;  2H7O A;  1HX1 B;  2J62 A;  3NZP A;  2I0M A;  3C64 A;  1GQE A;  3PUX F;  2QRX A;  4DR2 T;  2X51 A;  4TNV A;  5LG4 A;  2CA5 A;  2I59 A;  2XQ5 A;  4YHH T;  5AQN B;  3KBU A;  1J1J A;  4YFS A;  4XZC A;  4AQF A;  4AP2 B;  4DR6 T;  1KNP A;  3L3P A;  2P9B A;  3B57 A;  4ZS3 A;  4WQO D;  5DAB A;  4X1I E;  4CN4 A;  5AQM B;  1IBK T;  3L09 A;  5JH7 E;  2VKD A;  2V8S V;  3NRY A;  3C4X A;  3ESL A;  1G73 A;  2NWB A;  2DHR A;  4EOZ B;  1VCS A;  2WU2 A;  3DPL C;  4I0U A;  4FJO A;  3I1A A;  4PW8 A;  3ZMU B;  3K3N A;  4JUY A;  1D0X A;  2C5I T;  4EYY R;  5HAX A;  3AVS A;  1J5E T;  1UCU A;  1ZHC A;  3MKD A;  2WMN A;  4HFH A;  1UK5 A;  4APF B;  2E9X C;  3P4Q A;  1O3X A;  3VRA A;  4UF0 A;  4LFB T;  2NR4 A;  2VVS A;  2X68 A;  4GKK T;  3O4X E;  3SS1 A;  3ZJ2 A;  3PE0 A;  4X65 T;  2W0G A;  4MLK A;  3IF8 B;  3UU6 A;  5L2L A;  4CXW A;  2KND A;  4H63 H;  1MMN A;  2C5K T;  3AEE A;  3VU7 H;  5LGU B;  2E5L T;  2X9Y A;  2V1D B;  3FXE B;  3C50 A;  4LF6 T;  1FIO A;  4GYR A;  2CMR A;  4DV4 T;  3RTR A;  3LFM A;  4A56 A;  4LF8 T;  4NUV A;  4KBM B;  4IE0 A;  3P8C D;  1SE7 A;  3K1S A;  2KMF A;  2I6H A;  4WYV A;  2IAK A;  4U2Y A;  4E7S A;  4DMW A;  4X1Y E;  2D5U A;  2V6Y A;  3CQG B;  1OED C;  4Z90 A;  2XM2 A;  2QYW A;  4AKL A;  3VKH A;  3ZKR A;  4YSY A;  3PUQ A;  1D1C A;  4C91 A;  3OJA A;  4PNI A;  4BJN A;  4GK5 E;  1VRB A;  4COF A;  4PJL A;  4EZ4 A;  1XWM A;  5F5W A;  4ANJ A;  5ABE A;  2F4V T;  4JI6 T;  4K0K T;  3ZYM A;  4EIW A;  2LEH A;  4CI1 B;  4PK4 A;  1HG2 A;  5AQQ B;  5AQU B;  3RC3 A;  3ZJ1 A;  3PUG A;  3AXJ A;  3I9W A;  2BG9 E;  3HA4 A;  3GA8 A;  2KLQ A;  3AAA B;  3FZL B;  3IBP A;  5EK3 A;  2JQK A;  3CQX C;  1D0Y A;  5HCJ A;  2LLY A;  3RQU A;  2MBG A;  4CZZ B;  1SUM B;  2ZLY A;  3EVY A;  1LDJ A;  5JDG A;  4I43 B;  2B76 A;  5JDN A;  2PBI A;  1XZY A;  4B6X A;  1NEK A;  4EED A;  5JRC B;  3UU4 A;  4QX7 B;  4AI6 A;  3OVU A;  2ACX A;  2RA1 A;  1I94 T;  1B7T A;  2XM1 A;  3RC8 A;  4WBO A;  3JCF A;  3VHL A;  2BBJ A;  4HTE A;  3CVR A;  1MMA A;  2HHH T;  2Y8D A;  3PU3 A;  2ODU A;  2ZM2 A;  5L4E A;  4IDQ A;  5H6R B;  3AA0 B;  2WB5 A;  5LHG B;  1MNE A;  4KX6 A;  1YKE B;  4EB6 E;  3ZYL A;  5C8Y E;  5DQW A;  3RLF F;  1MMD A;  4ZI3 D;  2HN1 A;  4DMV A;  4YY3 T;  4HWD A;  2IHR 1;  3O1J A;  2XQA A;  4YTN A;  2WDR A;  5LBM A;  4EXT A;  4TV9 E;  4CN6 A;  2V5D A;  1MIY A;  3PV0 F;  2Q9Q B;  4PJN A;  2LSG A;  2B1E A;  5LYJ E;  3EAB A;  4YLH A;  5ABH A;  2L3L A;  4BAY B;  3ETV A;  2W61 A;  4C90 A;  3PDY A;  3N9M A;  3IA3 A;  4G63 A;  2YDQ A;  1HCI A;  2WU5 A;  4MAL A;  5LBQ B;  2X0H A;  2L9Q A;  3N2O A;  2YOE A;  1XNQ T;  4X1K E;  3ZT5 A;  4U2Z A;  5BR8 T;  5FVL A;  4IDO A;  2UXD T;  3MZK B;  1G8X A;  5JDF A;  2G0U A;  2CLY C;  4O4I E;  2NW7 A;  4GOU A;  3V5S A;  3FBL A;  4YHJ A;  2IC6 A;  2W62 A;  3LBX B;  2MTQ A;  5E0O A;  1V9D A;  5LP6 E;  2GK9 A;  4PK6 A;  3ABV A;  3LDQ B;  4LFC T;  5JRE A;  4B3S T;  4JGH D;  2JRK A;  3N9N A;  3UUN A;  1OED A;  3CIR A;  3K3O A;  3JC6 C;  2LE8 A;  3MJX A;  1LKX A;  3DJB A;  2CWO A;  4U7Y A;  4DBR A;  3N2G E;  4AQF C;  3LG7 A;  4ZI2 D;  3A7M A;  4CXY A;  2WM9 A;  5GON E;  5HXH A;  1FMV A;  5JDL A;  1I6Z A;  1XNR T;  3HKE E;  1SA0 E;  1U6G A;  3LK3 B;  1NWM X;  4H9N C;  2NOX A;  2X0Y A;  2VKH A;  3AA6 B;  1XMO T;  3RX6 A;  5HWX A;  5JDH A;  5AFU L;  2XAJ B;  1E2A A;  4JI4 T;  5EK4 A;  1VOM A;  1W9R A;  4U31 A;  2YU2 A;  4ASK A;  5AQG B;  2YN6 A;  4NIQ A;  3RYI E;  3TLU A;  1LDK B;  1LVK A;  3HI2 A;  2V7L A;  5IUX A;  3W15 B;  4X20 E;  4DO0 A;  3DTO A;  3QK6 A;  3UT5 E;  4H9R C;  5AQH B;  1WYC A;  5JDM A;  4TWF A;  3FZK B;  4HKA A;  2LHN A;  1JNR A;  4M1P A;  1WRD A;  2QA7 A;  2X67 A;  2E9X D;  3A5X A;  4GYS A;  4TWH A;  4DVD A;  2LRK A;  2IDO B;  2DCF A;  3T1H T;  3O1I A;  5LOV E;  1N33 T;  1KK7 A;  5F8P A;  1FJG T;  4ZHQ E;  2FJB A;  4ZS2 A;  3AE8 A;  1UGO A;  4HWI B;  5L3D B;  4O2B E;  4QXC B;  4CQI A;  4IDP A;  4KHZ F;  1J5W A;  3KV4 A;  2D9D A;  4WNK A;  3CKD A;  3N2K E;  4GIW A;  2JQH A;  4QWN B;  5EK2 A;  1D1B A;  4DR5 T;  2W4X A;  2E2A A;  2BVM A;  2KZ7 B;  3TLS A;  3N9L A;  2N9D A;  4HWC A;  3FXD B;  2DLR A;  4WW0 A;  2WQY A;  4KMC A;  1HG5 A;  3EDU A;  4IL9 A;  2VKJ A;  4QXB B;  1T98 A;  2C5J A;  4JI3 T;  2JJ9 A;  5FL1 A;  2KWH A;  2X9X A;  4DV1 T;  4HXI B;  1XMQ T;  2HN2 A;  1IZN B;  3HR0 A;  4JLE A;  3NRX A;  2CM0 A;  1YQ4 A;  4DV7 T;  2VUR A;  2WP9 A;  3DP7 A;  2BS2 A;  2WBL A;  3AEG A;  5LG3 A;  4EZH A;  3F2E A;  3HL6 A;  1M62 A;  3UFE A;  4TX5 A;  4UEM A;  3O9X A;  3CX6 B;  1US7 B;  2R6G F;  3KDS E;  4DR7 T;  3GN5 B;  4YXD A;  4TNW A;  3LSV A;  4X62 T;  3UUM A;  5J2T E;  2EHO D;  3L8R A;  3NZQ A;  1W09 A;  1BR2 A;  3AE4 A;  2NP9 A;  2WWV A;  3B5M A;  4UVC B;  2HPL A;  4AIU A;  5JRC A;  3TKL B;  4XBF B;  2XU0 A;  3QNU A;  5HYA A;  3H3M A;  2C0S A;  1LVF A;  4WBN E;  1KNZ A;  2XY8 B;  2XJ7 A;  3FZF B;  3ZYK A;  3TLW A;  1U4Q A;  3AE2 A;  4P09 A;  3LJC A;  5LNK A;  3AED A;  5L3E B;  2V7J A;  4IE7 A;  3ZC1 A;  5FVK A;  4EAH A;  3KV5 A;  2FUP A;  4HWH A;  4AXP A;  3PJA J;  2PJQ A;  4UV8 B;  4LMK A;  3MA9 A;  5L3B B;  3AE6 A;  2ACZ A;  4HEA A;  1U5P A;  1FMW A;  5KDM C;  4MBQ A;  3RKG A;  2RP4 A;  3AE3 A;  2Q9Q A;  3X1D A;  2D2S A;  2H88 A;  4IDZ A;  2XAQ B;  4DR4 T;  1JNZ A;  2A72 A;  4H9P C;  3U78 A;  2LRL A;  2MOZ A;  4ADZ A;  2ZM0 A;  2NTY A;  4ERR A;  3K3Q C;  3FB2 A;  1QLB A;  3RRW A;  3AEC A;  3AE1 A;  4HWF A;  4NPP A;  3JAF A;  4KP3 C;  3ZT6 A;  1MIV A;  4QKN A;  4JBW F;  3AAE B;  3A8Y C;  2XHE B;  4IHJ E;  4MHC A;  4ZOL E;  4UIG A;  4F8H A;  3LBX A;  4LF9 T;  1CHU A;  1KNR A;  2VK9 A;  1KFY A;  4Z91 A;  4HFD A;  3C4Z A;  5AQJ B;  3KVA A;  4O8S A;  3JC6 D;  4Q25 A;  4PK5 A;  2V7I A;  1ZV4 X;  3E08 A;  3LK4 2;  3VRB A;  3M3Z B;  4HFV A;  3RHW A;  4JI5 T;  3P4P A;  3PTR B;  5CGM A;  1HNZ T;  3RGL A;  2CWY A;  3CX8 B;  5ADX L;  2XAG B;  3AAI A;  4GK0 E;  4JEU B;  3HKC E;  2NW9 A;  4UVB B;  3C4W A;  3OKQ A;  5IWA T;  2RPA A;  3K8P C;  2BZB A;  3R84 B;  2XQ8 A;  2X66 A;  2IML A;  2YDR A;  2CRB A;  4A97 A;  2JQQ A;  4OYJ A;  1HNW T;  2BG9 B;  3TLT A;  5CFB A;  4DV0 T;  5FYM A;  2J4G A;  5ABG A;  3WAJ A;  4AKG A;  4HFB A;  5L4H A;  1BR4 A;  3AE5 A;  4DV2 T;  1LDK A;  2XAH B;  5JR9 B;  5CB4 E;  1OWA A;  5HXR A;  2UUA T;  3N9P A;  2OA5 A;  2X0L B;  5HEJ A;  4DID B;  1Y64 B;  2W66 A;  3Q5W A;  4LML A;  2WY2 A;  2CBJ A;  1E1H B;  4QHO A;  3O1H A;  3SRZ A;  3Q9D A;  4UEL A;  2V7K A;  3CPZ A;  2D0U A;  2XUE A;  4ZZB A;  2JPF A;  4IDN A;  2XQ6 A;  4DR1 T;  2YU1 A;  4DV5 T;  1WYB A;  3M65 A;  1UX5 A;  3EHZ A;  5AQR B;  4L5G A;  4AQG A;  2WWU A;  5AQP B;  4O4L E;  1MMG A;  2XSB A;  3VKG A;  1UX4 A;  3IEE A;  2XTL A;  2WAU A;  3BQL A;  4OHF A;  4HE8 A;  3RIA A;  4PFO A;  3NBX X;  3EAM A;  1R8I A;  2K9A A;  3N9Q A;  1M7K A;  3CK6 A;  2ZM6 T;  2X9W A;  2KXP B;  3Q5X A;  2XQY A;  3RRC A;  2E8I A;  3RYF E;  3UUL A;  2N1G A;  4X64 T;  3JAE A;  3RIF A;  4AQY T;  1H7C A;  4LF7 T;  3RYC E;  4LF4 T;  4JEH B;  4U33 A;  3MK7 C;  4BA9 A;  2XQ7 A;  1WR0 A;  1KF6 A;  3FZH B;  4DUY T;  2X9H A;  2ZMA A;  4HN9 A;  4PJJ A;  4I50 E;  4Z8X A;  5AQI B;  3E22 E;  2W2U A;  2E5V A;  3GN5 A;  4F6R C;  4HFI A;  2IC9 A;  2Y6X A;  2BG9 C;  3OTO T;  2UUC T;  4J2C A;  1IBL T;  1HS7 A;  5FY1 A;  3P50 A;  4U72 A;  2W67 A;  4E7Z A;  5JR9 C;  3ZMZ B;  2J47 A;  2MYS A;  3HKD E;  2XPK A;  1IAP A;  2XQ3 A;  2BS4 A;  1Y01 A;  2E9X B;  5LHI B;  1XDO A;  2BKP A;  2NW8 A;  4IRE A;  2FBW A;  5L3G B;  4GKJ T;  2BBH A;  2Q9Q C;  4PJM A;  3ZMS B;  3NVO A;  2K48 A;  1L0V A;  3SFD A;  3FZM B;  4O4H E;  5AQS B;  2LSY A;  5IYZ E;  4I4T E;  4K0U A;  5LJM A;  1AJ3 A;  2CPT A;  3ZEF B;  3UTK A;  2PG8 A;  2WZI A;  2Y48 B;  5JDQ A;  2M67 A;  3UUX B;  5AQL B;  2A3D A;  1OED E;  4OYK A;  4IE5 A;  3Q5E A;  2IUB A;  2W63 A;  4H9Q C;  4JI7 T;  2A9U A;  3Q2M A;  2LSI A;  3KV6 A;  2WZH A;  1E7P A;  5AQF B;  5FXZ A;  3ZSS A;  2MPK A;  2IW5 B;  2VKO A;  5KXJ A;  5H6Q B;  5HXC A;  5JVD E;  5HEH A;  3RIU A;  4UR9 A;  5AQV B;  4OFZ A;  4ISS A;  4P0B A;  2BDE A;  2AE9 A;  5HXE A;  4X5T A;  3MXZ A;  1DU2 A;  2LJL A;  3B13 A;  3PUS A;  4CN1 A;  3N5L A;  3IHR A;  3QB5 A;  3V5U A;  3RH3 A;  3P4S A;  2WS3 A;  5HEO A;  2NTX A;  2A2F X;  3AE9 A;  4JI8 T;  3CWZ B;  5AQO B;  2KSR A;  3LK2 B;  3OYX A;  2BS3 A;  3BQK A;  4QX8 B;  1CUN A;  5A1L A;  3C98 B;  4BJM A;  5J0Z A;  3ANW B;  2QGS A;  1MIW A;  2DWK A;  4JI2 T;  5DQV A;  5C3J A;  5LCY A;  4IL4 A;  4KUM B;  4UXN B;  3KBT A;  3QUJ A;  5LGN B;  2BKN A;  3ZLI A;  2EHO B;  4P0A A;  3AVR A;  4U74 A;  4F52 A;  1YQ3 A;  4HFC A;  3FBZ A;  4YTM A;  5L3C B;  4X66 T;  5HEU A;  3ONX A;  2HH7 A;  4AKH A;  3RKO A;  5LB7 B;  2UXB T;  5HEG A;  2KT9 A;  2BG9 A;  5DJQ C;  5FY0 A; 
#chains in the Genus database with same CATH homology
 2Z6E A;  2CWY A;  2PFV A;  2J1D G;  4IGU A;  5JRE A;  3CX8 B;  2JRK A;  1S94 A;  3N9N A;  3UUN A;  3PUR A;  5ADX L;  3ZCJ A;  1WLX A;  3CML A;  5BMV E;  4CXX A;  3K3O A;  2XAG B;  3JC6 C;  2LE8 A;  3AAI A;  4HGA A;  3MJX A;  4GK0 E;  3OBV E;  4JEU B;  5JR9 A;  3E0Z A;  4L0R A;  1LKX A;  3DJB A;  3RYH E;  2CWO A;  4ILU A;  1YD8 G;  3HKC E;  2NW9 A;  1HFA A;  4YJ3 E;  1SHZ C;  3SOL A;  3ZPO A;  1QSD A;  4UVB B;  2ZM8 A;  3C4W A;  3OKQ A;  4DBR A;  3N2G E;  3CQC B;  4AQF C;  3LG7 A;  4L9I A;  2BVL A;  4ZI2 D;  3K8P C;  2BZB A;  3R84 B;  5CA1 E;  3KV9 A;  2X66 A;  3RPU A;  4CXY A;  2WM9 A;  5GON E;  2LOS A;  5HXH A;  3ZC0 A;  3ETU A;  4UVA B;  1FMV A;  5JDL A;  3ZMV B;  2JQQ A;  5LXT E;  3HKE E;  4OYJ A;  2ES0 A;  1SA0 E;  5FYM A;  5J2U E;  3OYZ A;  3WAJ A;  3LK3 B;  1NWM X;  4H9N C;  4AKG A;  2UXN B;  3H37 A;  5LGT B;  3T8O A;  2NOX A;  3FHN A;  1BR4 A;  1S35 A;  2CEA A;  2VKH A;  4UV9 B;  3AA6 B;  2XAH B;  2VWA A;  2JMK A;  4OK0 A;  2XAF B;  3RX6 A;  5JR9 B;  5HWX A;  5JDH A;  3PUA A;  2XAJ B;  3EUH A;  4I55 E;  5CB4 E;  5AFU L;  1OWA A;  1FEW A;  2W00 A;  5HXR A;  2V26 A;  3N9P A;  4ZI2 C;  4AKI A;  5FXV A;  5EK4 A;  5EZY E;  2OA5 A;  1VOM A;  1HF8 A;  2H3R A;  3QC9 A;  2H7O A;  2CXD A;  2X0L B;  2YU2 A;  3NZP A;  4ASK A;  3C64 A;  1Y64 B;  3Q5W A;  3RYI E;  2ODV A;  2X51 A;  5LG4 A;  3ZMT B;  1LVK A;  2CA5 A;  2I59 A;  2V7L A;  3HI2 A;  5HWY A;  3KBU A;  4CI2 B;  4YFS A;  2CLY B;  4XZC A;  1E1H B;  4X20 E;  3DTO A;  3W15 B;  4AQF A;  4DO0 A;  3QK6 A;  4G2A A;  4QHO A;  3AA7 B;  3UT5 E;  4H9R C;  3GWH A;  3O1H A;  3L3P A;  3SRZ A;  3D0T A;  2P9B A;  3B57 A;  3Q9D A;  2N2N A;  4UEL A;  2V7K A;  4ZS3 A;  2LHR A;  1WYC A;  3CPZ A;  4IE6 A;  5DAB A;  4X1I E;  2D0U A;  5JDM A;  2XUE A;  3L09 A;  4HKA A;  5JH7 E;  2LHN A;  2SPC A;  2VKD A;  4M1P A;  1WRD A;  2X67 A;  2QA7 A;  2JPF A;  3NRY A;  2E9X D;  3C4X A;  4TZ4 C;  3A5X A;  4GYS A;  3ESL A;  2YU1 A;  1G73 A;  4DVD A;  2NWB A;  2DHR A;  4EOZ B;  3HKB E;  1WYB A;  3M65 A;  5LJN A;  2DCF A;  1UX5 A;  4FJO A;  3I1A A;  4PW8 A;  2LSJ A;  4AKR B;  3ZMU B;  3O1I A;  3K3N A;  4L5G A;  1HTJ F;  5LOV E;  4AQG A;  4JUY A;  1D0X A;  2WWU A;  2C5I T;  4EYY R;  5HAX A;  1YKH B;  3AVS A;  1KK7 A;  4PAG A;  5F8P A;  3KFW X;  4ZHQ E;  4O4L E;  4ZS2 A;  1UCU A;  1ZHC A;  3MKD A;  1MMG A;  5JQG E;  2UXX B;  2WMN A;  3S4U A;  2DI4 A;  2K5B B;  5FNV E;  4O2B E;  5L3D B;  4QXC B;  3VKG A;  4CQI A;  1UX4 A;  3IEE A;  3KV4 A;  2E9X C;  2XTL A;  2WAU A;  3BQL A;  4OHF A;  1O3X A;  4WNK A;  3CKD A;  3N2K E;  4HE8 A;  3BK9 A;  4GIW A;  4QWN B;  4UF0 A;  4PFO A;  3NBX X;  3J9X 1;  5EK2 A;  2EHO C;  2K9A A;  2X68 A;  3N9Q A;  3WAK A;  4MFR A;  3MAC A;  3J7Y q;  1D1B A;  3F57 A;  3O4X E;  2X9W A;  2KXP B;  3Q5X A;  2XQY A;  5J1G A;  3RRC A;  3SS1 A;  2VAS A;  2E8I A;  3ZJ2 A;  3PE0 A;  3RYF E;  3UUL A;  2BVM A;  3BQI A;  2N1G A;  2W0G A;  2KZ7 B;  4MLK A;  3IF8 B;  1YW0 A;  3N9L A;  5L2L A;  4CXW A;  3SWH A;  2N9D A;  1H7C A;  3FXD B;  2DLR A;  2KND A;  4WW0 A;  4H63 H;  2H7V C;  1MMN A;  3RYC E;  2C5K T;  3VU7 H;  4KMC A;  1HG5 A;  2DWG A;  3EDU A;  4JEH B;  5LGU B;  2VKJ A;  3MK7 C;  2X9Y A;  4QXB B;  4BA9 A;  5HXS A;  1T98 A;  4UF0 B;  2C5J A;  2V1D B;  3FXE B;  3C50 A;  2JJ9 A;  2LM9 A;  2X9H A;  2KWH A;  2X9X A;  4TN7 B;  1FIO A;  2CCQ A;  4FI5 A;  4GYR A;  2CMR A;  2ZMA A;  3LFM A;  4A56 A;  4HN9 A;  1NAF A;  3ZCI A;  4PJJ A;  4CI3 B;  4NUV A;  1IZN B;  4I50 E;  4KBM B;  4IE0 A;  4NUU A;  3HR0 A;  4Z8X A;  3P8C D;  4JLE A;  3E22 E;  3NRX A;  2CM0 A;  2E9X A;  3GN5 A;  4F6R C;  3H3A A;  2KMF A;  2CE7 A;  3DP7 A;  2IC9 A;  2WSS V;  2DNX A;  2IAK A;  2LSK A;  2WBL A;  4E7S A;  3ZN0 B;  2Y6X A;  4DMW A;  2LT3 A;  2Q9Q D;  3EDV A;  4J2C A;  1HS7 A;  5FY1 A;  5FP3 A;  4EZH A;  1EZ3 A;  1X79 A;  4X1Y E;  2D5U A;  4O2A E;  3F2E A;  2VB6 A;  3CQG B;  3HL6 A;  4U72 A;  3UFE A;  1BR1 A;  4TX5 A;  4UEM A;  5M4Y A;  4E7Z A;  5JR9 C;  3ZMZ B;  3O9X A;  3I0Q A;  2MYS A;  4AKL A;  3VKH A;  2HPJ A;  3HKD E;  5LHH B;  3I9Y A;  1IAP A;  3PUQ A;  1D1C A;  4C91 A;  3OJA A;  4PNI A;  4DND A;  4BJN A;  3CX6 B;  1US7 B;  3KDS E;  3N9O A;  2K24 A;  4GK5 E;  1VRB A;  2E9X B;  5LHI B;  3GN5 B;  2YIN A;  2NW8 A;  3C51 A;  4PJL A;  3UUM A;  4EZ4 A;  2D0T A;  4PFP A;  4IE4 A;  5J2T E;  4ANJ A;  2EHO D;  5L3G B;  3NZQ A;  2VL8 A;  1BR2 A;  2Q9Q C;  4PJM A;  1ZEE A;  3ZYM A;  2NP9 A;  3ZMS B;  4EIW A;  2K48 A;  2LEH A;  4UVC B;  3U3I A;  4CI1 B;  3AB3 B;  4V1A v;  2HPL A;  4PK4 A;  1HG2 A;  4O4H E;  5JRC A;  2LSY A;  5IYZ E;  3RC3 A;  3TKL B;  4I4T E;  3ZJ1 A;  5KX5 E;  4XBF B;  3PUG A;  1LRZ A;  2XU0 A;  4K0U A;  5HYA A;  5LJM A;  1AJ3 A;  3I9W A;  3ZEF B;  3UTK A;  2C0S A;  1LVF A;  3HA4 A;  4WBN E;  3GA8 A;  2KLQ A;  2PG8 A;  3AAA B;  5FXX A;  2Y48 B;  1KNZ A;  3IBP A;  5EK3 A;  5LA6 E;  3ZYK A;  5JDQ A;  3CQX C;  4EYU A;  2M67 A;  3UUX B;  1D0Y A;  2A3D A;  1U4Q A;  3GMI A;  2MBG A;  4CZZ B;  4OYK A;  4P09 A;  2YK0 A;  3LJC A;  2ZLY A;  3EVY A;  5LNK A;  4O4J E;  4IE5 A;  5L3E B;  5JDG A;  1IJ6 A;  2V7J A;  4IE7 A;  5L3F B;  3ZC1 A;  2CXL A;  4I43 B;  2W63 A;  4H9Q C;  5JDN A;  3Q2M A;  2LSI A;  2PBI A;  4EAH A;  3KV6 A;  3KV5 A;  4B6X A;  4N78 D;  4AXP A;  5JRC B;  4H9O C;  5FMN A;  4QX7 B;  5FXZ A;  4AI6 A;  2KIN B;  2ACX A;  2PJQ A;  2RA1 A;  4UV8 B;  2IW5 B;  1B7T A;  3MA9 A;  4XAX B;  5L3B B;  3RC8 A;  4HEA A;  4WBO A;  1U5P A;  2VKO A;  5H6Q B;  3KIN B;  5HXC A;  3VHL A;  1FMW A;  5JVD E;  1QUU A;  4HTE A;  5KDM C;  3CVR A;  1MMA A;  4MBQ A;  2RP4 A;  4H9S E;  4OFZ A;  2Y8D A;  2KWI B;  2Q9Q A;  3PU3 A;  2ODU A;  2ZM2 A;  4ISS A;  1IJ5 A;  2D2S A;  4IDZ A;  3P7I A;  5H6R B;  3AA0 B;  4P0B A;  5LHG B;  1MNE A;  1YKE B;  4EB6 E;  3ZYL A;  5C8Y E;  2BDE A;  2XAQ B;  5DQW A;  5HXE A;  3ANW A;  3MXZ A;  3R6N A;  2LJL A;  3CX7 B;  2A72 A;  3F31 A;  3B13 A;  1MMD A;  4H9P C;  3U78 A;  4ZI3 D;  3PUS A;  1OXZ A;  2V7M A;  1Z0P A;  4DMV A;  2MOZ A;  2XAS B;  3O1J A;  3N5L A;  2YEV C;  4IST A;  4ADZ A;  2ZM0 A;  3AA1 B;  3IHR A;  2NTY A;  4ERR A;  3K3Q C;  5LBM A;  2WMO A;  3RH3 A;  1ZKE A;  3V5U A;  3ZN1 B;  1BR0 A;  1D0Z A;  3FB2 A;  3I0O A;  2NTX A;  4EXT A;  1HX8 A;  5KMG P;  4TV9 E;  3RRW A;  2A2F X;  1MIY A;  1MND A;  2EHO A;  4TUY E;  3KVB A;  5IHY A;  4YJ2 E;  3CWZ B;  2Q9Q B;  4PJN A;  4KP3 C;  3LK2 B;  2LSG A;  5TAO A;  2B1E A;  1MIV A;  3OYX A;  5LYJ E;  3BQK A;  5FXW A;  4QKN A;  4QX8 B;  3AAE B;  1CUN A;  2XHE B;  4IHJ E;  4YLH A;  5A1L A;  3C98 B;  4BJM A;  2L3L A;  3ANW B;  4MHC A;  4BAY B;  2LOP A;  2QGS A;  1MIW A;  2DWK A;  3ETV A;  4ZOL E;  5DQV A;  4ZI3 C;  4UIG A;  4DBQ A;  2W61 A;  3LBX A;  4QXH B;  4C90 A;  3PDY A;  3N9M A;  5ETW A;  4G63 A;  5FY7 A;  5F3J A;  5LCY A;  4KUM B;  4UXN B;  1HCI A;  3KBT A;  3QUJ A;  4MAL A;  5LBQ B;  2VK9 A;  5LGN B;  3PU8 A;  3ZLI A;  2L9Q A;  3C4Z A;  3N2O A;  3KVA A;  2EHO B;  4O8S A;  1WR6 A;  3JC6 D;  4X1K E;  4PK5 A;  4P0A A;  3AVR A;  2CXF A;  2V7I A;  4TV8 E;  5CA0 E;  2JMH A;  3WI3 A;  4U74 A;  1ZV4 X;  3MZK B;  1G8X A;  5JDF A;  3E08 A;  2G0U A;  2CLY C;  4O4I E;  1D1A A;  3FBZ A;  3LK4 2;  2NW7 A;  4GOU A;  3V5S A;  3FBL A;  4YHJ A;  5L3C B;  4HFV A;  2IC6 A;  2W62 A;  2L8K A;  3ONX A;  2HH7 A;  3PTR B;  3LBX B;  4AKH A;  2MTQ A;  3RKO A;  4H63 V;  5E0O A;  1V9D A;  2KT9 A;  5DJQ C;  4ZI7 E;  2GK9 A;  4PK6 A;  5FY0 A;  5LP6 E;  4IIJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...