5F3KA

X-ray crystallographic structure of htrap1 n-terminal domain-apo
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
205
Chain Sequence
QGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mitochondrial Hsp90 is a ligand-activated molecular chaperone coupling ATP binding to dimer closure through a coiled-coil intermediate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock protein 75 kDa, mitochondrial
total genus 67
structure length 205
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5f3kA00
2HCHA 2XDXA 2YI7A 2ZBKB 4GGLA 2EXLA 4QPKA 2XJXA 4KFGA 3ZM7A 2QFOA 4URLA 2YE6A 3CGYA 3R92A 3MNRP 4CWPA 5M4MA 1UYKA 4B7PA 4LWEA 1TH8A 3WQ9A 4XITA 2XDKA 3VADA 2IOQA 5IDJA 4NH7A 4W7TA 2ESAA 2YE8A 1ZXNA 1BKNA 3HYZA 3VHAA 5J71A 2IWXA 3HZ1A 4GFNA 2YEFA 3EHFA 5BODA 4KSHA 3B25A 1Z59A 4WUCA 4CE2A 1TIDA 5CTUA 1YT0A 2BU7A 3Q5KA 1TILA 3T10A 4CE1A 3BM9A 4WUDA 1YS3A 5CF0A 2YJXA 3TZ4A 2WI2A 2XHXA 3U67A 4CWTA 1YSZA 2BU8A 4YKWA 3Q5LA 1PVGA 4EGIA 3CWVA 4R1FA 4BQJA 1Y8OA 3QTFA 3EKOA 5M4PA 2WI5A 3OPDA 3OWBA 4JASA 1QZRA 1BGQA 2HG1A 2WI1A 4LP0A 3CGZA 4XIRA 4XE2A 3SL2A 4L8ZA 4E00A 2WEPA 3O2FA 2YEAA 5D7RA 5CTXA 3K98A 3BMYA 2YGEA 1Y4UA 4V25A 4FPPA 4CWNA 4L90A 3IEDA 1I59A 2WI4A 4MP7A 2IWSA 3DGEA 1BXDA 1UYEA 4FMTA 4R3MA 4CWQA 4E01A 1NHIA 4WUBA 5IN9A 2CCSA 5J6AA 4O04A 2YGAA 4LWGA 4URNA 3K60A 3VHDA 3ZKBA 1YSRA 2XJGA 1ID0A 5L3JA 4ZVIA 3EHHA 4JAUA 1YERA 4MPEA 4FCPA 1AJ6A 4R3AA 5F3KA 5FNDA 1KIJA 1B62A 1NHJA 2XDSA 3H80A 4JQLA 4HXWA 4DZYA 3B26A 3RKZA 4KQVA 3R4MA 4LWHA 1I5BA 3HZ5A 3G7EA 4H81A 3G7BA 4O0BA 2YE2A 4UROA 1UYFA 5CTYA 3A0RA 3RLRA 5FWKA 1QYEA 2CG9A 4P7AA 1YC1A 4CWOA 2FYPA 4XKOA 1U0ZA 4ASBA 1UY7A 4HZ0A 4EGHA 2XJJA 4L94A 4GCZA 4MP2A 4O09A 1TBWA 1AMWA 4PL9A 1YT2A 2YEDA 1UY6A 2YEBA 1JM6A 4EFUA 3NMQA 5M4KA 2FXSA 4QPJA 4XC0A 2BYIA 2YEGA 1TC0A 2FWZA 3A0WA 3FT8A 5D7CA 4BQGA 2BTZA 2XX5A 2Q8GA 3G75A 1YETA 4Q20A 4AWQA 2Q8HA 3B24A 3T0ZA 2IOPA 1YC3A 3HHUA 4MBCA 4AS9A 1R62A 2YEJA 1I58A 2XCMA 3RLPA 1MU5A 3A0TA 4FCRA 2BU5A 4YKZA 2CCUA 3O6OA 1S14A 4P8OA 2YKBA 3GIGB 5F5RA 3Q5JA 2O1UA 4YKQA 3B28A 4LPBA 2AKPA 4MPCA 1UYHA 2YEHA 4GQTA 1US7A 4MB9A 1L0OA 1Y8PA 4XCJA 1KZNA 2BRCA 3OWDA 4EMVA 1B63A 4XD8A 2ZKJA 3PEHA 1GKZA 4YKYA 2YEEA 2YI6A 4HY6A 2Q2EB 4JAVA 3D0BA 4XCLA 4MOTA 4CWFA 2FWYA 2YKIA 2YK9A 2CCTA 4I3HA 2C2AA 1THNA 1EI1A 3OMUA 1AH6A 4GEEA 2YECA 3A0ZA 3D36A 4PU9A 1AM1A 2BU2A 4XIPA 1S16A 1UYDA 2JKIA 4HY1A 2IWUA 2IORA 4O07A 4U7NA 4AWPA 5C93A 3HEKA 3HYYA 3EKRA 3EHGA 4NH9A 4EGKA 3O0IA 1I5DA 5M4HA 5GGZA 4X9LA 4KTNA 1NHHA 4HZ5A 1Y4SA 4BAEA 3FV5A 3PEJA 1ZWHA 2HKJA 1YC4A 1OSFA 3RLQA 4YKRA 2YK2A 2XD6A 2VCJA 4U93A 3C11A 2BYHA 2QF6A 2YI0A 3LPSA 4ZKIA 4FCQA 1QY8A 3JZ3A 5IDMA 2WEQA 4BIUA 5FNFA 5CPHA 2O1WA 2VWCA 2QG0A 4ASGA 2ZDYA 4BIZA 1Z5AA 5M4NA 3VHCA 3U2KA 2YE5A 2XHTA 3FT5A 4I5SA 2BSMA 2Q8FA 2XK2A 4XIQA 1TC6A 2K5BA 3GIGA 1UYLA 1AH8A 4K4OA 5FNCA 3H4LA 4HXZA 3ZXOA 3ZKDA 4XTJA 4ASAA 3B27A 3K99A 2WI6A 4DUHA 4LWFA 4B6CA 1UYGA 1YT1A 4O05A 3ZXQA 3CRKA 4EEHA 2YKJA 3OW6A 2XX2A 4U7OA 4YKXA 4XKKA 1MX0A 4GT8A 4L91A 3TUHA 1H7UA 4URMA 1BYQA 2VW5A 2BT0A 4XKAA 3R91A 2GQPA 1A4HA 1B3QA 1EA6A 2UWDA 5D6QA 4EM7A 2O1VA 3TZ5A 2H55A 2BREA 2YE7A 3TTZA 1UY8A 2WERA 4H7QA 1I5CA 2YKCA 1YESA 1GKXA 4HYPA 3TZ0A 4PRVA 4ASFA 2YJWA 3TZ2A 3WHAA 1UY9A 3R4NA 4YKTA 4KSGA 3GIEA 1ZW9A 4XDMA 2XHRA 2YE9A 2WI3A 2PNRA 2YKEA 3A0YA 4CE3A 3T0HA 5CTWA 4AWOA 3LNUA 2H8MA 2VCIA 5BOCA 4H85A 4KP4A 5D6PA 4LWIA 1U2OA 2XABA 4NH8A 2QG2A 1UYMA 4L93A 2YE3A 3T2SA 4CWRA 2XDUA 1Z5CA 2XDLA 2E0AA 2Q8IA 5M4EA 2BU6A 1ZXMA 1I5AA 3EHJA 4HYMA 2BZ5A 3U2DA 3CRLA 4PRXA 4BXIA 1Z5BA 3KE6A 2JJCA 1H7SA 4E02A 3T1KA 1GJVA 2YEIA 3INWA 4YKUA 1UYCA 2WI7A 5D7DA 2CH4A 2ZDXA 3R4OA 3GIFA 3C0EA 3R4PA 3D2RA 4EFTA 2GFDA 3INXA 2XX4A 2YE4A 1Y8NA 4MPNA 4CWSA 3K97A 2CGFA 3QDDA 4V26A 2YGFA 1UYIA 2YI5A 3A0XA
chains in the Genus database with same CATH superfamily
2HCHA 2XDXA 2YI7A 2ZBKB 4GGLA 2EXLA 4QPKA 2XJXA 4KFGA 3ZM7A 2QFOA 4URLA 2YE6A 3CGYA 3R92A 3MNRP 4CWPA 5M4MA 1UYKA 4B7PA 4LWEA 1TH8A 3WQ9A 4XITA 2XDKA 3VADA 2IOQA 5IDJA 4NH7A 4W7TA 2ESAA 2YE8A 1ZXNA 5JENA 1BKNA 3HYZA 3VHAA 5J71A 2IWXA 3HZ1A 4GFNA 2YEFA 3EHFA 5BODA 4KSHA 3B25A 1Z59A 4WUCA 4CE2A 1TIDA 5CTUA 1YT0A 2BU7A 3Q5KA 1TILA 3T10A 4CE1A 3BM9A 4WUDA 1YS3A 5CF0A 2YJXA 3TZ4A 2WI2A 2XHXA 3U67A 4CWTA 1YSZA 2BU8A 4YKWA 3Q5LA 1PVGA 4EGIA 3CWVA 4R1FA 4BQJA 1Y8OA 3QTFA 3EKOA 5M4PA 2WI5A 3OPDA 3OWBA 4JASA 1QZRA 1BGQA 2HG1A 2WI1A 4LP0A 3CGZA 4XIRA 4XE2A 3SL2A 4L8ZA 4E00A 2WEPA 3O2FA 2YEAA 5D7RA 5CTXA 3K98A 3BMYA 2YGEA 1Y4UA 4V25A 4FPPA 4CWNA 4L90A 3IEDA 1I59A 2WI4A 4MP7A 2IWSA 3DGEA 1BXDA 1UYEA 4FMTA 4R3MA 1IXMA 4CWQA 4E01A 1NHIA 4WUBA 5IN9A 2CCSA 5J6AA 4O04A 2YGAA 4LWGA 4URNA 3K60A 3VHDA 3ZKBA 1YSRA 2XJGA 1ID0A 5L3JA 4ZVIA 3EHHA 4JAUA 1YERA 4MPEA 4FCPA 1AJ6A 4R3AA 5F3KA 5FNDA 1KIJA 1B62A 1NHJA 2XDSA 3H80A 4JQLA 4HXWA 1F51A 4DZYA 3B26A 3RKZA 4KQVA 3R4MA 4LWHA 1I5BA 3HZ5A 3G7EA 4H81A 3G7BA 4O0BA 2YE2A 4UROA 1UYFA 5CTYA 3A0RA 3RLRA 5FWKA 1QYEA 2CG9A 4P7AA 1YC1A 4CWOA 2FYPA 4XKOA 1U0ZA 4ASBA 1UY7A 4HZ0A 4EGHA 2XJJA 4L94A 4GCZA 4MP2A 4O09A 1TBWA 1AMWA 4PL9A 1YT2A 2YEDA 1UY6A 2YEBA 1JM6A 4EFUA 3NMQA 5M4KA 2FXSA 4QPJA 4XC0A 2BYIA 2YEGA 1TC0A 2FWZA 3A0WA 3FT8A 5D7CA 4BQGA 2BTZA 2XX5A 2Q8GA 3G75A 1YETA 4Q20A 4AWQA 2Q8HA 2C1IA 3B24A 3T0ZA 2IOPA 1YC3A 3HHUA 4MBCA 4AS9A 1R62A 2YEJA 1I58A 2XCMA 3RLPA 1MU5A 3A0TA 4FCRA 2BU5A 4YKZA 2CCUA 3O6OA 1S14A 4P8OA 2YKBA 3GIGB 5F5RA 3Q5JA 2O1UA 4YKQA 3B28A 4LPBA 2AKPA 4MPCA 1UYHA 2YEHA 4GQTA 1US7A 4MB9A 1L0OA 1Y8PA 4XCJA 1KZNA 2BRCA 3OWDA 4EMVA 1B63A 4XD8A 2ZKJA 3PEHA 1GKZA 4YKYA 2YEEA 2YI6A 2HHIA 4HY6A 2Q2EB 4JAVA 3D0BA 4XCLA 2C1GA 4MOTA 3LMMA 4CWFA 2FWYA 2YKIA 2YK9A 2CCTA 4I3HA 2C2AA 1THNA 1EI1A 3OMUA 1AH6A 4GEEA 2YECA 3A0ZA 3D36A 4PU9A 1AM1A 2BU2A 4XIPA 1S16A 1UYDA 2JKIA 4HY1A 2IWUA 2IORA 4O07A 4U7NA 4AWPA 5C93A 3HEKA 3HYYA 3EKRA 3EHGA 4NH9A 4EGKA 3O0IA 1I5DA 5M4HA 5GGZA 4X9LA 4KTNA 1NHHA 4HZ5A 1Y4SA 4BAEA 3FV5A 3PEJA 1ZWHA 2HKJA 1YC4A 1OSFA 3RLQA 4YKRA 2YK2A 2XD6A 2VCJA 4U93A 4E72A 3C11A 2BYHA 2QF6A 2YI0A 3LPSA 4ZKIA 4FCQA 1QY8A 3JZ3A 5IDMA 2WEQA 4BIUA 5FNFA 5CPHA 2O1WA 2VWCA 2QG0A 4ASGA 2ZDYA 4BIZA 1Z5AA 5M4NA 3VHCA 3U2KA 2YE5A 2XHTA 3FT5A 4I5SA 2BSMA 2Q8FA 2XK2A 4XIQA 1TC6A 2K5BA 3GIGA 1UYLA 1AH8A 4K4OA 5FNCA 3S5TA 3H4LA 4HXZA 3ZXOA 3ZKDA 4XTJA 4ASAA 3B27A 3K99A 2WI6A 4DUHA 4LWFA 4B6CA 1UYGA 1YT1A 4O05A 3ZXQA 3CRKA 4EEHA 2YKJA 3OW6A 2XX2A 4U7OA 4YKXA 4XKKA 1MX0A 4GT8A 4L91A 3TUHA 1H7UA 4URMA 1BYQA 2VW5A 2BT0A 4XKAA 3R91A 2GQPA 1A4HA 1B3QA 1EA6A 2UWDA 5D6QA 4EM7A 2O1VA 3TZ5A 2H55A 2BREA 2YE7A 3TTZA 1UY8A 2WERA 4H7QA 1I5CA 2YKCA 1YESA 1GKXA 4HYPA 3TZ0A 4PRVA 4ASFA 2YJWA 3TZ2A 3WHAA 1UY9A 3R4NA 4YKTA 4KSGA 3GIEA 1ZW9A 4XDMA 2XHRA 2YE9A 2WI3A 2PNRA 2YKEA 3A0YA 4CE3A 3T0HA 3CYGA 2FTKA 5CTWA 4AWOA 3LNUA 2H8MA 2VCIA 5BOCA 4H85A 4KP4A 5D6PA 4LWIA 1U2OA 2XABA 4NH8A 2QG2A 1UYMA 4L93A 2YE3A 3T2SA 4CWRA 2XDUA 1Z5CA 2XDLA 2E0AA 2Q8IA 5M4EA 2BU6A 1ZXMA 1I5AA 3EHJA 4HYMA 2BZ5A 3U2DA 3CRLA 4PRXA 4BXIA 1Z5BA 3KE6A 2JJCA 1H7SA 4E02A 3T1KA 1GJVA 2YEIA 3INWA 4YKUA 1UYCA 2WI7A 5D7DA 2CH4A 2ZDXA 3R4OA 3GIFA 3C0EA 3R4PA 3D2RA 4EFTA 2GFDA 3INXA 2XX4A 2YE4A 1Y8NA 4MPNA 4CWSA 3K97A 2CGFA 3QDDA 4V26A 2YGFA 1UYIA 2YI5A 3A0XA
chains in the Genus database with same CATH topology
2HCHA 2XDXA 2YI7A 2ZBKB 4GGLA 2EXLA 4QPKA 2XJXA 4KFGA 3ZM7A 2QFOA 4URLA 2YE6A 3CGYA 3R92A 3MNRP 4CWPA 5M4MA 1UYKA 4B7PA 4LWEA 1TH8A 3WQ9A 4XITA 2XDKA 3VADA 2IOQA 5IDJA 4NH7A 4W7TA 2ESAA 2YE8A 1ZXNA 1BKNA 3HYZA 3VHAA 5J71A 2IWXA 3HZ1A 4GFNA 2YEFA 3EHFA 5BODA 4KSHA 3B25A 1Z59A 4WUCA 4CE2A 1TIDA 5CTUA 1YT0A 2BU7A 3Q5KA 1TILA 3T10A 4CE1A 3BM9A 4WUDA 1YS3A 5CF0A 2YJXA 3TZ4A 2WI2A 2XHXA 3U67A 4CWTA 1YSZA 2BU8A 4YKWA 3Q5LA 1PVGA 4EGIA 3CWVA 4R1FA 4BQJA 1Y8OA 3QTFA 3EKOA 5M4PA 2WI5A 3OPDA 3OWBA 4JASA 1QZRA 1BGQA 2HG1A 2WI1A 4LP0A 3CGZA 4XIRA 4XE2A 3SL2A 4L8ZA 4E00A 2WEPA 3O2FA 2YEAA 5D7RA 5CTXA 3K98A 3BMYA 2YGEA 1Y4UA 4V25A 4FPPA 4CWNA 4L90A 3IEDA 1I59A 2WI4A 4MP7A 2IWSA 3DGEA 1BXDA 1UYEA 4FMTA 4R3MA 4CWQA 4E01A 1NHIA 4WUBA 5IN9A 2CCSA 5J6AA 4O04A 2YGAA 4LWGA 4URNA 3K60A 3VHDA 3ZKBA 1YSRA 2XJGA 1ID0A 5L3JA 4ZVIA 3EHHA 4JAUA 1YERA 4MPEA 4FCPA 1AJ6A 4R3AA 5F3KA 5FNDA 1KIJA 1B62A 1NHJA 2XDSA 3H80A 4JQLA 4HXWA 4DZYA 3B26A 3RKZA 4KQVA 3R4MA 4LWHA 1I5BA 3HZ5A 3G7EA 4H81A 3G7BA 4O0BA 2YE2A 4UROA 1UYFA 5CTYA 3A0RA 3RLRA 5FWKA 1QYEA 2CG9A 4P7AA 1YC1A 4CWOA 2FYPA 4XKOA 1U0ZA 4ASBA 1UY7A 4HZ0A 4EGHA 2XJJA 4L94A 4GCZA 4MP2A 4O09A 1TBWA 1AMWA 4PL9A 1YT2A 2YEDA 1UY6A 2YEBA 1JM6A 4EFUA 3NMQA 5M4KA 2FXSA 4QPJA 4XC0A 2BYIA 2YEGA 1TC0A 2FWZA 3A0WA 3FT8A 5D7CA 4BQGA 2BTZA 2XX5A 2Q8GA 3G75A 1YETA 4Q20A 4AWQA 2Q8HA 3B24A 3T0ZA 2IOPA 1YC3A 3HHUA 4MBCA 4AS9A 1R62A 2YEJA 1I58A 2XCMA 3RLPA 1MU5A 3A0TA 4FCRA 2BU5A 4YKZA 2CCUA 3O6OA 1S14A 4P8OA 2YKBA 3GIGB 5F5RA 3Q5JA 2O1UA 4YKQA 3B28A 4LPBA 2AKPA 4MPCA 1UYHA 2YEHA 4GQTA 1US7A 4MB9A 1L0OA 1Y8PA 4XCJA 1KZNA 2BRCA 3OWDA 4EMVA 1B63A 4XD8A 2ZKJA 3PEHA 1GKZA 4YKYA 2YEEA 2YI6A 4HY6A 2Q2EB 4JAVA 3D0BA 4XCLA 4MOTA 4CWFA 2FWYA 2YKIA 2YK9A 2CCTA 4I3HA 2C2AA 1THNA 1EI1A 3OMUA 1AH6A 4GEEA 2YECA 3A0ZA 3D36A 4PU9A 1AM1A 2BU2A 4XIPA 1S16A 1UYDA 2JKIA 4HY1A 2IWUA 2IORA 4O07A 4U7NA 4AWPA 5C93A 3HEKA 3HYYA 3EKRA 3EHGA 4NH9A 4EGKA 3O0IA 1I5DA 5M4HA 5GGZA 4X9LA 4KTNA 1NHHA 4HZ5A 1Y4SA 4BAEA 3FV5A 3PEJA 1ZWHA 2HKJA 1YC4A 1OSFA 3RLQA 4YKRA 2YK2A 2XD6A 2VCJA 4U93A 3C11A 2BYHA 2QF6A 2YI0A 3LPSA 4ZKIA 4FCQA 1QY8A 3JZ3A 5IDMA 2WEQA 4BIUA 5FNFA 5CPHA 2O1WA 2VWCA 2QG0A 4ASGA 2ZDYA 4BIZA 1Z5AA 5M4NA 3VHCA 3U2KA 2YE5A 2XHTA 3FT5A 4I5SA 2BSMA 2Q8FA 2XK2A 4XIQA 1TC6A 2K5BA 3GIGA 1UYLA 1AH8A 4K4OA 5FNCA 3H4LA 4HXZA 3ZXOA 3ZKDA 4XTJA 4ASAA 3B27A 3K99A 2WI6A 4DUHA 4LWFA 4B6CA 1UYGA 1YT1A 4O05A 3ZXQA 3CRKA 4EEHA 2YKJA 3OW6A 2XX2A 4U7OA 4YKXA 4XKKA 1MX0A 4GT8A 4L91A 3TUHA 1H7UA 4URMA 1BYQA 2VW5A 2BT0A 4XKAA 3R91A 2GQPA 1A4HA 1B3QA 1EA6A 2UWDA 5D6QA 4EM7A 2O1VA 3TZ5A 2H55A 2BREA 2YE7A 3TTZA 1UY8A 2WERA 4H7QA 1I5CA 2YKCA 1YESA 1GKXA 4HYPA 3TZ0A 4PRVA 4ASFA 2YJWA 3TZ2A 3WHAA 1UY9A 3R4NA 4YKTA 4KSGA 3GIEA 1ZW9A 4XDMA 2XHRA 2YE9A 2WI3A 2PNRA 2YKEA 3A0YA 4CE3A 3T0HA 5CTWA 4AWOA 3LNUA 2H8MA 2VCIA 5BOCA 4H85A 4KP4A 5D6PA 4LWIA 1U2OA 2XABA 4NH8A 2QG2A 1UYMA 4L93A 2YE3A 3T2SA 4CWRA 2XDUA 1Z5CA 2XDLA 2E0AA 2Q8IA 5M4EA 2BU6A 1ZXMA 1I5AA 3EHJA 4HYMA 2BZ5A 3U2DA 3CRLA 4PRXA 4BXIA 1Z5BA 3KE6A 2JJCA 1H7SA 4E02A 3T1KA 1GJVA 2YEIA 3INWA 4YKUA 1UYCA 2WI7A 5D7DA 2CH4A 2ZDXA 3R4OA 3GIFA 3C0EA 3R4PA 3D2RA 4EFTA 2GFDA 3INXA 2XX4A 2YE4A 1Y8NA 4MPNA 4CWSA 3K97A 2CGFA 3QDDA 4V26A 2YGFA 1UYIA 2YI5A 3A0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCH A;  2XDX A;  2YI7 A;  2ZBK B;  4GGL A;  2EXL A;  4QPK A;  2XJX A;  4KFG A;  3ZM7 A;  2QFO A;  4URL A;  2YE6 A;  3CGY A;  3R92 A;  3MNR P;  4CWP A;  5M4M A;  1UYK A;  4B7P A;  4LWE A;  1TH8 A;  3WQ9 A;  4XIT A;  2XDK A;  3VAD A;  2IOQ A;  5IDJ A;  4NH7 A;  4W7T A;  2ESA A;  2YE8 A;  1ZXN A;  1BKN A;  3HYZ A;  3VHA A;  5J71 A;  2IWX A;  3HZ1 A;  4GFN A;  2YEF A;  3EHF A;  5BOD A;  4KSH A;  3B25 A;  1Z59 A;  4WUC A;  4CE2 A;  1TID A;  5CTU A;  1YT0 A;  2BU7 A;  3Q5K A;  1TIL A;  3T10 A;  4CE1 A;  3BM9 A;  4WUD A;  1YS3 A;  5CF0 A;  2YJX A;  3TZ4 A;  2WI2 A;  2XHX A;  3U67 A;  4CWT A;  1YSZ A;  2BU8 A;  4YKW A;  3Q5L A;  1PVG A;  4EGI A;  3CWV A;  4R1F A;  4BQJ A;  1Y8O A;  3QTF A;  3EKO A;  5M4P A;  2WI5 A;  3OPD A;  3OWB A;  4JAS A;  1QZR A;  1BGQ A;  2HG1 A;  2WI1 A;  4LP0 A;  3CGZ A;  4XIR A;  4XE2 A;  3SL2 A;  4L8Z A;  4E00 A;  2WEP A;  3O2F A;  2YEA A;  5D7R A;  5CTX A;  3K98 A;  3BMY A;  2YGE A;  1Y4U A;  4V25 A;  4FPP A;  4CWN A;  4L90 A;  3IED A;  1I59 A;  2WI4 A;  4MP7 A;  2IWS A;  3DGE A;  1BXD A;  1UYE A;  4FMT A;  4R3M A;  4CWQ A;  4E01 A;  1NHI A;  4WUB A;  5IN9 A;  2CCS A;  5J6A A;  4O04 A;  2YGA A;  4LWG A;  4URN A;  3K60 A;  3VHD A;  3ZKB A;  1YSR A;  2XJG A;  1ID0 A;  5L3J A;  4ZVI A;  3EHH A;  4JAU A;  1YER A;  4MPE A;  4FCP A;  1AJ6 A;  4R3A A;  5F3K A;  5FND A;  1KIJ A;  1B62 A;  1NHJ A;  2XDS A;  3H80 A;  4JQL A;  4HXW A;  4DZY A;  3B26 A;  3RKZ A;  4KQV A;  3R4M A;  4LWH A;  1I5B A;  3HZ5 A;  3G7E A;  4H81 A;  3G7B A;  4O0B A;  2YE2 A;  4URO A;  1UYF A;  5CTY A;  3A0R A;  3RLR A;  5FWK A;  1QYE A;  2CG9 A;  4P7A A;  1YC1 A;  4CWO A;  2FYP A;  4XKO A;  1U0Z A;  4ASB A;  1UY7 A;  4HZ0 A;  4EGH A;  2XJJ A;  4L94 A;  4GCZ A;  4MP2 A;  4O09 A;  1TBW A;  1AMW A;  4PL9 A;  1YT2 A;  2YED A;  1UY6 A;  2YEB A;  1JM6 A;  4EFU A;  3NMQ A;  5M4K A;  2FXS A;  4QPJ A;  4XC0 A;  2BYI A;  2YEG A;  1TC0 A;  2FWZ A;  3A0W A;  3FT8 A;  5D7C A;  4BQG A;  2BTZ A;  2XX5 A;  2Q8G A;  3G75 A;  1YET A;  4Q20 A;  4AWQ A;  2Q8H A;  3B24 A;  3T0Z A;  2IOP A;  1YC3 A;  3HHU A;  4MBC A;  4AS9 A;  1R62 A;  2YEJ A;  1I58 A;  2XCM A;  3RLP A;  1MU5 A;  3A0T A;  4FCR A;  2BU5 A;  4YKZ A;  2CCU A;  3O6O A;  1S14 A;  4P8O A;  2YKB A;  3GIG B;  5F5R A;  3Q5J A;  2O1U A;  4YKQ A;  3B28 A;  4LPB A;  2AKP A;  4MPC A;  1UYH A;  2YEH A;  4GQT A;  1US7 A;  4MB9 A;  1L0O A;  1Y8P A;  4XCJ A;  1KZN A;  2BRC A;  3OWD A;  4EMV A;  1B63 A;  4XD8 A;  2ZKJ A;  3PEH A;  1GKZ A;  4YKY A;  2YEE A;  2YI6 A;  4HY6 A;  2Q2E B;  4JAV A;  3D0B A;  4XCL A;  4MOT A;  4CWF A;  2FWY A;  2YKI A;  2YK9 A;  2CCT A;  4I3H A;  2C2A A;  1THN A;  1EI1 A;  3OMU A;  1AH6 A;  4GEE A;  2YEC A;  3A0Z A;  3D36 A;  4PU9 A;  1AM1 A;  2BU2 A;  4XIP A;  1S16 A;  1UYD A;  2JKI A;  4HY1 A;  2IWU A;  2IOR A;  4O07 A;  4U7N A;  4AWP A;  5C93 A;  3HEK A;  3HYY A;  3EKR A;  3EHG A;  4NH9 A;  4EGK A;  3O0I A;  1I5D A;  5M4H A;  5GGZ A;  4X9L A;  4KTN A;  1NHH A;  4HZ5 A;  1Y4S A;  4BAE A;  3FV5 A;  3PEJ A;  1ZWH A;  2HKJ A;  1YC4 A;  1OSF A;  3RLQ A;  4YKR A;  2YK2 A;  2XD6 A;  2VCJ A;  4U93 A;  3C11 A;  2BYH A;  2QF6 A;  2YI0 A;  3LPS A;  4ZKI A;  4FCQ A;  1QY8 A;  3JZ3 A;  5IDM A;  2WEQ A;  4BIU A;  5FNF A;  5CPH A;  2O1W A;  2VWC A;  2QG0 A;  4ASG A;  2ZDY A;  4BIZ A;  1Z5A A;  5M4N A;  3VHC A;  3U2K A;  2YE5 A;  2XHT A;  3FT5 A;  4I5S A;  2BSM A;  2Q8F A;  2XK2 A;  4XIQ A;  1TC6 A;  2K5B A;  3GIG A;  1UYL A;  1AH8 A;  4K4O A;  5FNC A;  3H4L A;  4HXZ A;  3ZXO A;  3ZKD A;  4XTJ A;  4ASA A;  3B27 A;  3K99 A;  2WI6 A;  4DUH A;  4LWF A;  4B6C A;  1UYG A;  1YT1 A;  4O05 A;  3ZXQ A;  3CRK A;  4EEH A;  2YKJ A;  3OW6 A;  2XX2 A;  4U7O A;  4YKX A;  4XKK A;  1MX0 A;  4GT8 A;  4L91 A;  3TUH A;  1H7U A;  4URM A;  1BYQ A;  2VW5 A;  2BT0 A;  4XKA A;  3R91 A;  2GQP A;  1A4H A;  1B3Q A;  1EA6 A;  2UWD A;  5D6Q A;  4EM7 A;  2O1V A;  3TZ5 A;  2H55 A;  2BRE A;  2YE7 A;  3TTZ A;  1UY8 A;  2WER A;  4H7Q A;  1I5C A;  2YKC A;  1YES A;  1GKX A;  4HYP A;  3TZ0 A;  4PRV A;  4ASF A;  2YJW A;  3TZ2 A;  3WHA A;  1UY9 A;  3R4N A;  4YKT A;  4KSG A;  3GIE A;  1ZW9 A;  4XDM A;  2XHR A;  2YE9 A;  2WI3 A;  2PNR A;  2YKE A;  3A0Y A;  4CE3 A;  3T0H A;  5CTW A;  4AWO A;  3LNU A;  2H8M A;  2VCI A;  5BOC A;  4H85 A;  4KP4 A;  5D6P A;  4LWI A;  1U2O A;  2XAB A;  4NH8 A;  2QG2 A;  1UYM A;  4L93 A;  2YE3 A;  3T2S A;  4CWR A;  2XDU A;  1Z5C A;  2XDL A;  2E0A A;  2Q8I A;  5M4E A;  2BU6 A;  1ZXM A;  1I5A A;  3EHJ A;  4HYM A;  2BZ5 A;  3U2D A;  3CRL A;  4PRX A;  4BXI A;  1Z5B A;  3KE6 A;  2JJC A;  1H7S A;  4E02 A;  3T1K A;  1GJV A;  2YEI A;  3INW A;  4YKU A;  1UYC A;  2WI7 A;  5D7D A;  2CH4 A;  2ZDX A;  3R4O A;  3GIF A;  3C0E A;  3R4P A;  3D2R A;  4EFT A;  2GFD A;  3INX A;  2XX4 A;  2YE4 A;  1Y8N A;  4MPN A;  4CWS A;  3K97 A;  2CGF A;  3QDD A;  4V26 A;  2YGF A;  1UYI A;  2YI5 A;  3A0X A; 
#chains in the Genus database with same CATH topology
 2HCH A;  2XDX A;  2YI7 A;  2ZBK B;  4GGL A;  2EXL A;  4QPK A;  2XJX A;  4KFG A;  3ZM7 A;  2QFO A;  4URL A;  2YE6 A;  3CGY A;  3R92 A;  3MNR P;  4CWP A;  5M4M A;  1UYK A;  4B7P A;  4LWE A;  1TH8 A;  3WQ9 A;  4XIT A;  2XDK A;  3VAD A;  2IOQ A;  5IDJ A;  4NH7 A;  4W7T A;  2ESA A;  2YE8 A;  1ZXN A;  5JEN A;  1BKN A;  3HYZ A;  3VHA A;  5J71 A;  2IWX A;  3HZ1 A;  4GFN A;  2YEF A;  3EHF A;  5BOD A;  4KSH A;  3B25 A;  1Z59 A;  4WUC A;  4CE2 A;  1TID A;  5CTU A;  1YT0 A;  2BU7 A;  3Q5K A;  1TIL A;  3T10 A;  4CE1 A;  3BM9 A;  4WUD A;  1YS3 A;  5CF0 A;  2YJX A;  3TZ4 A;  2WI2 A;  2XHX A;  3U67 A;  4CWT A;  1YSZ A;  2BU8 A;  4YKW A;  3Q5L A;  1PVG A;  4EGI A;  3CWV A;  4R1F A;  4BQJ A;  1Y8O A;  3QTF A;  3EKO A;  5M4P A;  2WI5 A;  3OPD A;  3OWB A;  4JAS A;  1QZR A;  1BGQ A;  2HG1 A;  2WI1 A;  4LP0 A;  3CGZ A;  4XIR A;  4XE2 A;  3SL2 A;  4L8Z A;  4E00 A;  2WEP A;  3O2F A;  2YEA A;  5D7R A;  5CTX A;  3K98 A;  3BMY A;  2YGE A;  1Y4U A;  4V25 A;  4FPP A;  4CWN A;  4L90 A;  3IED A;  1I59 A;  2WI4 A;  4MP7 A;  2IWS A;  3DGE A;  1BXD A;  1UYE A;  4FMT A;  4R3M A;  1IXM A;  4CWQ A;  4E01 A;  1NHI A;  4WUB A;  5IN9 A;  2CCS A;  5J6A A;  4O04 A;  2YGA A;  4LWG A;  4URN A;  3K60 A;  3VHD A;  3ZKB A;  1YSR A;  2XJG A;  1ID0 A;  5L3J A;  4ZVI A;  3EHH A;  4JAU A;  1YER A;  4MPE A;  4FCP A;  1AJ6 A;  4R3A A;  5F3K A;  5FND A;  1KIJ A;  1B62 A;  1NHJ A;  2XDS A;  3H80 A;  4JQL A;  4HXW A;  1F51 A;  4DZY A;  3B26 A;  3RKZ A;  4KQV A;  3R4M A;  4LWH A;  1I5B A;  3HZ5 A;  3G7E A;  4H81 A;  3G7B A;  4O0B A;  2YE2 A;  4URO A;  1UYF A;  5CTY A;  3A0R A;  3RLR A;  5FWK A;  1QYE A;  2CG9 A;  4P7A A;  1YC1 A;  4CWO A;  2FYP A;  4XKO A;  1U0Z A;  4ASB A;  1UY7 A;  4HZ0 A;  4EGH A;  2XJJ A;  4L94 A;  4GCZ A;  4MP2 A;  4O09 A;  1TBW A;  1AMW A;  4PL9 A;  1YT2 A;  2YED A;  1UY6 A;  2YEB A;  1JM6 A;  4EFU A;  3NMQ A;  5M4K A;  2FXS A;  4QPJ A;  4XC0 A;  2BYI A;  2YEG A;  1TC0 A;  2FWZ A;  3A0W A;  3FT8 A;  5D7C A;  4BQG A;  2BTZ A;  2XX5 A;  2Q8G A;  3G75 A;  1YET A;  4Q20 A;  4AWQ A;  2Q8H A;  2C1I A;  3B24 A;  3T0Z A;  2IOP A;  1YC3 A;  3HHU A;  4MBC A;  4AS9 A;  1R62 A;  2YEJ A;  1I58 A;  2XCM A;  3RLP A;  1MU5 A;  3A0T A;  4FCR A;  2BU5 A;  4YKZ A;  2CCU A;  3O6O A;  1S14 A;  4P8O A;  2YKB A;  3GIG B;  5F5R A;  3Q5J A;  2O1U A;  4YKQ A;  3B28 A;  4LPB A;  2AKP A;  4MPC A;  1UYH A;  2YEH A;  4GQT A;  1US7 A;  4MB9 A;  1L0O A;  1Y8P A;  4XCJ A;  1KZN A;  2BRC A;  3OWD A;  4EMV A;  1B63 A;  4XD8 A;  2ZKJ A;  3PEH A;  1GKZ A;  4YKY A;  2YEE A;  2YI6 A;  2HHI A;  4HY6 A;  2Q2E B;  4JAV A;  3D0B A;  4XCL A;  2C1G A;  4MOT A;  3LMM A;  4CWF A;  2FWY A;  2YKI A;  2YK9 A;  2CCT A;  4I3H A;  2C2A A;  1THN A;  1EI1 A;  3OMU A;  1AH6 A;  4GEE A;  2YEC A;  3A0Z A;  3D36 A;  4PU9 A;  1AM1 A;  2BU2 A;  4XIP A;  1S16 A;  1UYD A;  2JKI A;  4HY1 A;  2IWU A;  2IOR A;  4O07 A;  4U7N A;  4AWP A;  5C93 A;  3HEK A;  3HYY A;  3EKR A;  3EHG A;  4NH9 A;  4EGK A;  3O0I A;  1I5D A;  5M4H A;  5GGZ A;  4X9L A;  4KTN A;  1NHH A;  4HZ5 A;  1Y4S A;  4BAE A;  3FV5 A;  3PEJ A;  1ZWH A;  2HKJ A;  1YC4 A;  1OSF A;  3RLQ A;  4YKR A;  2YK2 A;  2XD6 A;  2VCJ A;  4U93 A;  4E72 A;  3C11 A;  2BYH A;  2QF6 A;  2YI0 A;  3LPS A;  4ZKI A;  4FCQ A;  1QY8 A;  3JZ3 A;  5IDM A;  2WEQ A;  4BIU A;  5FNF A;  5CPH A;  2O1W A;  2VWC A;  2QG0 A;  4ASG A;  2ZDY A;  4BIZ A;  1Z5A A;  5M4N A;  3VHC A;  3U2K A;  2YE5 A;  2XHT A;  3FT5 A;  4I5S A;  2BSM A;  2Q8F A;  2XK2 A;  4XIQ A;  1TC6 A;  2K5B A;  3GIG A;  1UYL A;  1AH8 A;  4K4O A;  5FNC A;  3S5T A;  3H4L A;  4HXZ A;  3ZXO A;  3ZKD A;  4XTJ A;  4ASA A;  3B27 A;  3K99 A;  2WI6 A;  4DUH A;  4LWF A;  4B6C A;  1UYG A;  1YT1 A;  4O05 A;  3ZXQ A;  3CRK A;  4EEH A;  2YKJ A;  3OW6 A;  2XX2 A;  4U7O A;  4YKX A;  4XKK A;  1MX0 A;  4GT8 A;  4L91 A;  3TUH A;  1H7U A;  4URM A;  1BYQ A;  2VW5 A;  2BT0 A;  4XKA A;  3R91 A;  2GQP A;  1A4H A;  1B3Q A;  1EA6 A;  2UWD A;  5D6Q A;  4EM7 A;  2O1V A;  3TZ5 A;  2H55 A;  2BRE A;  2YE7 A;  3TTZ A;  1UY8 A;  2WER A;  4H7Q A;  1I5C A;  2YKC A;  1YES A;  1GKX A;  4HYP A;  3TZ0 A;  4PRV A;  4ASF A;  2YJW A;  3TZ2 A;  3WHA A;  1UY9 A;  3R4N A;  4YKT A;  4KSG A;  3GIE A;  1ZW9 A;  4XDM A;  2XHR A;  2YE9 A;  2WI3 A;  2PNR A;  2YKE A;  3A0Y A;  4CE3 A;  3T0H A;  3CYG A;  2FTK A;  5CTW A;  4AWO A;  3LNU A;  2H8M A;  2VCI A;  5BOC A;  4H85 A;  4KP4 A;  5D6P A;  4LWI A;  1U2O A;  2XAB A;  4NH8 A;  2QG2 A;  1UYM A;  4L93 A;  2YE3 A;  3T2S A;  4CWR A;  2XDU A;  1Z5C A;  2XDL A;  2E0A A;  2Q8I A;  5M4E A;  2BU6 A;  1ZXM A;  1I5A A;  3EHJ A;  4HYM A;  2BZ5 A;  3U2D A;  3CRL A;  4PRX A;  4BXI A;  1Z5B A;  3KE6 A;  2JJC A;  1H7S A;  4E02 A;  3T1K A;  1GJV A;  2YEI A;  3INW A;  4YKU A;  1UYC A;  2WI7 A;  5D7D A;  2CH4 A;  2ZDX A;  3R4O A;  3GIF A;  3C0E A;  3R4P A;  3D2R A;  4EFT A;  2GFD A;  3INX A;  2XX4 A;  2YE4 A;  1Y8N A;  4MPN A;  4CWS A;  3K97 A;  2CGF A;  3QDD A;  4V26 A;  2YGF A;  1UYI A;  2YI5 A;  3A0X A; 
#chains in the Genus database with same CATH homology
 2HCH A;  2XDX A;  2YI7 A;  2ZBK B;  4GGL A;  2EXL A;  4QPK A;  2XJX A;  4KFG A;  3ZM7 A;  2QFO A;  4URL A;  2YE6 A;  3CGY A;  3R92 A;  3MNR P;  4CWP A;  5M4M A;  1UYK A;  4B7P A;  4LWE A;  1TH8 A;  3WQ9 A;  4XIT A;  2XDK A;  3VAD A;  2IOQ A;  5IDJ A;  4NH7 A;  4W7T A;  2ESA A;  2YE8 A;  1ZXN A;  1BKN A;  3HYZ A;  3VHA A;  5J71 A;  2IWX A;  3HZ1 A;  4GFN A;  2YEF A;  3EHF A;  5BOD A;  4KSH A;  3B25 A;  1Z59 A;  4WUC A;  4CE2 A;  1TID A;  5CTU A;  1YT0 A;  2BU7 A;  3Q5K A;  1TIL A;  3T10 A;  4CE1 A;  3BM9 A;  4WUD A;  1YS3 A;  5CF0 A;  2YJX A;  3TZ4 A;  2WI2 A;  2XHX A;  3U67 A;  4CWT A;  1YSZ A;  2BU8 A;  4YKW A;  3Q5L A;  1PVG A;  4EGI A;  3CWV A;  4R1F A;  4BQJ A;  1Y8O A;  3QTF A;  3EKO A;  5M4P A;  2WI5 A;  3OPD A;  3OWB A;  4JAS A;  1QZR A;  1BGQ A;  2HG1 A;  2WI1 A;  4LP0 A;  3CGZ A;  4XIR A;  4XE2 A;  3SL2 A;  4L8Z A;  4E00 A;  2WEP A;  3O2F A;  2YEA A;  5D7R A;  5CTX A;  3K98 A;  3BMY A;  2YGE A;  1Y4U A;  4V25 A;  4FPP A;  4CWN A;  4L90 A;  3IED A;  1I59 A;  2WI4 A;  4MP7 A;  2IWS A;  3DGE A;  1BXD A;  1UYE A;  4FMT A;  4R3M A;  4CWQ A;  4E01 A;  1NHI A;  4WUB A;  5IN9 A;  2CCS A;  5J6A A;  4O04 A;  2YGA A;  4LWG A;  4URN A;  3K60 A;  3VHD A;  3ZKB A;  1YSR A;  2XJG A;  1ID0 A;  5L3J A;  4ZVI A;  3EHH A;  4JAU A;  1YER A;  4MPE A;  4FCP A;  1AJ6 A;  4R3A A;  5F3K A;  5FND A;  1KIJ A;  1B62 A;  1NHJ A;  2XDS A;  3H80 A;  4JQL A;  4HXW A;  4DZY A;  3B26 A;  3RKZ A;  4KQV A;  3R4M A;  4LWH A;  1I5B A;  3HZ5 A;  3G7E A;  4H81 A;  3G7B A;  4O0B A;  2YE2 A;  4URO A;  1UYF A;  5CTY A;  3A0R A;  3RLR A;  5FWK A;  1QYE A;  2CG9 A;  4P7A A;  1YC1 A;  4CWO A;  2FYP A;  4XKO A;  1U0Z A;  4ASB A;  1UY7 A;  4HZ0 A;  4EGH A;  2XJJ A;  4L94 A;  4GCZ A;  4MP2 A;  4O09 A;  1TBW A;  1AMW A;  4PL9 A;  1YT2 A;  2YED A;  1UY6 A;  2YEB A;  1JM6 A;  4EFU A;  3NMQ A;  5M4K A;  2FXS A;  4QPJ A;  4XC0 A;  2BYI A;  2YEG A;  1TC0 A;  2FWZ A;  3A0W A;  3FT8 A;  5D7C A;  4BQG A;  2BTZ A;  2XX5 A;  2Q8G A;  3G75 A;  1YET A;  4Q20 A;  4AWQ A;  2Q8H A;  3B24 A;  3T0Z A;  2IOP A;  1YC3 A;  3HHU A;  4MBC A;  4AS9 A;  1R62 A;  2YEJ A;  1I58 A;  2XCM A;  3RLP A;  1MU5 A;  3A0T A;  4FCR A;  2BU5 A;  4YKZ A;  2CCU A;  3O6O A;  1S14 A;  4P8O A;  2YKB A;  3GIG B;  5F5R A;  3Q5J A;  2O1U A;  4YKQ A;  3B28 A;  4LPB A;  2AKP A;  4MPC A;  1UYH A;  2YEH A;  4GQT A;  1US7 A;  4MB9 A;  1L0O A;  1Y8P A;  4XCJ A;  1KZN A;  2BRC A;  3OWD A;  4EMV A;  1B63 A;  4XD8 A;  2ZKJ A;  3PEH A;  1GKZ A;  4YKY A;  2YEE A;  2YI6 A;  4HY6 A;  2Q2E B;  4JAV A;  3D0B A;  4XCL A;  4MOT A;  4CWF A;  2FWY A;  2YKI A;  2YK9 A;  2CCT A;  4I3H A;  2C2A A;  1THN A;  1EI1 A;  3OMU A;  1AH6 A;  4GEE A;  2YEC A;  3A0Z A;  3D36 A;  4PU9 A;  1AM1 A;  2BU2 A;  4XIP A;  1S16 A;  1UYD A;  2JKI A;  4HY1 A;  2IWU A;  2IOR A;  4O07 A;  4U7N A;  4AWP A;  5C93 A;  3HEK A;  3HYY A;  3EKR A;  3EHG A;  4NH9 A;  4EGK A;  3O0I A;  1I5D A;  5M4H A;  5GGZ A;  4X9L A;  4KTN A;  1NHH A;  4HZ5 A;  1Y4S A;  4BAE A;  3FV5 A;  3PEJ A;  1ZWH A;  2HKJ A;  1YC4 A;  1OSF A;  3RLQ A;  4YKR A;  2YK2 A;  2XD6 A;  2VCJ A;  4U93 A;  3C11 A;  2BYH A;  2QF6 A;  2YI0 A;  3LPS A;  4ZKI A;  4FCQ A;  1QY8 A;  3JZ3 A;  5IDM A;  2WEQ A;  4BIU A;  5FNF A;  5CPH A;  2O1W A;  2VWC A;  2QG0 A;  4ASG A;  2ZDY A;  4BIZ A;  1Z5A A;  5M4N A;  3VHC A;  3U2K A;  2YE5 A;  2XHT A;  3FT5 A;  4I5S A;  2BSM A;  2Q8F A;  2XK2 A;  4XIQ A;  1TC6 A;  2K5B A;  3GIG A;  1UYL A;  1AH8 A;  4K4O A;  5FNC A;  3H4L A;  4HXZ A;  3ZXO A;  3ZKD A;  4XTJ A;  4ASA A;  3B27 A;  3K99 A;  2WI6 A;  4DUH A;  4LWF A;  4B6C A;  1UYG A;  1YT1 A;  4O05 A;  3ZXQ A;  3CRK A;  4EEH A;  2YKJ A;  3OW6 A;  2XX2 A;  4U7O A;  4YKX A;  4XKK A;  1MX0 A;  4GT8 A;  4L91 A;  3TUH A;  1H7U A;  4URM A;  1BYQ A;  2VW5 A;  2BT0 A;  4XKA A;  3R91 A;  2GQP A;  1A4H A;  1B3Q A;  1EA6 A;  2UWD A;  5D6Q A;  4EM7 A;  2O1V A;  3TZ5 A;  2H55 A;  2BRE A;  2YE7 A;  3TTZ A;  1UY8 A;  2WER A;  4H7Q A;  1I5C A;  2YKC A;  1YES A;  1GKX A;  4HYP A;  3TZ0 A;  4PRV A;  4ASF A;  2YJW A;  3TZ2 A;  3WHA A;  1UY9 A;  3R4N A;  4YKT A;  4KSG A;  3GIE A;  1ZW9 A;  4XDM A;  2XHR A;  2YE9 A;  2WI3 A;  2PNR A;  2YKE A;  3A0Y A;  4CE3 A;  3T0H A;  5CTW A;  4AWO A;  3LNU A;  2H8M A;  2VCI A;  5BOC A;  4H85 A;  4KP4 A;  5D6P A;  4LWI A;  1U2O A;  2XAB A;  4NH8 A;  2QG2 A;  1UYM A;  4L93 A;  2YE3 A;  3T2S A;  4CWR A;  2XDU A;  1Z5C A;  2XDL A;  2E0A A;  2Q8I A;  5M4E A;  2BU6 A;  1ZXM A;  1I5A A;  3EHJ A;  4HYM A;  2BZ5 A;  3U2D A;  3CRL A;  4PRX A;  4BXI A;  1Z5B A;  3KE6 A;  2JJC A;  1H7S A;  4E02 A;  3T1K A;  1GJV A;  2YEI A;  3INW A;  4YKU A;  1UYC A;  2WI7 A;  5D7D A;  2CH4 A;  2ZDX A;  3R4O A;  3GIF A;  3C0E A;  3R4P A;  3D2R A;  4EFT A;  2GFD A;  3INX A;  2XX4 A;  2YE4 A;  1Y8N A;  4MPN A;  4CWS A;  3K97 A;  2CGF A;  3QDD A;  4V26 A;  2YGF A;  1UYI A;  2YI5 A;  3A0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...