5F3KA

X-ray crystallographic structure of htrap1 n-terminal domain-apo
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
205
Chain Sequence
b'QGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 75 kDa, mitochondrial
publication title Mitochondrial Hsp90 is a ligand-activated molecular chaperone coupling ATP binding to dimer closure through a coiled-coil intermediate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 67
structure length 205
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5f3kA00
4V26A 1Y8NA 4UROA 4XIQA 4HXZA 4CE2A 4PL9A 1UY8A 2YEGA 3EHJA 3U67A 2HCHA 2IWXA 1TILA 3INXA 3H80A 4GQTA 4YKWA 3B28A 2IOQA 3EKOA 3O0IA 4EFTA 2BU6A 5CTUA 3TTZA 3B26A 4MPEA 2CG9A 3K60A 1UY9A 1YERA 3R4PA 3U2KA 4MOTA 4XTJA 3BM9A 1KZNA 3CGZA 3LPSA 4YKTA 3JZ3A 3T10A 3A0ZA 4EFUA 4AWPA 1MU5A 3VHAA 4L90A 2WI5A 4L94A 2XHTA 1YESA 3HEKA 3IEDA 3C0EA 4XCJA 4V25A 4LPBA 2YI5A 2YGFA 3A0RA 1KIJA 3ZKBA 2XD6A 4FMTA 1UY7A 3HHUA 1YT0A 3B25A 2CCTA 4LWHA 1NHJA 4CWPA 3HZ5A 1ID0A 2YI0A 1EI1A 2WERA 2ZDXA 4XE2A 3OWDA 4U7OA 2CCUA 3Q5KA 4HZ0A 5M4EA 4PRVA 2GQPA 3SL2A 3A0TA 5CPHA 5FWKA 4BAEA 2XX4A 1B3QA 2YE5A 4NH8A 4PRXA 4URMA 5D6PA 2BTZA 2Q8GA 4LWEA 3O2FA 1US7A 2UWDA 4KP4A 3D2RA 3Q5JA 2HKJA 2ESAA 1S14A 5CTYA 5IN9A 2WI7A 2YKEA 2XJXA 4GGLA 2YE7A 3OWBA 1GKXA 4XIPA 3D36A 4LWGA 5D7DA 2BSMA 2H55A 5CF0A 3HYZA 4FCQA 4EGKA 4XD8A 2XABA 2YI6A 4MPNA 3R91A 2BU8A 1ZXMA 1UY6A 5F5RA 3U2DA 5M4NA 1TC0A 2YKJA 2H8MA 2FWYA 4ASAA 4R3AA 1YC4A 3G7EA 1AH6A 3RKZA 1A4HA 1Y4SA 5M4HA 5C93A 1UYIA 4ASFA 2GFDA 3T0HA 2IOPA 1MX0A 4MBCA 4I5SA 2O1VA 1BKNA 2O1UA 3H4LA 4W7TA 5BOCA 4EMVA 3FT5A 4WUDA 4Q20A 4O0BA 2XHXA 2YGAA 4CWRA 2JKIA 3C11A 3RLQA 2QG0A 3NMQA 4CWTA 3EHFA 4MP2A 2XDLA 4XKKA 5M4MA 1NHIA 4YKZA 4HXWA 1TH8A 5BODA 3BMYA 1UYLA 5D7RA 3K97A 4LWIA 1TBWA 3OMUA 4PU9A 2XDUA 3EHHA 2ZKJA 4GT8A 4R3MA 3RLRA 5F3KA 4QPKA 1UYMA 2Q8FA 4XKOA 2EXLA 4CWNA 4KSGA 2WI2A 2O1WA 3WQ9A 4CWQA 3EKRA 2IORA 4EGHA 4P7AA 4EEHA 1R62A 2YKBA 4L91A 1TC6A 1YC1A 1U2OA 1AMWA 2XDKA 2YEAA 3LNUA 4E02A 2YE6A 2QG2A 1EA6A 4MP7A 1Z5BA 3R4OA 1YT1A 2AKPA 4CE1A 1THNA 3TZ2A 3GIEA 1I5CA 2HG1A 2YE3A 4HY6A 3CRLA 1Z59A 1H7UA 1Y4UA 4B6CA 3INWA 2FWZA 4CWFA 5J6AA 4GFNA 5CTXA 4KTNA 1UYKA 4P8OA 3K99A 4WUBA 1I58A 2BYHA 2C2AA 3ZM7A 4O07A 1JM6A 1ZWHA 3A0XA 4H7QA 3HZ1A 4L93A 3FV5A 4AS9A 3T2SA 4O09A 2ZDYA 4ASBA 4MPCA 3ZXQA 3ZXOA 2VW5A 4ZKIA 3G75A 4XKAA 2XDSA 3VADA 4HZ5A 3MNRP 1U0ZA 3A0WA 3D0BA 1I5AA 1BGQA 3PEJA 5FNFA 4XC0A 1Y8PA 2WEQA 2YK2A 4JASA 4XITA 2Q8HA 2BZ5A 2XDXA 2FYPA 3QDDA 4FPPA 4KQVA 5IDMA 4EGIA 4XDMA 5D7CA 2QF6A 4B7PA 1L0OA 3WHAA 4E00A 2BU5A 4GCZA 4BXIA 3A0YA 3TZ4A 1UYEA 3TZ5A 2XJJA 2FXSA 4DZYA 3OW6A 3TUHA 1UYFA 4HYMA 1B62A 2YE8A 2VCIA 4CWOA 5GGZA 4HYPA 1GKZA 2IWSA 1UYHA 3DGEA 3K98A 3O6OA 3Q5LA 4U93A 5IDJA 2YEBA 1YSZA 3G7BA 1TIDA 4BQJA 1BYQA 2VWCA 1AJ6A 4FCPA 1YT2A 2YI7A 4LP0A 3R92A 1QYEA 1ZW9A 1UYCA 1I59A 2WI1A 4O05A 2BYIA 2CCSA 1QZRA 3CRKA 2YJXA 3GIGB 4YKUA 3T0ZA 2YEDA 1PVGA 1I5BA 4AWQA 4URNA 4ASGA 5M4PA 1Y8OA 1I5DA 1OSFA 1S16A 4H85A 4WUCA 2K5BA 2Q8IA 4U7NA 3PEHA 2XX2A 2YKCA 2JJCA 4NH9A 1H7SA 2CH4A 2WEPA 2YEEA 2CGFA 1AH8A 1NHHA 2YJWA 5D6QA 4LWFA 4K4OA 4YKXA 1QY8A 1YSRA 2YECA 2YE2A 2YE4A 3R4NA 4X9LA 1YC3A 2YKIA 4HY1A 1GJVA 4XIRA 3ZKDA 3GIGA 1YS3A 2BREA 1Z5CA 1B63A 1YETA 4E01A 3R4MA 4NH7A 5L3JA 3KE6A 2BRCA 3OPDA 4YKQA 4MB9A 4QPJA 2XX5A 2IWUA 4YKRA 2YEIA 4R1FA 3T1KA 2XJGA 2E0AA 4JAUA 4BIUA 3TZ0A 2Q2EB 4CWSA 2YEJA 3FT8A 1UYDA 2XHRA 2ZBKB 4O04A 4YKYA 2YE9A 2BU2A 3RLPA 3VHDA 4BIZA 2XK2A 3EHGA 5FNCA 4KSHA 5J71A 1UYGA 1ZXNA 3CGYA 4JAVA 4GEEA 2WI4A 2PNRA 4CE3A 5CTWA 4EM7A 1AM1A 3QTFA 4DUHA 2VCJA 3VHCA 3HYYA 4FCRA 2WI3A 4I3HA 1Z5AA 2XCMA 4ZVIA 3CWVA 4KFGA 2BT0A 2YK9A 4BQGA 2YEHA 2YEFA 4H81A 3B27A 4AWOA 3GIFA 2YGEA 2BU7A 4URLA 4L8ZA 1BXDA 4JQLA 5M4KA 5FNDA 4XCLA 2QFOA 2WI6A 3B24A
chains in the Genus database with same CATH superfamily
4V26A 1Y8NA 4UROA 4XIQA 4HXZA 4CE2A 4PL9A 1UY8A 2YEGA 3EHJA 3U67A 2HCHA 2IWXA 1TILA 3INXA 3H80A 4GQTA 4YKWA 3B28A 2IOQA 3EKOA 3O0IA 4EFTA 2BU6A 5CTUA 3TTZA 3B26A 4MPEA 2CG9A 3K60A 1UY9A 1YERA 3R4PA 3U2KA 4MOTA 4XTJA 3BM9A 3LPSA 1KZNA 3CGZA 4YKTA 3JZ3A 3T10A 3A0ZA 4EFUA 4AWPA 1MU5A 3VHAA 4L90A 2WI5A 4L94A 2XHTA 1YESA 3HEKA 3IEDA 3C0EA 4XCJA 4V25A 4LPBA 2YI5A 2YGFA 3A0RA 1KIJA 3ZKBA 2XD6A 4FMTA 1UY7A 3HHUA 1YT0A 3B25A 2CCTA 4LWHA 1NHJA 4CWPA 3HZ5A 1ID0A 2YI0A 1EI1A 2WERA 2ZDXA 4XE2A 3OWDA 4U7OA 2CCUA 3Q5KA 4HZ0A 5M4EA 4PRVA 2GQPA 3SL2A 3A0TA 5CPHA 5FWKA 4BAEA 2XX4A 1B3QA 2YE5A 4NH8A 4PRXA 4URMA 5D6PA 2BTZA 2Q8GA 4LWEA 3O2FA 1US7A 2UWDA 4KP4A 3D2RA 3Q5JA 2HKJA 2ESAA 1S14A 2C1IA 5CTYA 5IN9A 2WI7A 2YKEA 2XJXA 4GGLA 2YE7A 3OWBA 1GKXA 4XIPA 3D36A 4LWGA 5D7DA 2BSMA 2H55A 5CF0A 3HYZA 4FCQA 4EGKA 4XD8A 2XABA 2YI6A 4MPNA 3R91A 2BU8A 1ZXMA 1UY6A 5F5RA 3U2DA 5M4NA 1TC0A 2YKJA 2H8MA 2FWYA 4ASAA 4R3AA 1YC4A 3G7EA 1AH6A 3RKZA 1A4HA 1Y4SA 5M4HA 5C93A 1UYIA 4ASFA 2GFDA 3T0HA 2FTKA 2IOPA 1MX0A 4MBCA 4I5SA 2O1VA 1BKNA 2O1UA 3H4LA 4W7TA 5BOCA 4EMVA 3FT5A 4WUDA 4Q20A 4O0BA 2XHXA 2YGAA 4CWRA 2JKIA 3C11A 3RLQA 2QG0A 3NMQA 4CWTA 3EHFA 4MP2A 2XDLA 4XKKA 5M4MA 1NHIA 4YKZA 4HXWA 1TH8A 5BODA 3BMYA 1UYLA 5D7RA 3K97A 4LWIA 1TBWA 3OMUA 4PU9A 2XDUA 3EHHA 2ZKJA 4GT8A 4R3MA 3RLRA 5F3KA 4QPKA 1UYMA 2Q8FA 4XKOA 2EXLA 4CWNA 4KSGA 2WI2A 2O1WA 3WQ9A 4CWQA 3EKRA 2IORA 4EGHA 4P7AA 4EEHA 1R62A 2YKBA 4L91A 1TC6A 1YC1A 1U2OA 1AMWA 2XDKA 2YEAA 3LNUA 4E02A 2YE6A 2QG2A 1EA6A 4MP7A 1Z5BA 3R4OA 1YT1A 2AKPA 4CE1A 1THNA 3TZ2A 3GIEA 1I5CA 2HG1A 2YE3A 4HY6A 3CRLA 1Z59A 1H7UA 1Y4UA 4B6CA 3INWA 2FWZA 4CWFA 5J6AA 4GFNA 5CTXA 4E72A 3LMMA 4KTNA 3CYGA 1UYKA 4P8OA 3K99A 4WUBA 1I58A 2BYHA 2C2AA 3ZM7A 5JENA 4O07A 1JM6A 1ZWHA 3A0XA 4H7QA 3HZ1A 4L93A 3FV5A 4AS9A 3T2SA 4O09A 2ZDYA 4ASBA 4MPCA 3ZXQA 3ZXOA 2VW5A 4ZKIA 3G75A 4XKAA 2XDSA 3VADA 4HZ5A 3MNRP 1U0ZA 3A0WA 3D0BA 1I5AA 1BGQA 3PEJA 5FNFA 4XC0A 1Y8PA 2WEQA 2YK2A 4JASA 4XITA 2Q8HA 2BZ5A 2XDXA 2FYPA 3QDDA 4FPPA 4KQVA 5IDMA 4EGIA 4XDMA 5D7CA 2QF6A 4B7PA 1L0OA 3WHAA 4E00A 2BU5A 4GCZA 4BXIA 3A0YA 3TZ4A 1UYEA 3TZ5A 2XJJA 2FXSA 4DZYA 3OW6A 3TUHA 2HHIA 1IXMA 1UYFA 4HYMA 1B62A 2YE8A 2VCIA 4CWOA 5GGZA 4HYPA 1GKZA 2IWSA 1UYHA 3DGEA 3K98A 3O6OA 3Q5LA 4U93A 5IDJA 2YEBA 1YSZA 3G7BA 1TIDA 4BQJA 1BYQA 2VWCA 1AJ6A 4FCPA 1YT2A 2YI7A 4LP0A 3R92A 1QYEA 1ZW9A 1UYCA 1I59A 2WI1A 4O05A 2BYIA 2CCSA 1QZRA 3CRKA 2YJXA 3GIGB 4YKUA 3T0ZA 2YEDA 1PVGA 1I5BA 4AWQA 4URNA 2C1GA 4ASGA 5M4PA 1Y8OA 1I5DA 1OSFA 1S16A 4H85A 4WUCA 2K5BA 2Q8IA 4U7NA 3PEHA 2XX2A 2YKCA 2JJCA 4NH9A 1H7SA 2CH4A 2WEPA 2YEEA 2CGFA 1AH8A 1NHHA 2YJWA 5D6QA 4LWFA 4K4OA 4YKXA 1QY8A 1YSRA 2YECA 2YE2A 2YE4A 3R4NA 4X9LA 1YC3A 2YKIA 4HY1A 1GJVA 4XIRA 3ZKDA 3GIGA 1YS3A 2BREA 1Z5CA 1B63A 1YETA 4E01A 3R4MA 4NH7A 5L3JA 3KE6A 2BRCA 3OPDA 4YKQA 4MB9A 4QPJA 2XX5A 2IWUA 4YKRA 2YEIA 4R1FA 3T1KA 2XJGA 2E0AA 4JAUA 4BIUA 3TZ0A 2Q2EB 4CWSA 2YEJA 1F51A 3FT8A 1UYDA 2XHRA 2ZBKB 4O04A 4YKYA 2YE9A 2BU2A 3RLPA 3VHDA 4BIZA 2XK2A 3EHGA 5FNCA 4KSHA 5J71A 1UYGA 1ZXNA 3CGYA 4JAVA 4GEEA 2WI4A 2PNRA 4CE3A 5CTWA 4EM7A 1AM1A 3QTFA 4DUHA 3S5TA 2VCJA 3VHCA 3HYYA 4FCRA 2WI3A 4I3HA 1Z5AA 2XCMA 4ZVIA 3CWVA 4KFGA 2BT0A 2YK9A 4BQGA 2YEHA 2YEFA 4H81A 3B27A 4AWOA 3GIFA 2YGEA 2BU7A 4URLA 4L8ZA 1BXDA 4JQLA 5M4KA 5FNDA 4XCLA 2QFOA 2WI6A 3B24A
chains in the Genus database with same CATH topology
4V26A 1Y8NA 4UROA 4XIQA 4HXZA 4CE2A 4PL9A 1UY8A 2YEGA 3EHJA 3U67A 2HCHA 2IWXA 1TILA 3INXA 3H80A 4GQTA 4YKWA 3B28A 2IOQA 3EKOA 3O0IA 4EFTA 2BU6A 5CTUA 3TTZA 3B26A 4MPEA 2CG9A 3K60A 1UY9A 1YERA 3R4PA 3U2KA 4MOTA 4XTJA 3BM9A 1KZNA 3CGZA 3LPSA 4YKTA 3JZ3A 3T10A 3A0ZA 4EFUA 4AWPA 1MU5A 3VHAA 4L90A 2WI5A 4L94A 2XHTA 1YESA 3HEKA 3IEDA 3C0EA 4XCJA 4V25A 4LPBA 2YI5A 2YGFA 3A0RA 1KIJA 3ZKBA 2XD6A 4FMTA 1UY7A 3HHUA 1YT0A 3B25A 2CCTA 4LWHA 1NHJA 4CWPA 3HZ5A 1ID0A 2YI0A 1EI1A 2WERA 2ZDXA 4XE2A 3OWDA 4U7OA 2CCUA 3Q5KA 4HZ0A 5M4EA 4PRVA 2GQPA 3SL2A 3A0TA 5CPHA 5FWKA 4BAEA 2XX4A 1B3QA 2YE5A 4NH8A 4PRXA 4URMA 5D6PA 2BTZA 2Q8GA 4LWEA 3O2FA 1US7A 2UWDA 4KP4A 3D2RA 3Q5JA 2HKJA 2ESAA 1S14A 5CTYA 5IN9A 2WI7A 2YKEA 2XJXA 4GGLA 2YE7A 3OWBA 1GKXA 4XIPA 3D36A 4LWGA 5D7DA 2BSMA 2H55A 5CF0A 3HYZA 4FCQA 4EGKA 4XD8A 2XABA 2YI6A 4MPNA 3R91A 2BU8A 1ZXMA 1UY6A 5F5RA 3U2DA 5M4NA 1TC0A 2YKJA 2H8MA 2FWYA 4ASAA 4R3AA 1YC4A 3G7EA 1AH6A 3RKZA 1A4HA 1Y4SA 5M4HA 5C93A 1UYIA 4ASFA 2GFDA 3T0HA 2IOPA 1MX0A 4MBCA 4I5SA 2O1VA 1BKNA 2O1UA 3H4LA 4W7TA 5BOCA 4EMVA 3FT5A 4WUDA 4Q20A 4O0BA 2XHXA 2YGAA 4CWRA 2JKIA 3C11A 3RLQA 2QG0A 3NMQA 4CWTA 3EHFA 4MP2A 2XDLA 4XKKA 5M4MA 1NHIA 4YKZA 4HXWA 1TH8A 5BODA 3BMYA 1UYLA 5D7RA 3K97A 4LWIA 1TBWA 3OMUA 4PU9A 2XDUA 3EHHA 2ZKJA 4GT8A 4R3MA 3RLRA 5F3KA 4QPKA 1UYMA 2Q8FA 4XKOA 2EXLA 4CWNA 4KSGA 2WI2A 2O1WA 3WQ9A 4CWQA 3EKRA 2IORA 4EGHA 4P7AA 4EEHA 1R62A 2YKBA 4L91A 1TC6A 1YC1A 1U2OA 1AMWA 2XDKA 2YEAA 3LNUA 4E02A 2YE6A 2QG2A 1EA6A 4MP7A 1Z5BA 3R4OA 1YT1A 2AKPA 4CE1A 1THNA 3TZ2A 3GIEA 1I5CA 2HG1A 2YE3A 4HY6A 3CRLA 1Z59A 1H7UA 1Y4UA 4B6CA 3INWA 2FWZA 4CWFA 5J6AA 4GFNA 5CTXA 4KTNA 1UYKA 4P8OA 3K99A 4WUBA 1I58A 2BYHA 2C2AA 3ZM7A 4O07A 1JM6A 1ZWHA 3A0XA 4H7QA 3HZ1A 4L93A 3FV5A 4AS9A 3T2SA 4O09A 2ZDYA 4ASBA 4MPCA 3ZXQA 3ZXOA 2VW5A 4ZKIA 3G75A 4XKAA 2XDSA 3VADA 4HZ5A 3MNRP 1U0ZA 3A0WA 3D0BA 1I5AA 1BGQA 3PEJA 5FNFA 4XC0A 1Y8PA 2WEQA 2YK2A 4JASA 4XITA 2Q8HA 2BZ5A 2XDXA 2FYPA 3QDDA 4FPPA 4KQVA 5IDMA 4EGIA 4XDMA 5D7CA 2QF6A 4B7PA 1L0OA 3WHAA 4E00A 2BU5A 4GCZA 4BXIA 3A0YA 3TZ4A 1UYEA 3TZ5A 2XJJA 2FXSA 4DZYA 3OW6A 3TUHA 1UYFA 4HYMA 1B62A 2YE8A 2VCIA 4CWOA 5GGZA 4HYPA 1GKZA 2IWSA 1UYHA 3DGEA 3K98A 3O6OA 3Q5LA 4U93A 5IDJA 2YEBA 1YSZA 3G7BA 1TIDA 4BQJA 1BYQA 2VWCA 1AJ6A 4FCPA 1YT2A 2YI7A 4LP0A 3R92A 1QYEA 1ZW9A 1UYCA 1I59A 2WI1A 4O05A 2BYIA 2CCSA 1QZRA 3CRKA 2YJXA 3GIGB 4YKUA 3T0ZA 2YEDA 1PVGA 1I5BA 4AWQA 4URNA 4ASGA 5M4PA 1Y8OA 1I5DA 1OSFA 1S16A 4H85A 4WUCA 2K5BA 2Q8IA 4U7NA 3PEHA 2XX2A 2YKCA 2JJCA 4NH9A 1H7SA 2CH4A 2WEPA 2YEEA 2CGFA 1AH8A 1NHHA 2YJWA 5D6QA 4LWFA 4K4OA 4YKXA 1QY8A 1YSRA 2YECA 2YE2A 2YE4A 3R4NA 4X9LA 1YC3A 2YKIA 4HY1A 1GJVA 4XIRA 3ZKDA 3GIGA 1YS3A 2BREA 1Z5CA 1B63A 1YETA 4E01A 3R4MA 4NH7A 5L3JA 3KE6A 2BRCA 3OPDA 4YKQA 4MB9A 4QPJA 2XX5A 2IWUA 4YKRA 2YEIA 4R1FA 3T1KA 2XJGA 2E0AA 4JAUA 4BIUA 3TZ0A 2Q2EB 4CWSA 2YEJA 3FT8A 1UYDA 2XHRA 2ZBKB 4O04A 4YKYA 2YE9A 2BU2A 3RLPA 3VHDA 4BIZA 2XK2A 3EHGA 5FNCA 4KSHA 5J71A 1UYGA 1ZXNA 3CGYA 4JAVA 4GEEA 2WI4A 2PNRA 4CE3A 5CTWA 4EM7A 1AM1A 3QTFA 4DUHA 2VCJA 3VHCA 3HYYA 4FCRA 2WI3A 4I3HA 1Z5AA 2XCMA 4ZVIA 3CWVA 4KFGA 2BT0A 2YK9A 4BQGA 2YEHA 2YEFA 4H81A 3B27A 4AWOA 3GIFA 2YGEA 2BU7A 4URLA 4L8ZA 1BXDA 4JQLA 5M4KA 5FNDA 4XCLA 2QFOA 2WI6A 3B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V26 A;  1Y8N A;  4URO A;  4XIQ A;  4HXZ A;  4CE2 A;  4PL9 A;  1UY8 A;  2YEG A;  3EHJ A;  3U67 A;  2HCH A;  2IWX A;  1TIL A;  3INX A;  3H80 A;  4GQT A;  4YKW A;  3B28 A;  2IOQ A;  3EKO A;  3O0I A;  4EFT A;  2BU6 A;  5CTU A;  3TTZ A;  3B26 A;  4MPE A;  2CG9 A;  3K60 A;  1UY9 A;  1YER A;  3R4P A;  3U2K A;  4MOT A;  4XTJ A;  3BM9 A;  1KZN A;  3CGZ A;  3LPS A;  4YKT A;  3JZ3 A;  3T10 A;  3A0Z A;  4EFU A;  4AWP A;  1MU5 A;  3VHA A;  4L90 A;  2WI5 A;  4L94 A;  2XHT A;  1YES A;  3HEK A;  3IED A;  3C0E A;  4XCJ A;  4V25 A;  4LPB A;  2YI5 A;  2YGF A;  3A0R A;  1KIJ A;  3ZKB A;  2XD6 A;  4FMT A;  1UY7 A;  3HHU A;  1YT0 A;  3B25 A;  2CCT A;  4LWH A;  1NHJ A;  4CWP A;  3HZ5 A;  1ID0 A;  2YI0 A;  1EI1 A;  2WER A;  2ZDX A;  4XE2 A;  3OWD A;  4U7O A;  2CCU A;  3Q5K A;  4HZ0 A;  5M4E A;  4PRV A;  2GQP A;  3SL2 A;  3A0T A;  5CPH A;  5FWK A;  4BAE A;  2XX4 A;  1B3Q A;  2YE5 A;  4NH8 A;  4PRX A;  4URM A;  5D6P A;  2BTZ A;  2Q8G A;  4LWE A;  3O2F A;  1US7 A;  2UWD A;  4KP4 A;  3D2R A;  3Q5J A;  2HKJ A;  2ESA A;  1S14 A;  5CTY A;  5IN9 A;  2WI7 A;  2YKE A;  2XJX A;  4GGL A;  2YE7 A;  3OWB A;  1GKX A;  4XIP A;  3D36 A;  4LWG A;  5D7D A;  2BSM A;  2H55 A;  5CF0 A;  3HYZ A;  4FCQ A;  4EGK A;  4XD8 A;  2XAB A;  2YI6 A;  4MPN A;  3R91 A;  2BU8 A;  1ZXM A;  1UY6 A;  5F5R A;  3U2D A;  5M4N A;  1TC0 A;  2YKJ A;  2H8M A;  2FWY A;  4ASA A;  4R3A A;  1YC4 A;  3G7E A;  1AH6 A;  3RKZ A;  1A4H A;  1Y4S A;  5M4H A;  5C93 A;  1UYI A;  4ASF A;  2GFD A;  3T0H A;  2IOP A;  1MX0 A;  4MBC A;  4I5S A;  2O1V A;  1BKN A;  2O1U A;  3H4L A;  4W7T A;  5BOC A;  4EMV A;  3FT5 A;  4WUD A;  4Q20 A;  4O0B A;  2XHX A;  2YGA A;  4CWR A;  2JKI A;  3C11 A;  3RLQ A;  2QG0 A;  3NMQ A;  4CWT A;  3EHF A;  4MP2 A;  2XDL A;  4XKK A;  5M4M A;  1NHI A;  4YKZ A;  4HXW A;  1TH8 A;  5BOD A;  3BMY A;  1UYL A;  5D7R A;  3K97 A;  4LWI A;  1TBW A;  3OMU A;  4PU9 A;  2XDU A;  3EHH A;  2ZKJ A;  4GT8 A;  4R3M A;  3RLR A;  5F3K A;  4QPK A;  1UYM A;  2Q8F A;  4XKO A;  2EXL A;  4CWN A;  4KSG A;  2WI2 A;  2O1W A;  3WQ9 A;  4CWQ A;  3EKR A;  2IOR A;  4EGH A;  4P7A A;  4EEH A;  1R62 A;  2YKB A;  4L91 A;  1TC6 A;  1YC1 A;  1U2O A;  1AMW A;  2XDK A;  2YEA A;  3LNU A;  4E02 A;  2YE6 A;  2QG2 A;  1EA6 A;  4MP7 A;  1Z5B A;  3R4O A;  1YT1 A;  2AKP A;  4CE1 A;  1THN A;  3TZ2 A;  3GIE A;  1I5C A;  2HG1 A;  2YE3 A;  4HY6 A;  3CRL A;  1Z59 A;  1H7U A;  1Y4U A;  4B6C A;  3INW A;  2FWZ A;  4CWF A;  5J6A A;  4GFN A;  5CTX A;  4KTN A;  1UYK A;  4P8O A;  3K99 A;  4WUB A;  1I58 A;  2BYH A;  2C2A A;  3ZM7 A;  4O07 A;  1JM6 A;  1ZWH A;  3A0X A;  4H7Q A;  3HZ1 A;  4L93 A;  3FV5 A;  4AS9 A;  3T2S A;  4O09 A;  2ZDY A;  4ASB A;  4MPC A;  3ZXQ A;  3ZXO A;  2VW5 A;  4ZKI A;  3G75 A;  4XKA A;  2XDS A;  3VAD A;  4HZ5 A;  3MNR P;  1U0Z A;  3A0W A;  3D0B A;  1I5A A;  1BGQ A;  3PEJ A;  5FNF A;  4XC0 A;  1Y8P A;  2WEQ A;  2YK2 A;  4JAS A;  4XIT A;  2Q8H A;  2BZ5 A;  2XDX A;  2FYP A;  3QDD A;  4FPP A;  4KQV A;  5IDM A;  4EGI A;  4XDM A;  5D7C A;  2QF6 A;  4B7P A;  1L0O A;  3WHA A;  4E00 A;  2BU5 A;  4GCZ A;  4BXI A;  3A0Y A;  3TZ4 A;  1UYE A;  3TZ5 A;  2XJJ A;  2FXS A;  4DZY A;  3OW6 A;  3TUH A;  1UYF A;  4HYM A;  1B62 A;  2YE8 A;  2VCI A;  4CWO A;  5GGZ A;  4HYP A;  1GKZ A;  2IWS A;  1UYH A;  3DGE A;  3K98 A;  3O6O A;  3Q5L A;  4U93 A;  5IDJ A;  2YEB A;  1YSZ A;  3G7B A;  1TID A;  4BQJ A;  1BYQ A;  2VWC A;  1AJ6 A;  4FCP A;  1YT2 A;  2YI7 A;  4LP0 A;  3R92 A;  1QYE A;  1ZW9 A;  1UYC A;  1I59 A;  2WI1 A;  4O05 A;  2BYI A;  2CCS A;  1QZR A;  3CRK A;  2YJX A;  3GIG B;  4YKU A;  3T0Z A;  2YED A;  1PVG A;  1I5B A;  4AWQ A;  4URN A;  4ASG A;  5M4P A;  1Y8O A;  1I5D A;  1OSF A;  1S16 A;  4H85 A;  4WUC A;  2K5B A;  2Q8I A;  4U7N A;  3PEH A;  2XX2 A;  2YKC A;  2JJC A;  4NH9 A;  1H7S A;  2CH4 A;  2WEP A;  2YEE A;  2CGF A;  1AH8 A;  1NHH A;  2YJW A;  5D6Q A;  4LWF A;  4K4O A;  4YKX A;  1QY8 A;  1YSR A;  2YEC A;  2YE2 A;  2YE4 A;  3R4N A;  4X9L A;  1YC3 A;  2YKI A;  4HY1 A;  1GJV A;  4XIR A;  3ZKD A;  3GIG A;  1YS3 A;  2BRE A;  1Z5C A;  1B63 A;  1YET A;  4E01 A;  3R4M A;  4NH7 A;  5L3J A;  3KE6 A;  2BRC A;  3OPD A;  4YKQ A;  4MB9 A;  4QPJ A;  2XX5 A;  2IWU A;  4YKR A;  2YEI A;  4R1F A;  3T1K A;  2XJG A;  2E0A A;  4JAU A;  4BIU A;  3TZ0 A;  2Q2E B;  4CWS A;  2YEJ A;  3FT8 A;  1UYD A;  2XHR A;  2ZBK B;  4O04 A;  4YKY A;  2YE9 A;  2BU2 A;  3RLP A;  3VHD A;  4BIZ A;  2XK2 A;  3EHG A;  5FNC A;  4KSH A;  5J71 A;  1UYG A;  1ZXN A;  3CGY A;  4JAV A;  4GEE A;  2WI4 A;  2PNR A;  4CE3 A;  5CTW A;  4EM7 A;  1AM1 A;  3QTF A;  4DUH A;  2VCJ A;  3VHC A;  3HYY A;  4FCR A;  2WI3 A;  4I3H A;  1Z5A A;  2XCM A;  4ZVI A;  3CWV A;  4KFG A;  2BT0 A;  2YK9 A;  4BQG A;  2YEH A;  2YEF A;  4H81 A;  3B27 A;  4AWO A;  3GIF A;  2YGE A;  2BU7 A;  4URL A;  4L8Z A;  1BXD A;  4JQL A;  5M4K A;  5FND A;  4XCL A;  2QFO A;  2WI6 A;  3B24 A; 
#chains in the Genus database with same CATH topology
 4V26 A;  1Y8N A;  4URO A;  4XIQ A;  4HXZ A;  4CE2 A;  4PL9 A;  1UY8 A;  2YEG A;  3EHJ A;  3U67 A;  2HCH A;  2IWX A;  1TIL A;  3INX A;  3H80 A;  4GQT A;  4YKW A;  3B28 A;  2IOQ A;  3EKO A;  3O0I A;  4EFT A;  2BU6 A;  5CTU A;  3TTZ A;  3B26 A;  4MPE A;  2CG9 A;  3K60 A;  1UY9 A;  1YER A;  3R4P A;  3U2K A;  4MOT A;  4XTJ A;  3BM9 A;  3LPS A;  1KZN A;  3CGZ A;  4YKT A;  3JZ3 A;  3T10 A;  3A0Z A;  4EFU A;  4AWP A;  1MU5 A;  3VHA A;  4L90 A;  2WI5 A;  4L94 A;  2XHT A;  1YES A;  3HEK A;  3IED A;  3C0E A;  4XCJ A;  4V25 A;  4LPB A;  2YI5 A;  2YGF A;  3A0R A;  1KIJ A;  3ZKB A;  2XD6 A;  4FMT A;  1UY7 A;  3HHU A;  1YT0 A;  3B25 A;  2CCT A;  4LWH A;  1NHJ A;  4CWP A;  3HZ5 A;  1ID0 A;  2YI0 A;  1EI1 A;  2WER A;  2ZDX A;  4XE2 A;  3OWD A;  4U7O A;  2CCU A;  3Q5K A;  4HZ0 A;  5M4E A;  4PRV A;  2GQP A;  3SL2 A;  3A0T A;  5CPH A;  5FWK A;  4BAE A;  2XX4 A;  1B3Q A;  2YE5 A;  4NH8 A;  4PRX A;  4URM A;  5D6P A;  2BTZ A;  2Q8G A;  4LWE A;  3O2F A;  1US7 A;  2UWD A;  4KP4 A;  3D2R A;  3Q5J A;  2HKJ A;  2ESA A;  1S14 A;  2C1I A;  5CTY A;  5IN9 A;  2WI7 A;  2YKE A;  2XJX A;  4GGL A;  2YE7 A;  3OWB A;  1GKX A;  4XIP A;  3D36 A;  4LWG A;  5D7D A;  2BSM A;  2H55 A;  5CF0 A;  3HYZ A;  4FCQ A;  4EGK A;  4XD8 A;  2XAB A;  2YI6 A;  4MPN A;  3R91 A;  2BU8 A;  1ZXM A;  1UY6 A;  5F5R A;  3U2D A;  5M4N A;  1TC0 A;  2YKJ A;  2H8M A;  2FWY A;  4ASA A;  4R3A A;  1YC4 A;  3G7E A;  1AH6 A;  3RKZ A;  1A4H A;  1Y4S A;  5M4H A;  5C93 A;  1UYI A;  4ASF A;  2GFD A;  3T0H A;  2FTK A;  2IOP A;  1MX0 A;  4MBC A;  4I5S A;  2O1V A;  1BKN A;  2O1U A;  3H4L A;  4W7T A;  5BOC A;  4EMV A;  3FT5 A;  4WUD A;  4Q20 A;  4O0B A;  2XHX A;  2YGA A;  4CWR A;  2JKI A;  3C11 A;  3RLQ A;  2QG0 A;  3NMQ A;  4CWT A;  3EHF A;  4MP2 A;  2XDL A;  4XKK A;  5M4M A;  1NHI A;  4YKZ A;  4HXW A;  1TH8 A;  5BOD A;  3BMY A;  1UYL A;  5D7R A;  3K97 A;  4LWI A;  1TBW A;  3OMU A;  4PU9 A;  2XDU A;  3EHH A;  2ZKJ A;  4GT8 A;  4R3M A;  3RLR A;  5F3K A;  4QPK A;  1UYM A;  2Q8F A;  4XKO A;  2EXL A;  4CWN A;  4KSG A;  2WI2 A;  2O1W A;  3WQ9 A;  4CWQ A;  3EKR A;  2IOR A;  4EGH A;  4P7A A;  4EEH A;  1R62 A;  2YKB A;  4L91 A;  1TC6 A;  1YC1 A;  1U2O A;  1AMW A;  2XDK A;  2YEA A;  3LNU A;  4E02 A;  2YE6 A;  2QG2 A;  1EA6 A;  4MP7 A;  1Z5B A;  3R4O A;  1YT1 A;  2AKP A;  4CE1 A;  1THN A;  3TZ2 A;  3GIE A;  1I5C A;  2HG1 A;  2YE3 A;  4HY6 A;  3CRL A;  1Z59 A;  1H7U A;  1Y4U A;  4B6C A;  3INW A;  2FWZ A;  4CWF A;  5J6A A;  4GFN A;  5CTX A;  4E72 A;  3LMM A;  4KTN A;  3CYG A;  1UYK A;  4P8O A;  3K99 A;  4WUB A;  1I58 A;  2BYH A;  2C2A A;  3ZM7 A;  5JEN A;  4O07 A;  1JM6 A;  1ZWH A;  3A0X A;  4H7Q A;  3HZ1 A;  4L93 A;  3FV5 A;  4AS9 A;  3T2S A;  4O09 A;  2ZDY A;  4ASB A;  4MPC A;  3ZXQ A;  3ZXO A;  2VW5 A;  4ZKI A;  3G75 A;  4XKA A;  2XDS A;  3VAD A;  4HZ5 A;  3MNR P;  1U0Z A;  3A0W A;  3D0B A;  1I5A A;  1BGQ A;  3PEJ A;  5FNF A;  4XC0 A;  1Y8P A;  2WEQ A;  2YK2 A;  4JAS A;  4XIT A;  2Q8H A;  2BZ5 A;  2XDX A;  2FYP A;  3QDD A;  4FPP A;  4KQV A;  5IDM A;  4EGI A;  4XDM A;  5D7C A;  2QF6 A;  4B7P A;  1L0O A;  3WHA A;  4E00 A;  2BU5 A;  4GCZ A;  4BXI A;  3A0Y A;  3TZ4 A;  1UYE A;  3TZ5 A;  2XJJ A;  2FXS A;  4DZY A;  3OW6 A;  3TUH A;  2HHI A;  1IXM A;  1UYF A;  4HYM A;  1B62 A;  2YE8 A;  2VCI A;  4CWO A;  5GGZ A;  4HYP A;  1GKZ A;  2IWS A;  1UYH A;  3DGE A;  3K98 A;  3O6O A;  3Q5L A;  4U93 A;  5IDJ A;  2YEB A;  1YSZ A;  3G7B A;  1TID A;  4BQJ A;  1BYQ A;  2VWC A;  1AJ6 A;  4FCP A;  1YT2 A;  2YI7 A;  4LP0 A;  3R92 A;  1QYE A;  1ZW9 A;  1UYC A;  1I59 A;  2WI1 A;  4O05 A;  2BYI A;  2CCS A;  1QZR A;  3CRK A;  2YJX A;  3GIG B;  4YKU A;  3T0Z A;  2YED A;  1PVG A;  1I5B A;  4AWQ A;  4URN A;  2C1G A;  4ASG A;  5M4P A;  1Y8O A;  1I5D A;  1OSF A;  1S16 A;  4H85 A;  4WUC A;  2K5B A;  2Q8I A;  4U7N A;  3PEH A;  2XX2 A;  2YKC A;  2JJC A;  4NH9 A;  1H7S A;  2CH4 A;  2WEP A;  2YEE A;  2CGF A;  1AH8 A;  1NHH A;  2YJW A;  5D6Q A;  4LWF A;  4K4O A;  4YKX A;  1QY8 A;  1YSR A;  2YEC A;  2YE2 A;  2YE4 A;  3R4N A;  4X9L A;  1YC3 A;  2YKI A;  4HY1 A;  1GJV A;  4XIR A;  3ZKD A;  3GIG A;  1YS3 A;  2BRE A;  1Z5C A;  1B63 A;  1YET A;  4E01 A;  3R4M A;  4NH7 A;  5L3J A;  3KE6 A;  2BRC A;  3OPD A;  4YKQ A;  4MB9 A;  4QPJ A;  2XX5 A;  2IWU A;  4YKR A;  2YEI A;  4R1F A;  3T1K A;  2XJG A;  2E0A A;  4JAU A;  4BIU A;  3TZ0 A;  2Q2E B;  4CWS A;  2YEJ A;  1F51 A;  3FT8 A;  1UYD A;  2XHR A;  2ZBK B;  4O04 A;  4YKY A;  2YE9 A;  2BU2 A;  3RLP A;  3VHD A;  4BIZ A;  2XK2 A;  3EHG A;  5FNC A;  4KSH A;  5J71 A;  1UYG A;  1ZXN A;  3CGY A;  4JAV A;  4GEE A;  2WI4 A;  2PNR A;  4CE3 A;  5CTW A;  4EM7 A;  1AM1 A;  3QTF A;  4DUH A;  3S5T A;  2VCJ A;  3VHC A;  3HYY A;  4FCR A;  2WI3 A;  4I3H A;  1Z5A A;  2XCM A;  4ZVI A;  3CWV A;  4KFG A;  2BT0 A;  2YK9 A;  4BQG A;  2YEH A;  2YEF A;  4H81 A;  3B27 A;  4AWO A;  3GIF A;  2YGE A;  2BU7 A;  4URL A;  4L8Z A;  1BXD A;  4JQL A;  5M4K A;  5FND A;  4XCL A;  2QFO A;  2WI6 A;  3B24 A; 
#chains in the Genus database with same CATH homology
 4V26 A;  1Y8N A;  4URO A;  4XIQ A;  4HXZ A;  4CE2 A;  4PL9 A;  1UY8 A;  2YEG A;  3EHJ A;  3U67 A;  2HCH A;  2IWX A;  1TIL A;  3INX A;  3H80 A;  4GQT A;  4YKW A;  3B28 A;  2IOQ A;  3EKO A;  3O0I A;  4EFT A;  2BU6 A;  5CTU A;  3TTZ A;  3B26 A;  4MPE A;  2CG9 A;  3K60 A;  1UY9 A;  1YER A;  3R4P A;  3U2K A;  4MOT A;  4XTJ A;  3BM9 A;  1KZN A;  3CGZ A;  3LPS A;  4YKT A;  3JZ3 A;  3T10 A;  3A0Z A;  4EFU A;  4AWP A;  1MU5 A;  3VHA A;  4L90 A;  2WI5 A;  4L94 A;  2XHT A;  1YES A;  3HEK A;  3IED A;  3C0E A;  4XCJ A;  4V25 A;  4LPB A;  2YI5 A;  2YGF A;  3A0R A;  1KIJ A;  3ZKB A;  2XD6 A;  4FMT A;  1UY7 A;  3HHU A;  1YT0 A;  3B25 A;  2CCT A;  4LWH A;  1NHJ A;  4CWP A;  3HZ5 A;  1ID0 A;  2YI0 A;  1EI1 A;  2WER A;  2ZDX A;  4XE2 A;  3OWD A;  4U7O A;  2CCU A;  3Q5K A;  4HZ0 A;  5M4E A;  4PRV A;  2GQP A;  3SL2 A;  3A0T A;  5CPH A;  5FWK A;  4BAE A;  2XX4 A;  1B3Q A;  2YE5 A;  4NH8 A;  4PRX A;  4URM A;  5D6P A;  2BTZ A;  2Q8G A;  4LWE A;  3O2F A;  1US7 A;  2UWD A;  4KP4 A;  3D2R A;  3Q5J A;  2HKJ A;  2ESA A;  1S14 A;  5CTY A;  5IN9 A;  2WI7 A;  2YKE A;  2XJX A;  4GGL A;  2YE7 A;  3OWB A;  1GKX A;  4XIP A;  3D36 A;  4LWG A;  5D7D A;  2BSM A;  2H55 A;  5CF0 A;  3HYZ A;  4FCQ A;  4EGK A;  4XD8 A;  2XAB A;  2YI6 A;  4MPN A;  3R91 A;  2BU8 A;  1ZXM A;  1UY6 A;  5F5R A;  3U2D A;  5M4N A;  1TC0 A;  2YKJ A;  2H8M A;  2FWY A;  4ASA A;  4R3A A;  1YC4 A;  3G7E A;  1AH6 A;  3RKZ A;  1A4H A;  1Y4S A;  5M4H A;  5C93 A;  1UYI A;  4ASF A;  2GFD A;  3T0H A;  2IOP A;  1MX0 A;  4MBC A;  4I5S A;  2O1V A;  1BKN A;  2O1U A;  3H4L A;  4W7T A;  5BOC A;  4EMV A;  3FT5 A;  4WUD A;  4Q20 A;  4O0B A;  2XHX A;  2YGA A;  4CWR A;  2JKI A;  3C11 A;  3RLQ A;  2QG0 A;  3NMQ A;  4CWT A;  3EHF A;  4MP2 A;  2XDL A;  4XKK A;  5M4M A;  1NHI A;  4YKZ A;  4HXW A;  1TH8 A;  5BOD A;  3BMY A;  1UYL A;  5D7R A;  3K97 A;  4LWI A;  1TBW A;  3OMU A;  4PU9 A;  2XDU A;  3EHH A;  2ZKJ A;  4GT8 A;  4R3M A;  3RLR A;  5F3K A;  4QPK A;  1UYM A;  2Q8F A;  4XKO A;  2EXL A;  4CWN A;  4KSG A;  2WI2 A;  2O1W A;  3WQ9 A;  4CWQ A;  3EKR A;  2IOR A;  4EGH A;  4P7A A;  4EEH A;  1R62 A;  2YKB A;  4L91 A;  1TC6 A;  1YC1 A;  1U2O A;  1AMW A;  2XDK A;  2YEA A;  3LNU A;  4E02 A;  2YE6 A;  2QG2 A;  1EA6 A;  4MP7 A;  1Z5B A;  3R4O A;  1YT1 A;  2AKP A;  4CE1 A;  1THN A;  3TZ2 A;  3GIE A;  1I5C A;  2HG1 A;  2YE3 A;  4HY6 A;  3CRL A;  1Z59 A;  1H7U A;  1Y4U A;  4B6C A;  3INW A;  2FWZ A;  4CWF A;  5J6A A;  4GFN A;  5CTX A;  4KTN A;  1UYK A;  4P8O A;  3K99 A;  4WUB A;  1I58 A;  2BYH A;  2C2A A;  3ZM7 A;  4O07 A;  1JM6 A;  1ZWH A;  3A0X A;  4H7Q A;  3HZ1 A;  4L93 A;  3FV5 A;  4AS9 A;  3T2S A;  4O09 A;  2ZDY A;  4ASB A;  4MPC A;  3ZXQ A;  3ZXO A;  2VW5 A;  4ZKI A;  3G75 A;  4XKA A;  2XDS A;  3VAD A;  4HZ5 A;  3MNR P;  1U0Z A;  3A0W A;  3D0B A;  1I5A A;  1BGQ A;  3PEJ A;  5FNF A;  4XC0 A;  1Y8P A;  2WEQ A;  2YK2 A;  4JAS A;  4XIT A;  2Q8H A;  2BZ5 A;  2XDX A;  2FYP A;  3QDD A;  4FPP A;  4KQV A;  5IDM A;  4EGI A;  4XDM A;  5D7C A;  2QF6 A;  4B7P A;  1L0O A;  3WHA A;  4E00 A;  2BU5 A;  4GCZ A;  4BXI A;  3A0Y A;  3TZ4 A;  1UYE A;  3TZ5 A;  2XJJ A;  2FXS A;  4DZY A;  3OW6 A;  3TUH A;  1UYF A;  4HYM A;  1B62 A;  2YE8 A;  2VCI A;  4CWO A;  5GGZ A;  4HYP A;  1GKZ A;  2IWS A;  1UYH A;  3DGE A;  3K98 A;  3O6O A;  3Q5L A;  4U93 A;  5IDJ A;  2YEB A;  1YSZ A;  3G7B A;  1TID A;  4BQJ A;  1BYQ A;  2VWC A;  1AJ6 A;  4FCP A;  1YT2 A;  2YI7 A;  4LP0 A;  3R92 A;  1QYE A;  1ZW9 A;  1UYC A;  1I59 A;  2WI1 A;  4O05 A;  2BYI A;  2CCS A;  1QZR A;  3CRK A;  2YJX A;  3GIG B;  4YKU A;  3T0Z A;  2YED A;  1PVG A;  1I5B A;  4AWQ A;  4URN A;  4ASG A;  5M4P A;  1Y8O A;  1I5D A;  1OSF A;  1S16 A;  4H85 A;  4WUC A;  2K5B A;  2Q8I A;  4U7N A;  3PEH A;  2XX2 A;  2YKC A;  2JJC A;  4NH9 A;  1H7S A;  2CH4 A;  2WEP A;  2YEE A;  2CGF A;  1AH8 A;  1NHH A;  2YJW A;  5D6Q A;  4LWF A;  4K4O A;  4YKX A;  1QY8 A;  1YSR A;  2YEC A;  2YE2 A;  2YE4 A;  3R4N A;  4X9L A;  1YC3 A;  2YKI A;  4HY1 A;  1GJV A;  4XIR A;  3ZKD A;  3GIG A;  1YS3 A;  2BRE A;  1Z5C A;  1B63 A;  1YET A;  4E01 A;  3R4M A;  4NH7 A;  5L3J A;  3KE6 A;  2BRC A;  3OPD A;  4YKQ A;  4MB9 A;  4QPJ A;  2XX5 A;  2IWU A;  4YKR A;  2YEI A;  4R1F A;  3T1K A;  2XJG A;  2E0A A;  4JAU A;  4BIU A;  3TZ0 A;  2Q2E B;  4CWS A;  2YEJ A;  3FT8 A;  1UYD A;  2XHR A;  2ZBK B;  4O04 A;  4YKY A;  2YE9 A;  2BU2 A;  3RLP A;  3VHD A;  4BIZ A;  2XK2 A;  3EHG A;  5FNC A;  4KSH A;  5J71 A;  1UYG A;  1ZXN A;  3CGY A;  4JAV A;  4GEE A;  2WI4 A;  2PNR A;  4CE3 A;  5CTW A;  4EM7 A;  1AM1 A;  3QTF A;  4DUH A;  2VCJ A;  3VHC A;  3HYY A;  4FCR A;  2WI3 A;  4I3H A;  1Z5A A;  2XCM A;  4ZVI A;  3CWV A;  4KFG A;  2BT0 A;  2YK9 A;  4BQG A;  2YEH A;  2YEF A;  4H81 A;  3B27 A;  4AWO A;  3GIF A;  2YGE A;  2BU7 A;  4URL A;  4L8Z A;  1BXD A;  4JQL A;  5M4K A;  5FND A;  4XCL A;  2QFO A;  2WI6 A;  3B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...