5F3RA

Structure of oxidized udp-galactopyranose mutase from mycobacterium smegmatis in complex with magnesium ion
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
391
structure length
391
Chain Sequence
GNFDLFVVGSGFFGLTIAERAATQLGKRVLVIERRPHIGGNAYSEPEPETGIEVHKYGAHLFHTSNKRVWDYVRQFTDFTGYQHRVFAMHNGQAYQFPMGLGLVSQFFGRYFSPDEARALIAEQASEIDTKDAKNFEEKAISLVGRPLYEAFIKHYTAKQWQTDPKDLPASNITRLPVRYTFDNRYFNDTYEGLPVEGYTKWLENMAADERIEVRLDTDWFDVRDDLRAANPDAPVVYTGPLDRYFDYAEGRLGWRTLDFELEVLETGDFQGTPVMNYNDLDVPYTRIHEFRHFHPERTYPTDKTVIMREYSRFADNDDEPYYPINTEADRAVLAAYRARAKAETASAKVLFGGRLGTYQYLDMHMAIASALSMFDNVLAPHLSEGASLVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural dynamics of UDP-galactopyranose mutase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Isomerase
molecule keywords UDP-galactopyranose mutase
total genus 124
structure length 391
sequence length 391
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f3rA01
1J6UA 2GZ3A 3ASVA 3WTBA 1YO6A 4C4OA 1EVIA 4MVJP 2YDYA 2HQ1A 3M2TA 2NTJA 1KETA 2GN9A 2OBNA 3M1AA 2RHRA 2PR2A 2VRCD 4BGEA 1YH3A 4BNWA 5JY6A 1ADFA 4J6FA 3RI3A 2FRDA 2ZJ1A 1WW8A 3GVXA 1GUYA 1ZO8A 1PJ4A 4AJEA 1ZW1A 2G0TA 5GMOA 3L0DA 3JQ9C 1ML3A 3AM4A 3TOZA 2NSDA 4Z0TA 4DUPA 3U62A 3EY4A 3UKOA 4KMSA 1LA2A 1X7GA 1V0JA 1YB5A 4A73A 1HE3A 4O0LA 4OIMA 5I7VA 3HADA 1ZSVA 3ZWMA 1YQDA 4RGBA 3R1IA 4PZCA 3E9MA 2JJYA 2OP0A 3G17A 4YAJA 2EWMA 2O3RA 3D0OA 3BA1A 4RVFA 2IZZA 3INTA 3IJRA 5AOVA 4CLDA 1E1KA 1ZUD1 1VKNA 5C7OO 3PEFA 3K8ZA 1BG6A 4PLZA 4PRLA 4WCFC 4OKNA 2E49A 1JVBA 4LN1A 4MINA 2D1YA 1SPXA 5FI5A 3E5MA 3UN1A 1EZ4A 1K2WA 1UH5A 2Y0EA 2FSVA 4XIJA 3F1KA 3JQFA 2EW8A 3KXDA 2D59A 4DREA 4BMVA 4WOJA 3MZ0A 4FFMA 3DFUA 2I5PO 3CXRA 4AJLA 3LQFA 4W99A 3ZWCA 2GLXA 1IOLA 2IEDA 4DQVA 1VJ1A 3PZRA 2ZCUA 1E6WA 4OH1A 3PHIA 3JTMA 4R54A 4XDYA 3I9MA 1N1GA 3OBBA 1P31A 3OJOA 2GO1A 2IXBA 3T4EA 1GZ6A 3RUFA 3LDHA 4ZHSA 3IMFA 3F3SA 5KCZA 2P9GA 4ONEA 2CDAA 2PZLA 1TXGA 3SLKA 4YPOA 1YONA 3F4BA 4Q3AA 3S2EA 4CM5A 4FFNA 3OF2A 2O4UX 2Y67A 5DN9A 2GNAA 4UVDA 3TZ6A 1J4AA 2O7SA 4QECA 4Z6KA 4YVFA 3RKUA 4ZRMA 2WE8A 4DMLA 3NYWA 3KSZO 1PL7A 1P1HA 4EEXA 4I5EA 1AUPA 4MDHA 1C0LA 2VYND 1I2CA 3HE3A 4BQRA 1R16A 1LEHA 4J43A 4EUHA 2EJWA 5T57A 1TVEA 1ONOA 4XQGA 4RVGA 3NGLA 4XQEA 4NK5A 4AJ2A 3K5PA 1PJ3A 5JFOA 3LC2O 1MFZA 4ND3A 4UUPA 4JP2A 1HYEA 1WPQA 4IJUA 3BTOA 1CYDA 1Q7BA 5DBGA 3L6OO 1K5HA 4RVUA 3NT4A 4AJPA 2FY8A 4JJFA 3H9UA 1BVUA 3K9QO 4NBRA 3TJRA 2HRBA 1H6AA 3I4CA 1E3WA 3BAZA 1ZK2A 3H9EO 4HUJA 2PV7A 1DAPA 1GCUA 4Z9XA 2ILTA 1I24A 3JD4A 1XCBA 1ULUA 1T1RA 3ST7A 2JD1A 1RM0A 1X7HA 2HMWA 2HUNA 2Y66A 4IZHA 3AOEA 1AHHA 3EVTA 3DOJA 4M55A 1O6ZA 4KP7A 1YWGO 4RZHA 4OXYA 3RFVA 4FQ8A 1XHLA 4YJDA 1ID1A 1KY5A 3IJPA 4PG6A 1QLJA 5EESA 3QP9A 1FDVA 1HWYA 1BXZA 3AY6A 4PG7A 1UXGA 2V6BA 1QV6A 2WYUA 5EQFA 5I9LA 1V6AA 4NJOA 5CPBA 4BIIA 1D7OA 5ILGA 5JCJA 3NJ4A 3MJCA 4IS2A 1TT5A 3MJVA 4CMEC 1XGKA 1LLCA 4GH5A 5ICMA 1RJWA 3FBTA 1DFGA 3CIFA 4MVJH 1YBMA 4J2HA 4FFPA 3VC7A 1X1EA 1E7QA 1GYRA 3GUCA 2NUAA 1MLDA 1QP8A 3PQFA 3Q0EA 2NVWA 1HDGO 4RDIA 3WBBA 4I1IA 1BDBA 4RL6A 1DHRA 4J7CA 2P4QA 3MWDB 3JD3A 1OFGA 2C20A 3C7AA 4WUVA 4Z9YA 4HBGA 1H93A 3NGXA 4MJLA 3JQFC 4GBJA 1EK5A 3ADPA 4FC6A 3ZW8A 1F12A 1UP6A 3E03A 4YJGA 5COBA 3JQAA 4R1NA 1JW9B 2IRWA 3T4XA 4E33A 1B8PA 1U9JA 2DM6A 5IF3A 2PKQP 2WWRA 3DAGA 1T26A 4TRNA 3VKUA 2QHXA 4YA6A 2R2GA 4ND4A 4PLVA 4HP8A 3E8XA 2OOSA 4J4HA 4CMJA 1KVTA 3ZV4A 1PX0A 3ENKA 5THQA 1GAEO 4XCVA 4R68A 3AUTA 3GEGA 4HNHA 3FSRA 3C7DB 4JXKA 4M89A 3WMWA 3JQ7B 1B8UA 3W8DA 4ZGWA 4R1TA 2ZQYA 3L6EA 5DOVA 1F8GA 1W0CA 1YDWA 3KB6A 4J3FA 1EDZA 4B7CA 4CM9A 1YB4A 4HY3A 4BNLA 1ZJZA 3CUKA 3ZWOA 1C1DA 5A9RA 1WNTA 1PJBA 2BRUA 4EGFA 3OQBA 1PGJA 4D42A 2VTDA 5A02A 3IUPA 2NQTA 2O3TA 4BNXA 3STHA 3HZZA 2B83A 4OSOA 1EFKA 3GNSA 4CJXA 2NU6A 4I8XA 3TFOA 4BNUA 3HDYA 4FOOA 3OA2A 3C8MA 4IIVA 4HADA 3TN7A 4LISA 4LMRA 1Y8RA 4DVJA 3ZV5A 4LW8A 4XZ3A 4YACA 4NG5A 5AQ1A 3ABIA 3V1TC 4B8ZA 2PZJA 1VJTA 1ZSNA 4ZN6A 2GYYA 3ZW9A 1GFSA 3KYCB 3TFQA 5JW6A 2A94A 3K2BA 4RF4A 1YJ8A 4YT4A 1XDWA 1OMOA 1DDOA 1PSDA 3ICPA 2X58A 3VPSA 5C7IO 1LDGA 3O03A 2X9VA 3PI7A 4GSLA 1PGPA 4JLWA 4MKXA 1L1FA 3DFZA 1EQUA 3AW9A 1L7EA 3D3WB 1KVUA 1LRKA 3PVZA 4PCVA 5IZCC 5JC8A 1LC3A 3WGTA 3WWZA 4YAIA 5KWEA 5CP8A 5JSFA 1EE2A 2PLAA 3ANMA 4PVCA 2POQX 3QWAA 1E77A 2EKQA 3KTDA 2CF5A 4XYGA 3U4CA 3B70A 5TQVA 3RROA 1SMKA 2LDBA 2LDXA 3SJ7A 4MP8A 1YL5A 4R1UA 4CMIB 1LQUA 4OM8A 2Y1EA 3O8QB 2HSDA 2FOIA 3PP8A 1ZSYA 2IXAA 2Y0CA 3WWYA 1GU7A 4NZ9A 4A03A 2EIHA 3JD2A 2HK9A 2IEBA 4WJZA 3JQGB 1RYDA 4OSPA 2DTEA 1E0DA 3RFXA 3DBRB 4WLEA 3DDNA 2H5LA 4K1LA 1JA9A 1PZHA 3V5NA 3AUSA 1NVGA 1Y7TA 1X14A 5IDWA 3JQ7A 4HNGA 3LSYA 4E21A 3NTRA 4P8RA 4GWGA 1I01A 1G0NA 1LU9A 5T8KA 1I8TA 3EZYA 2ZK7A 2OHXA 3GVIA 4K6FA 3P19A 4OO3A 4TQGA 1P1JA 4E5KA 1F17A 4AJ1A 2AQKA 3RQSA 1BMDA 1NHGA 1R4MA 4A7PA 4A5OA 4P4GA 3AFMA 3DL2A 3GK3A 1VLLA 1WMBA 4R01A 4CUKA 3PYXA 3IAHA 1U28A 5EINA 1HXHA 3OICA 4K26A 5THKA 1ADCA 1IY8A 3S1LA 1LDEA 1P0FA 2EW2A 2P5YA 3MOIA 3GUYA 4GVLA 4PZDA 5DOZA 1ADBA 1PZFA 1QMGA 1ZCJA 5JAMA 3DR3A 3WLFA 1GYQA 1UDAA 1Y9AA 3VAZA 1WZEA 2DU8A 1MB4A 1KIFA 3H8VA 1E92A 5AXAA 3M1LA 4IXWA 5CPFA 4MP6A 1QG6A 4WCFB 5JXWA 4UVEA 4GAEA 1PTJA 4UVGA 1HZJA 4HFJA 3OM9A 1JKIA 3ONDA 3PRJA 4IXTA 3JQDA 3D64A 4M8SA 5JYEA 3DBLA 5KKAA 1MG0A 3KOUA 3WGIA 1ENYA 3PYMA 2CVOA 3OFSA 3K96A 1JLLA 2GF2A 4IZIA 1XKQA 4GLLA 5DT9A 3I83A 1HE2A 5GZ6A 1U5AA 2GD1O 2D4AA 4BMSA 2EEZA 3PWKA 1M67A 2QYSA 1KS9A 1VKOA 1HDCA 1I32A 2HAEA 3BHIA 3ZV3A 1HLDA 4MVJG 5AYVA 1D1TA 5CEEA 3V1YA 3ZU4A 2G5CA 3HN7A 4EZBA 1ZFNA 3MTJA 5K6AA 4KQXA 2P5UA 3AJRA 3WGOA 5KNLA 3OMLA 2QZZA 5ICSA 3VZSA 5EIOA 1K6JA 4PLCA 3BHMA 2Y93A 1VL6A 1GEGA 3U4HA 3MJEA 2PGJA 1GQQA 3WSWA 4BO7A 1C14A 4LVCA 4KUGA 3FD8A 4TKLA 1HLPA 3ZNPA 1IHXA 1M75A 3ZI0A 3D5TA 1H5QA 1NHWA 2FPPA 3DXFA 2C7GA 4NBUA 1VJ0A 2YHIA 1K0UA 1E3LA 3INRA 1SB8A 3TSCA 2A35A 3DZJA 1BXGB 1DRWA 4Q3BA 1WVGA 1IUKA 2F1KA 2Q3EA 4BB6A 3NUGA 3PYLA 1QORA 5U9CA 1LDMA 5ES3A 3QIVA 4IINA 1M6WA 2DPGA 5BSFA 1R4MB 4ESOA 4YT8A 1GD1O 4AJ4A 4YXFA 1DEHA 3WGHA 5KJCA 3VH3A 2J3HA 1EK6A 4JJGA 1ISGA 1A9YA 5BT9A 2JCYA 4DQUA 2J6IA 4MIYA 5T5QA 1GYPA 1VPDA 3ZNQA 2OZPA 4OYRA 4BO3A 2NVUA 3NX4A 5I8ZA 5L7TA 3JYNA 5C3MA 1JU9A 1HE5A 2W2KA 4DIFA 3IL2A 4PG5A 1FXSA 1ZKMA 4IGFA 3ANLA 2O2YA 4NDNE 5COAA 2Q50A 1LTHR 3I9JA 2A9FA 2AQHA 1IPEA 3HUDA 3KM0A 3RCBA 1IZ9A 4AL4A 2NLOA 4I9UA 3LYLA 3CPSA 1T2EA 1SO8A 2FSSA 4N7RA 3U9LA 4DRYA 4EDFA 3IUSA 2O2SA 3I9OA 4GX1A 5BSGA 2RIRA 3RC9A 4GGPA 1PEDA 3RKRA 4R41A 3L6DA 2PFGA 4OOFA 2PGDA 4TVBA 1SZJG 2BKAA 4B7XA 4CODB 1LUAA 2ZTUA 1DIHA 1DPGA 3GC6A 1Y81A 4HX5A 4LGVA 4RPLA 5B4TA 4JIGA 1AGNA 3FNEA 5F1OA 4RPKA 3EUWA 2RCYA 3GHYA 4GMGA 3HNPA 3U09A 1N5DA 3H5NA 1LBEA 4IQ0A 1A7AA 1Y8QB 5ITVA 1GY8A 2FN7A 1GZ4A 2CFCA 2HMTA 5EERA 2EKLA 3LLVA 1R0SA 4H16A 3KETA 5C7LO 1QYDA 3ORFA 4ZQFA 4PRKA 3BZUA 2ZCVA 5EL0A 2YDXA 2NQ8A 3VH1A 1P33A 3PIDA 4II2A 2AA3A 3GRPA 3ZU3A 4AICA 1NPDA 3WDSA 2GGSA 3H9QA 4RCVA 1CIVA 4DLLA 4AJNA 4BKPA 5IJZA 2VNAA 2OGUA 3E1KA 8LDHA 1PGNA 2OL4A 1H9AA 1YQXA 2ZTVA 1HDXA 1DJNA 4N5MA 1P74A 3KSUA 2ZTMA 1GCOA 2FPIA 2I65A 3I52A 1MA0A 1MFPA 2Q4EA 1CDOA 1IYZA 4WE3A 2CVQA 1ISHA 2DBZA 1PWZA 2UV8A 3A06A 3TWOA 3ON5A 1FDWA 3MOGA 5F3RA 4AJHA 1TB4A 4R5HA 4NJMB 3X2EA 1ISIA 3VZPA 3NDRA 4IDAA 3UOGA 3A9WA 2Y1FA 1R0KA 4Q3CA 5TS3A 4R1SA 4L4RA 1DLIA 1LC0A 3TL3A 4XJTA 2J5KA 2O3UA 4CMEA 5JDIC 1FDUA 1U4SA 5TJHA 4XQCA 5CDUA 5AXDA 3RUAA 4TRMA 1T4BA 1GQ2A 2DBQA 4YBZA 2JHGA 3WLEA 1ISFA 2IYOA 3I9NA 3LF2A 4O63O 4J90A 1SOWA 2NNLD 4ZQGA 2EP7A 2JFGA 4MIEA 3OQ6A 2Y1OA 4INAA 1Q1NA 4B4UA 5L9AA 4BOYA 5BNIA 4WEOA 1JKJA 4DC1A 1W4ZA 1V3TA 5JBIA 1WP4A 1Y5RA 2O4CA 3RASA 1O5IA 3OJLA 4XYBA 5KJ1A 3ZNNA 1ZZEA 1ADGA 3WNVA 3I1JA 4GX0A 4L0QA 4BNHA 3JYPA 4FC7A 2VQ3A 5A3VA 2X7HA 2WSBA 4Y9DA 1C3VA 4YQYA 2I99A 1P3DA 1Q7GA 3GPIA 3G79A 2X0RA 1LRJA 5GY7A 4PLPA 3OA0A 3GGPA 5HS6A 1BTOA 1ZNQO 3B20A 3KVOA 2P4HX 3F9IA 3RJ9A 1XQ1A 1WDKA 2DQ4A 5IDYA 1BSVA 1PL6A 1BXKA 1H2HA 2H6EA 1LSOA 3AUAA 4M86A 1U3WA 4QO7A 1XU7A 4CM7A 1C1XA 4D46A 5JCJD 5KVQA 3PXXA 2X1HA 4L73A 1E6UA 5TSDA 1SB9A 1BW9B 3FF4A 3EGOA 1VSVA 5A9SB 2P91A 2H1SA 3RWBA 4DIOA 2OMEA 3W4IA 4FB5A 2NU7A 2I67A 3QHAA 4BNTA 2NACA 3GH3A 3QWIA 3DOCA 1DLJA 5A04A 5COQA 5TT1A 5JE8A 3UCFA 4IDEA 1FF9A 4DPLA 3U5TA 2PGLA 4DXHA 3PJEA 3ZU5A 4F46A 3W8FA 3LT0A 2DFDA 4BB5A 3JQ8B 1NASA 4OOEA 1MXHA 1WLYA 4B3IA 4EJMA 3HB5X 5KJFA 4ALJA 4CMBA 1WMAA 1A27A 4QQRA 2CF6A 5DDIP 1EUCA 3VVCA 3D3EA 2NVBA 4UREA 3EAGA 3I6IA 4BGIA 3JQCA 2C2YA 5KJEA 4XGNA 2AXQA 3VOSA 4L4SA 3WB9A 2CDCA 1Z73A 4MVJE 2YHIB 2ZB7A 4RF2A 4HXYA 5I7SA 1T25A 3KV3O 4E0BA 4ND1A 5G0SA 4J0EA 3GT0A 4CL8A 4YAKA 5KVVA 3K6JA 2YZ7A 4OHUA 4J9UE 4CLRB 3VPHA 4E5MA 2QRLA 3DB2A 5DBFA 1U8FO 1OAAA 4GKBA 2OBYA 4J4BA 1SEVA 3HB4X 1KEUA 2Y99A 4YJFB 3S2GA 3INGA 2VUTA 1OC4A 3A14A 3H7AA 3PLRA 1QLHA 3KYCA 3NDJA 1ZBQA 3ONFA 1DXYA 1PJLA 1KVRA 2VHVA 1PGOA 2OXIA 1FJHA 2AG8A 3N7UA 1N92A 1VRWA 4W6ZA 1N7GA 1T24A 3BXXA 1P45A 1B7GO 5KKCA 4Y6PA 2JFHA 3Q3CA 1V3VA 4WECA 1MUUA 3DHEA 1DFHA 1ZH8A 4D79A 3JQEA 1YKFA 2GR9A 1E7RA 2VYVA 3FHLA 2BH9A 3ZHXA 3R3SA 4RORA 1F06A 3EC7A 4NQZA 1AE1A 3MJ4A 1BHSA 3JQ6A 1NP3A 2FR0A 4GPD1 4HWKA 4R16A 3TZHA 4ILKA 2D0IA 2VHWA 5I8WA 1ONPA 1GPDG 1R4NB 1UAYA 5TX7A 1HKUA 1QYWA 2PWZA 2DUUA 5A9SA 4YEDA 3QJ5A 3RU7A 5KVSA 5IDQA 2WE7A 3RFTA 4IPTA 2NM0A 3DZGA 3TF5A 3G3EA 4FSHA 2Y68A 3GZNA 4E6PA 4IS3A 4L8VA 4MVJA 3FRJA 2C07A 1OZAA 3FWNA 1V8BA 4ZICA 3QVWA 1D8AA 2I3GA 1C0IA 2HJRA 3BMQB 2BMAA 3HQ4O 1KVQA 2ZYGA 3W8EA 1R4NA 3G49A 4I9HA 3CTMA 5DCUA 5G0WA 1E5QA 3VVBA 1KC3A 4L75A 1M76A 4JCOA 1EEHA 1HL3A 3IOYA 2YV3A 3H2ZA 4CMIA 1Z74A 3I4FA 3OECA 3GZNB 2RH8A 4JK3A 4JBIA 3WQQA 3DBHA 4LVUA 5JO9A 4BO2A 1Z6ZA 5JO0A 3GHHA 4ZQBA 1Y6JA 2Q1UA 3DWFA 3GVPA 3DMTC 3BMOA 4Y98A 2A4KA 2B35A 2TMDA 3AI2A 1U7TA 2I76A 3MWEB 1R0LA 4MIOA 2VOJA 5F21A 3VZRA 4BNGA 1PGQA 4PVDA 3ZCXA 2O3JA 4BMNA 3PIIA 4RVHA 2FMUA 2YJZA 3RD5A 4CL3A 4ZVVA 3GLQA 4JNKA 5DNAA 2OUIA 1N7HA 3FR8A 5KJ6A 1NPYA 2BD0A 1K3TA 5G0VA 1B3BA 1ZK0A 3RC1A 4U7WA 2HDHA 4KWHA 2AMFA 3ZU2A 1DIAA 5HS4A 1DC6A 2Y05A 4CQMB 4R4JA 1YQGA 4WPGA 2CNBA 1Q0HA 2J3KA 5A5EA 3D4PA 4NJMA 3H6KA 5G2OA 1YDEA 1VI2A 4I5GA 4GX5A 2WEKA 4RQUA 4ALLA 4CMCA 2VWHA 2X0IA 1KY4A 3T7CA 4E31A 2E37A 1IHYA 2DTDA 3D3WA 5L4LA 1BXGA 1DO8A 3MJTA 5K0ZA 1SEPA 4P4NA 4KDEA 3NRCA 3ZH2A 4TRRA 4BGVA 1WWKA 4XYLA 3DZFA 4P22A 1E7SA 2J8ZA 1F14A 4QT0A 4B4WA 2GUGA 2AW5A 1EQ2A 2D5CA 4QUKA 1YB1A 4Z3KA 2EXXA 1PQPA 4ALKA 3VDRA 3TL2A 4J7XA 4HV4A 3WJ7A 2C82A 1K6XA 1DB3A 4E13A 2X5OA 3IIEA 4Q39A 2HJSA 5LDHA 1DIBA 3RBVA 4UUOA 5TNXA 1V3UA 1DHTA 4XEHA 1PU2A 3AOGA 1UXHA 3F47A 1G1AA 2B36A 4OXKA 2WD7A 3BIOA 1E1LA 1V35A 1QRRA 1XWFA 2HO5A 3PDUA 2FPGA 3U49A 2DUWA 2OP1A 4FN4A 2O3SA 2D3TA 2FWMX 4Q3DA 3KEQA 2IZ1A 4M49A 1T2DA 1UDCA 1E3SA 1Y8QA 3DMYA 4IM7A 4L76A 4RF5A 3UICA 1R66A 4BS9A 3L4BC 5I7EA 5L51A 4KZPA 4WCFA 1UJMA 1UZLA 4YJGB 4IJVA 3K73O 4Y67A 1HE4A 4D41A 4BKOA 3I9KA 3DBLB 4F3YA 3TNLA 1P1FA 4N5LA 3BMOB 4RF3A 5IFLA 5TRTA 3WBFA 2UVDA 5A1TA 1WXDA 1EUZA 4EW6A 4I08A 3JQAD 4NBWA 3MTGA 4OL9A 4BVAA 4GKVA 1X7DA 4CR6A 1ZK3A 3GR6A 5I9MA 4CQLA 5GZ3A 2RHCA 2VHZA 3DZKA 3QWBA 5I7FA 2XF8A 1GV1A 1PS0A 3Q1LA 4R9SA 3B1KA 3GQVA 4NFSA 2W2KB 1NR7A 1LSJA 4J16A 2W4QA 3GRKA 1QYVA 2CVZA 3CMCO 2DTXA 5ILOA 1HETA 5KVCA 1NBOA 1D4FA 3FNGA 4D0SA 1U3VA 3WOHA 1A9ZA 1CETA 3B1JA 3R0IA 1JWBB 3AU8A 1LSSA 2Y1GA 3ROKA 4CUJA 1NYTA 4YJHA 5CG1A 2BGMA 4LSWA 3UH1A 4DLAA 2XAAA 2R00A 4BKUA 2C0CA 3WTCA 5B4VA 4R69A 3WSVA 2UDPA 5L40A 3OEWA 1JVSA 2WJPA 4IDFA 4Z3DA 3L9WA 1I3MA 3X2FA 4YR9A 1I3LA 3PQEA 2YYYA 2VZ0A 4M1QA 1D1SA 5G0TA 2V6FA 3K2EA 4QO8A 3OQ1A 4J1NA 4NFHA 3HN2A 4N54A 2VHXA 2NTVA 4D3SA 1I2ZA 4W7IA 1OBFO 3EDMA 1D3AA 2JL1A 2NWQA 1B2LA 3B6ZA 1EVZA 1CRWG 1NAIA 1NVMB 4IIUA 1YGYA 1E3JA 3Q9UA 5IXYA 2VT3A 5JLAA 4Q9NA 3GAZA 4GI2A 1XR3A 3E82A 4XRGA 4LRTB 1B8VA 3DOOA 1LDYA 4FJ0A 4XDZA 2Q2VA 2Z95A 3KEOA 5T8KC 4BNKA 2E6UX 3AI3A 1SOVA 1I10A 5B1YA 1PJSA 2W90A 3KZVA 1O8CA 3UGKA 1SNYA 1Z7EA 4H7PA 3KRTA 5U4QA 3FN4A 3HDJA 2PY6A 1ZXLA 3LZ6A 4JGBA 1FDSA 1QYCA 3RC2A 5EMHA 2WMDA 4ZQHA 1RKXA 1T1SA 2BI7A 4BKRA 1VSUA 3G1UA 2J5QA 3WS7A 2FR8A 4BNNA 1O94A 3NV9A 4TZTA 2YUTA 1R37A 1BRMA 4QFCA 2HRZA 1BVRA 2GERA 4RLHA 2EP5A 1E1NA 4NFYA 3JSAA 3NT5A 4ZQEA 3MJSA 4IGEA 1QSGA 1UZMA 2VTEA 4NU6A 3NKLA 3ULKA 3UVEA 3DZHA 1EDOA 3CKYA 4BO6A 2B69A 3NEPX 4R9RA 1Z82A 3GFBA 3SC6A 3F5SA 3JQAB 3PGJA 4KQWA 1I3NA 1LDNA 1LX6A 1A7KA 2X5JO 3E9NA 1QR6A 4I9NA 1MGOA 4DYDA 5A5FA 2FR1A 1ISMA 1GQYA 5CAEA 3U4DA 3LF1A 2QRJA 2V6GA 2Z5LA 1NQTA 1MXFA 1HRDA 1P0CA 3DMTA 1A4UA 3GY0A 2C54A 3I9LA 5A06A 3L4BA 1N1EA 3FCOA 3LT2A 2GN4A 3O38A 3S8MA 3EHEA 4O5OA 2Q1TA 4AJKA 1ENZA 2NU8A 3C1AA 4L9RA 2I66A 3WFJA 4HFRA 2AG5A 3PHLA 4ND5A 2E82A 4UAGA 2OO5A 3LC7O 2HMSA 4XA8A 3BTUA 2CDBA 5FEUA 3K92A 5A03A 3OJ0A 4JROA 5IG2A 2XOXA 3OEYA 2Q4BA 2PD6A 2JFFA 5JDCA 2YFQA 4CM3A 4FGSA 3U0BA 3M6IA 5TC4A 5CDGA 2Q1WA 4Y6SA 1C1XB 4XGKA 4XQ9A 5G0UA 4GMFA 4J9VA 1H6BA 3MEQA 2VYVD 1DAOA 3L07A 2I3AA 1KOLA 3GFGA 4ROSA 5B12A 3WGYA 1BW9A 2ZQZA 2AHRA 3SX2A 3F1LA 3CINA 4XR4A 1R12A 3PPIA 4IJKA 4PLTA 1MX3A 2ZATA 4BNJA 3GG2A 2H9IA 1IZ0A 2X86A 1B26A 5JAIA 4EI2A 4F6LA 4IQ8A 1E5LA 4RLSA 4B79A 4CM8A 5MDHA 3AK4A 4LCEA 1LLQA 2RAFA 1VL8A 1H9BA 4CQMD 3RBXA 4A2CA 1QKIA 4DBZA 2ET6A 5T67A 1XSEA 2W2LA 3AU9A 3ZWBA 1U8XX 5L53A 2G17A 2J3JA 5LCXA 2R6JA 3VZQA 2GZ1A 4JQCA 1WAMA 4FPXA 1HDRA 1U3TA 1N9GA 1EUDA 4J7UA 4ALMA 3QWHA 1PS8A 4XYMA 2HKIA 4PLFA 3VHRA 2V65A 3ZWAA 1C0PA 3NAQA 1X1TA 4NR0A 3NT2A 4YQZA 2PKQO 2C5EA 3ETEA 4LCJA 1EVYA 5L4NA 2P68A 4W4TA 4EITA 5F5NA 5IXSA 5ENVA 1Q0LA 2J5RA 3PJDA 4J91A 5KIAA 2W2LD 1LNQA 5A3JA 2C29D 1B15A 4TROA 3PFWO 4DLBA 1NFRA 1J49A 1AXGA 1IE3A 1HDOA 1LQTA 1EFLA 3RIHA 4D3DA 1HDZA 1E3EA 2SCUA 1GTMA 2AEMA 1KEWA 4B4VA 1U4OA 1ZK4A 3PDJA 3QVTA 1XU9A 1RM4A 4R3WA 1MP0A 2CUKA 2X23A 2IODA 3H5AA 3WGQA 4XX0A 4DPMA 3PWSA 1A72A 4MO2A 5LDGA 4PN3A 4A26A 2WD8A 1I5RA 2JKVA 2DBRA 1NM5A 1P1IA 1NPTO 2CMDA 1DC5A 4QTZA 3A4VA 3WYEA 3RUEA 3H3FA 4G2NA 5H81A 5LC1A 3RVDA 3ZWPA 1CJCA 1HYHA 3HJAA 4IQGA 3ADOA 3DAPA 4XR9A 5EN4A 4L74A 2PD3A 3DZBA 2XXBA 4RPHA 2BFMA 1WDLA 3DC2A 2X6TA 5HRUA 3WGGA 3TZKA 4NNJA 3RUHA 5L3ZA 5B37A 1PQUA 2VCYA 5H83A 1M66A 1H94A 1Y9EA 3FWZA 1NQAO 4RQTA 5EJ2A 5FWNA 2PK3A 5TLSA 3AI1A 3BMQA 5HA5A 1SC6A 1TT7A 4XJSA 4FW8A 2P9CA 2YV2A 3EZLA 3IP1A 1I0ZA 1FK8A 3UF0A 3ASUA 4XB2A 3RAJA 5F1KA 3F4LA 1PJCA 4FS3A 3JYLA 2PZMA 1BWSA 3DO5A 3PHGA 4E5NA 4XYEA 4IDCA 4DYVA 4Z0HO 4B3HA 1UP4A 3A1NA 3S2FA 4BO1A 4YT2A 4YYZA 1E7MA 5IN4A 4XRRA 3W6ZA 4EYEA 3OETA 2PH5A 2W8ZA 3DBRA 1XYGA 5JYDA 5A05A 4KUEA 4S3MA 4TMFA 4U0JA 1K6IA 2I9PA 3GOHA 1AHIA 3W6UA 4DL9A 3WIEA 2PZKA 3K31A 4HFMA 4EJ6A 2BGKA 2BF7A 3QW2A 3RBZA 4N5NA 3P2YA 3OJEA 4L4XA 3V1UA 2FHSA 2P9EA 3HSKA 1B3RA 2QZ9A 3FNHA 4Z9FA 3ZWNA 2HMVA 1VC2A 4DQXA 3QQPA 4RPJA 5ITWA 2O7QA 2ZJ0A 3O8QA 1GL3A 1ARZA 2GRAA 3EVNA 5JPIA 3V2HA 3WG9A 3E5RA 4BO4A 3RSHA 4FBGA 5EPOA 1T4DA 3OH8A 4URFA 1TEHA 2BELA 2EF1A 2V7PA 3AFNA 4W82A 1I2BA 4A10A 2WD7B 1IULA 4KUHA 4YRAA 1W8DA 3N74A 5TIIA 2EGHA 4KTTE 3Q6IA 5B4UA 8ADHA 3IKVA 3OIDA 3B1FA 4XIYA 4U5QA 4JX8A 4WEQA 2C59A 1R15A 4GL4A 4QEDA 1Y8RB 1CEQA 4NPCA 1HSOA 1XLTA 1J5PA 1T2AA 3U4IA 1Q7CA 4ALIA 1PL8A 4F6CA 4RZIA 3D4NA 4CMAA 4P4LA 4YJFA 3DTYA 3HFSA 1CQIA 2YFHA 4EUFA 1PR9A 1X0XA 3CZRA 6ADHA 3WMXA 4CMKA 2VRBA 4IMRA 1NVTA 3FPCA 1DOHA 1IB6A 1NAHA 1ZVMA 4OGWA 3E18A 1ZEJA 2X0NA 2AEFA 4PG4A 1H2BA 2EV9A 4YJHB 5JC1A 4NBVA 4LMPA 4BNVA 4CV3A 1KYQA 3PGXA 4IDBA 3HWRA 5CHEA 1DIGA 4BO0A 1FDTA 3UCXA 3CH6A 4FFRA 2FZEA 2BGLA 3WYBA 5BQFA 3QWFA 1DSSG 1BDMA 4IUYA 5AXCA 5BR7A 3H65A 3PHHA 2BFOA 4YB8A 1YOVA 1HTBA 3BTVA 4YRDA 4ZRNA 4XD2A 4R5MA 4WASA 2UYYA 3PQDA 5JS6A 4RJTA 5IZCA 2CZCA 4PG8A 2QYTA 3GNQA 4MVJF 2DPHA 5TJ9A 5JMPA 3W4JA 1H6CA 3KLPX 1PQWA 1CQJA 3KBOA 5T6BA 3Q2IA 3FNFA 5FF9A 3HDQA 3ITDA 4N18A 5BNTA 5JAZA 5AXBA 4CQLB 4IY1A 2Y1DA 4IBOA 2HU2A 3WIDA 4B3JA 4D45A 1HEUA 2BFAA 1E6EA 3GF4A 3SEFA 5GZ1A 4E32A 5ER6A 3VDQA 2TMGA 4KWIA 2Q49A 1LDBA 3WGZA 1UXJA 1ONNA 3VPXA 1Q2XA 3WNQA 4OAQA 3L77A 2F00A 4PLYA 4CMGA 4DMMA 3PFFA 4H3VA 2HCTA 4A0SA 2X8LA 4OQZA 4FD3A 1MV8A 3GGGA 4JBHA 2EG9A 4ITUA 3BMCB 3ETDA 2AQ8A 3OSUA 4U6SA 4WLFA 3ZWWA 3AOEC 1Y1PA 1NX6A 4GWKA 4FIZA 3ZDFA 1JDJA 4CMHA 3GG9A 3WQSB 4DA9A 1XQ6A 4YAGA 1ZJYA 4DIBA 5ENDA 4QXMA 4RVSA 3P5SA 3TPCA 2G82A 3LVFO 4UEKA 2CD9A 3WFIA 2HK7A 3H5RA 1I36A 2AE2A 2IE0A 1GPJA 4NK4A 3U3XA 2JHFA 5JNLA 3LC1O 5J23A 3C85A 3KO8A 2R00C 3WXBA 2Q2WA 2ZIZA 4XGIA 3ZWXA 3F5QA 4WCDA 4OJNA 2BI8A 3UCEA 7ADHA 2B5WA 1PIWA 4O6VA 2VOEA 5F1PA 2W98A 3EYWA 3FTNA 4YWJA 3HDHA 5CDSA 4D44A 1BGVA 2UUPA 1EE9A 3M2PA 4WLOA 4TKMA 2GPTA 1I33A 1PJ2A 4E12A 4BHTA 4AJIA 4Y8VA 3JD0A 1DC3A 1PZEA 1SCUA 2ZKLA 4FJ1A 4FDAA 4YCAA 1YE3A 1UP7A 4KOAA 5DULA 4RO0A 7MDHA 2Z1NA 4CQMA 1PR3A 1J0XO 5H82A 2PD4A 2O50A 5TT0A 3CMMA 4IJWA 2A92A 3CEAA 1A5ZA 3QV1A 4CM6A 4WNIA 3P7MA 4MOWA 2YQ4A 1P9LA 3C24A 2EKPA 2QW8A 4WLUA 3TRIA 4BNZA 4PZEA 1NTOA 3GN1A 1OOEA 3O9ZA 4XWYA 1VL0A 1E7WA 2CY0A 4NHEA 1ENOA 2B4TO 4E5YA 9LDTA 5I9NA 3UXYA 5L7WA 4MVJD 4CM8B 1GDHA 1PZGA 2YQ5A 3LK7A 1OI7A 2AQIA 3EW7A 4BKQA 1PJTA 3SVTA 3KSDO 1G6KA 3H9JA 2VWPA 5U1PA 2FP4A 4MPDA 3VKVA 4EBFA 1WDMA 5HTOA 3JYOA 1QYXA 4KDFA 4R51A 5DBIA 3DBHB 1KEVA 3D5QA 1YL7A 3OP4A 5TGDA 4CR8A 3JQBC 3I23A 3ROQA 5FYDA 3DBVO 1ZXBA 2VHYA 3IP3A 3RUIA 3LU1A 5CDTA 1CERA 2G76A 3BTSA 4J1QA 1P1KA 1HSZA 1O95A 4HKTA 1B14A 1N8KA 3PJGA 3PTZA 1JQBA 3UAGA 1GEEA 4B7UA 4J4TA 1PS9A 4G5HA 2WTBA 1YBAA 4ID9A 1ISJA 1TLTA 2DLDA 4PLWA 1IL0A 3H4VA 5L4SA 1GUFA 3VH4A 2DKNA 3KYBA 4RV9A 1QXSA 2YY7A 2FZWA 2VUUA 2G1UA 2ZYDA 3K30A 1NWCA 3GVCA 2ZYAA 4BQPA 2X5KO 4GGOA 2JAPA 1R6DA 3L4SO 3UUWA 4IMPA 4CPDA 5IN5A 2VRCA 3DAFA 3PWZA 1ZMOA 4K28A 4BO9A 4WOKA 5F5LA 4CV1A 5CG2A 1HF3A 4II3A 3WICA 3DONA 3JQBA 1UZNA 2NVUB 1ZK1A 4OQYA 3JV7A 1LI4A 5L95A 3WJAA 1YJQA 3IKTA 1E1MA 1C0KA 4QFDA 3GZ4A 1EMDA 2DBVO 1DIRA 1UR5A 2IDZA 5JDCC 5L45A 1LLDA 4PLGA 4UVHA 4WK6A 4B4OA 4WNCA 1PJQA 1DRUA 4FFLA 5DF1A 4HFNA 2E48A 4CM1A 1YOVB 3OIFA 2YHUA 1E3WB 1MG5A 4CLOA 4EEZA 4NU5A 1SAYA 2ZB8A 1LJ8A 2QQ5A 3O26A 4RPGA 4XB1A 4YT5A 3GNTA 2D8AA 4CUZA 4EJ0A 4NH4A 2WM3A 2HLPA 1S6YA 3P2OA 2PA3A 1HDYA 4WLNA 2PNFA 1N9GB 4JN6B 3UFXA 3L9XA 5BNFA 3H3JA 1CF2O 2PKRA 1ENPA 3ZWYA 2E4AA 5FFFA 1X0VA 4BO8A 3I5MA 1NR1A 3QVOA 3OJFA 4E2XA 3KYDB 4CLHA 2DVMA 2XXJA 3NTQA 3FI9A 3W4KA 3AY7A 4IDDA 4LK3A 4E2ZA 4ZD6A 3PK0A 2JCXA 3C3XA 1JKFA 1NQOA 4NIMA 3ROMA 4MKZA 4BO5A 4BV9A 2WYWA 2Q45A 3ZGYA 2QIOA 1OC2A 1GV0A 2C7VA 3T7EA 1W73A 4MP3A 1XIVA 4UULA 1HT0A 1Z45A 3ZHYA 3DHYA 4A27A 3V2UA 3FPLA 5K9ZA 3C1TA 1P1RA 4D3FA 5L7YA 4FOSA 1RPNA 3C1OA 5ADHA 4G65A 5DCWA 2X22A 1U2DA 5CFZA 3KHUA 1AN9A 1NNUA 2VYNA 4ALNA 4OXNA 3IQDB 1C1DB 2AE1A 2GASA 3JQ8A 3ONEA 4AJJA 4X54A 5JY1A 5HWSA 4F45A 5JAQA 3R6DA 4Y6RA 1XELA 3TQHA 4DTIA 1ZIDA 1M6HA 3A28A 3H2SA 3SXPA 5CEJA 3ZZNA 1AXEA 2JD0A 1T2FA 5C37A 5HM8A 3I3OA 3TDKA 3IDSA 4YRBA 4DWVA 1S7CA 3AM3A 5CEFA 4BL5A 1A4IA 4GSKA 1DBVO 3ENNA 2WDZA 3VPFA 2NV6A 2EGGA 3COSA 4LRSB 3D7LA 2CSUA 4GQAA 4U8GA 1X15A 4UUNA 4BNIA 1VM6A 3N58A 3FBGA 3ROPA 4G81A 2Q1SA 3AWDA 2B4RO 3PLNA 4RDHA 3VTZA 4CM9D 4C7JA 4WKGA 2J3IA 3D4OA 4ZJUA 4E4YA 2AEJA 1E7YA 1TT5B 3IC5A 3GGOA 3ICCA 4QX6A 1RM3A 1RYEA 3ZN2A 1JAYA 2GN6A 2B37A 3ANNA 4O59O 3BMNB 3OHSX 1I30A 5C5IA 3MCVA 4C7KA 2X4GA 2NADA 3GEMA 3E48A 1UXIA 2VNSA 2VN8A 3WX0A 4J1SA 3QSGA 3QVSA 1T2CA 1GADO 1Q0QA 2H63A 2X9GA 3D1LA 1Z7BA 3WQRA 4AJOA 2NU9A 1UDBA 3NTOA 1Y5MA 4J49A 1LRLA 1O89A 1NXQA 1UUFA 3GEDA 4PIVA 1GR0A 3JYQA 4PGFA 4Q3NA 4J0FA 1YL6A 3O4RA 1GUZA 5T64A 4E2WA 4UEJA 3FR7A 1L7DA 4J2OA 3DHNA 4BGUA 5JMWA 3ZWVA 4KTVE 4NBTA 5KTKA 4FR5A 2EERA 4UEOA 4BUCA 5ER9A 3UHAA 3KUXA 5A4DA 4WGGA 3SC4A 2GSDA 4M87A 3AY3A 4TSKA 1KVSA 5G4LA 1V9LA 5IAAA 4CM4A 2EHDA 2D2IA 3ZNOA 1XG5A 3WR5A 4DGSA 2RH4A 3GDGA 1FMCA 9LDBA 1Z75A 3SLGA 3CSDA 3UW3A 2QX7A 1YXMA 2D5AA 2HMUA 4S1VA 2O48X 3TOXA 4DPKA 1NFQA 2VZ9A 4U0KA 3V8BA 3ZHZA 5JDIA 2GDZA 1K89A 5HBRA 4BNMA 4IDGA 3QE3A 4UVIA 4B8WA 3VH2A 3DEYX 3KYDA 1O9BA 4PFJA 4W9NC 4YAEA 3KLMX 5MGBA 4K6CA 2NTNA 6LDHA 1TI7A 3PJFA 5JCXA 4DBVO 5IZ4A 3DQPA 1UXKA 3G1TA 5G4KA 4E30A 4JJIA 1PWXA 1ZEMA 3BMCA 4AVYA 2QRKA 4YTEA 4DC0A 4NI5A 1LSUA 1DFIA 2JD2A 4CV0A 1EBUA 2VZ8A 4CLRA 5K6AC 1EBFA 1CWUA 1JTVA 2IYPA 4FJ2A 3GDOA 4JP3A 5DZSA 5FI3A 3H9GA 1RWBA 3GA0A 2X9NA 4CM4B 4I5DA 1XA0A 2Q99A 1EVJA 1XEAA 3EMKA 3GMSA 1O0SA 3RUCA 3RC7A 4O1MA 2HK8A 4I5FA 1JAXA 1DC4A 3S55A 2DAPA 1KBZA 3C7CB 2O3QA 4TWRA 3JQ9A 4QSMA 3E9QA 4D43A 1JN0A 1YRLA 4M54A 2IZ0A 2JCVA 1B16A 1LXCA 2PH3A 3QVXA 3GMDA 3ETGA 4ND2A 1I3KA 1U7HA 3AM5A 1W6UA 3Q2KA 5TF4A 4FCCA 4E5PA 3SBOA 4Z0PA 3LT1A 2P2SA 2YW9A 3HFGA 3BMNA 3R3JA 1YVEI 1ZMTA 1G0OA 3GN2A 3GVHA 3RJ5A 3SJUA 1IPFA 2VWQA 3G0OA 1UAGA 4CV2A 5BSEA 4JBGA 3RUDA 2VUSA 5DP2A 4W7HA 4CLEA 4GX2A 4RVDA 3GAFA 3IS3A 1F8FA 3FTPA 1HYGA 4MKRA 1ORRA 1MC5A 1WZIA 3DTTA 3I6QA 4FFOA 3TZCA 5EQDA 2ZTLA 4GVXA 1U5CA 1U1IA 4U6QA 2GZ2A 1KEPA 3GPDG 5DCYA 1YBVA 5KOIA 4LSMA 4XKJA 2OFPA 4PLHA 2GCGA 2BLLA 4WLVA 4EUEA 3NDIA 2BHLA 2BFPA 2DC1A 2OORA 2UAGA 2X0JA 2ZB4A 3JQGA 4P38A 1DRVA 4TRJA 2B0JA 1A71A 2O23A 3TZQA 3BYZA 4NMHA 5BSHA 3DZIA 3LLSA 2V6MA 3QY9A 4MVJM 3V2GA 3ITKA 2I6TA 1JWAB 4J1TA 1QV7A 5A9TA 1SBYA 2PTGA 4ZU3A 1DJQA 4TZKA 3WYCA 3JD1A 2Q2QA 1ULSA 4K9DA 4E3ZA 4Q3EA 4AG3A 1M2WA 3HHPA 1N2SA 1NQ5A 2B4QA 2EJVA 3F6YA 2GN8A 4GLOA 3QRWA 4UUMA 5AVOA 3CE6A 4D7AA 4H15A 1GZ3A 4BNYA 4R3NA 3CZMA 1YS4A 3RU9A 1U3UA 3S2IA 4AFNA 2Q46A 3VPGA 3QLJA 2YV1A 4CR7A 3QA9A 1VE9A 2RBEA 1NFFA 2ZB3A 1P77A 2QG4A 3HG7A 1H0KA 3NJ8A 2Z1MA 1KC1A 3LT4A 3Q11A 5DP1A 1U2GA 3W1VA 2Y1CA 4BNFA 4BV8A 2C5AA 1NWHA 1HZZA 3ZHBA 2VT2A 4CLXA 3PHJA 2JAHA 3PZBA 1LLUA 4E2YA 1P44A 2C2XA 4TVOA 3F46A 1KERA 3JCZA 2DFVA 5CDYA 2DT5A 2VWGA 3OIGA 1RM5A 4CLOB 5IDXA 4OKIA 1E3IA 3BHJA 4MVJI 4D0RA 2XPCA 1MC4A 1H6DA 2Y0DA 3Q9NA 4OMUA 2WYVA 3VTFA 4W9NA 4ZA2A 3ZV6A 1F0YA 1TA4A 3AUUA 3E6AA 1X13A 1B0AA 3EK2A 5G4KB 2B5VA 4YDRA 4FGWA 2UUOA 3GDFA
chains in the Genus database with same CATH superfamily
2HA0A 1Q21A 3NWOA 4HQ6A 3IJ5A 4TMYA 1YO6A 4C4OA 1YUMA 2YDYA 1HO3A 2V3VA 1JKXA 4FI3C 5DMXA 3DVAB 1TAHA 3TW6A 4DCGA 1A1VA 3QSYA 4YDSA 1KETA 2GN9A 2OV6A 1YZNA 5E6UB 1ZRMA 5KSZA 3D4BA 2PR2A 2VRCD 5F3WB 1YQUA 2G71A 3M6WA 4EHHA 2P2CA 1YH3A 4BFUA 1T8YA 1XZEA 8GPBA 5JY6A 3O8OA 2QT1A 2J46A 4LJ4A 3ZHSA 1JEYA 2C84A 1FYVA 2XMSA 3EF3A 2ZJ1A 4HXFB 4PNPA 4AO8A 1J9ZA 3EWNA 1NYLA 3DDSA 4Y9TA 1Y6FA 1KJIA 2UUBB 1SQGA 1ZW1A 4L85A 5IUNC 3KXKA 4QDXA 2IP1A 3RFUA 3AM4A 4DZZA 4ZDIA 4DUPA 4WFKA 3EGDA 3NBYC 3U62A 1PFGA 3WRYA 1BMQA 1W5FA 1KK3A 1X7GA 4X7MA 2A0KA 1ESZA 4OIMA 3CNNA 1RBQA 3HADA 5I7VA 2LPMA 3VI3B 2VF2A 4R98A 4XCXA 2C4KA 2LCFA 1SKYE 3PNBA 4OBXA 4PZCA 5IPFA 1IDOA 1J8MF 2F3TA 3R76A 4D9NA 1V3QE 4EYGA 4YAJA 1I94B 2EWMA 3H1EA 3WYFA 5DWQA 1GA1A 3BQMB 4AYXA 1L7RA 3V2IA 3VM6A 4CLDA 4YBRA 1TX4B 2VUIB 4HH4A 1BH6A 4MTLA 3FNRA 3TQSA 4KBYA 4MUAA 3L6RA 1O3YA 3O8DA 2R66A 5JEDA 4H9GA 4TYPA 2XBUA 4L3VA 4LN1A 1X86B 3K1ZA 3K05A 2GBFA 3V3KA 1XYYA 1TKCA 1EZ4A 3DKIA 3ZJ5A 1TVKA 1UH5A 4LMBA 2OV2A 3JQFA 2HWYA 3KXDA 4OMFG 2O2JA 4GYKA 2XTMA 3MZ0A 3LTEA 4WOJA 5HMMA 1VCHA 3DFUA 2GCOA 2JATA 1E18A 3IQGX 5I4BA 1BC5A 1UJNA 4M46A 4W99A 5GADl 1RRFA 2A2ZA 4G0MA 4AZ0B 3KQUA 1E9AA 3HEMA 3E58A 1KFBB 3EGWA 4HRAA 5D86A 4DNOA 3RTEA 1PVOA 1H05A 3UB2A 4DA7A 4R54A 5I5EA 1W1UA 1XEWY 2QRVB 3V7YA 4NXNB 4PBTA 1U3GA 1XZMA 3OJOA 1P31A 1XFDA 1JDTA 1KJWA 2WSLA 1M74A 1GZ6A 3EFOA 1NA5A 2VJCA 3LDHA 4ZHSA 3ZJVA 3NIGB 2PUJA 3F3SA 4NFLA 2JLCA 2P9GA 4V0LA 2CMKA 4D9JA 5KCZA 4ONEA 2CDAA 3UENA 1H3NA 4EOGA 1YRQA 1SUWA 4UDYX 1YONA 2X7JA 3EBPA 3ZIAA 2Y67A 3DE7X 2P9HA 4Z1MA 2ZWAA 3A1VA 2QWXA 4D9CA 5IT4A 1JIXA 4LDJA 2ZYVX 1NW3A 3K1AB 5EIHA 3G2JA 4EEXA 5JSQA 1G8JA 1BN7A 4H4DA 4KGZA 1AUPA 2ZXEA 3HVHA 2BKLA 4MDHA 3UWOA 5JQGB 2EFCB 1I2CA 4AMGA 4BQRA 4URXR 3AEQA 4IIBA 1KAGA 1EWRA 4J43A 3RS8A 4BEBA 4YMUA 3OOJA 1XTJA 1TVEA 1I6MA 2YL2A 5CD1A 3NGLA 2HZBA 3AX6A 1UPBA 4NK5A 4AJ2A 4R1QA 4FINA 3MHTA 1M3SA 2D2XA 2R2AA 3AZPA 3DO8A 4ASUA 1WPQA 4KJZA 3PVCA 5DNDA 1CYDA 3HPQA 1H8ED 2ZJ6A 4GLFA 1P17A 4N5IX 2A1UA 3V42A 4RVUA 2ZVPX 3NT4A 4GLJA 5DE3A 4H6PA 5BMVB 3WP0A 1BVUA 2GTHA 3MCWA 1TFUA 3IIIA 3S0JA 3TJRA 2PWBA 1Z13A 2B8NA 1CRQA 4ZI7F 4QM7A 1L4UA 3IP6A 3MINB 1X7ZB 1XZBA 4MS3B 3RLFA 1SVSA 2QUBA 4M1WA 1GPLA 4ACBA 2ORED 1HT2E 1ULUA 1T1RA 4TV8A 1Y6QA 2I1LA 1RM0A 5ESWA 1X7HA 1P2UA 1VCIA 1JXMA 4B40A 2VJYA 1OFUA 1JAZA 1AHHA 1ECCA 2XB9A 3ELBA 3EVTA 4M8IA 3MQFA 1DWQA 4QREA 3OE1A 1R4AA 5BWNA 2EJUA 4MGZR 4QDZA 2PL1A 4HWRA 3TIGA 1WBDA 4YJDA 1ID1A 2GEDA 4PG6A 2IPOA 1MIHA 5LB4A 1JPUA 4RVNA 3AY6A 3TTWA 5EMMA 4HYTA 1EVQA 1M2HA 5JLJA 1UXGA 4EA6A 1PV2A 3IKLA 4AB1A 4YUWA 4DMHA 1J8FA 2WYUA 4QJ5A 4D9FA 2QTNA 3BKWA 4LX8A 1ZRNA 4ZJYA 1X7WA 3QBDA 1NBMD 2D7CA 2ZUUA 3HKCB 1YCDA 2OAP1 3NJ4A 4NJOA 3NKVA 5ILGA 5JCJA 4AC9A 1HNXB 3QU5A 4GH5A 4CL0A 4BZQA 2GM4A 1WUTA 3CGWA 3ESCA 3I62A 2JGLA 4Y0VA 1PZNA 1QOPB 2H1HA 3D6NB 4R8SA 4HZGA 1RKVA 1R10A 1N6RA 5JJLA 4LQDA 3JAWB 2GJAA 2HU8A 1X7YA 1GKUB 3CF2A 1FMLA 4FFPA 4FCTA 4OAOA 4YROA 2MYPA 4ODIA 2F4VB 3WYAA 2NUAA 4N40A 4EUSA 1DQYA 5GONF 3Q0EA 4EZEA 5AM2A 2HZ7A 3WBBA 4UOEA 2XQVA 2ZBRA 3I12A 4QTTB 4I1IA 4NOLA 5UKDA 2X0DA 3TOSA 3VHQA 1FLVA 2W5UA 1GLNA 5AW0A 1JFLA 1LV8A 1TMYA 2Y0BA 3DXYA 1L5LA 4V1CB 1OFGA 2C20A 2DPMA 1CC1S 1U11A 4PFKA 4WUVA 3KALA 1IWOA 1U1EA 3P9YA 1LJLA 1MJ5A 3W5CA 2DSNA 3UATA 3KZCA 1EK5A 2PLRA 1II9A 1NNSA 5A71A 1RI2A 4BB0A 4WBXC 5COBA 3JQAA 4R1NA 4E33A 2B1GA 3D3KA 3AG6A 1OQAA 3CO5A 1B8PA 1IBCA 4BZXA 3EA5A 2OVFA 1KQPA 2XITA 4YV1A 2I78A 3KB8A 4ZGGA 1BYUA 3FOZA 1O8BA 1O1YA 2IP2A 2ZYRA 1FXWA 4ND4A 3STXA 4YRSA 2XODA 4TMVA 1OASA 4N76A 2VL7A 2BI4A 4R68A 3AUTA 3EXIA 5FAXA 2IYUA 4JXJA 3ZUPA 4BXOA 5ALPA 3I01A 2JGNA 3FSRA 1E9EA 5JTTA 5KPDA 3C7DB 4GR4A 4JLSA 1YQEA 4HUTA 3JQ7B 2V6JA 2FH5B 3MBOA 1B8UA 2VHTA 1NT2A 3B6KA 4JB2A 4BV2A 2XNHA 2ZQYA 3HKDA 3QXHA 4PO3X 4HAVA 4URHA 3NPAA 2HTFA 3DGFC 2JAOA 4F2WA 1THZA 4J3FA 1L5MA 4CM9A 1Z8FA 1ZM7A 2KQUA 1YB4A 1P2SA 3USES 4BNLA 1ZJZA 3CUKA 3QUQA 1Y3DE 5A9RA 4EGFA 3GFTA 1HQDA 4QT4A 3MBIA 4KFTA 1KR2A 4KK4A 4D42A 1RQLA 2O3TA 2AX3A 1TZMA 3TSOA 2Q29A 3L0IB 4OSOA 1EFKA 1MQ9A 1SHJA 4I8XA 1G17A 2VJMB 2Z4TA 4Y7DA 4BWGA 3T12A 1CR0A 1SKAA 5JNTA 2ODBA 4LXQA 4ARIA 1E9FA 2Q8QA 3NIFB 4NCIA 5KOHA 4IIVA 3IV6A 3PXEA 1VRCA 2DKFA 3TN7A 5DSXA 3JW8A 4ROTA 3ZXYA 4QBGB 4YACA 3TLXA 4Z4CA 1GNTA 4P0PB 4B8ZA 3ITNA 4QOFA 3CEPB 5BN3A 3O7MA 5K09A 1UBCA 1E61A 1LGYA 3EZ6A 4L4YA 4ZT7A 2QKYA 3AR9A 1TM1E 4EPYA 3KYCB 3MCAA 4PYRA 4BJ1A 5KWJA 3Q3IA 1KMHB 2I4OA 2QAGC 3WDLA 4RF4A 4YRZA 5J5CA 1FYDA 2BOVA 2A88A 3IMKA 1DDOA 4J16C 1LDGA 1Z36A 3DLIA 1JXOA 2FW1A 3OPXA 4KQKA 4MEJA 1JXQA 2X4DA 2X9VA 4A1FA 2BFDB 1PGPA 1NY5A 3NZEA 4QJBA 4QG3A 2BFCB 4JEUA 5BYKA 4UDXX 1OLOA 1I7SB 1L7EA 3FNQA 3NVKI 4DGQA 1ETHA 4EELA 2NPOA 2AFIE 3EGCA 2ZT5A 4E7OA 4L1KA 2GN1A 1EM6A 3N0WA 4AZ0A 5JC8A 1IN5A 4JYAB 3WGTA 4DMKA 3WWZA 4LWPA 2QSJA 4YAIA 4A82A 4TTQA 1KK1A 3F7MA 5FTMA 4UATA 3T34A 1CJVC 3TECE 1CR2A 1NOIA 3L0CA 1BS1A 5CTAA 5FIUA 3S40A 1ZR4A 1KGDA 2Q07A 4CF3A 3KTDA 2CF5A 4HGZA 1YR3A 1A97A 2XTJA 3AQIA 4DLXA 3RROA 4Q9HA 1SMKA 4KN9S 2FB9A 4UPDA 4MP8A 1YL5A 4R1UA 4F7DA 5M29A 5EP3A 4XB6B 3PEEA 2Y1EA 3PP8A 5IAGA 4DNPA 3B3QA 4RHCA 3TNJA 3KYJB 3QFFA 4G5YA 5ES4B 3VYSB 4G5XA 4BE9A 2EIHA 3QY0A 2IFTA 2ODEA 4PPNA 2HK9A 3OLYA 3QPUA 3PQ2A 1RYDA 4O4HA 1NVEA 1P1CA 1YI8A 3DDNA 3MQ2A 4MKIA 4K1LA 4LAFA 1CDEA 1PZHA 2GK3A 1EX6A 1NVGA 4GE3A 3QX7A 2Q3HA 1Y7TA 3AERB 4N47A 5IDWA 3JQ7A 2OO7A 2FZCA 4N6NA 3A7EA 4P80A 5ALTA 3ZZ1A 3S44A 1OLSA 1TIPA 4UHBA 5CPBA 3AEYA 1XKXA 4B0PA 1K1EA 1G0NA 4QASA 1LU9A 4ER5A 2C0QA 3C2QA 3DCJA 2O1EA 3EZYA 3IUYA 4NV3A 3P97A 1K7YA 2PRYA 1U04A 1E2BA 2MT9A 2RGAA 3IXQA 3MUOA 3P96A 4XD7A 3HJTA 2VJPA 4MV1A 4E5KA 4AJ1A 5EEGA 2Q9UA 2OSBA 1YDGA 3OZDA 1SY7A 4Z8YA 4ZOEA 2PO7A 3WWOA 5IYZA 1RHUA 3IYLW 4P4GA 4YP5A 3U26A 4ZI7A 1BGWA 2O2HA 4IEFB 2GK6A 1WMBA 2XA1A 4G07A 4W9RA 3NHPA 5LQAA 1W2HA 3ZGLA 1U28A 4BPBA 4GZMA 1FFEA 1QHIA 3OICA 1DTWA 4IW3B 4CEHA 5THKA 1IY8A 1U8TA 4IF4A 1Y6RA 1PG5A 2EW2A 3FGPA 3GUYA 3MOIA 1FRNA 1T6NA 4PZDA 5D2CA 4DDHA 5JAMA 1W88B 2EBHX 2PKEA 3DR3A 3GJ0A 3AH8A 3QOYA 1AC5A 1MB4A 5IS2A 1KIFA 4IFBA 4B32A 1MHTA 4RL4A 1WB9A 3F2VA 1PG0A 2PSEA 2ZWMA 1QG6A 3B85A 4LZPA 4QXAA 2V7WA 1JJVA 1OX6A 2CLHB 3ESYA 3F3KA 3IVMA 4B5LA 2Z2JA 5IEJA 3PRJA 3H2GA 4OKSA 2C3PA 2IYEA 2VPWA 2ZVQX 2ZPAA 4M8SA 3R5KA 5C18A 1AG9A 4KFSA 5LA6F 1ENYA 1Z2OX 4BV3A 1WXFA 2IQ5A 3DMNA 4GC5A 3R5HA 1S8NA 2JI6A 3K0CA 3KOZA 4IZIA 1MB0A 1ZS9A 4KQ6A 3PQ3A 3K71B 5GZ6A 1ZN8A 3Q8LA 4C3UA 3OZAA 5CH8A 3N2KA 3N28A 3BJEA 1JZTA 1T8WA 2GD1O 1WCWA 5FUWA 4EVRA 4BMSA 1ZD1A 2VF8A 1M2FA 4P0TA 4HQNA 2XIQA 1VKOA 4LDNA 2B5OA 3BHIA 4QRIA 1HLDA 3HHEA 4MVJG 5EOVA 4QYIA 5GONA 2JAQA 2OCLA 1HH4A 1OZ0A 4EZBA 3CZCA 1PFKA 1UF9A 1Z6AA 3MTJA 4HDMB 2WWVD 2P5UA 4B48A 3OQOA 3GJ8A 2FN8A 3WGOA 1FQJA 4PYJA 3DM9B 1XRPA 2QRHA 3LI2A 3OMLA 1IEXA 4PZ9A 4UMVA 4CG1A 3FOFC 3WL3A 2QZZA 3A27A 4MCAA 3LD9A 3WY9A 1ZL0A 4AZTA 4JLMA 4YPFA 4PQRA 3BE4A 2O8BB 4XWOA 3ZUGA 1WHTA 2WKRA 1ACJA 3W7VA 2HNKA 2YN4A 4OXXA 3GGDA 1BZYA 2I8AA 3RJZA 4GVPA 3U9SA 2J3MA 3M34A 2QGZA 4TKLA 1KDZA 4GOXA 2RGUA 1RJ9A 1XDSA 2HXGA 1JG2A 1H5QA 1NHWA 1G3RA 4NCJA 5C35A 1AUXA 4BMOB 1SVMA 2RH5A 3INRA 1SB8A 3LRTA 5JJ5A 1NSYA 2JLVA 1OWOA 4QOSA 3AGQA 3A1WA 4XWGA 3LGSA 3PNLA 1UBLS 2Q3EA 1JR4A 2PS0A 1EJ0A 5JJBA 1X1DA 4PIMA 1EGHA 3VYVA 1SBCA 2J09A 5FLYA 4BNTA 1N4DA 1UT8A 3ZY4A 1MO2A 3FFWA 4UBMA 1THMA 3K1JA 3MJHA 2OD7A 3HSSA 4LJKA 3SQMA 1T36B 2OHGA 1T0UA 3KKKA 3KVYA 3PUKA 4HH1A 1JR3A 4J0JA 4HEA1 4EL5A 4ESOA 4YT8A 1GD1O 4P4SA 1DEHA 3PGMA 3DV9A 3SE0A 2XCIA 1MJHA 2J3HA 2JA1A 3R0ZA 4JJGA 4L5CA 1E3DA 1B41A 1UBUS 3Q41A 1ACLA 4C0SA 4I4CA 3IUJA 1AF7A 1OXBB 4NHOA 2PUCA 4MIYA 1GCGA 2QRGA 5DLPA 4OYRA 1IZYA 1RLTA 5KMGB 2NVUA 3EGDB 3NX4A 4J2TA 4ZCQA 5C3MA 3A2KA 1QZ3A 4HX9A 4NVRA 1XUOA 3OFVA 2BFFA 2ZAIA 3B78A 1SHZA 4DIFA 3ACDA 4HX2A 3MAAC 3QTLA 2O2YA 4NDNE 3OZTA 2OR3A 4BMZA 1LTHR 3UBTA 3I61A 5K03A 1KJNA 3HUDA 2B8TA 2YZMA 3L7LA 3FRIA 3H11B 4L15A 1JHOA 1Z29A 4M9XA 4JLPA 1QS0A 2LUOA 3ZWQA 4K6KA 1RZRA 4I9UA 4CKBB 5C5EA 3EXG1 4I2NA 2GCOB 4ISBA 1ZHFA 2B30A 1FP7A 2W43A 4KE8A 4MAMA 3TCXB 1SO8A 1QANA 4N7RA 4E14A 4EDFA 1IY0A 4RTKA 3I9OA 2YVLA 2B34A 3GLFB 3RKRA 3V1LA 5LBTA 4O2BB 1L5SA 4F5YA 1J70A 3YASA 4RK7A 2FA9A 4RTJA 1SZJG 2JCGA 2BKAA 3Q0TA 4OLJA 3ROZA 3GL9A 2QQGA 3E9EA 3GC6A 5ELXA 4LGVA 2D7DA 1L2TA 4HOYA 3CF6R 2QS9A 3DBOB 4OA5A 3W2EA 5HZGA 4JIGA 1AGNA 4MX8A 5F1OA 4PC6A 3COVA 4NWIA 2RCYA 5H8WA 1ZD9A 1G2OA 2OM6A 1RBZA 3U09A 1OGIA 3H5NA 1LBEA 2ZULA 1NRXA 2M2IA 1F1JA 4M6WB 1X9IA 1AKUA 1LTKA 5DXAA 1M6NA 1DI0A 2FN7A 3A7DA 2VPPA 1C7ZA 1GZ4A 2HMTA 1NL3A 1N2HA 4Y1EA 5EERA 2Q3MA 3U13A 4KH0A 2VF7A 2W2VA 2HCRA 5C7LO 4B2YA 4JNCA 4PRKA 1NXTA 2KX7A 5KNDH 3VNVA 1PYGA 1SCBA 4PGGA 1BU8A 5A2QA 1QDLB 2Y1KA 3BXGA 1CUJA 1ZPDA 2BUBA 3BFXA 1S9DA 3L1VA 3K5WA 4P81A 3ZGNA 3PIDA 4O29A 2EC5A 3GRPA 3R3ZA 3SZ3A 3AWIA 2CHQA 3SZMA 1PJAA 3EG9B 5DHUA 1NPDA 3VUEA 3WDSA 3BVPA 1Y0BA 5KDOA 2B1RA 2NUTA 4AZSA 1YZQA 1P61B 4QUEA 2VNAA 3BJMA 4WERA 1H2YA 2P35A 4WKPA 4B9EA 3DKPA 4NBSA 1OCEA 2WAAA 3I9V6 3NUQA 1DINA 1RAGA 3EC1A 2HQBA 2ZTVA 4U7GA 2GKGA 1DJNA 1G2IA 1RRCA 4B2LA 3KSUA 4KE7A 5EKUA 4YRPA 5A0TA 1STOA 3SSAA 4KLZA 2Q4EA 4B75A 1PX2A 4WE3A 5T4EA 2G72A 1HG1A 3PC4A 4MLCA 3REQB 3MJDA 1MVLA 2MTBA 3V4VB 1NRIA 3LDAA 3R6WA 1RYYA 3MOGA 4JI6B 4YQFA 3G8DA 2C4VA 1ISIA 5ILQA 4MVCA 5CA1F 1AD2A 4U7JA 5FLKA 2Y1FA 1R0KA 2XDAA 4CU2A 4Q3CA 3ED5A 3IOMA 3IDZA 4TL8A 3RO7A 1SU8A 7ABPA 4LF4B 2JARA 2HADA 1LC0A 4AF8A 4L08A 3R8FA 2J5KA 1RWVA 3ZJTA 1QBGA 5TJHA 1U1GA 1A96A 3SY8A 1YV9A 1RRMA 2IA5A 4ECAA 1K6MA 4TRMA 1T4BA 4YBZA 4DJFC 3MUNA 2PCLA 3RIEA 3I9NA 3MIIA 2QQEA 2RJNA 1J06A 2F3PA 2H7CA 2NNLD 3ORQA 5FEMA 2R0QC 3OQ6A 2R85A 3L1UA 1CUYA 1YCHA 3TLGA 3QENA 3MMXA 4BOYA 1EFCA 1JKJA 1W4ZA 2DULA 3H8SA 3UOWA 5JBIA 5LL6P 2HWWA 2QRNA 4OY3A 2YBEA 1G18A 3DWGA 2W6JA 4LF9B 3NIDB 3AVQA 4XYBA 1NDUA 2QLLA 3GO4A 4I4NA 5ALSA 3WNVA 1U3FA 3LLCA 2JGFA 5CMLA 4ZT3A 4DLYA 4PC7A 4GX0A 3PSHA 5LXTF 1I0IA 1ZH4A 1FVHA 1T1JA 2YJ3A 4RJ2A 1MU0A 4IYJA 2OY0A 3BX1A 3GPCA 1Z2PX 1ORTA 2Z8YM 3IUQA 4F0JA 2OM2A 4UNSA 4NRDA 1WM1A 4G9BA 4Y9DA 4YQYA 2I99A 2EU8A 3GPIA 1DELA 3G79A 4URYR 4AF6A 5GY7A 1A9XA 3OA0A 1JHAA 3Q7SA 5G1PA 1M1YE 3GU3A 3THSA 2HUPA 3VR5A 4RCYA 1OV6A 3RJ9A 1OYOA 3BGWA 5DT2A 3ESRA 3ZHCA 1N0WA 1WU7A 5K99A 4C5BA 1O0CA 1U1CA 1C50A 3WZ2A 3AUAA 5LMUB 3MFQA 1M0SA 2J07A 1C1XA 4FT4A 2VHJA 1GA4A 2W22A 4HVTA 3TG8A 1GGVA 2JLUA 4WIAA 3E5HA 2VYFA 2FTKE 1P2VA 2V9ZA 1G59A 3FF4A 1G7TA 1KXJA 3QUAA 2WJ6A 2TYSB 2H1SA 4Y1GA 3AJDA 5BNWA 1VE5A 4Q05A 4NE9A 3HV0A 1HEYA 1YDMA 2WW8A 5EJEA 2AKEA 3NP7A 1L4NA 3OIUA 3RREA 4IQFA 3O7WA 3WQHA 3H99A 3VV3A 1GPBA 4WOCA 2IU3A 4Q1EA 1H4TA 5HKKA 2ZIVB 2ENWA 1DLJA 1YQTA 5C5DA 1BQEA 2XIJA 3N87A 1FF9A 5BWBA 2P6PA 3C8UA 1IN1A 4MTCA 4INJA 1Y3CE 4JB3A 4MPJA 4F46A 3WWDA 2FW6A 4RK1A 3SE7A 1EGAA 2I1QA 2NSLA 2DFDA 5LIRA 1SXPA 4TS9A 4K03A 1ABFA 3EWSA 1NASA 1CJUC 1SM4A 1WLYA 3E61A 4M0MA 4MMZB 4Q7EA 4B3IA 3DE5X 2GJ8A 4EHAA 1G5RA 2QGNA 3GJ5A 1PD1A 3AEKB 3V55A 4ZHQA 5KJFA 5CCXA 2R8OA 5EJ5A 3FCCA 4QQRA 3V1MA 2PH7A 4KQMA 3VVCA 1G5PA 1MC1A 4OHPA 3D3EA 4UREA 2GBCA 3GYBA 3JQCA 2FWRA 2QTVA 4TL7A 5ESDA 1UJ4A 5JNVA 2IXDA 4EHJA 4M0CA 3H5LA 4IO0A 4MVJE 4RF2A 4JLAA 1GDDA 3CM0A 3COPA 3N8IA 4YAKA 1Y7LA 1FFXB 3BXHA 3BILA 4FYJA 1ZI8A 3EQ9A 2XD4A 3QVLA 4FOTA 3BL5A 3Q7RA 4IIYA 1J99A 5HQ3B 1U8FO 3ERCA 3KAQA 1JGTA 4QL3A 1OAAA 5ECDA 3SBXA 4J4BA 1MJNA 3GRYA 5AKHA 3VJMA 1KEUA 3BCRA 4TXNA 3EDRA 1Y8ZA 3BSYA 2V96A 4ND6A 3SXJA 1ZBQA 2VK1A 1PJLA 1P3JA 3A6HA 1KVRA 3N2NA 3TQFA 5U4XA 3P9XA 1FJHA 3N7UA 2PT9A 2H16A 1N92A 2C5HA 1NW4A 1KQ3A 3NWBA 5IUJC 1P45A 1B7GO 5FOVA 3TIVA 4Y6PA 1SPBS 4CTMA 2CHGA 3RSLA 4WMLA 1WXHA 5KSPA 4QM6A 4XVHA 2I2AA 5EXEA 1FFWA 4ZOBA 5MFZA 1T9DA 5C4MA 1DFHA 3NXKA 4B6GA 1ZOIA 2OZVA 1JG1A 1M8KA 2ONCA 3D8BA 1R6UA 2UYHA 1NU8A 4AS1A 4FSDA 2EFEB 2J6CA 1GFIA 3R3SA 1T15A 2H4WA 1F06A 4RORA 3EC7A 4CIDA 4NQZA 2BH2A 4QFMA 3W90A 3OCZA 4EMBA 3U80A 3U7GA 1NP3A 1Q2UA 4CKEB 3HCRA 4HWKA 1GAQA 2EATA 1JI0A 3TW4A 4ID3A 2EYUA 3HYTA 5I8WA 1ONPA 4ZVKA 1UAYA 1QO0D 5I7OA 4EB6A 2R7AA 3UJ9A 4B76A 4BB9A 2ZDGA 4E5SA 1YBHA 4YEDA 4I4LA 1U8CB 4NBKA 4MR7A 5H70A 2VTVA 5AIBA 1E8DA 2NM0A 3AESB 1QOQB 1OZHA 1Y1RA 4FSHA 1BE0A 3H84A 2D4HA 4IS3A 5DVZA 2QLFA 5P21A 3W1EA 1JWLA 1SVUA 3SHTA 2WK1A 1TUEA 4OQNA 4R2LA 4UTVA 5AUOB 1JYEA 1KQGA 3UMYA 2NUBA 3DKRA 4MVJA 1MW8X 3CLUC 3IQIX 4KI7A 4KQ9A 2X3YA 4TLLB 1C8KA 3QEMA 4LZOA 1FW6A 2JZNA 2AGVA 2I4MA 3BMQB 3P9NA 3DLHA 4C6SA 3HQ4O 3MJRA 3RQIA 3RF7A 1E9RA 2ZRLA 5FULA 4QUDA 3VNSA 3O21A 1U7OA 3CTMA 3NBAA 2NYRA 4L75A 3COJA 2G7MC 2J0UA 3E15A 1EEHA 1HL3A 4IVPA 3IOYA 2YV3A 4H1TA 3HH8A 1II0A 2VRWA 1RDFA 5JSHA 3D8RA 4JASB 1R50A 1BN6A 1MKYA 2RH8A 1YFLA 2VP5A 4QU0A 4O8ZA 1GXSB 2ZSBA 4GF5A 1HQYE 4K81B 5JO9A 4QVIA 5BOVA 4C0XA 4G01B 2H7VA 3U3ZA 3FVRA 4I6EA 1YBFA 3DWFA 2QNIA 3PDHA 4GOLD 5EE3A 1OFHA 4OEHA 1L7QA 2TMDA 3AI2A 5L7TA 4BQSA 4MIOA 2J85A 3GT4A 2AEEA 3UXMA 4LI3X 4FT2A 4FMBB 2WIDA 3PIIA 1RE0A 4CL3A 2YJZA 2E87A 3EGXA 3GLQA 2D2VA 5F33A 5FUXA 3M8KA 1VIVA 2R6R1 1UBRS 3WB1A 1QHYA 4JX9A 3PQ8A 5KJ6A 2GESA 1MAHA 2C5BA 3W2HA 3IE0A 1Y48E 5FHQA 2AKAB 3JWJA 2P9YA 3FHJA 3E0QA 3RC1A 1E99A 4OAPA 4PGAA 5IJAA 3VDMA 2OQRA 4PWYA 3VGJA 2HJ9A 3FRHA 5HS4A 3NBKA 2Y05A 4M2LA 4CQMB 1KQFA 4DLVA 4WN9A 1N77A 3MF4A 2PM8A 4EPVA 2J3KA 3S2SA 5HKBA 4KFRA 4ZVOA 1PSWA 4QXOA 2GZDA 3H6KA 1FTQA 1YDEA 1VI2A 2WAXA 4BATA 2BFDA 4D3YA 4ALLA 1O4VA 3BCSA 1R0XA 2X0IA 5F2NA 5LXTB 1KY4A 3OD5A 5CLFA 4FILA 1OU0A 1QVAA 4OF4A 1U6JA 4EBBA 1SRQA 1UPUA 2RK4A 2WIKA 1DO8A 3FTDA 2VYQA 1PTKA 3MJTA 5K0ZA 2YZ2A 3ZH2A 2CLFB 2G7ZA 4DYHA 4BGVA 2DB3A 1WPXA 4XYLA 3H9BA 3DZFA 1E7SA 2I6GA 4NU0A 4BRWA 4JI4B 2J8ZA 1EWKA 4BQQA 2D5CA 2QD3A 1YB1A 4Q4HA 1N2CA 1WR8A 2EXXA 3PUHA 3M83A 5AJZA 5DRTA 5AW5A 2WD9A 4J7XA 1THTA 5FD8A 4X8MA 3SIPA 2C82A 4XPIB 1XQ9A 3UJ3X 2F48A 4E13A 1NBMA 4Q39A 2HJSA 5LDHA 1DIBA 2F3UA 3DVLA 3QBEA 4CTOA 1V3UA 1VJRA 3LBNA 4AUNA 4NC9A 3AOGA 2V03A 2CEAA 4X84A 3F47A 1C80A 5C4GB 5CXQA 4LJAA 4IXDA 1SH7A 1N1DA 2WD7A 4QEZA 5D7NA 2ATIA 3TM4A 2QX4A 1XWFA 1NUHA 1CP2A 2HO5A 2OAQ1 1A9OA 3FX2A 3GB9A 4DBLE 2JGRA 2FPGA 4F1JA 2DUWA 2OP1A 3N0TA 4FX5A 5IC4A 4UM9D 3TKLA 4EG3A 2IELA 2D3TA 1U7DA 2QUZA 3OLCX 4Q3DA 4UUAA 1QIEA 1H5UA 2VDMB 3MWGA 1QF9A 1Y8QA 4PBSA 5TQ0B 3RS7A 3GRFA 4RF5A 5SYNA 4B85A 2IW1A 1XRNA 3ZQ4A 4WCFA 1FFCA 1UK9A 1UJMA 4MPRA 4KXLA 3CQ9A 1HE4A 3BK1A 3O73A 5NLLA 3A3KA 4ZHQB 3I9KA 1JEQB 4X65B 5CLHA 3TNLA 1DOAA 3BMOB 1OXVA 4D56A 3WBFA 5AH0A 1UBGA 2ACKA 4B3MB 4QPZA 3JQAD 1V8PA 2FETA 4NBWA 4OL9A 1X8KA 2NU8B 1X7DA 3TO5A 1Y4UA 4XUGB 4EAQA 1ZK3A 1P8AA 3HWWA 2YOGA 4KGXA 4Y0NA 4GZ5A 1EINA 4UZEA 2EARA 3AB7A 3FLBA 2Z9BA 2Q3FA 1LFDB 4KACA 4YAFA 2V4ZA 1JIQA 1LD3A 2L17A 3EFBA 1NR5A 3H83A 4KPUA 5H80A 5IBRA 2Q7OE 5KWVA 5H9VA 5BRJA 2L2QA 4GBGA 3DMRA 4IVRA 2DTXA 4N4AA 3H2IA 4CT0A 2JZOA 3OU2A 4OHRA 4OK3A 3VSEA 3WOHA 3KVNA 4YJ2F 5DHQA 1BHQ1 3R0IA 1JWBB 2CHEA 1XQWA 2Y1GA 3AFGA 3P32A 5CH5A 5JBNA 4S1PA 3ROKA 4RJKA 4CUJA 5DSZA 2R5WA 3JQQA 1IJFA 4BFLA 2VLBA 5HE8A 2BGMA 3UH1A 1ULAA 2O8DA 1MAAA 4S1TA 3QQ5A 1XEXA 4LHEA 4ZOLA 1DTEA 3ONNA 4L57A 2UDPA 2PUTA 1JVSA 1ZQ9A 2WJPA 4Z3DA 3L9WA 3Q6MA 3TTTA 2VKTA 1VLZA 4I1SA 4A0RA 4C4PA 4YR9A 2VZ0A 1J8VA 3H04A 4D26A 3G5MA 5BQXA 2V6IA 3C4VA 1D1SA 4ERNA 3DT6A 2V6FA 3K2EA 3QG1A 3UPUA 6NULA 2PLNA 3HN2A 4YRFA 3C15C 2L19A 1MH1A 3RTGA 4MWSA 1I2ZA 1WMDA 1TAQA 4W7IA 4G1UC 1OBFO 4UQOA 1D3AA 4PHFA 3Q3JB 2OLKA 3OHMA 4JQSA 3B6ZA 3SMQA 1CRWG 3T9EA 5IXYA 2QZ4A 4EJFA 3G0CA 4YCCA 1XR3A 3KKOA 4FDUA 1YE8A 3RUPA 3VR5D 1JSRA 3A1UA 3KEOA 2ORWA 5T8KC 2XB8A 4BNKA 4EFMA 5B1YA 1I10A 4LUCA 1BJKA 2O1SA 1CULC 4MWOA 4M4SA 4UM9B 1SNYA 1Z7EA 1NLMA 1XJ0A 1A4XA 2DP4E 2GF9A 1AM4D 3BCHA 5U4QA 5BMVA 3HDJA 4WV3A 3L8GA 1L4GA 3RRBA 1F8YA 1QPGA 2IHVA 1QYCA 2V1XA 3RC2A 4MCJA 4B31A 4F4JA 1PVVA 2P1RA 4IXNA 4MYHA 3K9BA 5EMHA 5J5AA 5K0BA 5KYYA 4KRFA 3MS2A 1G1MA 5I3ZA 3REQA 1ADJA 3BH0A 4FD2A 4MI9A 2XYRA 5JSZA 2AR9A 2J5QA 1NVVR 4JDPA 5CA0B 1D1PA 1A98A 2QVXX 5EXXA 3OWXA 3C6XA 5GVSA 4EJSC 1ORVA 1R37A 1DIOB 4L22A 4GI7A 4WESA 1IEWA 4RLHA 4NFYA 1FNMA 3NT5A 4ZQEA 5EIBD 5IULC 2D54A 3D6TB 3PT5A 1QSGA 2VTEA 3ASZA 1Q17A 5E7QA 5EWJB 4CDNA 2YWJA 4X8HA 3GEBA 1WPGA 3K0HA 5CXSA 4R05A 5HOEA 2WYOA 4EKNB 3UVEA 1G4HA 2IOFA 2VDLB 2PYZA 3A36A 1DKLA 1TE2A 3CKYA 1PNTA 1Z82A 3NEPX 4FHFA 1U0EA 5EUBA 1M72A 2QT9A 3F5SA 4PWZA 5BR8B 5E7IA 5C53B 2R8YA 2VIIA 1R6XA 3QLTA 4HGPA 3H5IA 3IEUA 1HYBA 2BM0A 2X5JO 1BWRA 1QR6A 1MGOA 4P98A 3VJKA 2FR1A 2O2EA 2X8BA 3F6BX 4MLPA 5CAEA 3U4DA 1SVIA 1XFAA 1BDJA 2ZRKA 2XKJE 4DR6B 3MWFA 4ZO4A 2GVZC 4QULA 3GA7A 5EE9A 3T0FA 3W6UA 5B57C 3K35A 4D6YA 3JWIA 5FX2A 1YZYA 3X1JA 3LT2A 3FIUA 2A4MA 1X3LA 4BY9E 5FBWB 1E2PA 2XT0A 1J8YF 2ZR9A 3EHEA 2XNCA 3UJ7A 3W3AH 2D1TA 3Q7IA 3C1AA 4D97A 3W9UA 4AUEA 3FCUB 2OESA 4DNQA 3THWA 3PGVA 3KHSA 3SGLA 4X41A 1HI9A 4RAOA 2OO5A 1U0NA 4QOIA 1MB2A 4XA8A 4IUBS 2Q5HA 4BEWA 2YY5A 3IAM1 3O0TA 4IHJF 5CIYA 2J9RA 1ODFA 4ZCPA 1GKLA 1XZIA 3GJRA 4LJLA 2VS1A 5I6DA 4W1SA 1OLUA 1H1DA 1P80A 2Q4BA 4C21A 2J0VA 3ILVA 4FGSA 3NHRA 3G6WA 3OVMA 1K9SA 1KORA 2WT8A 3M6IA 1GIAA 2Z9CA 4EABA 2Q1WA 1YK1A 4Y6SA 5CDGA 1C1XB 1X9GA 4XGKA 5G0UA 5K0CA 4G23A 2A9QA 2PLFA 1T2NA 3IEPA 3GFGA 4ROSA 4BQIA 2VTBB 2ODTX 2AHRA 1Q16A 4J8PA 5B3LA 2G83A 4ER0A 4TMTA 1BXRA 1VXRA 2BGRA 2M9MA 3F1LA 3L7NA 3X1DA 3U4QA 1OFVA 1R12A 4X97A 5ELLA 1K8YB 1XALA 5EMLA 1N0VC 4MUKA 4ABTA 4BNJA 1OIXA 1V25A 3GG2A 2QROA 5E9QA 4LFBB 3BIWA 1K9VF 1B26A 2CK3D 1XKLA 2X86A 2ONZA 4Z0NA 2VQ6A 1L5HA 4AIIA 4MR9A 2CGEA 2G9ZA 3CS3A 3ENWA 4RD1A 2GUWA 4GP9A 2Q1XA 4RM3A 1Y1SA 1I2MA 3DYVA 3G02A 4HNQA 4RLSA 3E2PA 1OVMA 1TF5A 1Z7GA 5C51B 4B3BA 4TXJA 3UMVA 2AKYA 4QBTA 4DCSA 5JPDA 4H7EA 3KUKA 3DAHA 4RCZA 4KXWA 1WVMA 4QYSA 1NBAA 4DHEA 5HUQA 3EFEA 4JY7A 1UM9A 2ZAOA 5MN4A 2G9VA 1UIRA 3FYUA 2G17A 3NHJA 1KRHA 1XLVA 4W5TA 4JLNA 4FPXA 3EXFB 1H2RS 1N6PA 5BPHA 1A9RA 1U3TA 4ZT6A 3LT5A 1QZTA 1F9AA 3HY3A 1PS8A 3NO4A 5KOYA 4FYPA 1LQ2A 1OAOA 1JSLA 1QGZA 2OZLA 3NAQA 5CLGA 2Q5CA 2ZROA 3QUBA 3M89A 4YQZA 3TDMA 4YPVA 2C5EA 3KD3A 5KX5A 2RCNA 2FR8C 4F56A 1W5AA 1C1YA 4W5OA 1WTCA 1OX4B 3PJDA 3GDHA 4J91A 5F98A 2W2LD 1LNQA 1NJFA 2C29D 2NX2A 3R0JA 4PX3A 3R0QA 4BRUA 1NFRA 1WSWA 2PA0A 2R6DA 1AXGA 1G5IA 4N9WA 3RS2A 2QR3A 2O19A 2I7XA 2BKEA 2ZBUA 1BJTA 1HDZA 1U1FA 1P0MA 1QIGA 2W6IA 3H1FA 1JNYA 2CXUA 1FNSA 1OUMA 2EYQA 3EARA 3PDJA 4U02A 4MV6A 5BR1A 1VL2A 3HLTA 2FMFA 1W85A 1LPMA 1SC3A 5SY4A 2CUKA 1YHZA 2ZRHA 1IAQA 3H5AA 2VJMA 1U65A 2AWNA 1S9HA 1TJNA 2WHRA 4AKIA 1I6KA 5FLXA 1A72A 3HJUA 1MV5A 2DSTA 2WD8A 1D6NA 1S2OA 3C87A 3EQ8A 1M34A 3G2PA 5TEWA 5AHRA 1KY2A 1P1IA 4N12A 3P94A 3HO1A 1N2IA 2P1DA 4LSGA 3BCUA 2VH5R 1NW5A 1SXJE 1NKSA 4OB6A 4QTZA 1E1YA 3X1YA 4EZIA 3T5AA 6Q21A 2HHAA 1X80B 4Q5IA 3H3FA 4G2NA 1W7AA 3AHCA 3SDZA 1NVDA 1NF2A 4LEIA 5EN4A 4G9EA 3KE8A 3UPDA 1NNLA 2PD3A 3DZBA 4XFKA 2DJ5A 2BFMA 2XJ4A 3CIOA 3TQOA 1WW3A 2I0FA 4KXVA 4DSZA 2X6TA 1SIBE 4A9AA 4CF7A 3TZKA 5A4JA 2FCAA 1SG6A 3IHTA 3QEMB 3EXIB 4Q12A 5H83A 1QQBA 3R9IA 1H94A 2BMFA 2BRUC 1Y5LA 3P0IA 4MW1A 5EJ2A 2QX8A 2FN4A 2OBXA 3BMQA 4C7XA 2HWXA 3L6UA 2P3QA 5D85A 3NHKA 4ITVA 1A8SA 3OZUA 3J81k 1PBNA 1XCLA 4L9SA 4OQPA 2QI9F 1FFGA 3O8NA 4GYWA 3U7EB 3FKSD 4MGIR 3U7IA 1K0FA 4OYYA 3WB9A 2GPAA 4BWFB 5FUQA 2WB2A 3QYPA 4Z4HA 4YDHB 3TLMA 3UF0A 4XB2A 3T38A 1JFVA 2HH9A 1PJCA 1QDUA 3JYLA 1V6CA 1CUIA 5F7JA 2PZMA 1BWSA 4OFXA 4ZI7B