5F3XB

Crystal structure of harmonin npdz1 in complex with anks4b sam-pbm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
VDATPLEVFLQSQHLEEFLPIFMREQIDLEALLLCSDEDLQNIHMQLGPRKKVLSAIDKRKQVLQQPGQLVDTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Harmonin
publication title Mechanistic Basis of Organization of the Harmonin/USH1C-Mediated Brush Border Microvilli Tip-Link Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/protein binding
total genus 23
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5f3xB00
1OW5A 2D3DA 1B4FA 1PK1B 1Z1VA 2K4PA 1SV4A 3BS5A 4NL9C 2ESEA 1LKYA 2GLEA 4IS7A 2B6GA 1OXJA 1SV0A 1SXDA 3H8MA 1V85A 2KE7A 3TADC 1COKA 2DKXA 4NJ8A 2LPEA 3K1RB 2F8KA 2JV3A 1X9XA 1PK3A 4RQMA 1PK1A 1WWUA 1DXSA 2QB0B 4RQNA 2E8MA 2E8NA 4NL9A 2F3NA 2Y9TA 5JRTA 2QARB 2LMRA 2YTUA 2F44A 2KSOA 1V38A 2QB1A 2EAOA 2K60A 2EAMA 2L5YA 3IDWA 3BS7A 1RG6A 3KKAC 1WWVA 3BS5B 2EANA 5JU5A 1F0MA 3SEIA 1LKYB 4PZOA 5JTIA 2E8PA 1UQVA 3TADA 1SV0C 3TACB 2FE9A 2KIVA 1UCVA 1B0XA 1SXEA 5F3XB 2ES6A 3KKAA 1SGGA 2QKQA 2DL0A 5J8YC 2Y9UA 2KMDA 2QB0A 4PZNA 4MHVA 5KNIA 2DKZA 3BQ7A 1X40A 2QARA 1KW4A 2D8CA 1JI7A 1X66A 2KSOB 2E8OA 2EAPA 3HILA 2KG5A 5L1MA 3SENA 5J8YA
chains in the Genus database with same CATH superfamily
2F1HA 2JH7A 2M0NA 1NK0A 8ICUA 1SV4A 2KK0A 8ICXA 1QH9A 1BPBA 2GLEA 4XA5A 2LYBA 5J2IA 2Z7JA 3QX7A 2HW3A 2DKXA 1ZJNA 4AP9A 2JV3A 4DLEA 2HHUA 5KFAA 2HBKA 2OCEA 4Y2YA 4O3MA 4QZCA 9ICHA 4I27A 4DSKA 3ZDEA 4P2HA 4F50A 5DDYA 3JPQA 5J2BA 5L1KA 1RPLA 5J29A 4DL4A 4KMOB 2LYAA 4PGYA 8ICFA 1XNSA 2BR0A 4Y2SA 4CE6A 3QYPA 5C0YA 3SAHA 3CNHA 3RBDA 4C8NA 2H5XA 4DOCA 4C8LA 4RQ6A 1SKRA 4UB3A 3RJHA 1V9PA 2MAXA 9ICGA 4TQRA 5KG3A 5ALJA 5AM1A 4I2BA 3JPSA 1S0OA 1CI4A 5AKXA 3IG8A 4F5NA 4GXJA 7ICIA 1S10A 4ELVA 1ZD2P 4QZ8A 5KTQA 8ICVA 4YVZA 3ZDBA 2BCVA 5ALLA 2WHEA 2KP7A 2KJ5A 4K4IA 4UAWA 1SZHA 2NRVA 2W8KA 1T4GA 3H7IA 3PX0A 4C4RA 3MGIA 4DOBA 3AMZA 2BCUA 5KG2A 3ZD8A 4C7ZA 1CUKA 2HHWA 3JPOA 4IRCA 1QQ7A 4DF4A 3RRGA 2PFPA 3PMLA 1X9SA 3ZDCA 3ZI4A 4DFKA 2F77X 3ORYA 4F4ZA 1Z1VA 3WK5A 3L5KA 2OYYA 3BS5A 5CEHA 4J9SA 5AICA 4ED8A 4YG2A 9ICTA 2ESEA 4F72A 4Q8FA 1H38A 1VDVA 4JV2A 5ALSA 4DSLA 5AI5A 1SIJA 3M1YA 2W9AA 4P4MA 3RB4A 3C1YA 4B9MA 1N5XA 5AIBA 1WWUA 4CF4A 5F9LA 2FDRA 1ECWA 5DG8A 2E8NA 3GIMA 4US8A 4F91B 4ZH4A 3PY8A 4B9NA 1SB3C 4KITB 3JPTA 1U4BA 4YR0A 3SD7A 4FZNA 1GO3F 2ZIXA 3ISBA 2H3FA 1BPXA 4F3OA 2ZIWA 5AKZA 2WTFA 3KKAC 4RU9A 7ICEA 2I1QA 4P0QB 3SMVA 2KZMA 1J2MA 1UT8A 1HJPA 2F1JA 1TE2A 1U48A 1NJWA 2K8AA 1ZOLA 2EZZA 4QZDA 5EE3A 2WB1F 3TARA 4KLFA 4I2FA 1FIQA 3RB6A 1ZQFA 7ICVA 4KLMA 3KHRA 3TQ1A 3OGUA 1ZQCA 9ICLA 5DQHA 5BOMA 3TFRA 4O3SA 4NLGA 5AKHA 3C5GA 2GOLA 5J0WA 4R63A 4F4YA 3THVA 8ICKA 4RQ3A 2JZBA 2OHFA 4ELUA 8ICLA 1NI3A 1ZQWA 7ICSA 2ALZA 3PSIA 3CP8A 5DB7A 3M8RA 4GLXA 1AQ6A 1NK6A 3FM9A 2BQUA 1ZQDA 5G5GA 2XCPA 2W3SA 3AQEA 4PHPA 1NK7A 1B4FA 5J0XA 3GV7B 3BZKA 4NJ8A 4QJFB 2JEIA 2EQYA 4M47A 4QZ9A 1VLBA 1LB2B 4DFDA 2VIXA 2KVCA 4M9NA 2JH1A 2YY6A 1RYUA 5L1JA 4J9RA 2G07A 1XO0A 4DSIA 3IG5A 3ED5A 1XU4A 3RAQA 1X9WA 4C0ZA 2KICA 3M8SA 3NRZA 4JB3A 4B9SA 9ICRA 3RJJA 3MR3A 4KLHA 4RPYA 1P7DA 5KT6A 1XSLA 3EW9A 5KFBA 1S0VA 3RJGA 1F0MA 4RQ8A 2DBYA 9ICSA 3AN1A 1QQ6A 5AI4A 3Q8RB 4KLSA 2ZJ8A 9ICKA 3RH4A 1FEZA 1QSYA 3PZPA 2JR5A 2JEJA 2HI0A 3PNCA 1BVSA 1N61A 1B0XA 2Q4TA 3M9OB 3SZ2A 1N56A 5KG7A 1NJYA 4BDPA 1L6NA 3H0LB 2KTQA 4Y2QA 4C7YA 1KSPA 4O9MA 5KNIA 3IM1A 1RYSA 4EBEA 3RAXA 4QZFA 1N62A 3PW5A 2GWSA 1K1QA 5HR6A 1TAUA 4PHEA 4J9OA 2LHTA 3GQCA 3C21A 1ZQTA 1FO4A 2VA8A 1BPDA 4R64A 5KFCA 2JGAA 2RHFA 2YMPA 4P0QA 2K4PA 2ZJ5A 4P4PA 1KN5A 3N28A 2I6XA 3AL0B 1ZQXA 2KVSA 1ZD5A 3LVVA 5DQIA 5BPCA 2PI5A 4E0DA 3TKAA 1L7PA 9ICMA 2YMLA 2PFOA 3NVVA 3QUCA 4OCZA 2Y1IA 3UMBA 1VJ5A 4I2DA 5KFPA 4RPXA 1Q3VA 4UW9A 1B43A 2F76X 1NZBA 5J2EA 2KJ8A 3MC1A 4EX7A 3WKDA 4O3QA 4KLQA 1N5WA 2K8BB 1RQNA 2PMZC 4ECSA 8ICGA 3BQTA 3N7PD 5ALYA 1SL1A 3F2BA 2HVHA 3NASA 1UHUA 2HHQA 3FDSA 4RNOA 5ALWA 4XRHA 1JALA 2XGPA 3QZ7A 5JTIA 5DB6A 4O3NA 1UQVA 4O5KA 2IOFK 5CHGA 4UB6U 3G6YA 1LV5A 3HT3A 3PO5A 2EZYA 1L3VA 5AK6A 2DUYA 2HOQA 3LYSA 3SR6A 4EBDA 4MFFA 2C22A 2Y9UA 1ZQQA 8ICCA 3SAFA 2KJ9A 1AROP 2DKZA 3BQ7A 1IXRA 1FFUA 5KFNA 4DFMA 3QU2A 1K1SA 1ZQKA 1ZRMA 5IINA 4M9GA 4IQTA 1N2XA 2IOHA 1RZTA 3OTQA 5ALVA 4KLUA 4DFPA 1S9FA 4O3OA 2ASLA 5KFWA 2ODGA 2KZ3A 5AKLA 4FZLA 2FPKA 2WAQC 3MGVA 1SXDA 2KIWA 2YX8A 4M9LA 5ALQA 4BWJA 4DSFA 3HX0A 1D9FA 4FE3A 2NV3A 4G9BA 1HEKA 4QWAA 4FFDA 2HDOA 4DF8A 4B9LA 4I2GA 9ICJA 2C2RA 1NOMA 5KFJA 1KL9A 4LZDA 5KFYA 4MF8A 2JEGA 1KFDA 5IIIA 2RP5A 1L3UA 1ZQGA 4C8KA 5HP4A 3T5LA 4PGQA 3IP4B 1V38A 1O03A 1D8BA 1ZQOA 3RBEA 1KDHA 4DOAA 1ZQAA 4QW9A 2BPFA 2EAMA 3JPNA 5A0LA 1TK5A 4PL1A 2A1JB 5KFIA 2ISPA 3B0YA 7ICFA 4USAA 3UMCA 1RQLA 4J9KA 3RB0A 3TADA 5KG6A 4ICAA 2KKVA 2J6UA 2JEFA 4OO1J 2FE9A 5KFUA 5KT7A 1TK0A 1UCVA 4C4TA 2VA3A 1SXEA 2C28A 2W9BA 5KG5A 2CRXA 3LVWA 5AM5A 2RDIA 4QWBA 5J0QA 5ALHA 1SKWA 2R8GA 3M9NB 5KFFA 2ZTEA 4YXMA 1L3SA 4ECRA 4QWEA 3F53A 2W9CB 3WKAA 3LWMA 5L1MA 2AQ4A 4LJXA 1NZPA 3BQ2A 3K4GA 1L7OA 4NXZA 2XCAA 3KZXA 4IL6U 5AK5A 2OEHA 1SV0A 1ZQBA 3TADC 2ZIXB 5KL1B 3E2EA 3K1ZA 4F2SA 1IM4A 3C1ZA 4GIBA 1U47A 5G5HA 5AK4A 3RH6A 1SWVA 4QZGA 3MR5A 1ED1A 4HYKA 2QARB 5ALKA 2K89A 3GIIA 3TAQA 2F44A 8ICYA 4F92B 4JUZA 1Z4NA 4O3RA 3GV5B 2P35A 4CGZA 3MFIA 2L5YA 2R8JA 3L4PA 1RG6A 4J9QA 2JZBB 4ECTA 1NK9A 1LKYB 4UBCA 3SV3A 4DFJA 2BCQA 1QCKA 1MA7A 1XWLA 1SV0C 1XS9D 4WJ3B 4PHDA 1U9LA 5DLGA 3SAGA 4CNQA 3PX6A 1QTMA 3EUB2 4KLTA 1SGGA 3TANA 4RNNA 1RXWA 3D2SA 2HBLA 1ZQSA 4KLGA 4PZNA 2VJ5A 2V4RA 3H4BA 2C2DA 1A76A 4YR3A 4UAYA 4OJ5A 3BQ0A 1IV8A 5CRXA 3ETRA 5HHHA 5E79U 4DQSA 1PVQA 2AHOB 2R8IA 4RQ1A 3WK9A 5KAIU 2G0AA 4QZEA 5DDMA 2A1JA 2ZUDA 5L1IA 3Q8KA 5TZVA 1Y88A 2DF4B 3A0BU 4QWCA 2KE7A 4I2EA 2PMZF 5EE1A 8ICZA 5J0OA 1JMSA 2F8KA 4F2RA 1WYGA 5J0SA 1NK5A 3UPQA 4I2HA 2R8HA 1DXSA 2W55A 2EZXA 2QB0B 4ACOA 4NL9A 5JRTA 1JXEA 2W43A 4NWIA 1L7MA 4QZIA 3RJIA 2HBJA 3N7RC 3D2NA 1TAQA 4CCHA 2W9CA 2DPJA 3WK8A 1JN3A 1ZQIA 4NLZA 4JV1A 8ICAA 5AI0A 4LZGA 1WWVA 1D9DA 7ICMA 3B9JA 4RZRA 3UQ2A 3ICXA 8ICIA 4R8UB 4O3PA 3AQFA 4RNMA 5L1LA 4RT3A 3OJSA 1NK4A 2ZUBA 4UB1A 8ICJA 1Z00B 5KFXA 5J0PA 5F3XB 3PW2A 2HHSA 4IR1A 2BDUA 3MDCA 2KMDA 9ICWA 3QU4A 2W7PA 3UXPA 2FLNA 4MFCA 2QARA 9ICCA 3WK4A 2KFNA 3IRUA 2WAQF 1L7NA 2EAPA 2YB1A 3PSFA 5KFQA 2HOFA 4F5RA 2AU0A 3DDHA 4M6WB 4Y2VA 5H2FU 4OJLA 2PFNA 1SKSA 4PJ0U 3R9KA 1Z19A 3H0MB 1LKYA 2BDPA 2NRZA 8ICEA 4YN4A 3UM9A 4BX9C 5ALDA 2HSZA 2JHDA 2OM6A 5J2CA 3H0RB 4UB4A 4UAUA 5AKJA 4QZAA 2I5HA 4UASA 3H8JA 4UB2A 3QE9Y 3QU9A 1RYRA 4ED6A 9ICEA 2IHNA 3RJKA 3FC4A 4A8EA 2K60A 2RQ5A 2OH2A 8ICNA 2KHQA 5ALGA 4B9UA 5EE9A 2ASDA 3NS1A 3I76A 5CR0A 3FYHA 2FI1A 5B5EU 5J2GA 1X6IA 3AM9A 1MQ2A 9ICVA 3HW8A 4DL3A 5J2KA 2Y0SC 2B0CA 5KFEA 4RPZA 2QKQA 8ICHA 3N4MB 2QB0A 4Y2RA 2YN4A 3HRDD 1T3QA 1SL0A 5KFDA 3HWTA 3Q8LA 5CA7A 4RT2A 2WF8A 1F44A 4DQIA 5ALEA 2FPLA 4EZ9A 1DRGA 3O0FA 3QU7A 2Q0ZX 2DQNB 4DLGA 1TKDA 1S5LU 2IOFA 5J0UA 4DL6A 1T8EA 1U49A 1T7PA 3B0XA 5ALIA 4R8UA 4IS7A 2AGPA 4ECUA 2MA1A 2XICA 4O0IA 1K5OA 4YMOA 1WCLA 4ECYA 4Y2XA 3AUOA 1Z00A 2AGOA 4IQWA 5DB8A 3PSPA 1X6JA 4J9LA 4ED0A 2VANA 2K4EA 2W54A 1NKEA 1ZQ1C 5AKKA 1L3TA 3RB3A 3IDWA 4M6WA 3C5FA 1NKBA 4NLNA 1S76D 2W9BB 5FP0A 4I28A 1D8YA 1LVHA 8ICPA 4YD2A 1N63A 1YZ6A 2PKEA 3RH5A 5DB9A 3SEIA 2EDUA 2PI4A 2DPIA 2LM4A 4PZOA 1KKXA 3KHHA 2HVIA 1JROA 5ALFA 1Q46A 3AU2A 2XC9A 1F5SA 4KX3A 1NJZA 5KFHA 4ELTA 3N7SC 1XC9A 2YMMA 2NO4A 5ALNA 4M9JA 3BZCA 1X66A 4QWDA 1YZ7A 8ICQA 2KKPA 2XY7A 1L5UA 5CB1A 4JWNA 3ONNA 3OHBA 4UATA 5J8YA 3V7KA 2GH1A 2HOIA 2BCSA 4ECQA 1BNOA 3HP6A 4Q43A 2KHVA 1QQ5A 2CPRA 2G09A 4FBUA 9ICNA 3TFSA 3H8MA 1V85A 3PX4A 3WKCA 4B9VA 4M0AA 2LPEA 3RFAA 3K1RB 3BDPA 5ALXA 2RRDA 5AM4A 4BUGA 1PK3A 5BOLA 2ZIVB 8ICWA 4KLJA 3V72A 1UA0A 1QSLA 2IHMA 3UMGA 1EXNA 3T5HA 1T3NA 2LYHA 2ZIUB 3HKZC 3AEVA 1N48A 3MR2A 5EOZA 4F4WA 4EEKA 3QXGA 3AU6A 4EZ6A 3SV4A 4Q45A 2VKQA 2V9WA 4Z6EA 5C5JA 1HUZA 4J9MA 2A19A 4C80A 3VC8A 2BQ3A 7ICLA 2GO7A 3QEBZ 3TI0A 1KFSA 4F8RA 1SL2A 4AYBC 4YCXA 3LDAA 1YT3A 4KMUA 4EYHB 2DWQA 4MEYA 3EPIA 3SQIA 1O08A 1T94A 1J97A 2NRTA 4UAVA 3F2CA 5EWFA 4EBCA 5DBCA 1A77A 5HNKA 2E1EA 2ZUCA 2BHNA 4B9TA 4CF5A 2A3VA 1DOQA 5DG9A 1N60A 2ATLA 5L9XA 4MEXA 4F5OA 3VCBA 1JIHA 5ALPA 3HJEA 2KFZA 7ICOA 2O6KA 4KLLA 8ICTA 4FZMA 2XY6A 2ZXIA 4J03A 5AI8A 2B21A 1U45A 2H3QA 2N1RA 1RDFA 5HMMA 3UXNA 3M7DA 4G3IA 5KG0A 1NK8A 3RJFA 1X9XA 4ED1A 1QSSA 2K4IA 3KZIU 2DGZA 1PK1A 3K75D 3C2LA 5D4BA 4MF2A 1UPHA 3IHQB 4TURA 4RQNA 4YR2A 4RQ5A 3RR8A 1KTQA 2F3NA 4KTQA 4DQRA 5KFZA 5KL8B 1ZETA 5AIAA 3MFHA 4MFAA 1L8OA 4Q44A 1SWWA 2P66A 1MQ3A 1MSWD 5ALZA 1MC8A 3JPRA 5TISU 2W03A 2RLTA 5KG1A 2I9GA 7ICTA 2Y0SF 1KQQA 2W11A 4GC7A 3BS7A 5J2AA 1CEZA 2MUTB 4QW8A 3E58A 4OJOA 3ZDDA 1UT5A 4KN4A 4ED7A 3QUTA 4X5VA 5DG7A 2UVVA 4RUCA 2ZG6A 4IC9A 1TV9A 3EPGA 5KT4A 3WKEA 3KFUF 4YMMA 2ZIVA 5DBBA 5EWEA 3U26A 2M9NA 1KEJA 2ZIUA 2YB4A 3FAHA 3T3FA 5DBAA 4J9NA 2Y1JA 3HILA 3CRXA 5IIJA 1NKCA 5AKEA 3ZDAA 3G6XA 2J6SA 1A0PA 4I2CA 2PXIA 5B66U 4GXKA 3F5EA 2NO5A 3V7JA 3QEAZ 5AI6A 2MRLA 2R8KA 2P6RA 2B6GA 2OXOA 4TQSA 3BQ1A 5CP2A 4UBBA 2YMQA 4DSJA 3C28A 4F5PA 2ISOA 3GZFA 4ECVA 1RXVA 2AH5A 3PV8A 4Z6FA 3I28A 2NYVA 2ZXHA 4C8MA 4DQQA 4UQGA 7ICHA 5EE0A 9ICBA 5HHIA 2MSNA 3OSNA 3OSPA 1DGJA 1URJA 3T5KA 2AGQA 2LI6A 1Q8KA 1S8OA 2DFLA 4DCCA 3CYMA 1JUDA 4F5QA 1ZYQA 3IN5A 2EANA 3MR6A 5JU5A 1C20A 5HMLA 9ICUA 2A1AA 4QZHA 3Q8QB 5K4LA 4J9PA 3RF9A 2W3RA 5D46A 3IV6A 2W9MA 4HAIA 1ZXIA 4BXOB 2JRZA 2BGWA 5DKWA 3KKAA 4M04A 2H3IA 4QIWC 4Z6DA 3PO4A 5J2FA 4MHVA 4CF3A 5KG4A 3GIJA 2ZTCA 4QZBA 8ICMA 1L8LA 1ZQJA 2HHTA 3QNMA 3ISDA 4B6JA 1KBUA 9ICFA 4YP3A 2LBOA 8ICRA 4C8OA 9ICIA 4Y2PA 5J2JA 4NLCA 2ASJA 4I2JA 3C2MA 1OW5A 7ICUA 1NNLA 4CDGA 2H3ZA 1JRPA 3QZ8A 2MUTA 5AM3A 4YFKA 9ICAA 3M6KA 1Z4OA 4NL9C 3RR7A 2HBMA 4US9A 2H3VA 3TAPA 3HKZF 7ICRA 4U7CA 2NRWA 5DGBA 9ICOA 4O5CA 4RUAA 1TVAA 1X42A 7ICQA 4F71A 4UB8U 4RQMA 3OHAA 5AI9A 2FLLA 2E1FA 2PFQA 5T14A 2LMRA 2YTUA 1SZPA 3KD3A 1BPYA 2WF6A 5AKGA 4Z6CA 2QB1A 4FS1A 4NLBA 4JV0A 2FMQA 5GTIU 3NGDA 4AYBF 4DO9A 2WF5A 5GTHU 2K8CB 3M9MB 5ALOA 4BWMA 2XVTA 5J0YA 5J0RA 1ZQZA 3UQ0A 5IIOA 9ICPA 4DL5A 2LKYA 4ECXA 3H4DA 1ZQMA 4YQWA 2ES6A 3RRHA 3PMNA 1OUQA 3UXOA 4NY8A 4OD0A 5ALUA 4UARA 1C7YA 2F8LA 4DL7A 4EEYA 1X40A 5DLFA 1V97A 4DS5A 1ZQRA 2J6TA 1PZNA 2FMSA 2D8CA 5KAFU 2KSOB 4JK1A 2HHVA 3PR4A 2FLPA 3Q8MA 2P6UA 4GFJA 1COOA 1D8LA 3NVWA 5AKIA 1PVPA 2IMWP 2K4HA 3DV9A 2KN7A 5DGAA 2BQRA 1S0NA 4I2IA 3NTUA 3L3FX 2UVRA 5EWGA 1ZQUA 1KRPA 5F9NA 3S6JA 3MBYA 4KX5A 4P0PB 1ZQVA 2KEYA 7ICGA 4F93B 1MN8A 4DS4A 7ICNA 4ED2A 2BPCA 3EWAA 4O5EA 2AJQA 4KLEA 5ALTA 5AM2A 2WF9A 4BXOA 4KN7A 1KLNA 1ZQEA 5KFSA 3F2DA 3C2KA 4M9HA 3OJUA 3NUQA 2FPMA 3V7LA 4NM2A 2XIDA 1BGXT 3KOOA 8ICSA 2F1IA 4IQVA 4PL2A 5DQGA 5KFMA 4OJPA 4DEZA 2IBKA 1FFVA 4U6PA 4M2YA 3QU5A 1DK2A 4C4SA 4RQ4A 3Q8SB 3KTQA 1Z1BA 3D6JA 3WK7A 3T5JA 1JXLA 3V6HA 4RQ7A 4XUSA 3T79A 1WCNA 4GXIA 4FS2A 3H8SA 4ZOHC 3KHLA 1DK3A 4NLKA 2JXJA 5CWRA 2XGQA 2MU2A 2LM1A 3ALRA 4EELA 1WG8A 3F5AA 5KT3A 1NJXA 1BPEA 2ZJAA 2W8LA 3C23A 3QUBA 2BPGA 4IR9A 3WK6A 1KW4A 3EYZA 3OPXA 2E8OA 3SI8A 2WF7A 3J81j 2BCRA 1TAMA 2XY5A 3DEEA 3CW2C 1Z3EB 3V6JA 4UAZA 1DGSA 4BGDA 4EX6A 4NV0A 5AK3A 2W7OA 1PK1B 2BKEA 5AKYA 4R65A 4F4XA 2EH9A 3G6VA 1Q3UA 3PW7A 3N97B 5J2DA 3NRWA 5D49A 4R66A 2XO7A 3WKBA 2UVWA 3NVZA 2E5SA 5HR7A 2CN1A 3NVYA 3MGHA 1COKA 5KT5A 1CRXA 1RM6C 4DWIA 4PH5A 4IRKA 4YMNA 2RDJA 1IG6A 2NRXA 2E3TA 5ALMA 3JPPA 2Y9TA 4CRXA 4QNLA 5KFGA 2KOBA 3A0HU 4RQ0A 4FO6A 2KSOA 1J2NA 1ZQNA 2F2AB 3MDAA 2C2EA 3QUQA 4BJQA 2HHXA 3E0FA 1X2IA 3D2QA 1HIWA 3RTVA 4QIWF 2AXTU 2XI9A 3GFKB 3PVXA 4P0PA 4K4HA 1IIPA 4IQUA 2JMGA 7ICJA 3KBBA 4XQ8A 2G06A 3SYZA 2HCFA 2W04A 1S97A 4Y2TA 4KLDA 3I1YA 1S0MA 2DL0A 5J8YC 4I29A 4TUQA 2WB1C 2G08A 3EZ5A 4Y2JA 3C29A 4EENA 2HMXA 2VA2A 4DQPA 2KNJA 4PHAA 4EYIB 4IRDA 1ZD4A 3SENA 1TK8A 2G5IB 4YD1A 5J2HA 4LVSA 2D3DA 2YQEA 3GILA 3MABA 4Q8EA 2BZFA 5IILA 3GV8B 5KFLA 4DSEA 1A6SA 4YXJA 4JMUA 5KFTA 2D6FC 4ED3A 4ECWA 1OXJA 3PW4A 4PGXA 4KLIA 7ICPA 1ZQLA 3V6KA 3H8WA 2AQ0A 1HUOA 5J0TA 1QLNA 5IIMA 2VJ4A 1S77D 4P4OA 1WUDA 2WFAA 4F4KA 8ICOA 1ZJMA 4I2AA 3Q8PB 8ICBA 1BPZA 2E8MA 3ZD9A 3WU2U 2ZTDA 2FJ6A 5KFVA 4GC6A 1XSPA 2FMPA 1BNPA 1TFRA 4UB5A 2EAOA 5KT2A 1KFTA 1XSNA 3LK9A 5AM0A 3PW0A 5KFOA 1PUZA 5AHXA 3BS5B 1XO1A 5CJ7A 1JX4A 5IIKA 2CXYA 5KFKA 1UA1A 2E8PA 1ZQYA 7ICKA 4RQ2A 1PVRA 4ECZA 3TACB 2KIVA 4Y2UA 5KFRA 4OJ6A 3ETLA 2OWOA 2R18A 4JWMA 3BJYA 2QLTA 4KLOA 9ICQA 1ZQHA 9ICXA 4NM1A 3HPOA 3GIKA 3M6ZA 1ZQPA 5ALRA 4FBTA 1ZD3A 4DL2A 1B22A 2KD1A 2IA6A 2KZZA 3PR5B 1JI7A 3GU3A 3ISCA 3GDXA 2KV2A 4PPXA 4K4GA 1M6YA 3LWLA 2KG5A 5JUMA 1ZRNA 4TUPA 4TUSA 3KHGA 1X9MA 2G5HB 3RJEA 3H40A 2UVUA 2V4QA 3PSTA 2ZIWB
chains in the Genus database with same CATH topology
1OW5A 2D3DA 1B4FA 1PK1B 1Z1VA 2K4PA 1SV4A 3BS5A 4NL9C 2ESEA 1LKYA 2GLEA 4IS7A 2B6GA 1OXJA 1SV0A 1SXDA 3H8MA 1V85A 2KE7A 3TADC 1COKA 2DKXA 4NJ8A 2LPEA 3K1RB 2F8KA 2JV3A 1X9XA 1PK3A 4RQMA 1PK1A 1WWUA 1DXSA 2QB0B 4RQNA 2E8MA 2E8NA 4NL9A 2F3NA 2Y9TA 5JRTA 2QARB 2LMRA 2YTUA 2F44A 2KSOA 1V38A 2QB1A 2EAOA 2K60A 2EAMA 2L5YA 3IDWA 3BS7A 1RG6A 3KKAC 1WWVA 3BS5B 2EANA 5JU5A 1F0MA 3SEIA 1LKYB 4PZOA 5JTIA 2E8PA 1UQVA 3TADA 1SV0C 3TACB 2FE9A 2KIVA 1UCVA 1B0XA 1SXEA 5F3XB 2ES6A 3KKAA 1SGGA 2QKQA 2DL0A 5J8YC 2Y9UA 2KMDA 2QB0A 4PZNA 4MHVA 5KNIA 2DKZA 3BQ7A 1X40A 2QARA 1KW4A 2D8CA 1JI7A 1X66A 2KSOB 2E8OA 2EAPA 3HILA 2KG5A 5L1MA 3SENA 5J8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW5 A;  2D3D A;  1B4F A;  1PK1 B;  1Z1V A;  2K4P A;  1SV4 A;  3BS5 A;  4NL9 C;  2ESE A;  1LKY A;  2GLE A;  4IS7 A;  2B6G A;  1OXJ A;  1SV0 A;  1SXD A;  3H8M A;  1V85 A;  2KE7 A;  3TAD C;  1COK A;  2DKX A;  4NJ8 A;  2LPE A;  3K1R B;  2F8K A;  2JV3 A;  1X9X A;  1PK3 A;  4RQM A;  1PK1 A;  1WWU A;  1DXS A;  2QB0 B;  4RQN A;  2E8M A;  2E8N A;  4NL9 A;  2F3N A;  2Y9T A;  5JRT A;  2QAR B;  2LMR A;  2YTU A;  2F44 A;  2KSO A;  1V38 A;  2QB1 A;  2EAO A;  2K60 A;  2EAM A;  2L5Y A;  3IDW A;  3BS7 A;  1RG6 A;  3KKA C;  1WWV A;  3BS5 B;  2EAN A;  5JU5 A;  1F0M A;  3SEI A;  1LKY B;  4PZO A;  5JTI A;  2E8P A;  1UQV A;  3TAD A;  1SV0 C;  3TAC B;  2FE9 A;  2KIV A;  1UCV A;  1B0X A;  1SXE A;  5F3X B;  2ES6 A;  3KKA A;  1SGG A;  2QKQ A;  2DL0 A;  5J8Y C;  2Y9U A;  2KMD A;  2QB0 A;  4PZN A;  4MHV A;  5KNI A;  2DKZ A;  3BQ7 A;  1X40 A;  2QAR A;  1KW4 A;  2D8C A;  1JI7 A;  1X66 A;  2KSO B;  2E8O A;  2EAP A;  3HIL A;  2KG5 A;  5L1M A;  3SEN A;  5J8Y A; 
#chains in the Genus database with same CATH topology
 2F1H A;  2JH7 A;  2M0N A;  1NK0 A;  8ICU A;  1SV4 A;  2KK0 A;  8ICX A;  1QH9 A;  1BPB A;  2GLE A;  4XA5 A;  2LYB A;  5J2I A;  2Z7J A;  3QX7 A;  2HW3 A;  2DKX A;  1ZJN A;  4AP9 A;  2JV3 A;  4DLE A;  2HHU A;  5KFA A;  2HBK A;  2OCE A;  4Y2Y A;  4O3M A;  4QZC A;  9ICH A;  4I27 A;  4DSK A;  3ZDE A;  4P2H A;  4F50 A;  5DDY A;  3JPQ A;  5J2B A;  5L1K A;  1RPL A;  5J29 A;  4DL4 A;  4KMO B;  2LYA A;  4PGY A;  8ICF A;  1XNS A;  2BR0 A;  4Y2S A;  4CE6 A;  3QYP A;  5C0Y A;  3SAH A;  3CNH A;  3RBD A;  4C8N A;  2H5X A;  4DOC A;  4C8L A;  4RQ6 A;  1SKR A;  4UB3 A;  3RJH A;  1V9P A;  2MAX A;  9ICG A;  4TQR A;  5KG3 A;  5ALJ A;  5AM1 A;  4I2B A;  3JPS A;  1S0O A;  1CI4 A;  5AKX A;  3IG8 A;  4F5N A;  4GXJ A;  7ICI A;  1S10 A;  4ELV A;  1ZD2 P;  4QZ8 A;  5KTQ A;  8ICV A;  4YVZ A;  3ZDB A;  2BCV A;  5ALL A;  2WHE A;  2KP7 A;  2KJ5 A;  4K4I A;  4UAW A;  1SZH A;  2NRV A;  2W8K A;  1T4G A;  3H7I A;  3PX0 A;  4C4R A;  3MGI A;  4DOB A;  3AMZ A;  2BCU A;  5KG2 A;  3ZD8 A;  4C7Z A;  1CUK A;  2HHW A;  3JPO A;  4IRC A;  1QQ7 A;  4DF4 A;  3RRG A;  2PFP A;  3PML A;  1X9S A;  3ZDC A;  3ZI4 A;  4DFK A;  2F77 X;  3ORY A;  4F4Z A;  1Z1V A;  3WK5 A;  3L5K A;  2OYY A;  3BS5 A;  5CEH A;  4J9S A;  5AIC A;  4ED8 A;  4YG2 A;  9ICT A;  2ESE A;  4F72 A;  4Q8F A;  1H38 A;  1VDV A;  4JV2 A;  5ALS A;  4DSL A;  5AI5 A;  1SIJ A;  3M1Y A;  2W9A A;  4P4M A;  3RB4 A;  3C1Y A;  4B9M A;  1N5X A;  5AIB A;  1WWU A;  4CF4 A;  5F9L A;  2FDR A;  1ECW A;  5DG8 A;  2E8N A;  3GIM A;  4US8 A;  4F91 B;  4ZH4 A;  3PY8 A;  4B9N A;  1SB3 C;  4KIT B;  3JPT A;  1U4B A;  4YR0 A;  3SD7 A;  4FZN A;  1GO3 F;  2ZIX A;  3ISB A;  2H3F A;  1BPX A;  4F3O A;  2ZIW A;  5AKZ A;  2WTF A;  3KKA C;  4RU9 A;  7ICE A;  2I1Q A;  4P0Q B;  3SMV A;  2KZM A;  1J2M A;  1UT8 A;  1HJP A;  2F1J A;  1TE2 A;  1U48 A;  1NJW A;  2K8A A;  1ZOL A;  2EZZ A;  4QZD A;  5EE3 A;  2WB1 F;  3TAR A;  4KLF A;  4I2F A;  1FIQ A;  3RB6 A;  1ZQF A;  7ICV A;  4KLM A;  3KHR A;  3TQ1 A;  3OGU A;  1ZQC A;  9ICL A;  5DQH A;  5BOM A;  3TFR A;  4O3S A;  4NLG A;  5AKH A;  3C5G A;  2GOL A;  5J0W A;  4R63 A;  4F4Y A;  3THV A;  8ICK A;  4RQ3 A;  2JZB A;  2OHF A;  4ELU A;  8ICL A;  1NI3 A;  1ZQW A;  7ICS A;  2ALZ A;  3PSI A;  3CP8 A;  5DB7 A;  3M8R A;  4GLX A;  1AQ6 A;  1NK6 A;  3FM9 A;  2BQU A;  1ZQD A;  5G5G A;  2XCP A;  2W3S A;  3AQE A;  4PHP A;  1NK7 A;  1B4F A;  5J0X A;  3GV7 B;  3BZK A;  4NJ8 A;  4QJF B;  2JEI A;  2EQY A;  4M47 A;  4QZ9 A;  1VLB A;  1LB2 B;  4DFD A;  2VIX A;  2KVC A;  4M9N A;  2JH1 A;  2YY6 A;  1RYU A;  5L1J A;  4J9R A;  2G07 A;  1XO0 A;  4DSI A;  3IG5 A;  3ED5 A;  1XU4 A;  3RAQ A;  1X9W A;  4C0Z A;  2KIC A;  3M8S A;  3NRZ A;  4JB3 A;  4B9S A;  9ICR A;  3RJJ A;  3MR3 A;  4KLH A;  4RPY A;  1P7D A;  5KT6 A;  1XSL A;  3EW9 A;  5KFB A;  1S0V A;  3RJG A;  1F0M A;  4RQ8 A;  2DBY A;  9ICS A;  3AN1 A;  1QQ6 A;  5AI4 A;  3Q8R B;  4KLS A;  2ZJ8 A;  9ICK A;  3RH4 A;  1FEZ A;  1QSY A;  3PZP A;  2JR5 A;  2JEJ A;  2HI0 A;  3PNC A;  1BVS A;  1N61 A;  1B0X A;  2Q4T A;  3M9O B;  3SZ2 A;  1N56 A;  5KG7 A;  1NJY A;  4BDP A;  1L6N A;  3H0L B;  2KTQ A;  4Y2Q A;  4C7Y A;  1KSP A;  4O9M A;  5KNI A;  3IM1 A;  1RYS A;  4EBE A;  3RAX A;  4QZF A;  1N62 A;  3PW5 A;  2GWS A;  1K1Q A;  5HR6 A;  1TAU A;  4PHE A;  4J9O A;  2LHT A;  3GQC A;  3C21 A;  1ZQT A;  1FO4 A;  2VA8 A;  1BPD A;  4R64 A;  5KFC A;  2JGA A;  2RHF A;  2YMP A;  4P0Q A;  2K4P A;  2ZJ5 A;  4P4P A;  1KN5 A;  3N28 A;  2I6X A;  3AL0 B;  1ZQX A;  2KVS A;  1ZD5 A;  3LVV A;  5DQI A;  5BPC A;  2PI5 A;  4E0D A;  3TKA A;  1L7P A;  9ICM A;  2YML A;  2PFO A;  3NVV A;  3QUC A;  4OCZ A;  2Y1I A;  3UMB A;  1VJ5 A;  4I2D A;  5KFP A;  4RPX A;  1Q3V A;  4UW9 A;  1B43 A;  2F76 X;  1NZB A;  5J2E A;  2KJ8 A;  3MC1 A;  4EX7 A;  3WKD A;  4O3Q A;  4KLQ A;  1N5W A;  2K8B B;  1RQN A;  2PMZ C;  4ECS A;  8ICG A;  3BQT A;  3N7P D;  5ALY A;  1SL1 A;  3F2B A;  2HVH A;  3NAS A;  1UHU A;  2HHQ A;  3FDS A;  4RNO A;  5ALW A;  4XRH A;  1JAL A;  2XGP A;  3QZ7 A;  5JTI A;  5DB6 A;  4O3N A;  1UQV A;  4O5K A;  2IOF K;  5CHG A;  4UB6 U;  3G6Y A;  1LV5 A;  3HT3 A;  3PO5 A;  2EZY A;  1L3V A;  5AK6 A;  2DUY A;  2HOQ A;  3LYS A;  3SR6 A;  4EBD A;  4MFF A;  2C22 A;  2Y9U A;  1ZQQ A;  8ICC A;  3SAF A;  2KJ9 A;  1ARO P;  2DKZ A;  3BQ7 A;  1IXR A;  1FFU A;  5KFN A;  4DFM A;  3QU2 A;  1K1S A;  1ZQK A;  1ZRM A;  5IIN A;  4M9G A;  4IQT A;  1N2X A;  2IOH A;  1RZT A;  3OTQ A;  5ALV A;  4KLU A;  4DFP A;  1S9F A;  4O3O A;  2ASL A;  5KFW A;  2ODG A;  2KZ3 A;  5AKL A;  4FZL A;  2FPK A;  2WAQ C;  3MGV A;  1SXD A;  2KIW A;  2YX8 A;  4M9L A;  5ALQ A;  4BWJ A;  4DSF A;  3HX0 A;  1D9F A;  4FE3 A;  2NV3 A;  4G9B A;  1HEK A;  4QWA A;  4FFD A;  2HDO A;  4DF8 A;  4B9L A;  4I2G A;  9ICJ A;  2C2R A;  1NOM A;  5KFJ A;  1KL9 A;  4LZD A;  5KFY A;  4MF8 A;  2JEG A;  1KFD A;  5III A;  2RP5 A;  1L3U A;  1ZQG A;  4C8K A;  5HP4 A;  3T5L A;  4PGQ A;  3IP4 B;  1V38 A;  1O03 A;  1D8B A;  1ZQO A;  3RBE A;  1KDH A;  4DOA A;  1ZQA A;  4QW9 A;  2BPF A;  2EAM A;  3JPN A;  5A0L A;  1TK5 A;  4PL1 A;  2A1J B;  5KFI A;  2ISP A;  3B0Y A;  7ICF A;  4USA A;  3UMC A;  1RQL A;  4J9K A;  3RB0 A;  3TAD A;  5KG6 A;  4ICA A;  2KKV A;  2J6U A;  2JEF A;  4OO1 J;  2FE9 A;  5KFU A;  5KT7 A;  1TK0 A;  1UCV A;  4C4T A;  2VA3 A;  1SXE A;  2C28 A;  2W9B A;  5KG5 A;  2CRX A;  3LVW A;  5AM5 A;  2RDI A;  4QWB A;  5J0Q A;  5ALH A;  1SKW A;  2R8G A;  3M9N B;  5KFF A;  2ZTE A;  4YXM A;  1L3S A;  4ECR A;  4QWE A;  3F53 A;  2W9C B;  3WKA A;  3LWM A;  5L1M A;  2AQ4 A;  4LJX A;  1NZP A;  3BQ2 A;  3K4G A;  1L7O A;  4NXZ A;  2XCA A;  3KZX A;  4IL6 U;  5AK5 A;  2OEH A;  1SV0 A;  1ZQB A;  3TAD C;  2ZIX B;  5KL1 B;  3E2E A;  3K1Z A;  4F2S A;  1IM4 A;  3C1Z A;  4GIB A;  1U47 A;  5G5H A;  5AK4 A;  3RH6 A;  1SWV A;  4QZG A;  3MR5 A;  1ED1 A;  4HYK A;  2QAR B;  5ALK A;  2K89 A;  3GII A;  3TAQ A;  2F44 A;  8ICY A;  4F92 B;  4JUZ A;  1Z4N A;  4O3R A;  3GV5 B;  2P35 A;  4CGZ A;  3MFI A;  2L5Y A;  2R8J A;  3L4P A;  1RG6 A;  4J9Q A;  2JZB B;  4ECT A;  1NK9 A;  1LKY B;  4UBC A;  3SV3 A;  4DFJ A;  2BCQ A;  1QCK A;  1MA7 A;  1XWL A;  1SV0 C;  1XS9 D;  4WJ3 B;  4PHD A;  1U9L A;  5DLG A;  3SAG A;  4CNQ A;  3PX6 A;  1QTM A;  3EUB 2;  4KLT A;  1SGG A;  3TAN A;  4RNN A;  1RXW A;  3D2S A;  2HBL A;  1ZQS A;  4KLG A;  4PZN A;  2VJ5 A;  2V4R A;  3H4B A;  2C2D A;  1A76 A;  4YR3 A;  4UAY A;  4OJ5 A;  3BQ0 A;  1IV8 A;  5CRX A;  3ETR A;  5HHH A;  5E79 U;  4DQS A;  1PVQ A;  2AHO B;  2R8I A;  4RQ1 A;  3WK9 A;  5KAI U;  2G0A A;  4QZE A;  5DDM A;  2A1J A;  2ZUD A;  5L1I A;  3Q8K A;  5TZV A;  1Y88 A;  2DF4 B;  3A0B U;  4QWC A;  2KE7 A;  4I2E A;  2PMZ F;  5EE1 A;  8ICZ A;  5J0O A;  1JMS A;  2F8K A;  4F2R A;  1WYG A;  5J0S A;  1NK5 A;  3UPQ A;  4I2H A;  2R8H A;  1DXS A;  2W55 A;  2EZX A;  2QB0 B;  4ACO A;  4NL9 A;  5JRT A;  1JXE A;  2W43 A;  4NWI A;  1L7M A;  4QZI A;  3RJI A;  2HBJ A;  3N7R C;  3D2N A;  1TAQ A;  4CCH A;  2W9C A;  2DPJ A;  3WK8 A;  1JN3 A;  1ZQI A;  4NLZ A;  4JV1 A;  8ICA A;  5AI0 A;  4LZG A;  1WWV A;  1D9D A;  7ICM A;  3B9J A;  4RZR A;  3UQ2 A;  3ICX A;  8ICI A;  4R8U B;  4O3P A;  3AQF A;  4RNM A;  5L1L A;  4RT3 A;  3OJS A;  1NK4 A;  2ZUB A;  4UB1 A;  8ICJ A;  1Z00 B;  5KFX A;  5J0P A;  5F3X B;  3PW2 A;  2HHS A;  4IR1 A;  2BDU A;  3MDC A;  2KMD A;  9ICW A;  3QU4 A;  2W7P A;  3UXP A;  2FLN A;  4MFC A;  2QAR A;  9ICC A;  3WK4 A;  2KFN A;  3IRU A;  2WAQ F;  1L7N A;  2EAP A;  2YB1 A;  3PSF A;  5KFQ A;  2HOF A;  4F5R A;  2AU0 A;  3DDH A;  4M6W B;  4Y2V A;  5H2F U;  4OJL A;  2PFN A;  1SKS A;  4PJ0 U;  3R9K A;  1Z19 A;  3H0M B;  1LKY A;  2BDP A;  2NRZ A;  8ICE A;  4YN4 A;  3UM9 A;  4BX9 C;  5ALD A;  2HSZ A;  2JHD A;  2OM6 A;  5J2C A;  3H0R B;  4UB4 A;  4UAU A;  5AKJ A;  4QZA A;  2I5H A;  4UAS A;  3H8J A;  4UB2 A;  3QE9 Y;  3QU9 A;  1RYR A;  4ED6 A;  9ICE A;  2IHN A;  3RJK A;  3FC4 A;  4A8E A;  2K60 A;  2RQ5 A;  2OH2 A;  8ICN A;  2KHQ A;  5ALG A;  4B9U A;  5EE9 A;  2ASD A;  3NS1 A;  3I76 A;  5CR0 A;  3FYH A;  2FI1 A;  5B5E U;  5J2G A;  1X6I A;  3AM9 A;  1MQ2 A;  9ICV A;  3HW8 A;  4DL3 A;  5J2K A;  2Y0S C;  2B0C A;  5KFE A;  4RPZ A;  2QKQ A;  8ICH A;  3N4M B;  2QB0 A;  4Y2R A;  2YN4 A;  3HRD D;  1T3Q A;  1SL0 A;  5KFD A;  3HWT A;  3Q8L A;  5CA7 A;  4RT2 A;  2WF8 A;  1F44 A;  4DQI A;  5ALE A;  2FPL A;  4EZ9 A;  1DRG A;  3O0F A;  3QU7 A;  2Q0Z X;  2DQN B;  4DLG A;  1TKD A;  1S5L U;  2IOF A;  5J0U A;  4DL6 A;  1T8E A;  1U49 A;  1T7P A;  3B0X A;  5ALI A;  4R8U A;  4IS7 A;  2AGP A;  4ECU A;  2MA1 A;  2XIC A;  4O0I A;  1K5O A;  4YMO A;  1WCL A;  4ECY A;  4Y2X A;  3AUO A;  1Z00 A;  2AGO A;  4IQW A;  5DB8 A;  3PSP A;  1X6J A;  4J9L A;  4ED0 A;  2VAN A;  2K4E A;  2W54 A;  1NKE A;  1ZQ1 C;  5AKK A;  1L3T A;  3RB3 A;  3IDW A;  4M6W A;  3C5F A;  1NKB A;  4NLN A;  1S76 D;  2W9B B;  5FP0 A;  4I28 A;  1D8Y A;  1LVH A;  8ICP A;  4YD2 A;  1N63 A;  1YZ6 A;  2PKE A;  3RH5 A;  5DB9 A;  3SEI A;  2EDU A;  2PI4 A;  2DPI A;  2LM4 A;  4PZO A;  1KKX A;  3KHH A;  2HVI A;  1JRO A;  5ALF A;  1Q46 A;  3AU2 A;  2XC9 A;  1F5S A;  4KX3 A;  1NJZ A;  5KFH A;  4ELT A;  3N7S C;  1XC9 A;  2YMM A;  2NO4 A;  5ALN A;  4M9J A;  3BZC A;  1X66 A;  4QWD A;  1YZ7 A;  8ICQ A;  2KKP A;  2XY7 A;  1L5U A;  5CB1 A;  4JWN A;  3ONN A;  3OHB A;  4UAT A;  5J8Y A;  3V7K A;  2GH1 A;  2HOI A;  2BCS A;  4ECQ A;  1BNO A;  3HP6 A;  4Q43 A;  2KHV A;  1QQ5 A;  2CPR A;  2G09 A;  4FBU A;  9ICN A;  3TFS A;  3H8M A;  1V85 A;  3PX4 A;  3WKC A;  4B9V A;  4M0A A;  2LPE A;  3RFA A;  3K1R B;  3BDP A;  5ALX A;  2RRD A;  5AM4 A;  4BUG A;  1PK3 A;  5BOL A;  2ZIV B;  8ICW A;  4KLJ A;  3V72 A;  1UA0 A;  1QSL A;  2IHM A;  3UMG A;  1EXN A;  3T5H A;  1T3N A;  2LYH A;  2ZIU B;  3HKZ C;  3AEV A;  1N48 A;  3MR2 A;  5EOZ A;  4F4W A;  4EEK A;  3QXG A;  3AU6 A;  4EZ6 A;  3SV4 A;  4Q45 A;  2VKQ A;  2V9W A;  4Z6E A;  5C5J A;  1HUZ A;  4J9M A;  2A19 A;  4C80 A;  3VC8 A;  2BQ3 A;  7ICL A;  2GO7 A;  3QEB Z;  3TI0 A;  1KFS A;  4F8R A;  1SL2 A;  4AYB C;  4YCX A;  3LDA A;  1YT3 A;  4KMU A;  4EYH B;  2DWQ A;  4MEY A;  3EPI A;  3SQI A;  1O08 A;  1T94 A;  1J97 A;  2NRT A;  4UAV A;  3F2C A;  5EWF A;  4EBC A;  5DBC A;  1A77 A;  5HNK A;  2E1E A;  2ZUC A;  2BHN A;  4B9T A;  4CF5 A;  2A3V A;  1DOQ A;  5DG9 A;  1N60 A;  2ATL A;  5L9X A;  4MEX A;  4F5O A;  3VCB A;  1JIH A;  5ALP A;  3HJE A;  2KFZ A;  7ICO A;  2O6K A;  4KLL A;  8ICT A;  4FZM A;  2XY6 A;  2ZXI A;  4J03 A;  5AI8 A;  2B21 A;  1U45 A;  2H3Q A;  2N1R A;  1RDF A;  5HMM A;  3UXN A;  3M7D A;  4G3I A;  5KG0 A;  1NK8 A;  3RJF A;  1X9X A;  4ED1 A;  1QSS A;  2K4I A;  3KZI U;  2DGZ A;  1PK1 A;  3K75 D;  3C2L A;  5D4B A;  4MF2 A;  1UPH A;  3IHQ B;  4TUR A;  4RQN A;  4YR2 A;  4RQ5 A;  3RR8 A;  1KTQ A;  2F3N A;  4KTQ A;  4DQR A;  5KFZ A;  5KL8 B;  1ZET A;  5AIA A;  3MFH A;  4MFA A;  1L8O A;  4Q44 A;  1SWW A;  2P66 A;  1MQ3 A;  1MSW D;  5ALZ A;  1MC8 A;  3JPR A;  5TIS U;  2W03 A;  2RLT A;  5KG1 A;  2I9G A;  7ICT A;  2Y0S F;  1KQQ A;  2W11 A;  4GC7 A;  3BS7 A;  5J2A A;  1CEZ A;  2MUT B;  4QW8 A;  3E58 A;  4OJO A;  3ZDD A;  1UT5 A;  4KN4 A;  4ED7 A;  3QUT A;  4X5V A;  5DG7 A;  2UVV A;  4RUC A;  2ZG6 A;  4IC9 A;  1TV9 A;  3EPG A;  5KT4 A;  3WKE A;  3KFU F;  4YMM A;  2ZIV A;  5DBB A;  5EWE A;  3U26 A;  2M9N A;  1KEJ A;  2ZIU A;  2YB4 A;  3FAH A;  3T3F A;  5DBA A;  4J9N A;  2Y1J A;  3HIL A;  3CRX A;  5IIJ A;  1NKC A;  5AKE A;  3ZDA A;  3G6X A;  2J6S A;  1A0P A;  4I2C A;  2PXI A;  5B66 U;  4GXK A;  3F5E A;  2NO5 A;  3V7J A;  3QEA Z;  5AI6 A;  2MRL A;  2R8K A;  2P6R A;  2B6G A;  2OXO A;  4TQS A;  3BQ1 A;  5CP2 A;  4UBB A;  2YMQ A;  4DSJ A;  3C28 A;  4F5P A;  2ISO A;  3GZF A;  4ECV A;  1RXV A;  2AH5 A;  3PV8 A;  4Z6F A;  3I28 A;  2NYV A;  2ZXH A;  4C8M A;  4DQQ A;  4UQG A;  7ICH A;  5EE0 A;  9ICB A;  5HHI A;  2MSN A;  3OSN A;  3OSP A;  1DGJ A;  1URJ A;  3T5K A;  2AGQ A;  2LI6 A;  1Q8K A;  1S8O A;  2DFL A;  4DCC A;  3CYM A;  1JUD A;  4F5Q A;  1ZYQ A;  3IN5 A;  2EAN A;  3MR6 A;  5JU5 A;  1C20 A;  5HML A;  9ICU A;  2A1A A;  4QZH A;  3Q8Q B;  5K4L A;  4J9P A;  3RF9 A;  2W3R A;  5D46 A;  3IV6 A;  2W9M A;  4HAI A;  1ZXI A;  4BXO B;  2JRZ A;  2BGW A;  5DKW A;  3KKA A;  4M04 A;  2H3I A;  4QIW C;  4Z6D A;  3PO4 A;  5J2F A;  4MHV A;  4CF3 A;  5KG4 A;  3GIJ A;  2ZTC A;  4QZB A;  8ICM A;  1L8L A;  1ZQJ A;  2HHT A;  3QNM A;  3ISD A;  4B6J A;  1KBU A;  9ICF A;  4YP3 A;  2LBO A;  8ICR A;  4C8O A;  9ICI A;  4Y2P A;  5J2J A;  4NLC A;  2ASJ A;  4I2J A;  3C2M A;  1OW5 A;  7ICU A;  1NNL A;  4CDG A;  2H3Z A;  1JRP A;  3QZ8 A;  2MUT A;  5AM3 A;  4YFK A;  9ICA A;  3M6K A;  1Z4O A;  4NL9 C;  3RR7 A;  2HBM A;  4US9 A;  2H3V A;  3TAP A;  3HKZ F;  7ICR A;  4U7C A;  2NRW A;  5DGB A;  9ICO A;  4O5C A;  4RUA A;  1TVA A;  1X42 A;  7ICQ A;  4F71 A;  4UB8 U;  4RQM A;  3OHA A;  5AI9 A;  2FLL A;  2E1F A;  2PFQ A;  5T14 A;  2LMR A;  2YTU A;  1SZP A;  3KD3 A;  1BPY A;  2WF6 A;  5AKG A;  4Z6C A;  2QB1 A;  4FS1 A;  4NLB A;  4JV0 A;  2FMQ A;  5GTI U;  3NGD A;  4AYB F;  4DO9 A;  2WF5 A;  5GTH U;  2K8C B;  3M9M B;  5ALO A;  4BWM A;  2XVT A;  5J0Y A;  5J0R A;  1ZQZ A;  3UQ0 A;  5IIO A;  9ICP A;  4DL5 A;  2LKY A;  4ECX A;  3H4D A;  1ZQM A;  4YQW A;  2ES6 A;  3RRH A;  3PMN A;  1OUQ A;  3UXO A;  4NY8 A;  4OD0 A;  5ALU A;  4UAR A;  1C7Y A;  2F8L A;  4DL7 A;  4EEY A;  1X40 A;  5DLF A;  1V97 A;  4DS5 A;  1ZQR A;  2J6T A;  1PZN A;  2FMS A;  2D8C A;  5KAF U;  2KSO B;  4JK1 A;  2HHV A;  3PR4 A;  2FLP A;  3Q8M A;  2P6U A;  4GFJ A;  1COO A;  1D8L A;  3NVW A;  5AKI A;  1PVP A;  2IMW P;  2K4H A;  3DV9 A;  2KN7 A;  5DGA A;  2BQR A;  1S0N A;  4I2I A;  3NTU A;  3L3F X;  2UVR A;  5EWG A;  1ZQU A;  1KRP A;  5F9N A;  3S6J A;  3MBY A;  4KX5 A;  4P0P B;  1ZQV A;  2KEY A;  7ICG A;  4F93 B;  1MN8 A;  4DS4 A;  7ICN A;  4ED2 A;  2BPC A;  3EWA A;  4O5E A;  2AJQ A;  4KLE A;  5ALT A;  5AM2 A;  2WF9 A;  4BXO A;  4KN7 A;  1KLN A;  1ZQE A;  5KFS A;  3F2D A;  3C2K A;  4M9H A;  3OJU A;  3NUQ A;  2FPM A;  3V7L A;  4NM2 A;  2XID A;  1BGX T;  3KOO A;  8ICS A;  2F1I A;  4IQV A;  4PL2 A;  5DQG A;  5KFM A;  4OJP A;  4DEZ A;  2IBK A;  1FFV A;  4U6P A;  4M2Y A;  3QU5 A;  1DK2 A;  4C4S A;  4RQ4 A;  3Q8S B;  3KTQ A;  1Z1B A;  3D6J A;  3WK7 A;  3T5J A;  1JXL A;  3V6H A;  4RQ7 A;  4XUS A;  3T79 A;  1WCN A;  4GXI A;  4FS2 A;  3H8S A;  4ZOH C;  3KHL A;  1DK3 A;  4NLK A;  2JXJ A;  5CWR A;  2XGQ A;  2MU2 A;  2LM1 A;  3ALR A;  4EEL A;  1WG8 A;  3F5A A;  5KT3 A;  1NJX A;  1BPE A;  2ZJA A;  2W8L A;  3C23 A;  3QUB A;  2BPG A;  4IR9 A;  3WK6 A;  1KW4 A;  3EYZ A;  3OPX A;  2E8O A;  3SI8 A;  2WF7 A;  3J81 j;  2BCR A;  1TAM A;  2XY5 A;  3DEE A;  3CW2 C;  1Z3E B;  3V6J A;  4UAZ A;  1DGS A;  4BGD A;  4EX6 A;  4NV0 A;  5AK3 A;  2W7O A;  1PK1 B;  2BKE A;  5AKY A;  4R65 A;  4F4X A;  2EH9 A;  3G6V A;  1Q3U A;  3PW7 A;  3N97 B;  5J2D A;  3NRW A;  5D49 A;  4R66 A;  2XO7 A;  3WKB A;  2UVW A;  3NVZ A;  2E5S A;  5HR7 A;  2CN1 A;  3NVY A;  3MGH A;  1COK A;  5KT5 A;  1CRX A;  1RM6 C;  4DWI A;  4PH5 A;  4IRK A;  4YMN A;  2RDJ A;  1IG6 A;  2NRX A;  2E3T A;  5ALM A;  3JPP A;  2Y9T A;  4CRX A;  4QNL A;  5KFG A;  2KOB A;  3A0H U;  4RQ0 A;  4FO6 A;  2KSO A;  1J2N A;  1ZQN A;  2F2A B;  3MDA A;  2C2E A;  3QUQ A;  4BJQ A;  2HHX A;  3E0F A;  1X2I A;  3D2Q A;  1HIW A;  3RTV A;  4QIW F;  2AXT U;  2XI9 A;  3GFK B;  3PVX A;  4P0P A;  4K4H A;  1IIP A;  4IQU A;  2JMG A;  7ICJ A;  3KBB A;  4XQ8 A;  2G06 A;  3SYZ A;  2HCF A;  2W04 A;  1S97 A;  4Y2T A;  4KLD A;  3I1Y A;  1S0M A;  2DL0 A;  5J8Y C;  4I29 A;  4TUQ A;  2WB1 C;  2G08 A;  3EZ5 A;  4Y2J A;  3C29 A;  4EEN A;  2HMX A;  2VA2 A;  4DQP A;  2KNJ A;  4PHA A;  4EYI B;  4IRD A;  1ZD4 A;  3SEN A;  1TK8 A;  2G5I B;  4YD1 A;  5J2H A;  4LVS A;  2D3D A;  2YQE A;  3GIL A;  3MAB A;  4Q8E A;  2BZF A;  5IIL A;  3GV8 B;  5KFL A;  4DSE A;  1A6S A;  4YXJ A;  4JMU A;  5KFT A;  2D6F C;  4ED3 A;  4ECW A;  1OXJ A;  3PW4 A;  4PGX A;  4KLI A;  7ICP A;  1ZQL A;  3V6K A;  3H8W A;  2AQ0 A;  1HUO A;  5J0T A;  1QLN A;  5IIM A;  2VJ4 A;  1S77 D;  4P4O A;  1WUD A;  2WFA A;  4F4K A;  8ICO A;  1ZJM A;  4I2A A;  3Q8P B;  8ICB A;  1BPZ A;  2E8M A;  3ZD9 A;  3WU2 U;  2ZTD A;  2FJ6 A;  5KFV A;  4GC6 A;  1XSP A;  2FMP A;  1BNP A;  1TFR A;  4UB5 A;  2EAO A;  5KT2 A;  1KFT A;  1XSN A;  3LK9 A;  5AM0 A;  3PW0 A;  5KFO A;  1PUZ A;  5AHX A;  3BS5 B;  1XO1 A;  5CJ7 A;  1JX4 A;  5IIK A;  2CXY A;  5KFK A;  1UA1 A;  2E8P A;  1ZQY A;  7ICK A;  4RQ2 A;  1PVR A;  4ECZ A;  3TAC B;  2KIV A;  4Y2U A;  5KFR A;  4OJ6 A;  3ETL A;  2OWO A;  2R18 A;  4JWM A;  3BJY A;  2QLT A;  4KLO A;  9ICQ A;  1ZQH A;  9ICX A;  4NM1 A;  3HPO A;  3GIK A;  3M6Z A;  1ZQP A;  5ALR A;  4FBT A;  1ZD3 A;  4DL2 A;  1B22 A;  2KD1 A;  2IA6 A;  2KZZ A;  3PR5 B;  1JI7 A;  3GU3 A;  3ISC A;  3GDX A;  2KV2 A;  4PPX A;  4K4G A;  1M6Y A;  3LWL A;  2KG5 A;  5JUM A;  1ZRN A;  4TUP A;  4TUS A;  3KHG A;  1X9M A;  2G5H B;  3RJE A;  3H40 A;  2UVU A;  2V4Q A;  3PST A;  2ZIW B; 
#chains in the Genus database with same CATH homology
 1OW5 A;  2D3D A;  1B4F A;  1PK1 B;  1Z1V A;  2K4P A;  1SV4 A;  3BS5 A;  4NL9 C;  2ESE A;  1LKY A;  2GLE A;  4IS7 A;  2B6G A;  1OXJ A;  1SV0 A;  1SXD A;  3H8M A;  1V85 A;  2KE7 A;  3TAD C;  1COK A;  2DKX A;  4NJ8 A;  2LPE A;  3K1R B;  2F8K A;  2JV3 A;  1X9X A;  1PK3 A;  4RQM A;  1PK1 A;  1WWU A;  1DXS A;  2QB0 B;  4RQN A;  2E8M A;  2E8N A;  4NL9 A;  2F3N A;  2Y9T A;  5JRT A;  2QAR B;  2LMR A;  2YTU A;  2F44 A;  2KSO A;  1V38 A;  2QB1 A;  2EAO A;  2K60 A;  2EAM A;  2L5Y A;  3IDW A;  3BS7 A;  1RG6 A;  3KKA C;  1WWV A;  3BS5 B;  2EAN A;  5JU5 A;  1F0M A;  3SEI A;  1LKY B;  4PZO A;  5JTI A;  2E8P A;  1UQV A;  3TAD A;  1SV0 C;  3TAC B;  2FE9 A;  2KIV A;  1UCV A;  1B0X A;  1SXE A;  5F3X B;  2ES6 A;  3KKA A;  1SGG A;  2QKQ A;  2DL0 A;  5J8Y C;  2Y9U A;  2KMD A;  2QB0 A;  4PZN A;  4MHV A;  5KNI A;  2DKZ A;  3BQ7 A;  1X40 A;  2QAR A;  1KW4 A;  2D8C A;  1JI7 A;  1X66 A;  2KSO B;  2E8O A;  2EAP A;  3HIL A;  2KG5 A;  5L1M A;  3SEN A;  5J8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...