5F3XB

Crystal structure of harmonin npdz1 in complex with anks4b sam-pbm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
b'VDATPLEVFLQSQHLEEFLPIFMREQIDLEALLLCSDEDLQNIHMQLGPRKKVLSAIDKRKQVLQQPGQLVDTSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Harmonin
publication title Mechanistic Basis of Organization of the Harmonin/USH1C-Mediated Brush Border Microvilli Tip-Link Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/protein binding
total genus 23
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5f3xB00
1DXSA 2Y9UA 2JV3A 1PK3A 5JU5A 2EAMA 2B6GA 2K60A 1B0XA 1SGGA 3SENA 2KE7A 2K4PA 2DKZA 1LKYA 5JRTA 5JTIA 2FE9A 1OXJA 1X66A 3KKAA 2QARB 2E8NA 1KW4A 4NL9A 1PK1A 1F0MA 2QKQA 2E8OA 2F8KA 1WWUA 2KMDA 2ESEA 2KSOA 2DKXA 3SEIA 5J8YA 1Z1VA 2LPEA 2GLEA 1SXDA 2YTUA 1V38A 3K1RB 3HILA 4PZNA 5KNIA 1PK1B 1SV0A 1X40A 2EAOA 4PZOA 3TADA 2DL0A 1JI7A 2KSOB 2EAPA 1SV4A 2QB1A 1LKYB 1UQVA 2EANA 3KKAC 4IS7A 4RQMA 1SXEA 4NL9C 3BS5A 1RG6A 2E8MA 4RQNA 1B4FA 2KG5A 1V85A 1WWVA 2L5YA 4MHVA 2QB0A 2D8CA 2D3DA 3TACB 5L1MA 5J8YC 2F3NA 1UCVA 2KIVA 5F3XB 2ES6A 3BS5B 1SV0C 2E8PA 2F44A 3H8MA 1OW5A 1X9XA 3IDWA 3TADC 2LMRA 3BS7A 4NJ8A 2QB0B 3BQ7A 2Y9TA 1COKA 2QARA
chains in the Genus database with same CATH superfamily
4NLGA 2JH7A 3Q8KA 1DXSA 2BDPA 3IRUA 2JV3A 5KT7A 4B9VA 1XU4A 5J2KA 1SGGA 3KZIU 4DCCA 3PV8A 2JH1A 3M9MB 1OXJA 5DGBA 2XICA 2QARB 3PMNA 5ALFA 2NRXA 1CRXA 3A0HU 2FMPA 3M8RA 3TKAA 2DPIA 2AH5A 4KLOA 3E58A 4O5CA 4Y2QA 2OWOA 4RQ2A 1D8YA 3ZDEA 3L4PA 5TISU 2XY5A 3L5KA 1A77A 2WB1C 3UMCA 4RT3A 1PUZA 3C2MA 1X40A 4MEXA 5EE1A 1X9SA 1TAQA 4ED1A 4F5NA 4J9OA 2XCPA 3Q8SB 4RT2A 1Q8KA 3ZD9A 3KKAC 4IS7A 4IQUA 2HHTA 1JRPA 2KZMA 1DGSA 5CEHA 9ICEA 4Y2PA 2DFLA 1SKWA 4R65A 4EYHB 1UPHA 2HBLA 4X5VA 5J2AA 5DG9A 1ZQVA 4B9UA 2UVWA 4GC6A 3H8WA 3RTVA 2J6TA 2HHSA 4KLLA 2KIVA 2GWSA 1RQLA 4BWMA 4O3MA 5L1IA 4NM1A 1JIHA 3BDPA 4PGYA 3C1ZA 4M6WA 3SZ2A 3F5AA 4QNLA 4DSIA 2C2DA 9ICOA 3M9OB 2HHXA 2LYBA 4Z6CA 3C2LA 4I2FA 4NWIA 2Y9UA 3QU5A 5KFKA 4DFKA 2B6GA 4ZOHC 2JXJA 3SAFA 4CF5A 3NVVA 4BXOB 1CI4A 3KTQA 2F76X 5IINA 3SI8A 2K8BB 1JROA 5KFBA 3FYHA 1DGJA 1VJ5A 4ECQA 3WKEA 4Z6EA 4NLZA 8ICHA 5EE3A 5BPCA 1HUZA 5J0SA 4R8UB 1KTQA 3S6JA 3EZ5A 4DLGA 4RUCA 1ZETA 5KFXA 2C2EA 4DFDA 2JHDA 5AHXA 2LPEA 1COOA 5DBBA 2W7OA 1NK6A 2DPJA 2VJ4A 4DL3A 5AK6A 3K75D 3ZDBA 4U6PA 3WKDA 5J2DA 4ECWA 8ICJA 5C5JA 1Z3EB 4ECYA 2KSOB 9ICQA 2R8HA 3AL0B 4EBCA 5ALRA 2LYAA 3RJIA 1J2MA 1TAMA 9ICSA 4UB6U 9ICWA 1B4FA 4O0IA 2KK0A 1C7YA 1WYGA 1YT3A 5AI9A 4MHVA 4DQQA 2Y0SC 4CF4A 2ZIUB 4Q8FA 2C22A 1IXRA 2A19A 1NZPA 5H2FU 1T94A 1ZQSA 1NKBA 2H3QA 3HP6A 3F2CA 4M9JA 4C7ZA 1U45A 1SB3C 2BCUA 3C5GA 2BPFA 2F1IA 8ICLA 1COKA 4JMUA 3H4BA 2EAMA 3MDAA 2ZXHA 2W04A 5BOMA 3O0FA 5DG8A 4RNNA 2F2AB 5IIJA 2K4HA 3ISCA 2OHFA 4UB4A 2ZUDA 4QWCA 4OJOA 8ICZA 4YXJA 3HJEA 5GTIU 3UM9A 8ICKA 4IR1A 2KHQA 3HRDD 5IIMA 1ZQ1C 1WWUA 3FM9A 3PNCA 4DO9A 3G6YA 4MF2A 2OXOA 1NJXA 1SIJA 2M9NA 2ZIWA 5AI4A 1GO3F 2MSNA 4PZNA 2BPCA 4OJ5A 4YMNA 3I28A 4JV0A 1UA1A 3ZI4A 5AM1A 3QYPA 3GU3A 1LV5A 4JUZA 3V7JA 2CRXA 3JPPA 2KOBA 1Z19A 2RLTA 1RZTA 4ECXA 4M9HA 1T4GA 4F5PA 4QZFA 4GFJA 1TAUA 4RQMA 4XUSA 4UAWA 4UQGA 2ISOA 5AKJA 1XSLA 1A6SA 1SWVA 3V72A 5AICA 3WK4A 3ZDAA 3THVA 7ICNA 3LVWA 3HT3A 4CNQA 2XVTA 4CRXA 3M7DA 4C80A 1URJA 2KFZA 2PKEA 4K4HA 5KT2A 3QX7A 5AKEA 2E8PA 1ZQZA 3K1ZA 9ICAA 3IDWA 3FDSA 2I5HA 5EWEA 3TAQA 2FLNA 4JV2A 3PY8A 3UXNA 2HBJA 3KHRA 4NXZA 2W9MA 4PPXA 1RYRA 4C8MA 2ZUBA 2XY7A 1MC8A 3H0RB 3RB6A 5KFUA 3B0XA 4M6WB 2K4PA 4PGQA 3E0FA 1QSYA 4JWMA 5K4LA 2NO4A 4EBDA 3RJEA 4PL1A 3JPSA 4UAYA 4KTQA 4J9SA 3KHHA 2K8AA 2KKPA 4ECRA 4DLEA 2ASDA 5IIKA 2A1JA 2ZIVA 4CDGA 2KMDA 4EZ6A 3BQTA 2K89A 2VKQA 1ZQWA 4UATA 2JMGA 1FFUA 1ZQTA 5KNIA 2VANA 4KX5A 4RPXA 2BHNA 2G06A 4F72A 2H5XA 2KZ3A 5KFGA 4UB8U 1ZRNA 4ECZA 2XGQA 4ELTA 2QB1A 1ZQRA 4OCZA 1MQ2A 4O3SA 1ECWA 3PR5B 2K8CB 3HKZF 4I2IA 4RQNA 1U47A 3RAXA 2P6UA 4NLBA 5T14A 8ICFA 3RB4A 4YMMA 3N7PD 2HI0A 3RJJA 2D8CA 5HP4A 2AXTU 1TV9A 3IG5A 5ALZA 4IRKA 5AM0A 2G08A 4A8EA 4BWJA 5KFJA 3KHLA 2UVUA 5ALGA 1JX4A 1F5SA 5L1LA 1L7OA 3F5EA 4F4YA 2GO7A 3BQ1A 5DGAA 3RH5A 4IQTA 5KFVA 1ZD2P 2NRTA 3T5HA 2FLPA 4GXJA 2PFQA 4ED2A 4RQ7A 2R18A 2D6FC 2PFNA 4TUPA 2FI1A 1SL1A 4GLXA 4RQ8A 8ICPA 2AU0A 1UA0A 3RBEA 5E79U 5DG7A 3OHAA 1RM6C 4NL9A 3T3FA 4F5RA 1BPDA 1ZQMA 3VCBA 3PX6A 1T8EA 5AKHA 2AJQA 4XQ8A 1QSSA 3F2DA 5J0UA 4OJLA 4F71A 7ICLA 4O5KA 4GC7A 5EWFA 3NVWA 3HKZC 5KAFU 5HHIA 2KVSA 1JI7A 2HVHA 4KN4A 2JZBA 3AM9A 1LKYB 5DDYA 1KFTA 1T3NA 2XO7A 2JRZA 4KITB 5AKXA 4USAA 4YP3A 3LVVA 2FPLA 3QU9A 2ODGA 3LDAA 4I2BA 3V6JA 1ZQFA 1QLNA 1ED1A 2KP7A 9ICNA 4LVSA 5J2IA 7ICVA 2CXYA 5AM3A 1WCLA 2DGZA 2ATLA 5DQIA 3MR6A 1NK7A 2HMXA 9ICRA 2HOQA 2ZJAA 3PSTA 4JV1A 3SYZA 5DLGA 4FO6A 1D8LA 4RZRA 1X2IA 8ICBA 4I27A 5JU5A 2HHUA 8ICOA 3MGIA 2E1EA 4US8A 3C5FA 4KN7A 4QZGA 2XGPA 1TKDA 2YX8A 5J29A 2A3VA 3ISDA 2FE9A 4NM2A 5J2BA 2I6XA 5J2GA 5JUMA 4EBEA 2FJ6A 3M6KA 2HOFA 5KG5A 5KFDA 2CN1A 3LYSA 4QJFB 3KD3A 4LZDA 2WHEA 3NVZA 5KT6A 3BZCA 1X9WA 4QWDA 5CA7A 3Q8PB 5ALIA 2ZJ8A 4TQRA 3SV3A 1L7NA 4PL2A 2R8KA 3WK7A 1ZQGA 1SXDA 4PHAA 1ZQDA 8ICEA 3KHGA 5ALTA 4MFCA 3MFHA 5AI8A 2A1JB 2KIWA 5KT5A 2ZIVB 3GQCA 5KFNA 4KLJA 3PW5A 2W43A 1N5XA 4DEZA 4FS1A 1NKCA 5ALWA 8ICGA 1SXEA 2H3FA 4NL9C 3MDCA 3AQEA 4F91B 1RPLA 3UMBA 3E2EA 1C20A 2UVVA 3TARA 5TZVA 4IR9A 1EXNA 5L1JA 2QB0A 5HNKA 5KFPA 3MGVA 5AIAA 4C8KA 3D2QA 3H8JA 3T79A 3OSPA 7ICIA 3RB3A 2HSZA 2B0CA 2F44A 1QCKA 3H8MA 3F53A 4P4OA 4GXKA 3HX0A 5KFTA 1Z00A 3ICXA 2YN4A 4KLUA 2YB4A 2FDRA 1ZRMA 4RUAA 5J0TA 9ICFA 3RRGA 4OJPA 3D2SA 2GH1A 2M0NA 9ICGA 2HCFA 2W9AA 8ICMA 4OJ6A 3NRWA 2R8GA 2Y0SF 4Y2TA 8ICRA 1NK8A 1NJYA 2E8NA 2IBKA 2XY6A 1NZBA 5AKLA 4ED7A 3UQ2A 3A0BU 2EZXA 4R66A 5ALLA 4YCXA 1TK8A 4RQ6A 3RJGA 7ICMA 5ALMA 4I2CA 2JEIA 3SEIA 4CGZA 1NK5A 4KLMA 2EQYA 1FEZA 3TFSA 4I29A 4YXMA 3EYZA 4RQ5A 1V9PA 2XCAA 3HW8A 5ALUA 2PI4A 1A76A 3N7SC 3AEVA 3SAGA 8ICYA 1X9MA 5KFLA 1ZQIA 5AM5A 7ICTA 3EUB2 2W03A 2DF4B 3WK5A 4J9MA 1UT8A 1L7MA 8ICTA 1QQ6A 1ZQKA 4BJQA 3WU2U 3MABA 4DQSA 5KL8B 7ICUA 2MUTA 1HEKA 4BX9C 2D3DA 3TACB 2MAXA 2DUYA 5A0LA 2ZTDA 1UCVA 1SKRA 5J2CA 5D4BA 2ES6A 1S5LU 3DV9A 1L3UA 5AKZA 2FPKA 4KLGA 5J2FA 3BS7A 4M2YA 3IV6A 3MGHA 2LBOA 2Y9TA 2NRWA 5AK4A 3QUCA 1N56A 2Q4TA 2KN7A 4YR2A 4YMOA 2PXIA 2KNJA 3PSFA 3PX0A 5ALHA 4EENA 1LVHA 1XSNA 2P35A 5JTIA 3CYMA 1ZXIA 1L8OA 2OYYA 4RU9A 3C1YA 5J0PA 3QEBZ 4ECTA 1KW4A 4ECUA 3N7RC 3RB0A 1D8BA 1PK1A 1ZJMA 3NASA 4QWBA 2QKQA 2DWQA 2KICA 1S8OA 4M9NA 1X6IA 2JEGA 2WF8A 7ICEA 5J8YA 2E5SA 2LM1A 1S0VA 1TE2A 1V38A 5F9LA 4RQ4A 4F4KA 1SV0A 5ALQA 4QZCA 2FMSA 4FZMA 4O3QA 5KFRA 1ZQCA 5KT3A 3ZDDA 2ZIXA 5AK5A 5HHHA 3QZ8A 5KG0A 3CNHA 5ALVA 2F1JA 2N1RA 7ICOA 2WTFA 3QE9Y 3TANA 1ZQUA 8ICWA 2V4QA 2F1HA 2GOLA 5J2JA 4YR3A 4F3OA 2KVCA 4B9SA 4AP9A 1PVRA 4O3OA 4Q8EA 3M6ZA 4EYIB 2L5YA 3EW9A 5GTHU 2MA1A 2MRLA 5AIBA 7ICFA 1HIWA 2MU2A 5ALDA 3SD7A 4HAIA 2BCQA 4HYKA 3GDXA 3FC4A 2K4EA 2BCSA 4NJ8A 5EWGA 2QB0B 4DF8A 3GZFA 1L5UA 2WF5A 1IV8A 5D46A 5KFCA 4DL7A 5KG4A 1T3QA 5DDMA 3NTUA 5DB7A 1BNPA 3IM1A 4QZ8A 7ICQA 3MR3A 2CPRA 2KJ8A 2IHNA 8ICVA 4P4MA 9ICJA 1BPBA 5DQHA 4O5EA 5KFAA 3V7LA 4DSLA 4KMOB 3RF9A 2NO5A 3JPTA 3OGUA 4BUGA 5J0YA 4J9LA 1N62A 5AI6A 3JPOA 5IIIA 4ED3A 1N48A 2YQEA 3PW7A 1TVAA 2IHMA 4QZBA 2HBMA 4DS4A 8ICAA 5CJ7A 1WCNA 1ZQJA 3BZKA 3Q8MA 3UMGA 5DBAA 4G9BA 2YTUA 2E1FA 1SWWA 2AGOA 3UQ0A 1L6NA 4J9RA 5ALYA 4TUSA 9ICPA 2DL0A 5KFWA 3NVYA 4DL5A 2P6RA 4B9LA 1ZD5A 2RP5A 4DSEA 1KBUA 4ZH4A 4J03A 2DBYA 4F93B 2H3ZA 2VJ5A 4Y2YA 1JALA 2EZZA 5J8YC 2BDUA 1YZ7A 1SV0C 3RFAA 2W8LA 4QZDA 3Q8QB 4E0DA 4QW9A 8ICUA 4JWNA 4P0PA 2FMQA 4DFMA 2MUTB 4MF8A 2YMLA 4PHEA 4C8LA 3TAPA 8ICXA 5DB6A 4NY8A 1ZQXA 2VIXA 4C8NA 4GXIA 2JEFA 1P7DA 2W7PA 4C7YA 2W11A 3T5JA 4J9KA 3VC8A 2DKZA 4QZ9A 1LB2B 4IC9A 2BQRA 1NK4A 2UVRA 4PH5A 2KZZA 4FE3A 3L3FX 2KJ9A 2HHQA 1A0PA 3AQFA 4M9LA 1S76D 3PVXA 2FPMA 5CWRA 3LWMA 4F2RA 5ALKA 4J9PA 1NOMA 4DQRA 5KFZA 5J0QA 4M0AA 2BCVA 2GLEA 3WKBA 9ICIA 2AHOB 5KFFA 2RRDA 5DB9A 2RDIA 1PK1B 4DSJA 4YR0A 2EAOA 5DBCA 4DSFA 1ZQPA 2DQNB 3TADA 4TUQA 4Y2SA 4DL4A 2I1QA 5IIOA 1TFRA 1FIQA 3JPQA 4UAZA 1N5WA 3Q8RB 1XC9A 5L9XA 1PVPA 5HR6A 2ZIXB 4J9QA 3EPIA 3QXGA 4ED8A 2WF7A 4ELVA 1B43A 3CP8A 5F9NA 4TQSA 1MN8A 5L1MA 4R8UA 3JPRA 2Z7JA 4KLHA 2ZIWB 4JK1A 1X6JA 1QSLA 1SL2A 4FFDA 1XWLA 2G5HB 4KMUA 4Y2VA 3GFKB 1S0NA 4DFPA 3SV4A 3TFRA 1CUKA 2LMRA 4QZIA 2HHVA 3RH4A 4F4XA 1IIPA 3V6HA 1PK3A 3QZ7A 4F50A 2HVIA 1NJZA 2KE7A 3NGDA 1KL9A 1N63A 2NRVA 3KOOA 2ISPA 5KG3A 4I2AA 4IRDA 1X66A 7ICSA 1KKXA 3I1YA 2BKEA 2QLTA 4YG2A 1BVSA 1DK2A 5KFOA 5CR0A 4PJ0U 4C0ZA 3C21A 3M1YA 5CRXA 3CW2C 2DKXA 4BGDA 1Z1VA 3RBDA 4PHDA 9ICXA 3V6KA 3IHQB 4LJXA 2HW3A 1NK9A 4I2GA 1U4BA 1L3VA 2WAQF 4DL2A 4FBTA 2VA2A 2PFOA 1T7PA 2H3IA 2J6SA 3ED5A 3PW4A 4QWEA 3PX4A 1UQVA 3IG8A 3ORYA 3ETLA 5AKYA 3GV7B 1RDFA 4M47A 4LZGA 3FAHA 2BZFA 2ZG6A 9ICMA 1V85A 2C2RA 3ALRA 3KZXA 1JUDA 2I9GA 3OSNA 2KTQA 2C28A 1TK5A 2V9WA 3PMLA 3KBBA 1QQ7A 2YY6A 4O3PA 4UAVA 1ZQYA 1ZQBA 2W3RA 3TADC 5AKGA 9ICVA 3EWAA 5ALNA 3J81j 4FZLA 7ICKA 3SR6A 1SZPA 1RYUA 5ALJA 3G6VA 2W9BA 5B66U 1Q46A 1DOQA 3NS1A 4P0PB 1KN5A 1XSPA 4P0QA 4ED6A 1JN3A 2KFNA 1M6YA 3AUOA 9ICHA 1K1QA 2E8OA 5CB1A 2R8JA 2NRZA 4IQVA 2A1AA 4UBBA 1S0MA 2NV3A 3WKAA 2WAQC 3PW0A 1L8LA 3RJFA 5J0WA 1KDHA 4B9NA 3B9JA 1L3TA 8ICQA 1ZOLA 4IRCA 2WF6A 4RNOA 4UAUA 1H38A 3SQIA 1ZQQA 4K4IA 1BPEA 3RJKA 4I2HA 3MFIA 5CHGA 9ICLA 2LYHA 2LM4A 2ZTEA 5J0OA 1FFVA 3HPOA 2IA6A 4F5OA 2F77X 5KL1B 5J2EA 2PI5A 1RG6A 4KLTA 3C23A 2RHFA 4C4TA 4IL6U 1WWVA 2KD1A 4Z6DA 4B9TA 3IN5A 3C28A 2RQ5A 2XIDA 3C2KA 2RDJA 7ICRA 5KFSA 2Q0ZX 3SAHA 3N28A 3I76A 1OW5A 2ASLA 4DOAA 1S9FA 4Y2XA 4CCHA 2JZBB 5KFHA 5KFYA 4RPYA 8ICCA 5C0YA 4DOCA 1UT5A 4O3NA 1SKSA 2XI9A 1B0XA 1L7PA 3SENA 2BQUA 4Y2UA 4DWIA 5HMLA 3KFUF 1U48A 8ICNA 1IG6A 5ALXA 5KFIA 3GIJA 1RXWA 1K5OA 4UB1A 3QUBA 1UHUA 5J0XA 2HDOA 1J2NA 2IOHA 1B22A 4AYBF 3PW2A 3TQ1A 1MQ3A 3UXOA 2P66A 3K1RB 5DB8A 3DEEA 4F4WA 1XO0A 2E3TA 4ACOA 3NRZA 3QNMA 5CP2A 4C4RA 1DRGA 3DDHA 4Q43A 4M9GA 3C29A 2G07A 4CF3A 5KG7A 3PR4A 4GIBA 1CEZA 1XNSA 2ZUCA 2EAPA 4KLSA 3H40A 3WKCA 1HJPA 2JGAA 4NLKA 3BS5A 2B21A 3QU7A 4QIWF 1Z4OA 1YZ6A 1XS9D 1Z4NA 4DS5A 2JEJA 4R64A 2AGPA 5AI0A 7ICJA 4UW9A 3K4GA 1S10A 3MBYA 4YFKA 4BDPA 4YQWA 5KG6A 1ZJNA 5HR7A 3OPXA 4I2JA 2KJ5A 4KLDA 3M8SA 3BQ2A 5AI5A 3RJHA 3JPNA 2FLLA 4YD2A 1RXVA 3BQ7A 2VA8A 3WK6A 2YB1A 3N4MB 1KFDA 4F5QA 4ECSA 4YVZA 4Q44A 1KLNA 3QU4A 2PFPA 2O6KA 4U7CA 2KEYA 1PZNA 4PGXA 1N2XA 3B0YA 3BQ0A 4O9MA 7ICPA 1LKYA 1BNOA 3PSPA 4NV0A 2VA3A 2OH2A 2YMMA 1Z1BA 1QH9A 5KFMA 2LHTA 4AYBC 4UBCA 1Q3UA 4R63A 3H8SA 2W9BB 3ETRA 1ZD4A 4QZEA 3OJSA 2BR0A 3QU2A 3V7KA 2WFAA 5G5HA 3UXPA 1NKEA 1JXLA 3HWTA 4P0QB 2KHVA 1RYSA 4DF4A 3U26A 3OHBA 2EDUA 2ZTCA 5DQGA 1Z00B 2Y1IA 4OO1J 4TURA 4RNMA 1AROP 2ASJA 1KRPA 1VDVA 3GIIA 4PZOA 3RR8A 4QIWC 1HUOA 3AU2A 3RR7A 4DFJA 5ALPA 3AN1A 4US9A 5ALSA 2IOFA 5AKIA 2KV2A 3AMZA 1QTMA 2W9CA 3RH6A 1MA7A 4RQ1A 4KLEA 4DL6A 3ZDCA 4ELUA 3MC1A 1Q3VA 1KQQA 3TI0A 2AQ4A 3M9NB 5KTQA 4UB3A 5DLFA 2BGWA 5L1KA 4KLQA 5F3XB 8ICIA 4B9MA 2AGQA 1Y88A 2EH9A 3T5LA 5AKKA 1IM4A 4UB2A 1DK3A 1NI3A 2H3VA 3QUTA 2HOIA 2KKVA 4PHPA 4C4SA 1U9LA 2QARA 1L3SA 2AQ0A 1ZQNA 3H4DA 3PO5A 3AU6A 2W55A 4RQ3A 1XO1A 2JR5A 3ONNA 2BCRA 3PO4A 3SMVA 4EELA 4YN4A 1D9FA 7ICGA 1S77D 2PMZF 4KLFA 2OM6A 4UB5A 5G5GA 3H7IA 1D9DA 1N61A 1O08A 2ESEA 4EX7A 8ICSA 4F2SA 4K4GA 4I2DA 1NJWA 4KLIA 4CE6A 3HILA 3QUQA 5EOZA 3N97B 4FS2A 1WG8A 1BPXA 3F2BA 3Q8LA 2G09A 1U49A 4FBUA 4WJ3B 3R9KA 3MR2A 9ICUA 1PVQA 9ICKA 3QEAZ 4QW8A 2YMPA 1SV4A 5J2HA 3RRHA 2ZJ5A 2EANA 4EEKA 2NYVA 1NK0A 4Z6FA 1TK0A 4B6JA 4MFFA 3OTQA 1QQ5A 4DOBA 1J97A 1ZQEA 1JXEA 5B5EU 5KFQA 2W3SA 2F3NA 2WF9A 3BS5B 3WK9A 2IOFK 1V97A 3CRXA 1BPYA 4BXOA 3GIKA 2G5IB 1FO4A 1ZD3A 9ICTA 2ALZA 2K4IA 2J6UA 2Y1JA 1MSWD 3H0LB 2G0AA 3PSIA 1ZQOA 4F92B 4I2EA 5EE0A 5EE9A 5BOLA 4RQ0A 4FZNA 2PMZC 4NLNA 3UPQA 2K60A 4MFAA 3GILA 3MR5A 3GV8B 1O03A 3T5KA 4DSKA 2R8IA 2W54A 5JRTA 4EEYA 4Y2RA 1KSPA 2EZYA 3KKAA 2OEHA 1RQNA 2OCEA 4IQWA 4O3RA 2HHWA 4P4PA 5KT4A 4F8RA 1NNLA 4DQPA 1F0MA 5IILA 1ZQLA 5FP0A 4KX3A 3ISBA 2F8KA 1F44A 4YD1A 4RPZA 5AK3A 5ALOA 3G6XA 4ECVA 4QWAA 2KSOA 2LI6A 3GIMA 5KAIU 4UASA 5J0RA 4J9NA 4MEYA 4EX6A 1SL0A 4NLCA 2BPGA 1KFSA 3LK9A 4XA5A 3LWLA 5HMMA 1AQ6A 3WK8A 4UARA 1S97A 3RAQA 3NUQA 1OUQA 7ICHA 9ICCA 3D6JA 4DQIA 4Q45A 4C8OA 4M04A 1N60A 5AM2A 5KG1A 1BPZA 4QZAA 3GV5B 4P2HA 4G3IA 2WB1F 4Y2JA 2ZIUA 4JB3A 2YMQA 1BGXT 2ZXIA 4ED0A 4EZ9A 5ALEA 3PZPA 5DKWA 3IP4B 1KEJA 2E8MA 4I28A 5KFEA 1WUDA 2KG5A 3H0MB 5AM4A 5D49A 1ZQHA 1SZHA 4ICAA 4XRHA 1JMSA 2F8LA 4F4ZA 2LKYA 3ZD8A 2XC9A 1S0OA 1K1SA 2W9CB 2W8KA 1ZQAA 2BQ3A 9ICBA 2IMWP 1ZYQA 1X42A 3D2NA 2HBKA 1X9XA 2V4RA 4QZHA 5KG2A 3BJYA 3EPGA 1VLBA 3OJUA 4OD0A
chains in the Genus database with same CATH topology
1DXSA 2Y9UA 2JV3A 1PK3A 5JU5A 2EAMA 2B6GA 2K60A 1B0XA 1SGGA 3SENA 2KE7A 2K4PA 2DKZA 1LKYA 5JRTA 5JTIA 2FE9A 1OXJA 1X66A 3KKAA 2QARB 2E8NA 1KW4A 4NL9A 1PK1A 1F0MA 2QKQA 2E8OA 2F8KA 1WWUA 2KMDA 2ESEA 2KSOA 2DKXA 3SEIA 5J8YA 1Z1VA 2LPEA 2GLEA 1SXDA 2YTUA 1V38A 3K1RB 3HILA 4PZNA 5KNIA 1PK1B 1SV0A 1X40A 2EAOA 4PZOA 3TADA 2DL0A 1JI7A 2KSOB 2EAPA 1SV4A 2QB1A 1LKYB 1UQVA 2EANA 3KKAC 4IS7A 4RQMA 1SXEA 4NL9C 3BS5A 1RG6A 2E8MA 4RQNA 1B4FA 2KG5A 1V85A 1WWVA 2L5YA 4MHVA 2QB0A 2D8CA 2D3DA 3TACB 5L1MA 5J8YC 2F3NA 1UCVA 2KIVA 5F3XB 2ES6A 3BS5B 1SV0C 2E8PA 2F44A 3H8MA 1OW5A 1X9XA 3IDWA 3TADC 2LMRA 3BS7A 4NJ8A 2QB0B 3BQ7A 2Y9TA 1COKA 2QARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DXS A;  2Y9U A;  2JV3 A;  1PK3 A;  5JU5 A;  2EAM A;  2B6G A;  2K60 A;  1B0X A;  1SGG A;  3SEN A;  2KE7 A;  2K4P A;  2DKZ A;  1LKY A;  5JRT A;  5JTI A;  2FE9 A;  1OXJ A;  1X66 A;  3KKA A;  2QAR B;  2E8N A;  1KW4 A;  4NL9 A;  1PK1 A;  1F0M A;  2QKQ A;  2E8O A;  2F8K A;  1WWU A;  2KMD A;  2ESE A;  2KSO A;  2DKX A;  3SEI A;  5J8Y A;  1Z1V A;  2LPE A;  2GLE A;  1SXD A;  2YTU A;  1V38 A;  3K1R B;  3HIL A;  4PZN A;  5KNI A;  1PK1 B;  1SV0 A;  1X40 A;  2EAO A;  4PZO A;  3TAD A;  2DL0 A;  1JI7 A;  2KSO B;  2EAP A;  1SV4 A;  2QB1 A;  1LKY B;  1UQV A;  2EAN A;  3KKA C;  4IS7 A;  4RQM A;  1SXE A;  4NL9 C;  3BS5 A;  1RG6 A;  2E8M A;  4RQN A;  1B4F A;  2KG5 A;  1V85 A;  1WWV A;  2L5Y A;  4MHV A;  2QB0 A;  2D8C A;  2D3D A;  3TAC B;  5L1M A;  5J8Y C;  2F3N A;  1UCV A;  2KIV A;  5F3X B;  2ES6 A;  3BS5 B;  1SV0 C;  2E8P A;  2F44 A;  3H8M A;  1OW5 A;  1X9X A;  3IDW A;  3TAD C;  2LMR A;  3BS7 A;  4NJ8 A;  2QB0 B;  3BQ7 A;  2Y9T A;  1COK A;  2QAR A; 
#chains in the Genus database with same CATH topology
 4NLG A;  2JH7 A;  3Q8K A;  1DXS A;  2BDP A;  3IRU A;  2JV3 A;  5KT7 A;  4B9V A;  1XU4 A;  5J2K A;  1SGG A;  3KZI U;  4DCC A;  3PV8 A;  2JH1 A;  3M9M B;  1OXJ A;  5DGB A;  2XIC A;  2QAR B;  3PMN A;  5ALF A;  2NRX A;  1CRX A;  3A0H U;  2FMP A;  3M8R A;  3TKA A;  2DPI A;  2AH5 A;  4KLO A;  3E58 A;  4O5C A;  4Y2Q A;  2OWO A;  4RQ2 A;  1D8Y A;  3ZDE A;  3L4P A;  5TIS U;  2XY5 A;  3L5K A;  1A77 A;  2WB1 C;  3UMC A;  4RT3 A;  1PUZ A;  3C2M A;  1X40 A;  4MEX A;  5EE1 A;  1X9S A;  1TAQ A;  4ED1 A;  4F5N A;  4J9O A;  2XCP A;  3Q8S B;  4RT2 A;  1Q8K A;  3ZD9 A;  3KKA C;  4IS7 A;  4IQU A;  2HHT A;  1JRP A;  2KZM A;  1DGS A;  5CEH A;  9ICE A;  4Y2P A;  2DFL A;  1SKW A;  4R65 A;  4EYH B;  1UPH A;  2HBL A;  4X5V A;  5J2A A;  5DG9 A;  1ZQV A;  4B9U A;  2UVW A;  4GC6 A;  3H8W A;  3RTV A;  2J6T A;  2HHS A;  4KLL A;  2KIV A;  2GWS A;  1RQL A;  4BWM A;  4O3M A;  5L1I A;  4NM1 A;  1JIH A;  3BDP A;  4PGY A;  3C1Z A;  4M6W A;  3SZ2 A;  3F5A A;  4QNL A;  4DSI A;  2C2D A;  9ICO A;  3M9O B;  2HHX A;  2LYB A;  4Z6C A;  3C2L A;  4I2F A;  4NWI A;  2Y9U A;  3QU5 A;  5KFK A;  4DFK A;  2B6G A;  4ZOH C;  2JXJ A;  3SAF A;  4CF5 A;  3NVV A;  4BXO B;  1CI4 A;  3KTQ A;  2F76 X;  5IIN A;  3SI8 A;  2K8B B;  1JRO A;  5KFB A;  3FYH A;  1DGJ A;  1VJ5 A;  4ECQ A;  3WKE A;  4Z6E A;  4NLZ A;  8ICH A;  5EE3 A;  5BPC A;  1HUZ A;  5J0S A;  4R8U B;  1KTQ A;  3S6J A;  3EZ5 A;  4DLG A;  4RUC A;  1ZET A;  5KFX A;  2C2E A;  4DFD A;  2JHD A;  5AHX A;  2LPE A;  1COO A;  5DBB A;  2W7O A;  1NK6 A;  2DPJ A;  2VJ4 A;  4DL3 A;  5AK6 A;  3K75 D;  3ZDB A;  4U6P A;  3WKD A;  5J2D A;  4ECW A;  8ICJ A;  5C5J A;  1Z3E B;  4ECY A;  2KSO B;  9ICQ A;  2R8H A;  3AL0 B;  4EBC A;  5ALR A;  2LYA A;  3RJI A;  1J2M A;  1TAM A;  9ICS A;  4UB6 U;  9ICW A;  1B4F A;  4O0I A;  2KK0 A;  1C7Y A;  1WYG A;  1YT3 A;  5AI9 A;  4MHV A;  4DQQ A;  2Y0S C;  4CF4 A;  2ZIU B;  4Q8F A;  2C22 A;  1IXR A;  2A19 A;  1NZP A;  5H2F U;  1T94 A;  1ZQS A;  1NKB A;  2H3Q A;  3HP6 A;  3F2C A;  4M9J A;  4C7Z A;  1U45 A;  1SB3 C;  2BCU A;  3C5G A;  2BPF A;  2F1I A;  8ICL A;  1COK A;  4JMU A;  3H4B A;  2EAM A;  3MDA A;  2ZXH A;  2W04 A;  5BOM A;  3O0F A;  5DG8 A;  4RNN A;  2F2A B;  5IIJ A;  2K4H A;  3ISC A;  2OHF A;  4UB4 A;  2ZUD A;  4QWC A;  4OJO A;  8ICZ A;  4YXJ A;  3HJE A;  5GTI U;  3UM9 A;  8ICK A;  4IR1 A;  2KHQ A;  3HRD D;  5IIM A;  1ZQ1 C;  1WWU A;  3FM9 A;  3PNC A;  4DO9 A;  3G6Y A;  4MF2 A;  2OXO A;  1NJX A;  1SIJ A;  2M9N A;  2ZIW A;  5AI4 A;  1GO3 F;  2MSN A;  4PZN A;  2BPC A;  4OJ5 A;  4YMN A;  3I28 A;  4JV0 A;  1UA1 A;  3ZI4 A;  5AM1 A;  3QYP A;  3GU3 A;  1LV5 A;  4JUZ A;  3V7J A;  2CRX A;  3JPP A;  2KOB A;  1Z19 A;  2RLT A;  1RZT A;  4ECX A;  4M9H A;  1T4G A;  4F5P A;  4QZF A;  4GFJ A;  1TAU A;  4RQM A;  4XUS A;  4UAW A;  4UQG A;  2ISO A;  5AKJ A;  1XSL A;  1A6S A;  1SWV A;  3V72 A;  5AIC A;  3WK4 A;  3ZDA A;  3THV A;  7ICN A;  3LVW A;  3HT3 A;  4CNQ A;  2XVT A;  4CRX A;  3M7D A;  4C80 A;  1URJ A;  2KFZ A;  2PKE A;  4K4H A;  5KT2 A;  3QX7 A;  5AKE A;  2E8P A;  1ZQZ A;  3K1Z A;  9ICA A;  3IDW A;  3FDS A;  2I5H A;  5EWE A;  3TAQ A;  2FLN A;  4JV2 A;  3PY8 A;  3UXN A;  2HBJ A;  3KHR A;  4NXZ A;  2W9M A;  4PPX A;  1RYR A;  4C8M A;  2ZUB A;  2XY7 A;  1MC8 A;  3H0R B;  3RB6 A;  5KFU A;  3B0X A;  4M6W B;  2K4P A;  4PGQ A;  3E0F A;  1QSY A;  4JWM A;  5K4L A;  2NO4 A;  4EBD A;  3RJE A;  4PL1 A;  3JPS A;  4UAY A;  4KTQ A;  4J9S A;  3KHH A;  2K8A A;  2KKP A;  4ECR A;  4DLE A;  2ASD A;  5IIK A;  2A1J A;  2ZIV A;  4CDG A;  2KMD A;  4EZ6 A;  3BQT A;  2K89 A;  2VKQ A;  1ZQW A;  4UAT A;  2JMG A;  1FFU A;  1ZQT A;  5KNI A;  2VAN A;  4KX5 A;  4RPX A;  2BHN A;  2G06 A;  4F72 A;  2H5X A;  2KZ3 A;  5KFG A;  4UB8 U;  1ZRN A;  4ECZ A;  2XGQ A;  4ELT A;  2QB1 A;  1ZQR A;  4OCZ A;  1MQ2 A;  4O3S A;  1ECW A;  3PR5 B;  2K8C B;  3HKZ F;  4I2I A;  4RQN A;  1U47 A;  3RAX A;  2P6U A;  4NLB A;  5T14 A;  8ICF A;  3RB4 A;  4YMM A;  3N7P D;  2HI0 A;  3RJJ A;  2D8C A;  5HP4 A;  2AXT U;  1TV9 A;  3IG5 A;  5ALZ A;  4IRK A;  5AM0 A;  2G08 A;  4A8E A;  4BWJ A;  5KFJ A;  3KHL A;  2UVU A;  5ALG A;  1JX4 A;  1F5S A;  5L1L A;  1L7O A;  3F5E A;  4F4Y A;  2GO7 A;  3BQ1 A;  5DGA A;  3RH5 A;  4IQT A;  5KFV A;  1ZD2 P;  2NRT A;  3T5H A;  2FLP A;  4GXJ A;  2PFQ A;  4ED2 A;  4RQ7 A;  2R18 A;  2D6F C;  2PFN A;  4TUP A;  2FI1 A;  1SL1 A;  4GLX A;  4RQ8 A;  8ICP A;  2AU0 A;  1UA0 A;  3RBE A;  5E79 U;  5DG7 A;  3OHA A;  1RM6 C;  4NL9 A;  3T3F A;  4F5R A;  1BPD A;  1ZQM A;  3VCB A;  3PX6 A;  1T8E A;  5AKH A;  2AJQ A;  4XQ8 A;  1QSS A;  3F2D A;  5J0U A;  4OJL A;  4F71 A;  7ICL A;  4O5K A;  4GC7 A;  5EWF A;  3NVW A;  3HKZ C;  5KAF U;  5HHI A;  2KVS A;  1JI7 A;  2HVH A;  4KN4 A;  2JZB A;  3AM9 A;  1LKY B;  5DDY A;  1KFT A;  1T3N A;  2XO7 A;  2JRZ A;  4KIT B;  5AKX A;  4USA A;  4YP3 A;  3LVV A;  2FPL A;  3QU9 A;  2ODG A;  3LDA A;  4I2B A;  3V6J A;  1ZQF A;  1QLN A;  1ED1 A;  2KP7 A;  9ICN A;  4LVS A;  5J2I A;  7ICV A;  2CXY A;  5AM3 A;  1WCL A;  2DGZ A;  2ATL A;  5DQI A;  3MR6 A;  1NK7 A;  2HMX A;  9ICR A;  2HOQ A;  2ZJA A;  3PST A;  4JV1 A;  3SYZ A;  5DLG A;  4FO6 A;  1D8L A;  4RZR A;  1X2I A;  8ICB A;  4I27 A;  5JU5 A;  2HHU A;  8ICO A;  3MGI A;  2E1E A;  4US8 A;  3C5F A;  4KN7 A;  4QZG A;  2XGP A;  1TKD A;  2YX8 A;  5J29 A;  2A3V A;  3ISD A;  2FE9 A;  4NM2 A;  5J2B A;  2I6X A;  5J2G A;  5JUM A;  4EBE A;  2FJ6 A;  3M6K A;  2HOF A;  5KG5 A;  5KFD A;  2CN1 A;  3LYS A;  4QJF B;  3KD3 A;  4LZD A;  2WHE A;  3NVZ A;  5KT6 A;  3BZC A;  1X9W A;  4QWD A;  5CA7 A;  3Q8P B;  5ALI A;  2ZJ8 A;  4TQR A;  3SV3 A;  1L7N A;  4PL2 A;  2R8K A;  3WK7 A;  1ZQG A;  1SXD A;  4PHA A;  1ZQD A;  8ICE A;  3KHG A;  5ALT A;  4MFC A;  3MFH A;  5AI8 A;  2A1J B;  2KIW A;  5KT5 A;  2ZIV B;  3GQC A;  5KFN A;  4KLJ A;  3PW5 A;  2W43 A;  1N5X A;  4DEZ A;  4FS1 A;  1NKC A;  5ALW A;  8ICG A;  1SXE A;  2H3F A;  4NL9 C;  3MDC A;  3AQE A;  4F91 B;  1RPL A;  3UMB A;  3E2E A;  1C20 A;  2UVV A;  3TAR A;  5TZV A;  4IR9 A;  1EXN A;  5L1J A;  2QB0 A;  5HNK A;  5KFP A;  3MGV A;  5AIA A;  4C8K A;  3D2Q A;  3H8J A;  3T79 A;  3OSP A;  7ICI A;  3RB3 A;  2HSZ A;  2B0C A;  2F44 A;  1QCK A;  3H8M A;  3F53 A;  4P4O A;  4GXK A;  3HX0 A;  5KFT A;  1Z00 A;  3ICX A;  2YN4 A;  4KLU A;  2YB4 A;  2FDR A;  1ZRM A;  4RUA A;  5J0T A;  9ICF A;  3RRG A;  4OJP A;  3D2S A;  2GH1 A;  2M0N A;  9ICG A;  2HCF A;  2W9A A;  8ICM A;  4OJ6 A;  3NRW A;  2R8G A;  2Y0S F;  4Y2T A;  8ICR A;  1NK8 A;  1NJY A;  2E8N A;  2IBK A;  2XY6 A;  1NZB A;  5AKL A;  4ED7 A;  3UQ2 A;  3A0B U;  2EZX A;  4R66 A;  5ALL A;  4YCX A;  1TK8 A;  4RQ6 A;  3RJG A;  7ICM A;  5ALM A;  4I2C A;  2JEI A;  3SEI A;  4CGZ A;  1NK5 A;  4KLM A;  2EQY A;  1FEZ A;  3TFS A;  4I29 A;  4YXM A;  3EYZ A;  4RQ5 A;  1V9P A;  2XCA A;  3HW8 A;  5ALU A;  2PI4 A;  1A76 A;  3N7S C;  3AEV A;  3SAG A;  8ICY A;  1X9M A;  5KFL A;  1ZQI A;  5AM5 A;  7ICT A;  3EUB 2;  2W03 A;  2DF4 B;  3WK5 A;  4J9M A;  1UT8 A;  1L7M A;  8ICT A;  1QQ6 A;  1ZQK A;  4BJQ A;  3WU2 U;  3MAB A;  4DQS A;  5KL8 B;  7ICU A;  2MUT A;  1HEK A;  4BX9 C;  2D3D A;  3TAC B;  2MAX A;  2DUY A;  5A0L A;  2ZTD A;  1UCV A;  1SKR A;  5J2C A;  5D4B A;  2ES6 A;  1S5L U;  3DV9 A;  1L3U A;  5AKZ A;  2FPK A;  4KLG A;  5J2F A;  3BS7 A;  4M2Y A;  3IV6 A;  3MGH A;  2LBO A;  2Y9T A;  2NRW A;  5AK4 A;  3QUC A;  1N56 A;  2Q4T A;  2KN7 A;  4YR2 A;  4YMO A;  2PXI A;  2KNJ A;  3PSF A;  3PX0 A;  5ALH A;  4EEN A;  1LVH A;  1XSN A;  2P35 A;  5JTI A;  3CYM A;  1ZXI A;  1L8O A;  2OYY A;  4RU9 A;  3C1Y A;  5J0P A;  3QEB Z;  4ECT A;  1KW4 A;  4ECU A;  3N7R C;  3RB0 A;  1D8B A;  1PK1 A;  1ZJM A;  3NAS A;  4QWB A;  2QKQ A;  2DWQ A;  2KIC A;  1S8O A;  4M9N A;  1X6I A;  2JEG A;  2WF8 A;  7ICE A;  5J8Y A;  2E5S A;  2LM1 A;  1S0V A;  1TE2 A;  1V38 A;  5F9L A;  4RQ4 A;  4F4K A;  1SV0 A;  5ALQ A;  4QZC A;  2FMS A;  4FZM A;  4O3Q A;  5KFR A;  1ZQC A;  5KT3 A;  3ZDD A;  2ZIX A;  5AK5 A;  5HHH A;  3QZ8 A;  5KG0 A;  3CNH A;  5ALV A;  2F1J A;  2N1R A;  7ICO A;  2WTF A;  3QE9 Y;  3TAN A;  1ZQU A;  8ICW A;  2V4Q A;  2F1H A;  2GOL A;  5J2J A;  4YR3 A;  4F3O A;  2KVC A;  4B9S A;  4AP9 A;  1PVR A;  4O3O A;  4Q8E A;  3M6Z A;  4EYI B;  2L5Y A;  3EW9 A;  5GTH U;  2MA1 A;  2MRL A;  5AIB A;  7ICF A;  1HIW A;  2MU2 A;  5ALD A;  3SD7 A;  4HAI A;  2BCQ A;  4HYK A;  3GDX A;  3FC4 A;  2K4E A;  2BCS A;  4NJ8 A;  5EWG A;  2QB0 B;  4DF8 A;  3GZF A;  1L5U A;  2WF5 A;  1IV8 A;  5D46 A;  5KFC A;  4DL7 A;  5KG4 A;  1T3Q A;  5DDM A;  3NTU A;  5DB7 A;  1BNP A;  3IM1 A;  4QZ8 A;  7ICQ A;  3MR3 A;  2CPR A;  2KJ8 A;  2IHN A;  8ICV A;  4P4M A;  9ICJ A;  1BPB A;  5DQH A;  4O5E A;  5KFA A;  3V7L A;  4DSL A;  4KMO B;  3RF9 A;  2NO5 A;  3JPT A;  3OGU A;  4BUG A;  5J0Y A;  4J9L A;  1N62 A;  5AI6 A;  3JPO A;  5III A;  4ED3 A;  1N48 A;  2YQE A;  3PW7 A;  1TVA A;  2IHM A;  4QZB A;  2HBM A;  4DS4 A;  8ICA A;  5CJ7 A;  1WCN A;  1ZQJ A;  3BZK A;  3Q8M A;  3UMG A;  5DBA A;  4G9B A;  2YTU A;  2E1F A;  1SWW A;  2AGO A;  3UQ0 A;  1L6N A;  4J9R A;  5ALY A;  4TUS A;  9ICP A;  2DL0 A;  5KFW A;  3NVY A;  4DL5 A;  2P6R A;  4B9L A;  1ZD5 A;  2RP5 A;  4DSE A;  1KBU A;  4ZH4 A;  4J03 A;  2DBY A;  4F93 B;  2H3Z A;  2VJ5 A;  4Y2Y A;  1JAL A;  2EZZ A;  5J8Y C;  2BDU A;  1YZ7 A;  1SV0 C;  3RFA A;  2W8L A;  4QZD A;  3Q8Q B;  4E0D A;  4QW9 A;  8ICU A;  4JWN A;  4P0P A;  2FMQ A;  4DFM A;  2MUT B;  4MF8 A;  2YML A;  4PHE A;  4C8L A;  3TAP A;  8ICX A;  5DB6 A;  4NY8 A;  1ZQX A;  2VIX A;  4C8N A;  4GXI A;  2JEF A;  1P7D A;  2W7P A;  4C7Y A;  2W11 A;  3T5J A;  4J9K A;  3VC8 A;  2DKZ A;  4QZ9 A;  1LB2 B;  4IC9 A;  2BQR A;  1NK4 A;  2UVR A;  4PH5 A;  2KZZ A;  4FE3 A;  3L3F X;  2KJ9 A;  2HHQ A;  1A0P A;  3AQF A;  4M9L A;  1S76 D;  3PVX A;  2FPM A;  5CWR A;  3LWM A;  4F2R A;  5ALK A;  4J9P A;  1NOM A;  4DQR A;  5KFZ A;  5J0Q A;  4M0A A;  2BCV A;  2GLE A;  3WKB A;  9ICI A;  2AHO B;  5KFF A;  2RRD A;  5DB9 A;  2RDI A;  1PK1 B;  4DSJ A;  4YR0 A;  2EAO A;  5DBC A;  4DSF A;  1ZQP A;  2DQN B;  3TAD A;  4TUQ A;  4Y2S A;  4DL4 A;  2I1Q A;  5IIO A;  1TFR A;  1FIQ A;  3JPQ A;  4UAZ A;  1N5W A;  3Q8R B;  1XC9 A;  5L9X A;  1PVP A;  5HR6 A;  2ZIX B;  4J9Q A;  3EPI A;  3QXG A;  4ED8 A;  2WF7 A;  4ELV A;  1B43 A;  3CP8 A;  5F9N A;  4TQS A;  1MN8 A;  5L1M A;  4R8U A;  3JPR A;  2Z7J A;  4KLH A;  2ZIW B;  4JK1 A;  1X6J A;  1QSL A;  1SL2 A;  4FFD A;  1XWL A;  2G5H B;  4KMU A;  4Y2V A;  3GFK B;  1S0N A;  4DFP A;  3SV4 A;  3TFR A;  1CUK A;  2LMR A;  4QZI A;  2HHV A;  3RH4 A;  4F4X A;  1IIP A;  3V6H A;  1PK3 A;  3QZ7 A;  4F50 A;  2HVI A;  1NJZ A;  2KE7 A;  3NGD A;  1KL9 A;  1N63 A;  2NRV A;  3KOO A;  2ISP A;  5KG3 A;  4I2A A;  4IRD A;  1X66 A;  7ICS A;  1KKX A;  3I1Y A;  2BKE A;  2QLT A;  4YG2 A;  1BVS A;  1DK2 A;  5KFO A;  5CR0 A;  4PJ0 U;  4C0Z A;  3C21 A;  3M1Y A;  5CRX A;  3CW2 C;  2DKX A;  4BGD A;  1Z1V A;  3RBD A;  4PHD A;  9ICX A;  3V6K A;  3IHQ B;  4LJX A;  2HW3 A;  1NK9 A;  4I2G A;  1U4B A;  1L3V A;  2WAQ F;  4DL2 A;  4FBT A;  2VA2 A;  2PFO A;  1T7P A;  2H3I A;  2J6S A;  3ED5 A;  3PW4 A;  4QWE A;  3PX4 A;  1UQV A;  3IG8 A;  3ORY A;  3ETL A;  5AKY A;  3GV7 B;  1RDF A;  4M47 A;  4LZG A;  3FAH A;  2BZF A;  2ZG6 A;  9ICM A;  1V85 A;  2C2R A;  3ALR A;  3KZX A;  1JUD A;  2I9G A;  3OSN A;  2KTQ A;  2C28 A;  1TK5 A;  2V9W A;  3PML A;  3KBB A;  1QQ7 A;  2YY6 A;  4O3P A;  4UAV A;  1ZQY A;  1ZQB A;  2W3R A;  3TAD C;  5AKG A;  9ICV A;  3EWA A;  5ALN A;  3J81 j;  4FZL A;  7ICK A;  3SR6 A;  1SZP A;  1RYU A;  5ALJ A;  3G6V A;  2W9B A;  5B66 U;  1Q46 A;  1DOQ A;  3NS1 A;  4P0P B;  1KN5 A;  1XSP A;  4P0Q A;  4ED6 A;  1JN3 A;  2KFN A;  1M6Y A;  3AUO A;  9ICH A;  1K1Q A;  2E8O A;  5CB1 A;  2R8J A;  2NRZ A;  4IQV A;  2A1A A;  4UBB A;  1S0M A;  2NV3 A;  3WKA A;  2WAQ C;  3PW0 A;  1L8L A;  3RJF A;  5J0W A;  1KDH A;  4B9N A;  3B9J A;  1L3T A;  8ICQ A;  1ZOL A;  4IRC A;  2WF6 A;  4RNO A;  4UAU A;  1H38 A;  3SQI A;  1ZQQ A;  4K4I A;  1BPE A;  3RJK A;  4I2H A;  3MFI A;  5CHG A;  9ICL A;  2LYH A;  2LM4 A;  2ZTE A;  5J0O A;  1FFV A;  3HPO A;  2IA6 A;  4F5O A;  2F77 X;  5KL1 B;  5J2E A;  2PI5 A;  1RG6 A;  4KLT A;  3C23 A;  2RHF A;  4C4T A;  4IL6 U;  1WWV A;  2KD1 A;  4Z6D A;  4B9T A;  3IN5 A;  3C28 A;  2RQ5 A;  2XID A;  3C2K A;  2RDJ A;  7ICR A;  5KFS A;  2Q0Z X;  3SAH A;  3N28 A;  3I76 A;  1OW5 A;  2ASL A;  4DOA A;  1S9F A;  4Y2X A;  4CCH A;  2JZB B;  5KFH A;  5KFY A;  4RPY A;  8ICC A;  5C0Y A;  4DOC A;  1UT5 A;  4O3N A;  1SKS A;  2XI9 A;  1B0X A;  1L7P A;  3SEN A;  2BQU A;  4Y2U A;  4DWI A;  5HML A;  3KFU F;  1U48 A;  8ICN A;  1IG6 A;  5ALX A;  5KFI A;  3GIJ A;  1RXW A;  1K5O A;  4UB1 A;  3QUB A;  1UHU A;  5J0X A;  2HDO A;  1J2N A;  2IOH A;  1B22 A;  4AYB F;  3PW2 A;  3TQ1 A;  1MQ3 A;  3UXO A;  2P66 A;  3K1R B;  5DB8 A;  3DEE A;  4F4W A;  1XO0 A;  2E3T A;  4ACO A;  3NRZ A;  3QNM A;  5CP2 A;  4C4R A;  1DRG A;  3DDH A;  4Q43 A;  4M9G A;  3C29 A;  2G07 A;  4CF3 A;  5KG7 A;  3PR4 A;  4GIB A;  1CEZ A;  1XNS A;  2ZUC A;  2EAP A;  4KLS A;  3H40 A;  3WKC A;  1HJP A;  2JGA A;  4NLK A;  3BS5 A;  2B21 A;  3QU7 A;  4QIW F;  1Z4O A;  1YZ6 A;  1XS9 D;  1Z4N A;  4DS5 A;  2JEJ A;  4R64 A;  2AGP A;  5AI0 A;  7ICJ A;  4UW9 A;  3K4G A;  1S10 A;  3MBY A;  4YFK A;  4BDP A;  4YQW A;  5KG6 A;  1ZJN A;  5HR7 A;  3OPX A;  4I2J A;  2KJ5 A;  4KLD A;  3M8S A;  3BQ2 A;  5AI5 A;  3RJH A;  3JPN A;  2FLL A;  4YD2 A;  1RXV A;  3BQ7 A;  2VA8 A;  3WK6 A;  2YB1 A;  3N4M B;  1KFD A;  4F5Q A;  4ECS A;  4YVZ A;  4Q44 A;  1KLN A;  3QU4 A;  2PFP A;  2O6K A;  4U7C A;  2KEY A;  1PZN A;  4PGX A;  1N2X A;  3B0Y A;  3BQ0 A;  4O9M A;  7ICP A;  1LKY A;  1BNO A;  3PSP A;  4NV0 A;  2VA3 A;  2OH2 A;  2YMM A;  1Z1B A;  1QH9 A;  5KFM A;  2LHT A;  4AYB C;  4UBC A;  1Q3U A;  4R63 A;  3H8S A;  2W9B B;  3ETR A;  1ZD4 A;  4QZE A;  3OJS A;  2BR0 A;  3QU2 A;  3V7K A;  2WFA A;  5G5H A;  3UXP A;  1NKE A;  1JXL A;  3HWT A;  4P0Q B;  2KHV A;  1RYS A;  4DF4 A;  3U26 A;  3OHB A;  2EDU A;  2ZTC A;  5DQG A;  1Z00 B;  2Y1I A;  4OO1 J;  4TUR A;  4RNM A;  1ARO P;  2ASJ A;  1KRP A;  1VDV A;  3GII A;  4PZO A;  3RR8 A;  4QIW C;  1HUO A;  3AU2 A;  3RR7 A;  4DFJ A;  5ALP A;  3AN1 A;  4US9 A;  5ALS A;  2IOF A;  5AKI A;  2KV2 A;  3AMZ A;  1QTM A;  2W9C A;  3RH6 A;  1MA7 A;  4RQ1 A;  4KLE A;  4DL6 A;  3ZDC A;  4ELU A;  3MC1 A;  1Q3V A;  1KQQ A;  3TI0 A;  2AQ4 A;  3M9N B;  5KTQ A;  4UB3 A;  5DLF A;  2BGW A;  5L1K A;  4KLQ A;  5F3X B;  8ICI A;  4B9M A;  2AGQ A;  1Y88 A;  2EH9 A;  3T5L A;  5AKK A;  1IM4 A;  4UB2 A;  1DK3 A;  1NI3 A;  2H3V A;  3QUT A;  2HOI A;  2KKV A;  4PHP A;  4C4S A;  1U9L A;  2QAR A;  1L3S A;  2AQ0 A;  1ZQN A;  3H4D A;  3PO5 A;  3AU6 A;  2W55 A;  4RQ3 A;  1XO1 A;  2JR5 A;  3ONN A;  2BCR A;  3PO4 A;  3SMV A;  4EEL A;  4YN4 A;  1D9F A;  7ICG A;  1S77 D;  2PMZ F;  4KLF A;  2OM6 A;  4UB5 A;  5G5G A;  3H7I A;  1D9D A;  1N61 A;  1O08 A;  2ESE A;  4EX7 A;  8ICS A;  4F2S A;  4K4G A;  4I2D A;  1NJW A;  4KLI A;  4CE6 A;  3HIL A;  3QUQ A;  5EOZ A;  3N97 B;  4FS2 A;  1WG8 A;  1BPX A;  3F2B A;  3Q8L A;  2G09 A;  1U49 A;  4FBU A;  4WJ3 B;  3R9K A;  3MR2 A;  9ICU A;  1PVQ A;  9ICK A;  3QEA Z;  4QW8 A;  2YMP A;  1SV4 A;  5J2H A;  3RRH A;  2ZJ5 A;  2EAN A;  4EEK A;  2NYV A;  1NK0 A;  4Z6F A;  1TK0 A;  4B6J A;  4MFF A;  3OTQ A;  1QQ5 A;  4DOB A;  1J97 A;  1ZQE A;  1JXE A;  5B5E U;  5KFQ A;  2W3S A;  2F3N A;  2WF9 A;  3BS5 B;  3WK9 A;  2IOF K;  1V97 A;  3CRX A;  1BPY A;  4BXO A;  3GIK A;  2G5I B;  1FO4 A;  1ZD3 A;  9ICT A;  2ALZ A;  2K4I A;  2J6U A;  2Y1J A;  1MSW D;  3H0L B;  2G0A A;  3PSI A;  1ZQO A;  4F92 B;  4I2E A;  5EE0 A;  5EE9 A;  5BOL A;  4RQ0 A;  4FZN A;  2PMZ C;  4NLN A;  3UPQ A;  2K60 A;  4MFA A;  3GIL A;  3MR5 A;  3GV8 B;  1O03 A;  3T5K A;  4DSK A;  2R8I A;  2W54 A;  5JRT A;  4EEY A;  4Y2R A;  1KSP A;  2EZY A;  3KKA A;  2OEH A;  1RQN A;  2OCE A;  4IQW A;  4O3R A;  2HHW A;  4P4P A;  5KT4 A;  4F8R A;  1NNL A;  4DQP A;  1F0M A;  5IIL A;  1ZQL A;  5FP0 A;  4KX3 A;  3ISB A;  2F8K A;  1F44 A;  4YD1 A;  4RPZ A;  5AK3 A;  5ALO A;  3G6X A;  4ECV A;  4QWA A;  2KSO A;  2LI6 A;  3GIM A;  5KAI U;  4UAS A;  5J0R A;  4J9N A;  4MEY A;  4EX6 A;  1SL0 A;  4NLC A;  2BPG A;  1KFS A;  3LK9 A;  4XA5 A;  3LWL A;  5HMM A;  1AQ6 A;  3WK8 A;  4UAR A;  1S97 A;  3RAQ A;  3NUQ A;  1OUQ A;  7ICH A;  9ICC A;  3D6J A;  4DQI A;  4Q45 A;  4C8O A;  4M04 A;  1N60 A;  5AM2 A;  5KG1 A;  1BPZ A;  4QZA A;  3GV5 B;  4P2H A;  4G3I A;  2WB1 F;  4Y2J A;  2ZIU A;  4JB3 A;  2YMQ A;  1BGX T;  2ZXI A;  4ED0 A;  4EZ9 A;  5ALE A;  3PZP A;  5DKW A;  3IP4 B;  1KEJ A;  2E8M A;  4I28 A;  5KFE A;  1WUD A;  2KG5 A;  3H0M B;  5AM4 A;  5D49 A;  1ZQH A;  1SZH A;  4ICA A;  4XRH A;  1JMS A;  2F8L A;  4F4Z A;  2LKY A;  3ZD8 A;  2XC9 A;  1S0O A;  1K1S A;  2W9C B;  2W8K A;  1ZQA A;  2BQ3 A;  9ICB A;  2IMW P;  1ZYQ A;  1X42 A;  3D2N A;  2HBK A;  1X9X A;  2V4R A;  4QZH A;  5KG2 A;  3BJY A;  3EPG A;  1VLB A;  3OJU A;  4OD0 A; 
#chains in the Genus database with same CATH homology
 1DXS A;  2Y9U A;  2JV3 A;  1PK3 A;  5JU5 A;  2EAM A;  2B6G A;  2K60 A;  1B0X A;  1SGG A;  3SEN A;  2KE7 A;  2K4P A;  2DKZ A;  1LKY A;  5JRT A;  5JTI A;  2FE9 A;  1OXJ A;  1X66 A;  3KKA A;  2QAR B;  2E8N A;  1KW4 A;  4NL9 A;  1PK1 A;  1F0M A;  2QKQ A;  2E8O A;  2F8K A;  1WWU A;  2KMD A;  2ESE A;  2KSO A;  2DKX A;  3SEI A;  5J8Y A;  1Z1V A;  2LPE A;  2GLE A;  1SXD A;  2YTU A;  1V38 A;  3K1R B;  3HIL A;  4PZN A;  5KNI A;  1PK1 B;  1SV0 A;  1X40 A;  2EAO A;  4PZO A;  3TAD A;  2DL0 A;  1JI7 A;  2KSO B;  2EAP A;  1SV4 A;  2QB1 A;  1LKY B;  1UQV A;  2EAN A;  3KKA C;  4IS7 A;  4RQM A;  1SXE A;  4NL9 C;  3BS5 A;  1RG6 A;  2E8M A;  4RQN A;  1B4F A;  2KG5 A;  1V85 A;  1WWV A;  2L5Y A;  4MHV A;  2QB0 A;  2D8C A;  2D3D A;  3TAC B;  5L1M A;  5J8Y C;  2F3N A;  1UCV A;  2KIV A;  5F3X B;  2ES6 A;  3BS5 B;  1SV0 C;  2E8P A;  2F44 A;  3H8M A;  1OW5 A;  1X9X A;  3IDW A;  3TAD C;  2LMR A;  3BS7 A;  4NJ8 A;  2QB0 B;  3BQ7 A;  2Y9T A;  1COK A;  2QAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...