5F3XB

Crystal structure of harmonin npdz1 in complex with anks4b sam-pbm
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
VDATPLEVFLQSQHLEEFLPIFMREQIDLEALLLCSDEDLQNIHMQLGPRKKVLSAIDKRKQVLQQPGQLVDTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanistic Basis of Organization of the Harmonin/USH1C-Mediated Brush Border Microvilli Tip-Link Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/protein binding
molecule keywords Harmonin
total genus 23
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5f3xB00
1LKYB 3H8MA 1Z1VA 2QB1A 1RG6A 4MHVA 3TADC 1F0MA 2F3NA 2D3DA 2KSOA 3SEIA 2F44A 2QKQA 1PK1A 1OXJA 1DXSA 1PK1B 1PK3A 1SV4A 2E8PA 2D8CA 2YTUA 4IS7A 5J8YC 2KMDA 2E8OA 1JI7A 2L5YA 2EAPA 4NL9C 3KKAA 2QB0A 1UQVA 2QARB 2ES6A 3BS7A 1B0XA 3BQ7A 1V85A 3K1RB 2EANA 5F3XB 1X66A 5J8YA 1WWUA 2KSOB 3BS5B 2KG5A 1WWVA 1UCVA 4PZNA 2K60A 2KIVA 2DL0A 2LPEA 5JRTA 5KNIA 2DKZA 1SXEA 2ESEA 1LKYA 5L1MA 4PZOA 1COKA 1SXDA 1X9XA 1V38A 4NJ8A 4NL9A 2QARA 1OW5A 2E8MA 1SV0A 2F8KA 1X40A 1B4FA 1SV0C 2Y9TA 5JTIA 2KE7A 3TADA 1KW4A 3SENA 2JV3A 2E8NA 1SGGA 3KKAC 2EAMA 2B6GA 3HILA 3BS5A 2FE9A 2Y9UA 2DKXA 3TACB 4RQNA 2EAOA 5JU5A 3IDWA 2GLEA 4RQMA 2QB0B 2K4PA 2LMRA
chains in the Genus database with same CATH superfamily
3TADC 3H4BA 3N7SC 3JPSA 4K4IA 4Q8FA 4M9LA 4PL2A 7ICQA 8ICBA 3B0YA 5KFMA 3M9MB 2BCUA 1X2IA 4O5CA 1MC8A 2UVWA 4TUSA 2H3VA 5CRXA 2HHTA 4B9MA 2OWOA 3E0FA 4BX9C 8ICOA 4UB3A 4UAZA 3BQ0A 4EX6A 5KFEA 8ICCA 3NTUA 3WK4A 2BDUA 3AMZA 2PI5A 4Y2QA 4DLGA 3QUBA 1UT5A 4DOAA 1D9FA 3ONNA 2DKZA 3WKCA 4KLLA 5KAFU 2I6XA 2H3ZA 4IQUA 1Z19A 4PZOA 4YMNA 2K4EA 1X9XA 1V38A 3AU6A 3H0MB 4KLIA 3RF9A 2HBMA 2AQ4A 2HBKA 1J2NA 4IC9A 3PX6A 1XSPA 1SL0A 2ZIVA 3V6HA 4EZ6A 3RJGA 4UW9A 2JV3A 1L7MA 4U6PA 2R8GA 1L6NA 1S0MA 4UB2A 2P6UA 2RHFA 3BS5A 5AKGA 4UB1A 2ZTCA 3G6XA 1ZQCA 3GZFA 2Y9UA 4UAYA 5L9XA 4OJLA 4UAVA 1NJZA 3LDAA 1IV8A 5F9LA 2WFAA 2HOFA 7ICOA 5K4LA 4DCCA 4FS2A 4DWIA 8ICNA 3I76A 3AQFA 1S8OA 1QSLA 3TANA 4IR1A 1TFRA 4M47A 3CRXA 1B43A 2IHNA 1RYUA 1K1SA 1QH9A 1RYRA 2MU2A 3TKAA 3RB0A 2ZIUB 2W7OA 1TKDA 2YTUA 2L5YA 3WK7A 3O0FA 2NRVA 2VA8A 1SZPA 4U7CA 3ALRA 4DSLA 4Y2JA 4JV1A 1A76A 4F71A 3DEEA 4I2HA 3K1ZA 4P4OA 2QLTA 5F3XB 4HAIA 5ALXA 3SYZA 1WWVA 1PVRA 4TURA 4QWDA 9ICFA 2VIXA 4J9NA 2G06A 1F44A 1XSNA 1N61A 4QZFA 3GV8B 4F93B 1HEKA 1T7PA 4DS5A 2IOFA 3C2LA 9ICMA 1COKA 5E79U 5AKKA 3IG8A 1FO4A 2ZUBA 3RBDA 4QIWF 1KKXA 3M7DA 3G6VA 2CN1A 2PI4A 2YB1A 1FFUA 4DS4A 4I2JA 3MR5A 4J9QA 3H8SA 2C28A 1NNLA 4J9PA 4DQPA 5J2GA 5KT7A 4EELA 3QU7A 4B6JA 4NLZA 2WHEA 2E8NA 4ED6A 2F76X 3OHBA 2YY6A 3ZDBA 1QLNA 4NLGA 2BQRA 4F2SA 1HJPA 1Q46A 1X42A 2DKXA 2P35A 3HKZF 5AI9A 4Y2YA 5ALHA 1HIWA 2UVVA 4P0QA 2G0AA 5EE1A 2WAQF 2GLEA 3ICXA 2QB0B 2LYAA 4DL5A 3M9OB 4EYIB 1NJXA 1NK0A 3TFSA 2G5HB 7ICLA 2PFOA 5AM1A 4DSKA 4IQTA 4B9LA 4CE6A 3N28A 4UB6U 2IA6A 2V4RA 5DGBA 1L8OA 2W04A 2HVIA 9ICCA 1S9FA 3EWAA 1JROA 4IS7A 1XSLA 2A1JB 2KMDA 5AM5A 4RT3A 1IIPA 5KG0A 2ZIXB 1RXVA 4PL1A 4Q8EA 5KFUA 7ICJA 4KLHA 3PW0A 2AJQA 4I2FA 3Q8KA 2KSOB 1XWLA 3BZKA 1NKCA 1JIHA 5EWFA 2A1AA 4KMOB 5ALFA 3MABA 1T3NA 3ISBA 4I2CA 5IIKA 2W8KA 3QU2A 4R65A 5KFYA 4BUGA 5J2EA 3I28A 1A77A 5DDYA 3LVVA 4ECWA 4F4KA 1QSYA 5DG8A 3OSNA 4M9GA 2KK0A 5ALUA 3ORYA 4FZMA 3PY8A 2Y0SC 2MA1A 1N56A 2GOLA 1N2XA 4I27A 3QYPA 4QZHA 4FO6A 2Q0ZX 2J6UA 2HHUA 1NK5A 1ZQOA 1SKWA 2EDUA 4O3RA 2EAMA 3C23A 8ICIA 5KG5A 3SQIA 2ZIWA 2WF9A 3V7KA 1Z3EB 2GH1A 3PV8A 3GIKA 5IIIA 2AU0A 1CEZA 4UB5A 5CWRA 1RXWA 4QIWC 4C8MA 1S97A 8ICGA 1RM6C 3EUB2 1MQ2A 2RP5A 1K1QA 5L1KA 1Z1VA 3PO5A 1NOMA 4TQSA 2E1FA 9ICTA 1F0MA 4RQ0A 2D3DA 5J0OA 2MSNA 4YVZA 2HBLA 1BNPA 5ALIA 1ZQSA 4DQRA 4ECYA 1BVSA 4A8EA 8ICSA 1NJWA 4KLMA 2E3TA 4CCHA 4F4XA 1YT3A 3V7JA 3QZ8A 3ISCA 3BS7A 4QWAA 4YD1A 3RJIA 3JPRA 3K1RB 5EWEA 3RH4A 4KLGA 3BS5B 4O3QA 5GTIU 1TE2A 2DL0A 4F5OA 4QZBA 5DQIA 9ICQA 3PSFA 2ESEA 4YR3A 2W7PA 2AXTU 3WK9A 3PSIA 5CHGA 2W03A 1ZQ1C 1VJ5A 1ZOLA 4CNQA 3LWMA 3GDXA 5AKLA 2ZXIA 4ED1A 4DL2A 5EE0A 2EZYA 1SV0C 2FPMA 5AK6A 8ICJA 5J29A 4US8A 4M6WB 4NLBA 3MFIA 2C2DA 4M6WA 5DG9A 3NRWA 1AROP 2XCAA 2W54A 1KFSA 2ZIXA 3PW5A 1Z00B 4RT2A 2OM6A 3ZDAA 3LVWA 3V72A 1ZQYA 2NO4A 4RQNA 1NKBA 4KLUA 4F72A 2HHXA 2KVSA 4RQ2A 4O3NA 5KFKA 2JH1A 3V6JA 4M9JA 8ICEA 2XGQA 2JXJA 2QB1A 3ZI4A 1U47A 3FYHA 4GXKA 5ALJA 3KZXA 1SB3C 3E58A 2ASDA 4B9VA 2DWQA 2KHVA 4DEZA 4R63A 1DXSA 4DL6A 4I2DA 1SV4A 3IHQB 4K4GA 2KZZA 4DSFA 5DLFA 2DQNB 1ZQMA 2NO5A 9ICVA 4ACOA 8ICWA 1FIQA 3BJYA 5HR7A 1X66A 3ZD9A 2Q4TA 1NJYA 4J9LA 1RZTA 5DKWA 3C5GA 2G07A 2KIVA 1SIJA 4Y2RA 5C0YA 7ICRA 1L7PA 1JRPA 4I2GA 3AEVA 3UQ2A 4P4PA 2W9MA 4C8NA 1UT8A 2HDOA 4DFDA 1AQ6A 1ZD3A 4RPXA 2KN7A 1F5SA 4AP9A 4C7ZA 5DBAA 1BPBA 1QQ6A 4EEKA 2XO7A 3SR6A 3H8WA 4X5VA 1HUOA 3T5JA 2C2RA 5KFRA 4LZDA 3EPGA 7ICKA 2H3IA 3WKAA 3GILA 1SKSA 4OD0A 1T8EA 3PVXA 2DUYA 1ZQAA 2CPRA 4YP3A 4BXOB 3QXGA 1NK9A 5EE9A 4ZOHC 4FZNA 3D2NA 3S6JA 2JEJA 4KN4A 2UVRA 5BOLA 5HMMA 3UXNA 5AI5A 2OEHA 3IG5A 5B5EU 2H3QA 1X40A 2ZIVB 1ZYQA 4JV2A 4M0AA 2OYYA 5AK4A 4UAUA 7ICSA 5AIAA 4ED7A 3MR3A 5ALZA 1KFTA 2HI0A 1U45A 4RU9A 4QZIA 2FLPA 1TVAA 2O6KA 2C2EA 4C0ZA 2EAPA 4J9OA 4I28A 1ED1A 3RJKA 3V7LA 4FS1A 1Y88A 2JGAA 4KLSA 3BQ7A 4QZDA 4RPZA 2MRLA 5KG7A 2KG5A 4ECUA 3CP8A 5CR0A 2HSZA 5J2AA 3RTVA 2HHVA 9ICRA 2LI6A 3BQTA 4F91B 5J2IA 3HX0A 3HRDD 3SAGA 3OHAA 2BQ3A 5KFSA 1OW5A 3EPIA 2PMZF 2JZBB 4CRXA 1L3VA 4IRKA 1QQ5A 1SV0A 3H8JA 3UMBA 4IL6U 4HYKA 1PUZA 1S5LU 2Y9TA 8ICAA 4UB8U 1QCKA 1VDVA 3GIMA 3Q8MA 1C7YA 9ICOA 7ICVA 5GTHU 4C4RA 1DRGA 2ZTDA 3RH5A 4MFFA 2B6GA 3LWLA 1QTMA 7ICFA 4ED3A 1KQQA 1L7NA 4YMOA 5KG6A 3KZIU 4CF3A 4GXIA 4F8RA 5CP2A 1LKYB 5ALOA 4QZEA 5IIOA 4F5NA 2K8CB 3QU5A 2RQ5A 3Q8QB 5D46A 5ALNA 9ICUA 7ICMA 4OO1J 1SKRA 2F44A 2PFNA 5EOZA 2FPKA 2KKPA 1URJA 1PK1B 5IINA 4IR9A 3QUCA 4MEXA 3KHGA 4KLQA 2BGWA 1JUDA 3B9JA 3PNCA 4RQ8A 2F2AB 3RRHA 1ZQKA 1J97A 2LPEA 2JHDA 4Y2UA 1ZQHA 1SXEA 5AKHA 1KEJA 2DFLA 1UPHA 1RYSA 2WF8A 5DQHA 1SXDA 5AKJA 4NJ8A 3J81j 4PH5A 4UBCA 4AYBF 4KLDA 1KTQA 4YR0A 4DFJA 1ZQLA 3L5KA 3GIIA 2MUTB 2F1IA 2HVHA 4QNLA 2KE7A 5KFQA 4I2IA 5H2FU 1WG8A 3HWTA 5AI0A 2Y0SF 4TUQA 3LK9A 3WK6A 4NXZA 5J0PA 5ALKA 2KEYA 2FE9A 7ICPA 4ED8A 2W8LA 4RNMA 3ZD8A 1ZQQA 4LVSA 9ICLA 1KFDA 1OUQA 3PSPA 3AQEA 4G9BA 5ALYA 1PZNA 2DPIA 3FC4A 2HHQA 2KOBA 3A0HU 4C8OA 3RH6A 5AK3A 4RQ1A 2JEGA 2W43A 4P0PA 2XCPA 4XRHA 5L1LA 2K4IA 5J2FA 2UVUA 1CRXA 1TV9A 2AQ0A 4Z6EA 1BPZA 4QZCA 2BPCA 1UQVA 3SI8A 2KZ3A 1V85A 1MN8A 4G3IA 4OJ6A 4KX3A 3AM9A 1ZQEA 5KFFA 3HP6A 3H7IA 1UA0A 2R8IA 4ED2A 1UCVA 2NRXA 3JPNA 4IQVA 3N97B 5JRTA 1XO0A 3GQCA 1BPXA 3RR7A 4B9SA 3SZ2A 1L7OA 1WYGA 1N5XA 3ETLA 5DB7A 2YN4A 9ICIA 2A3VA 1NZPA 5AI4A 3OJUA 3RJHA 1KL9A 3RB3A 4YFKA 3DDHA 4R8UB 3MDAA 5KFJA 1J2MA 4I2BA 2W11A 3UM9A 2MAXA 1ZQXA 4P4MA 3H0RB 3TADA 4QWEA 4UARA 8ICLA 3EW9A 3CW2C 1L5UA 4ECQA 5EWGA 2BCQA 3HILA 1MSWD 4Y2VA 4DSIA 3RJFA 4WJ3B 2YMLA 2LKYA 3ZDCA 3QUQA 9ICPA 2A19A 5EE3A 1ZQDA 4QW9A 2B21A 3B0XA 3I1YA 3C1YA 1XNSA 4OCZA 3RB6A 3NS1A 4K4HA 3D6JA 3C2MA 3IP4B 3CNHA 5AM0A 2EZXA 1SL1A 9ICSA 1RQLA 2JRZA 7ICHA 4YMMA 2H5XA 1ZQTA 4EBCA 4QZ9A 1ECWA 3SMVA 3N4MB 1NZBA 5AK5A 4BWJA 3BDPA 8ICVA 1U9LA 2ZUCA 1NK6A 4J9SA 4ECRA 2HOQA 3LYSA 5AM4A 2ES6A 3M8SA 1ZJNA 1ZQBA 3FM9A 4O5EA 1JALA 2EANA 2AGQA 3PMLA 4P0QB 5DBCA 1XS9D 2FI1A 3M6KA 5DG7A 3NRZA 2HBJA 1BPEA 4F4ZA 4DSEA 4E0DA 4M9HA 3RR8A 5KT5A 1K5OA 5ALRA 1CI4A 3Q8LA 3R9KA 4DQSA 4B9TA 5BOMA 1S77D 2ISPA 1ZRMA 7ICNA 2BPGA 2E8MA 8ICYA 4YD2A 1H38A 2CRXA 1WCNA 8ICQA 2PFPA 2F1HA 4NM2A 5DB6A 2IOFK 3OSPA 4PGXA 3T79A 5ALQA 5JTIA 5HR6A 5JUMA 4USAA 4NWIA 3GV5B 5J2DA 5KFCA 5AICA 2FPLA 2JEFA 3KKAC 1BPDA 2PKEA 4MFAA 9ICAA 3MGVA 3PW4A 9ICHA 1ZQGA 5DB9A 3KFUF 2IMWP 4KTQA 2RRDA 2R8KA 1LVHA 4AYBC 1N48A 2HHSA 4DF8A 5KL1B 5J0SA 4M04A 2EZZA 3ZDEA 2F3NA 4F4YA 4DSJA 3A0BU 3IM1A 3C2KA 4KX5A 4JK1A 5KG3A 2K89A 4UATA 4UB4A 2ZTEA 4DL7A 2W9BA 5J0WA 4F5QA 5J8YC 1XO1A 2GO7A 5G5HA 5J0YA 3KHRA 3OPXA 1JX4A 4Q43A 5HMLA 3L4PA 3GFKB 4ECVA 2Y1IA 5HHHA 3Q8SB 2JEIA 5KFXA 4CDGA 4Z6DA 4UBBA 3C1ZA 5KFDA 9ICJA 3ZDDA 3PSTA 1FFVA 2FLNA 3RAQA 2ALZA 2KZMA 3NUQA 3HT3A 4RNOA 4KMUA 2IHMA 3PX0A 1UHUA 5AIBA 3VC8A 2G08A 4QJFB 1Z00A 4ELUA 2VJ4A 7ICIA 1D8LA 1BPYA 5J2KA 1LB2B 4F5PA 5FP0A 2XGPA 1SL2A 8ICMA 7ICGA 2DPJA 2YMQA 4US9A 1GO3F 1KW4A 3WKBA 2KJ5A 1TAUA 1KN5A 1LV5A 1SGGA 4DQIA 3TAQA 4J9MA 2BCVA 2AH5A 2ZJAA 4TQRA 1BNOA 4JMUA 2FMSA 1X9WA 1S0NA 4JV0A 3RB4A 1SZHA 4PGYA 2FMQA 3QEBZ 5CJ7A 2RLTA 4XUSA 4QWCA 2XI9A 2NYVA 1PK1A 1KDHA 2ZXHA 4C7YA 4C8LA 4NV0A 2E8PA 2D8CA 2OH2A 4EYHB 1D9DA 2ZUDA 1DK3A 4RQ3A 4EBDA 3TI0A 1X6JA 3QU9A 7ICEA 2F1JA 4DL4A 4YXMA 4PHAA 4JUZA 2KIWA 2KFNA 1TK0A 4P2HA 4KLEA 5D4BA 1KRPA 3ISDA 4F2RA 4RQ4A 2LYHA 3SAFA 2P66A 3MFHA 1VLBA 5KTQA 2DF4B 2LM4A 5J0RA 4BWMA 3WKEA 5J0UA 2WB1C 3T5HA 5B66U 3H0LB 3RAXA 1KLNA 8ICHA 3UMGA 3H4DA 3AN1A 3TFRA 1NK7A 1TAMA 1M6YA 5KG4A 4NM1A 4XQ8A 5D49A 2R8HA 3QEAZ 4DFMA 4KLOA 1NKEA 2JR5A 3SENA 4F4WA 1S76D 4EENA 4DQQA 2HHWA 3RJJA 1Z4NA 4KLJA 4JWMA 1BGXT 1NI3A 1SWVA 5ALGA 3EYZA 2XIDA 3GU3A 4GIBA 3TARA 4J03A 3IDWA 4ELTA 1T3QA 4KN7A 4QZ8A 2VA2A 3NASA 5KT2A 4NLKA 4BDPA 3H8MA 4ZH4A 4J9RA 3MGHA 2J6SA 2KSOA 2CXYA 5ALLA 3NVYA 3GIJA 4RQ6A 2QKQA 3HW8A 5DLGA 3E2EA 3JPOA 2K8AA 2KV2A 2XY5A 2GWSA 1SWWA 2FJ6A 3KKAA 8ICPA 1N5WA 5C5JA 2OXOA 1A0PA 3RJEA 3FDSA 1B0XA 4ELVA 4OJ5A 1T4GA 3KOOA 4O5KA 3KD3A 4CGZA 1U48A 2ZIUA 3N7RC 3GV7B 3RRGA 3RFAA 1ZQUA 4QW8A 5KFHA 4MF8A 9ICWA 2KJ9A 2HOIA 4IRDA 3TQ1A 2XVTA 3AU2A 4NLNA 1LKYA 1IXRA 2OHFA 3UXOA 4QZGA 3KBBA 5L1MA 4DFPA 3HPOA 2I9GA 9ICNA 4I2AA 2XICA 4NL9A 4Y2PA 5KFZA 2ZIWB 1TK8A 1S0OA 5IIMA 1S0VA 2F8KA 3MDCA 1Z4OA 3BQ1A 4IRCA 4Q45A 3T3FA 5HHIA 1JXEA 5DGAA 2RDIA 1IG6A 4M9NA 5J0QA 4EBEA 3KTQA 1ZRNA 9ICBA 3PW2A 3M1YA 2XC9A 4YQWA 1JMSA 4CF4A 4F3OA 3NVVA 2YMPA 5JU5A 2WB1F 3RBEA 3C21A 3F5AA 4FBUA 7ICTA 4UASA 2LMRA 1YZ7A 2G5IB 3Q8PB 5KFVA 3NGDA 2ASJA 4CF5A 4O9MA 4FE3A 3F53A 2AHOB 8ICRA 2I1QA 2MUTA 3SEIA 4MFCA 4P0PB 2E1EA 5L1IA 4KLTA 1ZQPA 4TUPA 2BR0A 3AL0B 1L8LA 4JB3A 2AGOA 3H40A 2WTFA 4NL9C 4YR2A 2VA3A 1RPLA 4UQGA 3SD7A 2QARB 3C28A 1ZD5A 3D2SA 3IN5A 3VCBA 2KD1A 5J8YA 1WWUA 2HMXA 2YQEA 5KFBA 1ZQWA 2WF6A 3KHLA 2DGZA 5TISU 1QQ7A 4FZLA 2WF7A 2ISOA 5J2BA 5IILA 3PR5B 2V9WA 2LHTA 5ALSA 2QARA 2W3SA 3WKDA 5AKEA 2WF5A 5J2CA 5T14A 1PVQA 2FLLA 5J0TA 1NK4A 4I29A 1TK5A 1O03A 1ZQZA 4ECSA 3F2DA 1ZJMA 4LZGA 2M0NA 3F2BA 4GC7A 5KT6A 3G6YA 1DOQA 3Q8RB 3PR4A 5L1JA 1P7DA 3T5LA 5AM3A 1RDFA 1ZQIA 2HW3A 1ZQFA 8ICUA 1WCLA 3ED5A 2OCEA 2F77X 3SAHA 5KFGA 4YN4A 2WAQC 1ZD2P 4RQ5A 4Y2SA 5KFAA 3TACB 1L3UA 4OJOA 2EAOA 2ZG6A 4EZ9A 3BQ2A 3WK5A 1V9PA 5AKYA 2XY6A 2K4PA 2D6FC 2LM1A 1ZQJA 2BCSA 1EXNA 2VKQA 5KFPA 1RG6A 4RPYA 3ETRA 2JMGA 3SV4A 1MA7A 4PHDA 4I2EA 4DOCA 4Y2XA 4GC6A 9ICGA 4JWNA 2A1JA 4B9UA 3NVWA 5J2JA 4MEYA 2V4QA 4DO9A 2ZJ5A 4EX7A 4YXJA 5AM2A 1D8YA 2FDRA 2QB0A 5IIJA 4RNNA 3JPQA 4NLCA 5AHXA 4ED0A 1L3TA 4PPXA 4DF4A 1XU4A 1RQNA 4O3OA 2ODGA 5DB8A 3UQ0A 4O3PA 1HUZA 5J2HA 7ICUA 1S10A 4YCXA 5KFOA 4YG2A 4RUAA 4ICAA 4ECXA 2KHQA 2VANA 9ICXA 4C4TA 4Y2TA 1COOA 8ICZA 1X6IA 2ASLA 2K4HA 5AI8A 4XA5A 2G09A 1N62A 1PVPA 5KFWA 5ALPA 3MR2A 4BXOA 3PO4A 3AUOA 5G5GA 4M2YA 4Q44A 4MF2A 2XY7A 1DK2A 2NRWA 2ZJ8A 1Q3VA 4FFDA 8ICTA 5KT4A 3U26A 3KHHA 3HKZC 2M9NA 1UA1A 5AKIA 3OJSA 1YZ6A 4C8KA 2YX8A 5HNKA 3QE9Y 4C80A 3MGIA 4F92B 2HCFA 2YB4A 4OJPA 2W9CA 5F9NA 1U49A 4MHVA 3UXPA 4R8UA 1Z1BA 3QUTA 2VJ5A 2BZFA 4QWBA 3D2QA 4O3MA 2E8OA 5ALVA 5CB1A 3FAHA 2I5HA 3CYMA 2EH9A 5ALEA 5AKXA 3TAPA 1L3SA 2K8BB 2PMZC 2W3RA 4DLEA 8ICKA 1C20A 3DV9A 2K60A 1NK8A 3JPTA 4B9NA 4EEYA 3QX7A 1N60A 3C29A 2PXIA 5BPCA 3C5FA 1WUDA 3K75D 1KSPA 2P6RA 1X9MA 2W55A 5KFLA 1A6SA 3F2CA 3QZ7A 2BKEA 4R66A 2IBKA 1O08A 4LJXA 1T94A 4RQ7A 3SV3A 2AGPA 3NVZA 4O0IA 5ALWA 5KFNA 4RUCA 4F5RA 2Z7JA 5CA7A 4ECTA 1X9SA 2W9CB 2J6TA 5ALMA 1Q8KA 5KG2A 1N63A 5ALDA 1U4BA 3PZPA 4DFKA 4PHPA 1TAQA 2ATLA 3HJEA 4Z6FA 2IOHA 4Z6CA 4GXJA 2R18A 4QZAA 2BQUA 4RQMA 2RDJA 4KLFA 4PZNA 2B0CA 5HP4A 2E5SA 3EZ5A 4KITB 2JH7A 3F5EA 2BCRA 3L3FX 2C22A 5KT3A 1ZQNA 1CUKA 2LYBA 2KVCA 3K4GA 4O3SA 3N7PD 2NRTA 4J9KA 1ZD4A 1D8BA 1OXJA 3UMCA 5DDMA 1PK3A 8ICXA 4DL3A 4F50A 1ZETA 1JI7A 9ICKA 2LBOA 4NY8A 5KFIA 3MR6A 4R64A 1JN3A 4DOBA 3OGUA 3PMNA 5DQGA 1JXLA 2BHNA 3PX4A 3UPQA 4GFJA 9ICEA 2JZBA 2KP7A 2NV3A 3THVA 1QSSA 3T5KA 2EQYA 1XC9A 2W9AA 4PGQA 5KNIA 5A0LA 4PHEA 3OTQA 5TZVA 3QU4A 2BPFA 2BDPA 3WK8A 2KTQA 3QNMA 5AKZA 4BJQA 4PJ0U 2PFQA 3M8RA 5KAIU 3M9NB 3V6KA 3BZCA 5J0XA 4ECZA 4UAWA 2FMPA 2KJ8A 1Q3UA 3JPPA 1B4FA 2KNJA 3WU2U 1IM4A 1DGJA 1KBUA 2W9BB 5KL8B 5KFTA 1B22A 2YMMA 4C4SA 3MC1A 4BGDA 3MBYA 2KKVA 2KFZA 2H3FA 5KG1A 4FBTA 3M6ZA 8ICFA 4GLXA 1FEZA 1ZQVA 4RZRA 1ZQRA 3IV6A 2N1RA 1DGSA 1V97A 3PW7A 2KICA 1ZXIA 5AI6A 2NRZA 5ALTA 5DBBA 4IQWA 2F8LA 5CEHA 1MQ3A 2R8JA 3IRUA 2Y1JA 2DBYA
chains in the Genus database with same CATH topology
1LKYB 3H8MA 1Z1VA 2QB1A 1RG6A 4MHVA 3TADC 1F0MA 2F3NA 2D3DA 2KSOA 3SEIA 2F44A 2QKQA 1PK1A 1OXJA 1DXSA 1PK1B 1PK3A 1SV4A 2E8PA 2D8CA 2YTUA 4IS7A 5J8YC 2KMDA 2E8OA 1JI7A 2L5YA 2EAPA 4NL9C 3KKAA 2QB0A 1UQVA 2QARB 2ES6A 3BS7A 1B0XA 3BQ7A 1V85A 3K1RB 2EANA 5F3XB 1X66A 5J8YA 1WWUA 2KSOB 3BS5B 2KG5A 1WWVA 1UCVA 4PZNA 2K60A 2KIVA 2DL0A 2LPEA 5JRTA 5KNIA 2DKZA 1SXEA 2ESEA 1LKYA 5L1MA 4PZOA 1COKA 1SXDA 1X9XA 1V38A 4NJ8A 4NL9A 2QARA 1OW5A 2E8MA 1SV0A 2F8KA 1X40A 1B4FA 1SV0C 2Y9TA 5JTIA 2KE7A 3TADA 1KW4A 3SENA 2JV3A 2E8NA 1SGGA 3KKAC 2EAMA 2B6GA 3HILA 3BS5A 2FE9A 2Y9UA 2DKXA 3TACB 4RQNA 2EAOA 5JU5A 3IDWA 2GLEA 4RQMA 2QB0B 2K4PA 2LMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKY B;  3H8M A;  1Z1V A;  2QB1 A;  1RG6 A;  4MHV A;  3TAD C;  1F0M A;  2F3N A;  2D3D A;  2KSO A;  3SEI A;  2F44 A;  2QKQ A;  1PK1 A;  1OXJ A;  1DXS A;  1PK1 B;  1PK3 A;  1SV4 A;  2E8P A;  2D8C A;  2YTU A;  4IS7 A;  5J8Y C;  2KMD A;  2E8O A;  1JI7 A;  2L5Y A;  2EAP A;  4NL9 C;  3KKA A;  2QB0 A;  1UQV A;  2QAR B;  2ES6 A;  3BS7 A;  1B0X A;  3BQ7 A;  1V85 A;  3K1R B;  2EAN A;  5F3X B;  1X66 A;  5J8Y A;  1WWU A;  2KSO B;  3BS5 B;  2KG5 A;  1WWV A;  1UCV A;  4PZN A;  2K60 A;  2KIV A;  2DL0 A;  2LPE A;  5JRT A;  5KNI A;  2DKZ A;  1SXE A;  2ESE A;  1LKY A;  5L1M A;  4PZO A;  1COK A;  1SXD A;  1X9X A;  1V38 A;  4NJ8 A;  4NL9 A;  2QAR A;  1OW5 A;  2E8M A;  1SV0 A;  2F8K A;  1X40 A;  1B4F A;  1SV0 C;  2Y9T A;  5JTI A;  2KE7 A;  3TAD A;  1KW4 A;  3SEN A;  2JV3 A;  2E8N A;  1SGG A;  3KKA C;  2EAM A;  2B6G A;  3HIL A;  3BS5 A;  2FE9 A;  2Y9U A;  2DKX A;  3TAC B;  4RQN A;  2EAO A;  5JU5 A;  3IDW A;  2GLE A;  4RQM A;  2QB0 B;  2K4P A;  2LMR A; 
#chains in the Genus database with same CATH topology
 3TAD C;  3H4B A;  3N7S C;  3JPS A;  4K4I A;  4Q8F A;  4M9L A;  4PL2 A;  7ICQ A;  8ICB A;  3B0Y A;  5KFM A;  3M9M B;  2BCU A;  1X2I A;  4O5C A;  1MC8 A;  2UVW A;  4TUS A;  2H3V A;  5CRX A;  2HHT A;  4B9M A;  2OWO A;  3E0F A;  4BX9 C;  8ICO A;  4UB3 A;  4UAZ A;  3BQ0 A;  4EX6 A;  5KFE A;  8ICC A;  3NTU A;  3WK4 A;  2BDU A;  3AMZ A;  2PI5 A;  4Y2Q A;  4DLG A;  3QUB A;  1UT5 A;  4DOA A;  1D9F A;  3ONN A;  2DKZ A;  3WKC A;  4KLL A;  5KAF U;  2I6X A;  2H3Z A;  4IQU A;  1Z19 A;  4PZO A;  4YMN A;  2K4E A;  1X9X A;  1V38 A;  3AU6 A;  3H0M B;  4KLI A;  3RF9 A;  2HBM A;  2AQ4 A;  2HBK A;  1J2N A;  4IC9 A;  3PX6 A;  1XSP A;  1SL0 A;  2ZIV A;  3V6H A;  4EZ6 A;  3RJG A;  4UW9 A;  2JV3 A;  1L7M A;  4U6P A;  2R8G A;  1L6N A;  1S0M A;  4UB2 A;  2P6U A;  2RHF A;  3BS5 A;  5AKG A;  4UB1 A;  2ZTC A;  3G6X A;  1ZQC A;  3GZF A;  2Y9U A;  4UAY A;  5L9X A;  4OJL A;  4UAV A;  1NJZ A;  3LDA A;  1IV8 A;  5F9L A;  2WFA A;  2HOF A;  7ICO A;  5K4L A;  4DCC A;  4FS2 A;  4DWI A;  8ICN A;  3I76 A;  3AQF A;  1S8O A;  1QSL A;  3TAN A;  4IR1 A;  1TFR A;  4M47 A;  3CRX A;  1B43 A;  2IHN A;  1RYU A;  1K1S A;  1QH9 A;  1RYR A;  2MU2 A;  3TKA A;  3RB0 A;  2ZIU B;  2W7O A;  1TKD A;  2YTU A;  2L5Y A;  3WK7 A;  3O0F A;  2NRV A;  2VA8 A;  1SZP A;  4U7C A;  3ALR A;  4DSL A;  4Y2J A;  4JV1 A;  1A76 A;  4F71 A;  3DEE A;  4I2H A;  3K1Z A;  4P4O A;  2QLT A;  5F3X B;  4HAI A;  5ALX A;  3SYZ A;  1WWV A;  1PVR A;  4TUR A;  4QWD A;  9ICF A;  2VIX A;  4J9N A;  2G06 A;  1F44 A;  1XSN A;  1N61 A;  4QZF A;  3GV8 B;  4F93 B;  1HEK A;  1T7P A;  4DS5 A;  2IOF A;  3C2L A;  9ICM A;  1COK A;  5E79 U;  5AKK A;  3IG8 A;  1FO4 A;  2ZUB A;  3RBD A;  4QIW F;  1KKX A;  3M7D A;  3G6V A;  2CN1 A;  2PI4 A;  2YB1 A;  1FFU A;  4DS4 A;  4I2J A;  3MR5 A;  4J9Q A;  3H8S A;  2C28 A;  1NNL A;  4J9P A;  4DQP A;  5J2G A;  5KT7 A;  4EEL A;  3QU7 A;  4B6J A;  4NLZ A;  2WHE A;  2E8N A;  4ED6 A;  2F76 X;  3OHB A;  2YY6 A;  3ZDB A;  1QLN A;  4NLG A;  2BQR A;  4F2S A;  1HJP A;  1Q46 A;  1X42 A;  2DKX A;  2P35 A;  3HKZ F;  5AI9 A;  4Y2Y A;  5ALH A;  1HIW A;  2UVV A;  4P0Q A;  2G0A A;  5EE1 A;  2WAQ F;  2GLE A;  3ICX A;  2QB0 B;  2LYA A;  4DL5 A;  3M9O B;  4EYI B;  1NJX A;  1NK0 A;  3TFS A;  2G5H B;  7ICL A;  2PFO A;  5AM1 A;  4DSK A;  4IQT A;  4B9L A;  4CE6 A;  3N28 A;  4UB6 U;  2IA6 A;  2V4R A;  5DGB A;  1L8O A;  2W04 A;  2HVI A;  9ICC A;  1S9F A;  3EWA A;  1JRO A;  4IS7 A;  1XSL A;  2A1J B;  2KMD A;  5AM5 A;  4RT3 A;  1IIP A;  5KG0 A;  2ZIX B;  1RXV A;  4PL1 A;  4Q8E A;  5KFU A;  7ICJ A;  4KLH A;  3PW0 A;  2AJQ A;  4I2F A;  3Q8K A;  2KSO B;  1XWL A;  3BZK A;  1NKC A;  1JIH A;  5EWF A;  2A1A A;  4KMO B;  5ALF A;  3MAB A;  1T3N A;  3ISB A;  4I2C A;  5IIK A;  2W8K A;  3QU2 A;  4R65 A;  5KFY A;  4BUG A;  5J2E A;  3I28 A;  1A77 A;  5DDY A;  3LVV A;  4ECW A;  4F4K A;  1QSY A;  5DG8 A;  3OSN A;  4M9G A;  2KK0 A;  5ALU A;  3ORY A;  4FZM A;  3PY8 A;  2Y0S C;  2MA1 A;  1N56 A;  2GOL A;  1N2X A;  4I27 A;  3QYP A;  4QZH A;  4FO6 A;  2Q0Z X;  2J6U A;  2HHU A;  1NK5 A;  1ZQO A;  1SKW A;  2EDU A;  4O3R A;  2EAM A;  3C23 A;  8ICI A;  5KG5 A;  3SQI A;  2ZIW A;  2WF9 A;  3V7K A;  1Z3E B;  2GH1 A;  3PV8 A;  3GIK A;  5III A;  2AU0 A;  1CEZ A;  4UB5 A;  5CWR A;  1RXW A;  4QIW C;  4C8M A;  1S97 A;  8ICG A;  1RM6 C;  3EUB 2;  1MQ2 A;  2RP5 A;  1K1Q A;  5L1K A;  1Z1V A;  3PO5 A;  1NOM A;  4TQS A;  2E1F A;  9ICT A;  1F0M A;  4RQ0 A;  2D3D A;  5J0O A;  2MSN A;  4YVZ A;  2HBL A;  1BNP A;  5ALI A;  1ZQS A;  4DQR A;  4ECY A;  1BVS A;  4A8E A;  8ICS A;  1NJW A;  4KLM A;  2E3T A;  4CCH A;  4F4X A;  1YT3 A;  3V7J A;  3QZ8 A;  3ISC A;  3BS7 A;  4QWA A;  4YD1 A;  3RJI A;  3JPR A;  3K1R B;  5EWE A;  3RH4 A;  4KLG A;  3BS5 B;  4O3Q A;  5GTI U;  1TE2 A;  2DL0 A;  4F5O A;  4QZB A;  5DQI A;  9ICQ A;  3PSF A;  2ESE A;  4YR3 A;  2W7P A;  2AXT U;  3WK9 A;  3PSI A;  5CHG A;  2W03 A;  1ZQ1 C;  1VJ5 A;  1ZOL A;  4CNQ A;  3LWM A;  3GDX A;  5AKL A;  2ZXI A;  4ED1 A;  4DL2 A;  5EE0 A;  2EZY A;  1SV0 C;  2FPM A;  5AK6 A;  8ICJ A;  5J29 A;  4US8 A;  4M6W B;  4NLB A;  3MFI A;  2C2D A;  4M6W A;  5DG9 A;  3NRW A;  1ARO P;  2XCA A;  2W54 A;  1KFS A;  2ZIX A;  3PW5 A;  1Z00 B;  4RT2 A;  2OM6 A;  3ZDA A;  3LVW A;  3V72 A;  1ZQY A;  2NO4 A;  4RQN A;  1NKB A;  4KLU A;  4F72 A;  2HHX A;  2KVS A;  4RQ2 A;  4O3N A;  5KFK A;  2JH1 A;  3V6J A;  4M9J A;  8ICE A;  2XGQ A;  2JXJ A;  2QB1 A;  3ZI4 A;  1U47 A;  3FYH A;  4GXK A;  5ALJ A;  3KZX A;  1SB3 C;  3E58 A;  2ASD A;  4B9V A;  2DWQ A;  2KHV A;  4DEZ A;  4R63 A;  1DXS A;  4DL6 A;  4I2D A;  1SV4 A;  3IHQ B;  4K4G A;  2KZZ A;  4DSF A;  5DLF A;  2DQN B;  1ZQM A;  2NO5 A;  9ICV A;  4ACO A;  8ICW A;  1FIQ A;  3BJY A;  5HR7 A;  1X66 A;  3ZD9 A;  2Q4T A;  1NJY A;  4J9L A;  1RZT A;  5DKW A;  3C5G A;  2G07 A;  2KIV A;  1SIJ A;  4Y2R A;  5C0Y A;  7ICR A;  1L7P A;  1JRP A;  4I2G A;  3AEV A;  3UQ2 A;  4P4P A;  2W9M A;  4C8N A;  1UT8 A;  2HDO A;  4DFD A;  1AQ6 A;  1ZD3 A;  4RPX A;  2KN7 A;  1F5S A;  4AP9 A;  4C7Z A;  5DBA A;  1BPB A;  1QQ6 A;  4EEK A;  2XO7 A;  3SR6 A;  3H8W A;  4X5V A;  1HUO A;  3T5J A;  2C2R A;  5KFR A;  4LZD A;  3EPG A;  7ICK A;  2H3I A;  3WKA A;  3GIL A;  1SKS A;  4OD0 A;  1T8E A;  3PVX A;  2DUY A;  1ZQA A;  2CPR A;  4YP3 A;  4BXO B;  3QXG A;  1NK9 A;  5EE9 A;  4ZOH C;  4FZN A;  3D2N A;  3S6J A;  2JEJ A;  4KN4 A;  2UVR A;  5BOL A;  5HMM A;  3UXN A;  5AI5 A;  2OEH A;  3IG5 A;  5B5E U;  2H3Q A;  1X40 A;  2ZIV B;  1ZYQ A;  4JV2 A;  4M0A A;  2OYY A;  5AK4 A;  4UAU A;  7ICS A;  5AIA A;  4ED7 A;  3MR3 A;  5ALZ A;  1KFT A;  2HI0 A;  1U45 A;  4RU9 A;  4QZI A;  2FLP A;  1TVA A;  2O6K A;  2C2E A;  4C0Z A;  2EAP A;  4J9O A;  4I28 A;  1ED1 A;  3RJK A;  3V7L A;  4FS1 A;  1Y88 A;  2JGA A;  4KLS A;  3BQ7 A;  4QZD A;  4RPZ A;  2MRL A;  5KG7 A;  2KG5 A;  4ECU A;  3CP8 A;  5CR0 A;  2HSZ A;  5J2A A;  3RTV A;  2HHV A;  9ICR A;  2LI6 A;  3BQT A;  4F91 B;  5J2I A;  3HX0 A;  3HRD D;  3SAG A;  3OHA A;  2BQ3 A;  5KFS A;  1OW5 A;  3EPI A;  2PMZ F;  2JZB B;  4CRX A;  1L3V A;  4IRK A;  1QQ5 A;  1SV0 A;  3H8J A;  3UMB A;  4IL6 U;  4HYK A;  1PUZ A;  1S5L U;  2Y9T A;  8ICA A;  4UB8 U;  1QCK A;  1VDV A;  3GIM A;  3Q8M A;  1C7Y A;  9ICO A;  7ICV A;  5GTH U;  4C4R A;  1DRG A;  2ZTD A;  3RH5 A;  4MFF A;  2B6G A;  3LWL A;  1QTM A;  7ICF A;  4ED3 A;  1KQQ A;  1L7N A;  4YMO A;  5KG6 A;  3KZI U;  4CF3 A;  4GXI A;  4F8R A;  5CP2 A;  1LKY B;  5ALO A;  4QZE A;  5IIO A;  4F5N A;  2K8C B;  3QU5 A;  2RQ5 A;  3Q8Q B;  5D46 A;  5ALN A;  9ICU A;  7ICM A;  4OO1 J;  1SKR A;  2F44 A;  2PFN A;  5EOZ A;  2FPK A;  2KKP A;  1URJ A;  1PK1 B;  5IIN A;  4IR9 A;  3QUC A;  4MEX A;  3KHG A;  4KLQ A;  2BGW A;  1JUD A;  3B9J A;  3PNC A;  4RQ8 A;  2F2A B;  3RRH A;  1ZQK A;  1J97 A;  2LPE A;  2JHD A;  4Y2U A;  1ZQH A;  1SXE A;  5AKH A;  1KEJ A;  2DFL A;  1UPH A;  1RYS A;  2WF8 A;  5DQH A;  1SXD A;  5AKJ A;  4NJ8 A;  3J81 j;  4PH5 A;  4UBC A;  4AYB F;  4KLD A;  1KTQ A;  4YR0 A;  4DFJ A;  1ZQL A;  3L5K A;  3GII A;  2MUT B;  2F1I A;  2HVH A;  4QNL A;  2KE7 A;  5KFQ A;  4I2I A;  5H2F U;  1WG8 A;  3HWT A;  5AI0 A;  2Y0S F;  4TUQ A;  3LK9 A;  3WK6 A;  4NXZ A;  5J0P A;  5ALK A;  2KEY A;  2FE9 A;  7ICP A;  4ED8 A;  2W8L A;  4RNM A;  3ZD8 A;  1ZQQ A;  4LVS A;  9ICL A;  1KFD A;  1OUQ A;  3PSP A;  3AQE A;  4G9B A;  5ALY A;  1PZN A;  2DPI A;  3FC4 A;  2HHQ A;  2KOB A;  3A0H U;  4C8O A;  3RH6 A;  5AK3 A;  4RQ1 A;  2JEG A;  2W43 A;  4P0P A;  2XCP A;  4XRH A;  5L1L A;  2K4I A;  5J2F A;  2UVU A;  1CRX A;  1TV9 A;  2AQ0 A;  4Z6E A;  1BPZ A;  4QZC A;  2BPC A;  1UQV A;  3SI8 A;  2KZ3 A;  1V85 A;  1MN8 A;  4G3I A;  4OJ6 A;  4KX3 A;  3AM9 A;  1ZQE A;  5KFF A;  3HP6 A;  3H7I A;  1UA0 A;  2R8I A;  4ED2 A;  1UCV A;  2NRX A;  3JPN A;  4IQV A;  3N97 B;  5JRT A;  1XO0 A;  3GQC A;  1BPX A;  3RR7 A;  4B9S A;  3SZ2 A;  1L7O A;  1WYG A;  1N5X A;  3ETL A;  5DB7 A;  2YN4 A;  9ICI A;  2A3V A;  1NZP A;  5AI4 A;  3OJU A;  3RJH A;  1KL9 A;  3RB3 A;  4YFK A;  3DDH A;  4R8U B;  3MDA A;  5KFJ A;  1J2M A;  4I2B A;  2W11 A;  3UM9 A;  2MAX A;  1ZQX A;  4P4M A;  3H0R B;  3TAD A;  4QWE A;  4UAR A;  8ICL A;  3EW9 A;  3CW2 C;  1L5U A;  4ECQ A;  5EWG A;  2BCQ A;  3HIL A;  1MSW D;  4Y2V A;  4DSI A;  3RJF A;  4WJ3 B;  2YML A;  2LKY A;  3ZDC A;  3QUQ A;  9ICP A;  2A19 A;  5EE3 A;  1ZQD A;  4QW9 A;  2B21 A;  3B0X A;  3I1Y A;  3C1Y A;  1XNS A;  4OCZ A;  3RB6 A;  3NS1 A;  4K4H A;  3D6J A;  3C2M A;  3IP4 B;  3CNH A;  5AM0 A;  2EZX A;  1SL1 A;  9ICS A;  1RQL A;  2JRZ A;  7ICH A;  4YMM A;  2H5X A;  1ZQT A;  4EBC A;  4QZ9 A;  1ECW A;  3SMV A;  3N4M B;  1NZB A;  5AK5 A;  4BWJ A;  3BDP A;  8ICV A;  1U9L A;  2ZUC A;  1NK6 A;  4J9S A;  4ECR A;  2HOQ A;  3LYS A;  5AM4 A;  2ES6 A;  3M8S A;  1ZJN A;  1ZQB A;  3FM9 A;  4O5E A;  1JAL A;  2EAN A;  2AGQ A;  3PML A;  4P0Q B;  5DBC A;  1XS9 D;  2FI1 A;  3M6K A;  5DG7 A;  3NRZ A;  2HBJ A;  1BPE A;  4F4Z A;  4DSE A;  4E0D A;  4M9H A;  3RR8 A;  5KT5 A;  1K5O A;  5ALR A;  1CI4 A;  3Q8L A;  3R9K A;  4DQS A;  4B9T A;  5BOM A;  1S77 D;  2ISP A;  1ZRM A;  7ICN A;  2BPG A;  2E8M A;  8ICY A;  4YD2 A;  1H38 A;  2CRX A;  1WCN A;  8ICQ A;  2PFP A;  2F1H A;  4NM2 A;  5DB6 A;  2IOF K;  3OSP A;  4PGX A;  3T79 A;  5ALQ A;  5JTI A;  5HR6 A;  5JUM A;  4USA A;  4NWI A;  3GV5 B;  5J2D A;  5KFC A;  5AIC A;  2FPL A;  2JEF A;  3KKA C;  1BPD A;  2PKE A;  4MFA A;  9ICA A;  3MGV A;  3PW4 A;  9ICH A;  1ZQG A;  5DB9 A;  3KFU F;  2IMW P;  4KTQ A;  2RRD A;  2R8K A;  1LVH A;  4AYB C;  1N48 A;  2HHS A;  4DF8 A;  5KL1 B;  5J0S A;  4M04 A;  2EZZ A;  3ZDE A;  2F3N A;  4F4Y A;  4DSJ A;  3A0B U;  3IM1 A;  3C2K A;  4KX5 A;  4JK1 A;  5KG3 A;  2K89 A;  4UAT A;  4UB4 A;  2ZTE A;  4DL7 A;  2W9B A;  5J0W A;  4F5Q A;  5J8Y C;  1XO1 A;  2GO7 A;  5G5H A;  5J0Y A;  3KHR A;  3OPX A;  1JX4 A;  4Q43 A;  5HML A;  3L4P A;  3GFK B;  4ECV A;  2Y1I A;  5HHH A;  3Q8S B;  2JEI A;  5KFX A;  4CDG A;  4Z6D A;  4UBB A;  3C1Z A;  5KFD A;  9ICJ A;  3ZDD A;  3PST A;  1FFV A;  2FLN A;  3RAQ A;  2ALZ A;  2KZM A;  3NUQ A;  3HT3 A;  4RNO A;  4KMU A;  2IHM A;  3PX0 A;  1UHU A;  5AIB A;  3VC8 A;  2G08 A;  4QJF B;  1Z00 A;  4ELU A;  2VJ4 A;  7ICI A;  1D8L A;  1BPY A;  5J2K A;  1LB2 B;  4F5P A;  5FP0 A;  2XGP A;  1SL2 A;  8ICM A;  7ICG A;  2DPJ A;  2YMQ A;  4US9 A;  1GO3 F;  1KW4 A;  3WKB A;  2KJ5 A;  1TAU A;  1KN5 A;  1LV5 A;  1SGG A;  4DQI A;  3TAQ A;  4J9M A;  2BCV A;  2AH5 A;  2ZJA A;  4TQR A;  1BNO A;  4JMU A;  2FMS A;  1X9W A;  1S0N A;  4JV0 A;  3RB4 A;  1SZH A;  4PGY A;  2FMQ A;  3QEB Z;  5CJ7 A;  2RLT A;  4XUS A;  4QWC A;  2XI9 A;  2NYV A;  1PK1 A;  1KDH A;  2ZXH A;  4C7Y A;  4C8L A;  4NV0 A;  2E8P A;  2D8C A;  2OH2 A;  4EYH B;  1D9D A;  2ZUD A;  1DK3 A;  4RQ3 A;  4EBD A;  3TI0 A;  1X6J A;  3QU9 A;  7ICE A;  2F1J A;  4DL4 A;  4YXM A;  4PHA A;  4JUZ A;  2KIW A;  2KFN A;  1TK0 A;  4P2H A;  4KLE A;  5D4B A;  1KRP A;  3ISD A;  4F2R A;  4RQ4 A;  2LYH A;  3SAF A;  2P66 A;  3MFH A;  1VLB A;  5KTQ A;  2DF4 B;  2LM4 A;  5J0R A;  4BWM A;  3WKE A;  5J0U A;  2WB1 C;  3T5H A;  5B66 U;  3H0L B;  3RAX A;  1KLN A;  8ICH A;  3UMG A;  3H4D A;  3AN1 A;  3TFR A;  1NK7 A;  1TAM A;  1M6Y A;  5KG4 A;  4NM1 A;  4XQ8 A;  5D49 A;  2R8H A;  3QEA Z;  4DFM A;  4KLO A;  1NKE A;  2JR5 A;  3SEN A;  4F4W A;  1S76 D;  4EEN A;  4DQQ A;  2HHW A;  3RJJ A;  1Z4N A;  4KLJ A;  4JWM A;  1BGX T;  1NI3 A;  1SWV A;  5ALG A;  3EYZ A;  2XID A;  3GU3 A;  4GIB A;  3TAR A;  4J03 A;  3IDW A;  4ELT A;  1T3Q A;  4KN7 A;  4QZ8 A;  2VA2 A;  3NAS A;  5KT2 A;  4NLK A;  4BDP A;  3H8M A;  4ZH4 A;  4J9R A;  3MGH A;  2J6S A;  2KSO A;  2CXY A;  5ALL A;  3NVY A;  3GIJ A;  4RQ6 A;  2QKQ A;  3HW8 A;  5DLG A;  3E2E A;  3JPO A;  2K8A A;  2KV2 A;  2XY5 A;  2GWS A;  1SWW A;  2FJ6 A;  3KKA A;  8ICP A;  1N5W A;  5C5J A;  2OXO A;  1A0P A;  3RJE A;  3FDS A;  1B0X A;  4ELV A;  4OJ5 A;  1T4G A;  3KOO A;  4O5K A;  3KD3 A;  4CGZ A;  1U48 A;  2ZIU A;  3N7R C;  3GV7 B;  3RRG A;  3RFA A;  1ZQU A;  4QW8 A;  5KFH A;  4MF8 A;  9ICW A;  2KJ9 A;  2HOI A;  4IRD A;  3TQ1 A;  2XVT A;  3AU2 A;  4NLN A;  1LKY A;  1IXR A;  2OHF A;  3UXO A;  4QZG A;  3KBB A;  5L1M A;  4DFP A;  3HPO A;  2I9G A;  9ICN A;  4I2A A;  2XIC A;  4NL9 A;  4Y2P A;  5KFZ A;  2ZIW B;  1TK8 A;  1S0O A;  5IIM A;  1S0V A;  2F8K A;  3MDC A;  1Z4O A;  3BQ1 A;  4IRC A;  4Q45 A;  3T3F A;  5HHI A;  1JXE A;  5DGA A;  2RDI A;  1IG6 A;  4M9N A;  5J0Q A;  4EBE A;  3KTQ A;  1ZRN A;  9ICB A;  3PW2 A;  3M1Y A;  2XC9 A;  4YQW A;  1JMS A;  4CF4 A;  4F3O A;  3NVV A;  2YMP A;  5JU5 A;  2WB1 F;  3RBE A;  3C21 A;  3F5A A;  4FBU A;  7ICT A;  4UAS A;  2LMR A;  1YZ7 A;  2G5I B;  3Q8P B;  5KFV A;  3NGD A;  2ASJ A;  4CF5 A;  4O9M A;  4FE3 A;  3F53 A;  2AHO B;  8ICR A;  2I1Q A;  2MUT A;  3SEI A;  4MFC A;  4P0P B;  2E1E A;  5L1I A;  4KLT A;  1ZQP A;  4TUP A;  2BR0 A;  3AL0 B;  1L8L A;  4JB3 A;  2AGO A;  3H40 A;  2WTF A;  4NL9 C;  4YR2 A;  2VA3 A;  1RPL A;  4UQG A;  3SD7 A;  2QAR B;  3C28 A;  1ZD5 A;  3D2S A;  3IN5 A;  3VCB A;  2KD1 A;  5J8Y A;  1WWU A;  2HMX A;  2YQE A;  5KFB A;  1ZQW A;  2WF6 A;  3KHL A;  2DGZ A;  5TIS U;  1QQ7 A;  4FZL A;  2WF7 A;  2ISO A;  5J2B A;  5IIL A;  3PR5 B;  2V9W A;  2LHT A;  5ALS A;  2QAR A;  2W3S A;  3WKD A;  5AKE A;  2WF5 A;  5J2C A;  5T14 A;  1PVQ A;  2FLL A;  5J0T A;  1NK4 A;  4I29 A;  1TK5 A;  1O03 A;  1ZQZ A;  4ECS A;  3F2D A;  1ZJM A;  4LZG A;  2M0N A;  3F2B A;  4GC7 A;  5KT6 A;  3G6Y A;  1DOQ A;  3Q8R B;  3PR4 A;  5L1J A;  1P7D A;  3T5L A;  5AM3 A;  1RDF A;  1ZQI A;  2HW3 A;  1ZQF A;  8ICU A;  1WCL A;  3ED5 A;  2OCE A;  2F77 X;  3SAH A;  5KFG A;  4YN4 A;  2WAQ C;  1ZD2 P;  4RQ5 A;  4Y2S A;  5KFA A;  3TAC B;  1L3U A;  4OJO A;  2EAO A;  2ZG6 A;  4EZ9 A;  3BQ2 A;  3WK5 A;  1V9P A;  5AKY A;  2XY6 A;  2K4P A;  2D6F C;  2LM1 A;  1ZQJ A;  2BCS A;  1EXN A;  2VKQ A;  5KFP A;  1RG6 A;  4RPY A;  3ETR A;  2JMG A;  3SV4 A;  1MA7 A;  4PHD A;  4I2E A;  4DOC A;  4Y2X A;  4GC6 A;  9ICG A;  4JWN A;  2A1J A;  4B9U A;  3NVW A;  5J2J A;  4MEY A;  2V4Q A;  4DO9 A;  2ZJ5 A;  4EX7 A;  4YXJ A;  5AM2 A;  1D8Y A;  2FDR A;  2QB0 A;  5IIJ A;  4RNN A;  3JPQ A;  4NLC A;  5AHX A;  4ED0 A;  1L3T A;  4PPX A;  4DF4 A;  1XU4 A;  1RQN A;  4O3O A;  2ODG A;  5DB8 A;  3UQ0 A;  4O3P A;  1HUZ A;  5J2H A;  7ICU A;  1S10 A;  4YCX A;  5KFO A;  4YG2 A;  4RUA A;  4ICA A;  4ECX A;  2KHQ A;  2VAN A;  9ICX A;  4C4T A;  4Y2T A;  1COO A;  8ICZ A;  1X6I A;  2ASL A;  2K4H A;  5AI8 A;  4XA5 A;  2G09 A;  1N62 A;  1PVP A;  5KFW A;  5ALP A;  3MR2 A;  4BXO A;  3PO4 A;  3AUO A;  5G5G A;  4M2Y A;  4Q44 A;  4MF2 A;  2XY7 A;  1DK2 A;  2NRW A;  2ZJ8 A;  1Q3V A;  4FFD A;  8ICT A;  5KT4 A;  3U26 A;  3KHH A;  3HKZ C;  2M9N A;  1UA1 A;  5AKI A;  3OJS A;  1YZ6 A;  4C8K A;  2YX8 A;  5HNK A;  3QE9 Y;  4C80 A;  3MGI A;  4F92 B;  2HCF A;  2YB4 A;  4OJP A;  2W9C A;  5F9N A;  1U49 A;  4MHV A;  3UXP A;  4R8U A;  1Z1B A;  3QUT A;  2VJ5 A;  2BZF A;  4QWB A;  3D2Q A;  4O3M A;  2E8O A;  5ALV A;  5CB1 A;  3FAH A;  2I5H A;  3CYM A;  2EH9 A;  5ALE A;  5AKX A;  3TAP A;  1L3S A;  2K8B B;  2PMZ C;  2W3R A;  4DLE A;  8ICK A;  1C20 A;  3DV9 A;  2K60 A;  1NK8 A;  3JPT A;  4B9N A;  4EEY A;  3QX7 A;  1N60 A;  3C29 A;  2PXI A;  5BPC A;  3C5F A;  1WUD A;  3K75 D;  1KSP A;  2P6R A;  1X9M A;  2W55 A;  5KFL A;  1A6S A;  3F2C A;  3QZ7 A;  2BKE A;  4R66 A;  2IBK A;  1O08 A;  4LJX A;  1T94 A;  4RQ7 A;  3SV3 A;  2AGP A;  3NVZ A;  4O0I A;  5ALW A;  5KFN A;  4RUC A;  4F5R A;  2Z7J A;  5CA7 A;  4ECT A;  1X9S A;  2W9C B;  2J6T A;  5ALM A;  1Q8K A;  5KG2 A;  1N63 A;  5ALD A;  1U4B A;  3PZP A;  4DFK A;  4PHP A;  1TAQ A;  2ATL A;  3HJE A;  4Z6F A;  2IOH A;  4Z6C A;  4GXJ A;  2R18 A;  4QZA A;  2BQU A;  4RQM A;  2RDJ A;  4KLF A;  4PZN A;  2B0C A;  5HP4 A;  2E5S A;  3EZ5 A;  4KIT B;  2JH7 A;  3F5E A;  2BCR A;  3L3F X;  2C22 A;  5KT3 A;  1ZQN A;  1CUK A;  2LYB A;  2KVC A;  3K4G A;  4O3S A;  3N7P D;  2NRT A;  4J9K A;  1ZD4 A;  1D8B A;  1OXJ A;  3UMC A;  5DDM A;  1PK3 A;  8ICX A;  4DL3 A;  4F50 A;  1ZET A;  1JI7 A;  9ICK A;  2LBO A;  4NY8 A;  5KFI A;  3MR6 A;  4R64 A;  1JN3 A;  4DOB A;  3OGU A;  3PMN A;  5DQG A;  1JXL A;  2BHN A;  3PX4 A;  3UPQ A;  4GFJ A;  9ICE A;  2JZB A;  2KP7 A;  2NV3 A;  3THV A;  1QSS A;  3T5K A;  2EQY A;  1XC9 A;  2W9A A;  4PGQ A;  5KNI A;  5A0L A;  4PHE A;  3OTQ A;  5TZV A;  3QU4 A;  2BPF A;  2BDP A;  3WK8 A;  2KTQ A;  3QNM A;  5AKZ A;  4BJQ A;  4PJ0 U;  2PFQ A;  3M8R A;  5KAI U;  3M9N B;  3V6K A;  3BZC A;  5J0X A;  4ECZ A;  4UAW A;  2FMP A;  2KJ8 A;  1Q3U A;  3JPP A;  1B4F A;  2KNJ A;  3WU2 U;  1IM4 A;  1DGJ A;  1KBU A;  2W9B B;  5KL8 B;  5KFT A;  1B22 A;  2YMM A;  4C4S A;  3MC1 A;  4BGD A;  3MBY A;  2KKV A;  2KFZ A;  2H3F A;  5KG1 A;  4FBT A;  3M6Z A;  8ICF A;  4GLX A;  1FEZ A;  1ZQV A;  4RZR A;  1ZQR A;  3IV6 A;  2N1R A;  1DGS A;  1V97 A;  3PW7 A;  2KIC A;  1ZXI A;  5AI6 A;  2NRZ A;  5ALT A;  5DBB A;  4IQW A;  2F8L A;  5CEH A;  1MQ3 A;  2R8J A;  3IRU A;  2Y1J A;  2DBY A; 
#chains in the Genus database with same CATH homology
 1LKY B;  3H8M A;  1Z1V A;  2QB1 A;  1RG6 A;  4MHV A;  3TAD C;  1F0M A;  2F3N A;  2D3D A;  2KSO A;  3SEI A;  2F44 A;  2QKQ A;  1PK1 A;  1OXJ A;  1DXS A;  1PK1 B;  1PK3 A;  1SV4 A;  2E8P A;  2D8C A;  2YTU A;  4IS7 A;  5J8Y C;  2KMD A;  2E8O A;  1JI7 A;  2L5Y A;  2EAP A;  4NL9 C;  3KKA A;  2QB0 A;  1UQV A;  2QAR B;  2ES6 A;  3BS7 A;  1B0X A;  3BQ7 A;  1V85 A;  3K1R B;  2EAN A;  5F3X B;  1X66 A;  5J8Y A;  1WWU A;  2KSO B;  3BS5 B;  2KG5 A;  1WWV A;  1UCV A;  4PZN A;  2K60 A;  2KIV A;  2DL0 A;  2LPE A;  5JRT A;  5KNI A;  2DKZ A;  1SXE A;  2ESE A;  1LKY A;  5L1M A;  4PZO A;  1COK A;  1SXD A;  1X9X A;  1V38 A;  4NJ8 A;  4NL9 A;  2QAR A;  1OW5 A;  2E8M A;  1SV0 A;  2F8K A;  1X40 A;  1B4F A;  1SV0 C;  2Y9T A;  5JTI A;  2KE7 A;  3TAD A;  1KW4 A;  3SEN A;  2JV3 A;  2E8N A;  1SGG A;  3KKA C;  2EAM A;  2B6G A;  3HIL A;  3BS5 A;  2FE9 A;  2Y9U A;  2DKX A;  3TAC B;  4RQN A;  2EAO A;  5JU5 A;  3IDW A;  2GLE A;  4RQM A;  2QB0 B;  2K4P A;  2LMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...