5F46A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample, apoenzyme form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f46A00
3RYOA 1MJ9A 2BL1A 2ATRA 4H89A 4JD6A 4CAWA 1Y9WA 2R98A 4CRYB 2P0WA 1K4JA 3ZZIA 1GHEA 1CM0A 4B5PB 4MI4A 4GS4A 4AB7A 4YFJA 1P0HA 4R3KA 3GYAA 3N7ZA 4M85A 1M4IA 4DNCA 3D3SA 5J8CA 1CJWA 2FCKA 3BLNA 1SQHA 2Z0ZA 2R1IA 2Z10A 3PZJA 1Q2DA 3F5BA 1M4GA 1M1DA 1BOBA 1WWZA 2ZW5A 3EFAA 5EBVA 4LUAA 1BO4A 3C26A 3S6GA 2K5TA 3KKWA 3H4QA 3P2HA 3S6HA 2FL4A 4JXQA 2EUIA 2BSWA 2ZW7A 4YRHA 4KVXA 4QVTA 2PRBA 3TCVA 2FE7A 1YK3A 4KOUA 1XE4A 4JJXA 1KZFA 2B4DB 4X5KA 5DWNA 3DDDA 3DNSA 5J8FA 2VZYA 4MJ8A 1XEBA 2AE6A 4FD5A 1XF8A 1QSOA 4E8OA 3W6XA 4B5PA 1Z4RA 1YVKA 4IUSA 1MJBA 4F0YA 5I0CA 4FD6A 4PK3A 4ONUA 3S6FA 5CNPA 4LX9A 1KUXA 3E0KA 4KLVA 1RO5A 2CNSA 3D2PA 3LD2A 3B8GA 4NSQA 4E0AA 3QAHA 3T90A 4B5OA 3TFYA 1I12A 3R9GA 4XNHB 1L0CA 3TOAA 4H6UA 4EVYA 2OZUA 1XMTA 1NMTA 5ISVA 2R8VA 3MGDA 4AG7A 4JLYA 3JUWA 2I79A 2B4DA 1Q2CA 2VI7A 2NMTA 3FB3A 1I21A 2B5GB 4KLWA 1NSLA 2BEIA 4XPDB 4IF5A 4JWPA 1OZPA 5H86A 4RS2A 4KOVA 2C27A 2H5MA 3R96A 2B58A 1QSTA 2FIWA 1WK4A 5IX3A 2EVNA 3D8PA 3F8KA 4H6ZA 1IIDA 1PU9A 3R9EA 4R87A 2I00A 4MY0A 4AVCA 3VWDA 2O28A 4R57A 4R9MA 4F6AA 3TE4A 3UY5A 2J8RA 2FSRA 4AVBA 2R7HA 1N71A 1TIQA 3IWGA 1P4NA 2PC1A 3BJ7A 2F5IA 2FT0A 4PV6A 4JXRA 1XIXA 1Y7RA 2PDOA 1QSMA 3IGRA 2Y0MA 4HNWB 2FS5A 4L89A 5HMNA 3FNCA 4II9A 2RC4A 4MBUA 2DXQA 5IB0A 3FBUA 3TOBA 3R1KA 4NEXA 2PR1A 4ZBGA 2OU2A 4U5YA 4UBRA 5GCNA 2OH1A 2JDDA 3JVNA 2REFA 1NE9A 4BMHA 2OZGA 3GY9A 1IB1E 3TO6A 4QBJA 3T9YA 1J4JA 4QC6A 3EXNA 1S60A 2JLMA 4XPLA 2Z11A 3FYNA 5F46A 4KVME 2GIVA 3I3GA 3EC4A 5EC4A 2REEA 3WR7A 2G3AA 1S7LA 3PP9A 2A4NA 2PR8A 2GE3A 1M44A 1YR0A 2IL4A 2Q0YA 3NE7A 1Z9UA 5C88A 1V0CA 2D4OA 2VBQA 5F49A 4QB9A 4R3LA 4OAEA 3TO7A 2B4BA 4KOSA 1QSNA 2J8MA 3W6SA 4CAXA 2ZXVA 1FY7A 4KOWA 5KTCA 4NF1A 3LODA 1Q2YA 1YX0A 1QSRA 3DR8A 1IYLA 1ON0A 4FD4A 2HQYA 2VZZA 3CXSA 3I9SA 4QUSA 3OWCA 4UWIA 1YLEA 4ORFA 2G0BA 3VWEA 4J3GA 5C82A 3DR6A 1S3ZA 4HKFA 2Q4YA 4UA3A 2P6EA 3FRMA 2HUZA 3S6KA 3GKRA 1Y9KA 4KZTA 4XNHC 4XPKA 4E2AA 1S5KA 2Q4VA 1MK4A 2JDCA 1S7NA 4OLLA 3SHPA 3R95A 5IV0A 1R57A 1I1DA 2FXFA 1B6BA 2ZPAA 2CY2A 3DSBA 2X7BA 4L8AA 2P6GA 3CXPA 3FXTA 2QIRA 4XPDC 1B87A 2P6FA 4CRZB 4NXYA 2B5GA 3V8IA 5HH1A 4PSXA 1S7FA 5F47A 3ZJ0A 4U9ZA 4KUBA 3G3SA 1Z4EA 4RI1A 3F0AA 3W91A 3FIXA 4HNXB 2VXKA 3TO9A 2OB0A 4KOTA 3G8WA 1IICA 4MHDA 1KUVA 5FVJA 1YVOA 3PGPA 2PSWA 4Y49B 2CNTA 3TTHA 2ZW6A 4KOXA 4K30A 4HNYB 4PSWA 4UWJA 2AJ6A 3SXNA 5F48A 4NCZA 1VHSA 4KUAA 2KCWA 2VQYA 3EO4A 5E96A 4PK2A 2OZHA 2QMLA 5JQ4A 3R9FA 2G3TA 2ZW4A 4I49A 2D4PA 3EY5A 5KTAA 5JPHA 3BJ8A 3SXOA 2J8NA 4OADA 2WPWA 1U6MA 2PQ8A 4CS0B 5KTDA 1KUYA 2VEZA 4KVOE 3CXQA 2B3UA 3TT2A 4MY3A 2FIAA 1RXTA 4FD7A 1UFHA 3QB8A 1LRZA 2Q44A 1IYKA 4KOYA 2JEVA 2WPXA 4AVAA 4Y49C 1S7KA 2HV2A 2CNMA 4M3SA 1PUAA 5H84A 2QECA 4U9YA 2ARHA 3P2FA 2GANA 4CAVA 2Q04A 2BUEA 1MJAA 4YGOA 5DWMA 1VKCA 1YGHA 3D2MA 3K9UA 4AG9A 2B3VA 1M4DA 4KORA 2Q7BA 1YREA
chains in the Genus database with same CATH superfamily
4ZX9A 3RYOA 2ZEMA 3BHXA 4PXDA 5LYDA 4NGQA 3PBBA 4CGMA 2ZOFA 1BLLE 1ARMA 1MJ9A 4B13A 1YQEA 2BL1A 3B3VA 3FH4A 2ATRA 5LYIA 5K8OA 2OR4A 4H89A 3CPXA 2O53A 1IOFA 4JD6A 4CAWA 1Y9WA 2R98A 4WWVA 4CRYB 4ZY0A 2P0WA 4F9VA 7CPAA 1K4JA 5A27A 3ZZIA 1GHEA 1CM0A 3S9LA 3KHXA 3PFEA 4B5PB 4MI4A 4GS4A 4AB7A 4YFJA 4IHMA 1P0HA 4R3KA 3GYAA 3N7ZA 1Q7LA 4M85A 3B7IA 1Y0RA 4GM5A 1M4IA 2OOTA 4DNCA 3D3SA 5J8CA 2F8HA 2GLFA 1CJWA 2FCKA 3BLNA 1SQHA 2Z0ZA 2R1IA 2Z10A 3PB7X 1Q2DA 1R43A 3F5BA 1M4GA 3PZJA 3TC8A 4CGLA 4ZI6A 2EK9A 1M1DA 1BOBA 1WWZA 2ZW5A 3EFAA 4C2ZA 3FEDA 5EBVA 4LUAA 1Z5RA 2XEJA 3DGVA 3S9MA 2YNDA 2CIJA 5J1QA 3ISZA 1BO4A 4KSFA 1ZLIA 3C26A 2PJ8A 4MFJA 3S6GA 2K5TA 3KKWA 3H4QA 4MFLA 2WZNA 4OC2A 3P2HA 4FWUA 1ZG9A 2PVVA 3S6HA 3V7ZA 2FL4A 4JXQA 1M4LA 2EUIA 2Q51A 3IWEA 4IK2A 4P10A 4YU9A 2BSWA 2ZW7A 4YRHA 4KVXA 3N5FA 2Z3LA 2YGWA 2GU2A 4QVTA 4A2ZA 4CYQA 5LYFA 3PEIA 3RBUA 4CGNA 2PRBA 3D68A 3ISXA 1LOKA 3KQXA 2PJ0A 2FE7A 3NFZA 3TCVA 4B10A 1YK3A 4KOUA 4UEZA 4TWEA 1XE4A 3D66A 2ZEFA 4JJXA 6CPAA 1KZFA 2B4DB 4R6TA 4X5KA 4A94A 2EBJA 2PJ3A 1LAPA 5DWNA 2ZEGA 2F7VA 3DDDA 2V8GA 3DNSA 4MXUA 4OC0A 4OMEA 4B11A 5J8FA 1FNOA 2PJ2A 2VZYA 4MJ8A 1XEBA 4YWYA 2AE6A 4FD5A 1XF8A 1QSOA 3WC7A 4E8OA 3W6XA 2RFHA 4B5PA 1Z4RA 4A32A 2C6GA 1YVKA 4K3NA 4IUSA 1MJBA 1TKFA 4F0YA 5I0CA 3IJ3A 3SI2A 4FD6A 4PK3A 4ONUA 3S6FA 5CNPA 1NSAA 3RNZA 2BOAA 2NSMA 3FJUA 4NGSA 5HXDA 3WC6A 4LX9A 1KUXA 4MFQA 3SJEA 3E0KA 4KLVA 4UCMA 3IIBA 1RO5A 2CNSA 4ZX8A 2CTCA 4UEEA 3D2PA 5EMIA 3WC5A 1TKHA 4PQAA 3LD2A 3B8GA 4NSQA 4E0AA 3QAHA 5CBMA 3T90A 3KGQA 4B5OA 3TFYA 2C6PA 2BCOA 3PBEA 4IAVA 1I12A 4P4DA 4R8FA 4UCNA 3KQZA 2AFXA 2NYQA 1JQGA 4F9UA 3R9GA 4XNHB 1L0CA 3HUVA 4WJBA 1CX8A 2PVWA 3JTKA 3TOAA 4H6UA 2ODFA 4EWTA 4EVYA 2PJBA 3DLJA 2OZUA 1DTDA 1XMTA 1YW6A 1NMTA 5ISVA 4P4EA 2R8VA 3B3CA 3MGDA 3BI0A 4OKOA 4AG7A 4F8ZA 1UWYA 4JLYA 3JUWA 2I79A 2B4DA 1Q2CA 2VI7A 2NMTA 5DS0A 4CAFA 1XMBA 1FT7A 3FB3A 4B6ZA 1I21A 2B5GB 4KLWA 4KSAA 1KWMA 3FEEA 1NSLA 2BEIA 2BO9A 4EMEA 3QNVA 3V38A 1XOVA 3LMSA 4CYPA 4XPDB 4IF5A 4JWPA 1X12A 1OZPA 5H86A 4RS2A 2ZEPA 4PXEA 4ONWA 2Z3KA 4KOVA 2C27A 4B14A 2H5MA 2AFSA 2AFZA 3R96A 2B58A 4A33A 1QSTA 4FAIA 2V8DA 2FIWA 2Z3OA 4NGPA 1WK4A 4GXHA 5IX3A 2EVNA 3D8PA 3PB9X 1IU8A 3F8KA 3PB4X 1IIDA 1PU9A 1BPNA 2RB7A 4H6ZA 1LANA 3R9EA 4R87A 2I00A 3VARA 5G22A 4MY0A 4AVCA 3VWDA 3GB0A 4M6IA 2O28A 3D67A 1ELLP 4MFZA 4R57A 4R9MA 4ZGYB 2HB6A 3KI9A 4C7HA 4F6AA 3TE4A 3UY5A 4A95A 2J8RA 2FSRA 2XEGA 4ZY1A 4AVBA 4FUUA 4X8IA 2R7HA 1N71A 3H5ZA 1TIQA 3KR4A 2QJ8A 4UIBA 3IWGA 1JWQA 1P4NA 3B3SA 2PRQA 2PJ1A 3SJXA 2PC1A 3BJ7A 3HLPA 2V77A 4NGNA 2DEAA 2CF4A 3NE8A 3PB6X 1QQ9A 2F5IA 4MCQA 1CP6A 2FT0A 2PIYA 3L2NA 4JXRA 1XIXA 4PV6A 1Y7RA 2PDOA 3GIUA 1QSMA 3IGRA 2AFUA 4MCPA 2DF5A 4W9YA 2Y0MA 3MRUA 2WYRA 4HNWB 2FS5A 4L89A 4AXVA 3LACA 5HMNA 1TF8A 3FNCA 1F2PA 2ZENA 1XFOA 4RN7A 4UEFA 2WUUA 4II9A 2RC4A 4MBUA 4P4FA 1LCPA 4BINA 4G1PA 2DXQA 4MRIA 1CBXA 4MCRA 3GUXA 3NH5A 4Q38A 1VIXA 3BI1A 3FBUA 4BD9A 5IB0A 3TOBA 3R1KA 4DUKA 4NEXA 2PR1A 1IY7A 4OC4A 4ZBGA 5JM6A 4P6YA 3RAMA 2OU2A 2GLJA 4U5YA 4UBRA 2OH1A 2JDDA 3JVNA 1ZLHA 2PJAA 3NH4A 2REFA 1XRYA 4HPSA 4CGPA 1Z8LA 5HVFA 3H8GA 4OP4A 2EK8A 3WT4A 1NE9A 1YW4A 1CPXA 5CPAA 4BMHA 2OZGA 3IC1A 4BBHA 3GY9A 3RO0A 4LQ6A 1IB1E 4KSIA 4PXBA 3TO6A 2PIZA 4QBJA 3T9YA 1J4JA 4QC6A 2AFMA 5AGEA 3EXNA 4CAEA 1S60A 2JLMA 4NGRA 4XPLA 3B3TA 2YNCC 3NA6A 1A2ZA 2Z11A 3FYNA 2POKA 5LRKA 4MMOA 5F46A 4KVME 4JZ0A 1ELMP 2GIVA 1VGYA 3I3GA 1HDUA 5AG4A 3EC4A 5EC4A 2REEA 3WR7A 2G3AA 2YNCA 1S7LA 3PP9A 4KS9A 5IB9A 2A4NA 2PR8A 5LRJA 2GE3A 4R7MA 3WABA 1M44A 1YR0A 2IL4A 2JBKA 2Q0YA 3NE7A 1Z9UA 3FECA 2EO8A 2AFWA 4A30A 3IFEA 5C88A 1V0CA 2YNEA 2D4OA 4F0XA 2VBQA 5AG6A 3B35A 3A9LA 3TX8A 5F49A 4P44A 4C2YA 4QB9A 2IMOA 4R3LA 4UFVA 3IEHA 4OAEA 4UF4A 3TO7A 1CG2A 2B4BA 3FX6A 2G9DA 4KOSA 1QSNA 2J8MA 3PRTA 3W6SA 2IJZA 1Z8XA 4CAXA 4OIDA 2ZXVA 1FY7A 4MHPA 4KOWA 5KTCA 4NF1A 4NJQA 1TF9A 2AFOA 3LODA 1Q2YA 3QAYA 1YX0A 3FF3A 1QSRA 3DR8A 5A28A 1IYLA 3FVLA 1ON0A 4FD4A 2HQYA 2VZZA 3CXSA 2ANPA 3I9SA 5THWA 2PE3A 4QUSA 4UFWA 3OWCA 4P4JA 4C2XA 2ZOGA 4NJRA 4UWIA 1YLEA 4ORFA 2G0BA 1BAVA 1EE3P 3VWEA 1Y0YA 2QVPA 5GCNA 4MHNA 4J3GA 1TXRA 3D7FA 4M6GA 5G1ZA 4CPAA 5C82A 4NGMA 3DR6A 3NH8A 1S3ZA 4HKFA 2Q4YA 4UA3A 3B2YA 2P6EA 3H8EA 3FRMA 4MFKA 2HUZA 3S6KA 1OBRA 4NGTA 3GKRA 4DYOA 1Y9KA 3KASA 4KZTA 4LQGA 1RTQA 4XNHC 4O23A 4XPKA 1ZO0A 3SJFA 4E2AA 4R76A 1S5KA 2Q4VA 3K9TA 1MK4A 1VHEA 2JDCA 1S7NA 2EWBA 4OLLA 2Q7SA 3CDXA 4X3RA 1PCAA 3SHPA 3PB8X 3IU1A 3R95A 2ZEDA 5JH9A 4C7IA 5IV0A 3KR5A 1R57A 1I1DA 3D4UA 1H8LA 1B6BA 2FXFA 2HC9A 2ZELA 2ZPAA 2CY2A 3DSBA 3CPAA 2X7BA 4L8AA 2ZEOA 1YMEA 1XJOA 2ZEHA 2I3CA 4MHYA 2P6GA 3CXPA 3FXTA 5K8PA 1R3NA 2QIRA 4A39A 3I1UA 4XPDC 5BWAB 4OC1A 1B87A 3KZWA 2P6FA 3KHZA 2ZEEA 1LFWA 2PJ7A 4B12A 4CRZB 3VH9A 3B3WA 3GLJA 4NXYA 2ABZA 2B5GA 2C6CA 3H8FA 4A37A 1F2OA 3V8IA 1XBUA 2Z3PA 2PJ4A 4PSXA 5HH1A 1Z2LA 1IOIA 2PJ9A 1S7FA 5F47A 1AUGA 2WSAA 3ZJ0A 4U9ZA 4KUBA 3G3SA 2CTBA 1AMPA 4P45A 1Z4EA 2Z3NA 4RI1A 3F0AA 2Z3MA 3SI1A 2GREA 3W91A 4C68A 3FIXA 1LAMA 5HVHA 8CPAA 1ZG8A 3CZXA 4CYOA 5D29A 4HNXB 2VXKA 2V8VA 1ARLA 3TO9A 2OB0A 4KOTA 1F57A 5K8NA 3G8WA 3S9NA 1IICA 4MHDA 1KUVA 5FVJA 1YVOA 3PGPA 2PSWA 2PCUA 1YLOA 4Y49B 4RUHA 1BPMA 4A38A 3KL9A 2CNTA 1QMUA 3FMCA 3RZAA 3TTHA 2ZW6A 2QYVA 4KOXA 3PFOA 4K30A 4HNYB 4X2TA 2Q4ZA 4PSWA 4TNUA 3T8WA 4UWJA 2XEFA 4DJLA 2PJ6A 3IU2A 4FBEA 2AJ6A 3SXNA 3IWWA 4NCZA 5F48A 4Q7AA 1VHSA 1PYTB 2C1CA 4PPZA 4KUAA 2KCWA 2VQYA 3VATA 3EO4A 5E96A 2JBJA 4MCSA 4PK2A 2OZHA 1HDQA 1Y7EA 2VL1A 4JYWA 2QMLA 5D8NA 3SJGA 3R9FA 4EFDA 5JQ4A 1GYTA 3LWUA 4ZYQA 2G3TA 2ZW4A 4I49A 5G20A 4UCPA 2D4PA 3EY5A 3MN8A 3D7HA 3D7GA 5JPHA 3BJ8A 5KTAA 3SXOA 3JRUA 4PXCA 2J8NA 4OADA 1VHOA 2WPWA 5JGFA 1U6MA 2FVGA 4OC5A 5AG7A 2PQ8A 4CS0B 5KTDA 2V8HA 1KUYA 4P4BA 2PJ5A 2VEZA 5AG5A 4Z65A 4MFPA 4KVOE 1TKJA 3CXQA 2B3UA 1CPSA 3TT2A 5I4MA 1ZG7A 4MY3A 4OC3A 2FIAA 1RXTA 1Z8WA 4FD7A 1UFHA 2J9AA 3QB8A 1LRZA 2Q44A 1IYKA 4UIAA 2Q43A 4P4IA 5F09A 2Q7BA 3BXMA 2GFQA 4KOYA 2JEVA 5HVGA 2WPXA 4AVAA 1Z8TA 2XEIA 3CT9A 3D7DA 4Y49C 1S7KA 2O4HA 5ELYA 4ZY2A 2HV2A 1YSJA 2CNMA 1PUAA 4M3SA 5LRGA 3K2KA 4UFXA 1CP7A 3IO1A 4Q36A 2JEWA 5H84A 2QECA 3SI0A 4U9YA 4A31A 2DPTA 4CYNA 5LYLA 2ARHA 1AYEA 5G21A 4CGOA 5K8MA 3P2FA 4MHZA 2GANA 4CAVA 2Q04A 1HEEA 2BUEA 1MJAA 4YGOA 1DE4C 4OIWA 5DWMA 2CXAA 1VKCA 1YGHA 3D2MA 3K9UA 2PJCA 4AG9A 1X10A 2B3VA 2DPSA 4H2KA 2IQ6A 4M6HA 1M4DA 4KORA 4NFRA 1IGBA 1YREA
chains in the Genus database with same CATH topology
3RYOA 4CGMA 1MJ9A 4B13A 2BL1A 2ATRA 4H89A 4JD6A 4CAWA 1Y9WA 2R98A 4CRYB 2P0WA 1K4JA 5A27A 3ZZIA 1GHEA 1CM0A 4B5PB 4MI4A 4GS4A 4AB7A 4YFJA 1P0HA 4R3KA 3GYAA 3N7ZA 4M85A 1M4IA 4DNCA 3D3SA 5J8CA 1CJWA 2FCKA 3BLNA 1SQHA 2Z0ZA 2R1IA 2Z10A 3PZJA 1Q2DA 3F5BA 1M4GA 4CGLA 1M1DA 1BOBA 1WWZA 2ZW5A 3EFAA 4C2ZA 5EBVA 4LUAA 2YNDA 1BO4A 4KSFA 3C26A 4MFJA 3S6GA 2K5TA 3KKWA 3H4QA 4MFLA 3P2HA 3S6HA 2FL4A 4JXQA 2EUIA 3IWEA 2BSWA 2ZW7A 4YRHA 4KVXA 2Z3LA 2YGWA 4QVTA 4A2ZA 4CYQA 4CGNA 2PRBA 3TCVA 4B10A 2FE7A 1YK3A 4KOUA 1XE4A 4JJXA 1KZFA 2B4DB 4X5KA 5DWNA 3DDDA 3DNSA 4B11A 5J8FA 2VZYA 4MJ8A 1XEBA 2AE6A 4FD5A 1XF8A 1QSOA 4E8OA 3W6XA 4B5PA 1Z4RA 4A32A 1YVKA 4IUSA 1MJBA 4F0YA 5I0CA 4FD6A 4PK3A 4ONUA 3S6FA 5CNPA 4LX9A 1KUXA 4MFQA 3E0KA 4KLVA 4UCMA 1RO5A 2CNSA 3D2PA 3LD2A 3B8GA 4NSQA 4E0AA 3QAHA 3T90A 4B5OA 3TFYA 1I12A 4UCNA 3R9GA 4XNHB 1L0CA 3JTKA 3TOAA 4H6UA 4EVYA 2OZUA 1XMTA 1NMTA 5ISVA 2R8VA 3MGDA 4AG7A 4JLYA 3JUWA 2I79A 2B4DA 1Q2CA 2VI7A 2NMTA 4CAFA 3FB3A 1I21A 2B5GB 4KLWA 4KSAA 1NSLA 2BEIA 4CYPA 4XPDB 4IF5A 4JWPA 1OZPA 5H86A 4RS2A 2Z3KA 4KOVA 2C27A 4B14A 2H5MA 3R96A 2B58A 4A33A 1QSTA 2FIWA 2Z3OA 1WK4A 5IX3A 2EVNA 3D8PA 3F8KA 4H6ZA 1IIDA 1PU9A 3R9EA 4R87A 2I00A 5G22A 4MY0A 4AVCA 3VWDA 2O28A 4MFZA 4R57A 4R9MA 4ZGYB 4F6AA 4C7HA 3TE4A 3UY5A 4A95A 2J8RA 2FSRA 4AVBA 2R7HA 1N71A 3H5ZA 1TIQA 3IWGA 1P4NA 2PC1A 3BJ7A 2F5IA 2FT0A 4PV6A 4JXRA 1XIXA 1Y7RA 2PDOA 1QSMA 3IGRA 2Y0MA 4HNWB 2FS5A 4L89A 5HMNA 3FNCA 4II9A 2WUUA 2RC4A 4MBUA 2DXQA 4Q38A 5IB0A 3FBUA 3TOBA 3R1KA 4NEXA 2PR1A 4ZBGA 2OU2A 4U5YA 4UBRA 5GCNA 2OH1A 2JDDA 3JVNA 2REFA 4CGPA 1NE9A 4BMHA 2OZGA 4BBHA 3GY9A 1IB1E 3TO6A 4QBJA 3T9YA 1J4JA 4QC6A 5AGEA 3EXNA 4CAEA 1S60A 2JLMA 4XPLA 2YNCC 2Z11A 3FYNA 5F46A 4KVME 2GIVA 3I3GA 5AG4A 3EC4A 5EC4A 2REEA 3WR7A 2G3AA 2YNCA 1S7LA 3PP9A 4KS9A 2A4NA 2PR8A 2GE3A 1M44A 1YR0A 2IL4A 2Q0YA 3NE7A 1Z9UA 4A30A 5C88A 1V0CA 2YNEA 2D4OA 4F0XA 2VBQA 5AG6A 3A9LA 5F49A 4C2YA 4QB9A 4R3LA 4UFVA 4OAEA 3TO7A 2B4BA 4KOSA 1QSNA 2J8MA 3W6SA 4CAXA 2ZXVA 1FY7A 4KOWA 5KTCA 4NF1A 3LODA 1Q2YA 1YX0A 1QSRA 3DR8A 5A28A 1IYLA 1ON0A 4FD4A 2HQYA 2VZZA 3CXSA 3I9SA 4QUSA 4UFWA 3OWCA 4C2XA 4UWIA 1YLEA 4ORFA 2G0BA 3VWEA 4J3GA 5C82A 5G1ZA 3DR6A 1S3ZA 4HKFA 2Q4YA 4UA3A 2P6EA 3FRMA 4MFKA 2HUZA 3S6KA 3GKRA 1Y9KA 4KZTA 4XNHC 4XPKA 1ZO0A 4E2AA 1S5KA 2Q4VA 1MK4A 2JDCA 1S7NA 4OLLA 3SHPA 3R95A 3IU1A 4C7IA 5IV0A 1R57A 1I1DA 2FXFA 1B6BA 2ZPAA 2CY2A 3DSBA 2X7BA 4L8AA 2P6GA 3CXPA 3FXTA 2QIRA 4XPDC 5BWAB 1B87A 2P6FA 4CRZB 4B12A 4NXYA 2B5GA 3V8IA 2Z3PA 5HH1A 4PSXA 1S7FA 5F47A 2WSAA 3ZJ0A 4U9ZA 4KUBA 3G3SA 1Z4EA 2Z3NA 4RI1A 3F0AA 2Z3MA 3W91A 4C68A 3FIXA 4CYOA 4HNXB 2VXKA 3TO9A 2OB0A 4KOTA 3G8WA 1IICA 4MHDA 1KUVA 5FVJA 1YVOA 3PGPA 2PSWA 4Y49B 2CNTA 3TTHA 2ZW6A 4KOXA 4K30A 4HNYB 4PSWA 4UWJA 3IU2A 2AJ6A 3SXNA 5F48A 4NCZA 1VHSA 4KUAA 2KCWA 2VQYA 3EO4A 5E96A 4PK2A 2OZHA 2QMLA 5JQ4A 3R9FA 2G3TA 2ZW4A 4I49A 5G20A 4UCPA 2D4PA 3EY5A 5KTAA 5JPHA 3BJ8A 3SXOA 2J8NA 4OADA 2WPWA 1U6MA 5AG7A 2PQ8A 4CS0B 5KTDA 5AG5A 1KUYA 2VEZA 4MFPA 4KVOE 3CXQA 2B3UA 3TT2A 4MY3A 2FIAA 1RXTA 4FD7A 1UFHA 3QB8A 1LRZA 2Q44A 1IYKA 4KOYA 2JEVA 2WPXA 4AVAA 4Y49C 1S7KA 2HV2A 2CNMA 4M3SA 1PUAA 4UFXA 4Q36A 5H84A 2QECA 4A31A 4U9YA 4CYNA 2DPTA 2ARHA 5G21A 4CGOA 3P2FA 2GANA 4CAVA 2Q04A 2BUEA 1MJAA 4YGOA 5DWMA 2CXAA 1VKCA 1YGHA 3D2MA 3K9UA 4AG9A 2B3VA 2DPSA 1M4DA 4KORA 2Q7BA 1YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RYO A;  1MJ9 A;  2BL1 A;  2ATR A;  4H89 A;  4JD6 A;  4CAW A;  1Y9W A;  2R98 A;  4CRY B;  2P0W A;  1K4J A;  3ZZI A;  1GHE A;  1CM0 A;  4B5P B;  4MI4 A;  4GS4 A;  4AB7 A;  4YFJ A;  1P0H A;  4R3K A;  3GYA A;  3N7Z A;  4M85 A;  1M4I A;  4DNC A;  3D3S A;  5J8C A;  1CJW A;  2FCK A;  3BLN A;  1SQH A;  2Z0Z A;  2R1I A;  2Z10 A;  3PZJ A;  1Q2D A;  3F5B A;  1M4G A;  1M1D A;  1BOB A;  1WWZ A;  2ZW5 A;  3EFA A;  5EBV A;  4LUA A;  1BO4 A;  3C26 A;  3S6G A;  2K5T A;  3KKW A;  3H4Q A;  3P2H A;  3S6H A;  2FL4 A;  4JXQ A;  2EUI A;  2BSW A;  2ZW7 A;  4YRH A;  4KVX A;  4QVT A;  2PRB A;  3TCV A;  2FE7 A;  1YK3 A;  4KOU A;  1XE4 A;  4JJX A;  1KZF A;  2B4D B;  4X5K A;  5DWN A;  3DDD A;  3DNS A;  5J8F A;  2VZY A;  4MJ8 A;  1XEB A;  2AE6 A;  4FD5 A;  1XF8 A;  1QSO A;  4E8O A;  3W6X A;  4B5P A;  1Z4R A;  1YVK A;  4IUS A;  1MJB A;  4F0Y A;  5I0C A;  4FD6 A;  4PK3 A;  4ONU A;  3S6F A;  5CNP A;  4LX9 A;  1KUX A;  3E0K A;  4KLV A;  1RO5 A;  2CNS A;  3D2P A;  3LD2 A;  3B8G A;  4NSQ A;  4E0A A;  3QAH A;  3T90 A;  4B5O A;  3TFY A;  1I12 A;  3R9G A;  4XNH B;  1L0C A;  3TOA A;  4H6U A;  4EVY A;  2OZU A;  1XMT A;  1NMT A;  5ISV A;  2R8V A;  3MGD A;  4AG7 A;  4JLY A;  3JUW A;  2I79 A;  2B4D A;  1Q2C A;  2VI7 A;  2NMT A;  3FB3 A;  1I21 A;  2B5G B;  4KLW A;  1NSL A;  2BEI A;  4XPD B;  4IF5 A;  4JWP A;  1OZP A;  5H86 A;  4RS2 A;  4KOV A;  2C27 A;  2H5M A;  3R96 A;  2B58 A;  1QST A;  2FIW A;  1WK4 A;  5IX3 A;  2EVN A;  3D8P A;  3F8K A;  4H6Z A;  1IID A;  1PU9 A;  3R9E A;  4R87 A;  2I00 A;  4MY0 A;  4AVC A;  3VWD A;  2O28 A;  4R57 A;  4R9M A;  4F6A A;  3TE4 A;  3UY5 A;  2J8R A;  2FSR A;  4AVB A;  2R7H A;  1N71 A;  1TIQ A;  3IWG A;  1P4N A;  2PC1 A;  3BJ7 A;  2F5I A;  2FT0 A;  4PV6 A;  4JXR A;  1XIX A;  1Y7R A;  2PDO A;  1QSM A;  3IGR A;  2Y0M A;  4HNW B;  2FS5 A;  4L89 A;  5HMN A;  3FNC A;  4II9 A;  2RC4 A;  4MBU A;  2DXQ A;  5IB0 A;  3FBU A;  3TOB A;  3R1K A;  4NEX A;  2PR1 A;  4ZBG A;  2OU2 A;  4U5Y A;  4UBR A;  5GCN A;  2OH1 A;  2JDD A;  3JVN A;  2REF A;  1NE9 A;  4BMH A;  2OZG A;  3GY9 A;  1IB1 E;  3TO6 A;  4QBJ A;  3T9Y A;  1J4J A;  4QC6 A;  3EXN A;  1S60 A;  2JLM A;  4XPL A;  2Z11 A;  3FYN A;  5F46 A;  4KVM E;  2GIV A;  3I3G A;  3EC4 A;  5EC4 A;  2REE A;  3WR7 A;  2G3A A;  1S7L A;  3PP9 A;  2A4N A;  2PR8 A;  2GE3 A;  1M44 A;  1YR0 A;  2IL4 A;  2Q0Y A;  3NE7 A;  1Z9U A;  5C88 A;  1V0C A;  2D4O A;  2VBQ A;  5F49 A;  4QB9 A;  4R3L A;  4OAE A;  3TO7 A;  2B4B A;  4KOS A;  1QSN A;  2J8M A;  3W6S A;  4CAX A;  2ZXV A;  1FY7 A;  4KOW A;  5KTC A;  4NF1 A;  3LOD A;  1Q2Y A;  1YX0 A;  1QSR A;  3DR8 A;  1IYL A;  1ON0 A;  4FD4 A;  2HQY A;  2VZZ A;  3CXS A;  3I9S A;  4QUS A;  3OWC A;  4UWI A;  1YLE A;  4ORF A;  2G0B A;  3VWE A;  4J3G A;  5C82 A;  3DR6 A;  1S3Z A;  4HKF A;  2Q4Y A;  4UA3 A;  2P6E A;  3FRM A;  2HUZ A;  3S6K A;  3GKR A;  1Y9K A;  4KZT A;  4XNH C;  4XPK A;  4E2A A;  1S5K A;  2Q4V A;  1MK4 A;  2JDC A;  1S7N A;  4OLL A;  3SHP A;  3R95 A;  5IV0 A;  1R57 A;  1I1D A;  2FXF A;  1B6B A;  2ZPA A;  2CY2 A;  3DSB A;  2X7B A;  4L8A A;  2P6G A;  3CXP A;  3FXT A;  2QIR A;  4XPD C;  1B87 A;  2P6F A;  4CRZ B;  4NXY A;  2B5G A;  3V8I A;  5HH1 A;  4PSX A;  1S7F A;  5F47 A;  3ZJ0 A;  4U9Z A;  4KUB A;  3G3S A;  1Z4E A;  4RI1 A;  3F0A A;  3W91 A;  3FIX A;  4HNX B;  2VXK A;  3TO9 A;  2OB0 A;  4KOT A;  3G8W A;  1IIC A;  4MHD A;  1KUV A;  5FVJ A;  1YVO A;  3PGP A;  2PSW A;  4Y49 B;  2CNT A;  3TTH A;  2ZW6 A;  4KOX A;  4K30 A;  4HNY B;  4PSW A;  4UWJ A;  2AJ6 A;  3SXN A;  5F48 A;  4NCZ A;  1VHS A;  4KUA A;  2KCW A;  2VQY A;  3EO4 A;  5E96 A;  4PK2 A;  2OZH A;  2QML A;  5JQ4 A;  3R9F A;  2G3T A;  2ZW4 A;  4I49 A;  2D4P A;  3EY5 A;  5KTA A;  5JPH A;  3BJ8 A;  3SXO A;  2J8N A;  4OAD A;  2WPW A;  1U6M A;  2PQ8 A;  4CS0 B;  5KTD A;  1KUY A;  2VEZ A;  4KVO E;  3CXQ A;  2B3U A;  3TT2 A;  4MY3 A;  2FIA A;  1RXT A;  4FD7 A;  1UFH A;  3QB8 A;  1LRZ A;  2Q44 A;  1IYK A;  4KOY A;  2JEV A;  2WPX A;  4AVA A;  4Y49 C;  1S7K A;  2HV2 A;  2CNM A;  4M3S A;  1PUA A;  5H84 A;  2QEC A;  4U9Y A;  2ARH A;  3P2F A;  2GAN A;  4CAV A;  2Q04 A;  2BUE A;  1MJA A;  4YGO A;  5DWM A;  1VKC A;  1YGH A;  3D2M A;  3K9U A;  4AG9 A;  2B3V A;  1M4D A;  4KOR A;  2Q7B A;  1YRE A; 
#chains in the Genus database with same CATH topology
 4ZX9 A;  3RYO A;  2ZEM A;  3BHX A;  4PXD A;  5LYD A;  4NGQ A;  3PBB A;  4CGM A;  2ZOF A;  1BLL E;  1ARM A;  1MJ9 A;  4B13 A;  1YQE A;  2BL1 A;  3B3V A;  3FH4 A;  2ATR A;  5LYI A;  5K8O A;  2OR4 A;  4H89 A;  3CPX A;  2O53 A;  1IOF A;  4JD6 A;  4CAW A;  1Y9W A;  2R98 A;  4WWV A;  4CRY B;  4ZY0 A;  2P0W A;  4F9V A;  7CPA A;  1K4J A;  5A27 A;  3ZZI A;  1GHE A;  1CM0 A;  3S9L A;  3KHX A;  3PFE A;  4B5P B;  4MI4 A;  4GS4 A;  4AB7 A;  4YFJ A;  4IHM A;  1P0H A;  4R3K A;  3GYA A;  3N7Z A;  1Q7L A;  4M85 A;  3B7I A;  1Y0R A;  4GM5 A;  1M4I A;  2OOT A;  4DNC A;  3D3S A;  5J8C A;  2F8H A;  2GLF A;  1CJW A;  2FCK A;  3BLN A;  1SQH A;  2Z0Z A;  2R1I A;  2Z10 A;  3PB7 X;  1Q2D A;  1R43 A;  3F5B A;  1M4G A;  3PZJ A;  3TC8 A;  4CGL A;  4ZI6 A;  2EK9 A;  1M1D A;  1BOB A;  1WWZ A;  2ZW5 A;  3EFA A;  4C2Z A;  3FED A;  5EBV A;  4LUA A;  1Z5R A;  2XEJ A;  3DGV A;  3S9M A;  2YND A;  2CIJ A;  5J1Q A;  3ISZ A;  1BO4 A;  4KSF A;  1ZLI A;  3C26 A;  2PJ8 A;  4MFJ A;  3S6G A;  2K5T A;  3KKW A;  3H4Q A;  4MFL A;  2WZN A;  4OC2 A;  3P2H A;  4FWU A;  1ZG9 A;  2PVV A;  3S6H A;  3V7Z A;  2FL4 A;  4JXQ A;  1M4L A;  2EUI A;  2Q51 A;  3IWE A;  4IK2 A;  4P10 A;  4YU9 A;  2BSW A;  2ZW7 A;  4YRH A;  4KVX A;  3N5F A;  2Z3L A;  2YGW A;  2GU2 A;  4QVT A;  4A2Z A;  4CYQ A;  5LYF A;  3PEI A;  3RBU A;  4CGN A;  2PRB A;  3D68 A;  3ISX A;  1LOK A;  3KQX A;  2PJ0 A;  2FE7 A;  3NFZ A;  3TCV A;  4B10 A;  1YK3 A;  4KOU A;  4UEZ A;  4TWE A;  1XE4 A;  3D66 A;  2ZEF A;  4JJX A;  6CPA A;  1KZF A;  2B4D B;  4R6T A;  4X5K A;  4A94 A;  2EBJ A;  2PJ3 A;  1LAP A;  5DWN A;  2ZEG A;  2F7V A;  3DDD A;  2V8G A;  3DNS A;  4MXU A;  4OC0 A;  4OME A;  4B11 A;  5J8F A;  1FNO A;  2PJ2 A;  2VZY A;  4MJ8 A;  1XEB A;  4YWY A;  2AE6 A;  4FD5 A;  1XF8 A;  1QSO A;  3WC7 A;  4E8O A;  3W6X A;  2RFH A;  4B5P A;  1Z4R A;  4A32 A;  2C6G A;  1YVK A;  4K3N A;  4IUS A;  1MJB A;  1TKF A;  4F0Y A;  5I0C A;  3IJ3 A;  3SI2 A;  4FD6 A;  4PK3 A;  4ONU A;  3S6F A;  5CNP A;  1NSA A;  3RNZ A;  2BOA A;  2NSM A;  3FJU A;  4NGS A;  5HXD A;  3WC6 A;  4LX9 A;  1KUX A;  4MFQ A;  3SJE A;  3E0K A;  4KLV A;  4UCM A;  3IIB A;  1RO5 A;  2CNS A;  4ZX8 A;  2CTC A;  4UEE A;  3D2P A;  5EMI A;  3WC5 A;  1TKH A;  4PQA A;  3LD2 A;  3B8G A;  4NSQ A;  4E0A A;  3QAH A;  5CBM A;  3T90 A;  3KGQ A;  4B5O A;  3TFY A;  2C6P A;  2BCO A;  3PBE A;  4IAV A;  1I12 A;  4P4D A;  4R8F A;  4UCN A;  3KQZ A;  2AFX A;  2NYQ A;  1JQG A;  4F9U A;  3R9G A;  4XNH B;  1L0C A;  3HUV A;  4WJB A;  1CX8 A;  2PVW A;  3JTK A;  3TOA A;  4H6U A;  2ODF A;  4EWT A;  4EVY A;  2PJB A;  3DLJ A;  2OZU A;  1DTD A;  1XMT A;  1YW6 A;  1NMT A;  5ISV A;  4P4E A;  2R8V A;  3B3C A;  3MGD A;  3BI0 A;  4OKO A;  4AG7 A;  4F8Z A;  1UWY A;  4JLY A;  3JUW A;  2I79 A;  2B4D A;  1Q2C A;  2VI7 A;  2NMT A;  5DS0 A;  4CAF A;  1XMB A;  1FT7 A;  3FB3 A;  4B6Z A;  1I21 A;  2B5G B;  4KLW A;  4KSA A;  1KWM A;  3FEE A;  1NSL A;  2BEI A;  2BO9 A;  4EME A;  3QNV A;  3V38 A;  1XOV A;  3LMS A;  4CYP A;  4XPD B;  4IF5 A;  4JWP A;  1X12 A;  1OZP A;  5H86 A;  4RS2 A;  2ZEP A;  4PXE A;  4ONW A;  2Z3K A;  4KOV A;  2C27 A;  4B14 A;  2H5M A;  2AFS A;  2AFZ A;  3R96 A;  2B58 A;  4A33 A;  1QST A;  4FAI A;  2V8D A;  2FIW A;  2Z3O A;  4NGP A;  1WK4 A;  4GXH A;  5IX3 A;  2EVN A;  3D8P A;  3PB9 X;  1IU8 A;  3F8K A;  3PB4 X;  1IID A;  1PU9 A;  1BPN A;  2RB7 A;  4H6Z A;  1LAN A;  3R9E A;  4R87 A;  2I00 A;  3VAR A;  5G22 A;  4MY0 A;  4AVC A;  3VWD A;  3GB0 A;  4M6I A;  2O28 A;  3D67 A;  1ELL P;  4MFZ A;  4R57 A;  4R9M A;  4ZGY B;  2HB6 A;  3KI9 A;  4C7H A;  4F6A A;  3TE4 A;  3UY5 A;  4A95 A;  2J8R A;  2FSR A;  2XEG A;  4ZY1 A;  4AVB A;  4FUU A;  4X8I A;  2R7H A;  1N71 A;  3H5Z A;  1TIQ A;  3KR4 A;  2QJ8 A;  4UIB A;  3IWG A;  1JWQ A;  1P4N A;  3B3S A;  2PRQ A;  2PJ1 A;  3SJX A;  2PC1 A;  3BJ7 A;  3HLP A;  2V77 A;  4NGN A;  2DEA A;  2CF4 A;  3NE8 A;  3PB6 X;  1QQ9 A;  2F5I A;  4MCQ A;  1CP6 A;  2FT0 A;  2PIY A;  3L2N A;  4JXR A;  1XIX A;  4PV6 A;  1Y7R A;  2PDO A;  3GIU A;  1QSM A;  3IGR A;  2AFU A;  4MCP A;  2DF5 A;  4W9Y A;  2Y0M A;  3MRU A;  2WYR A;  4HNW B;  2FS5 A;  4L89 A;  4AXV A;  3LAC A;  5HMN A;  1TF8 A;  3FNC A;  1F2P A;  2ZEN A;  1XFO A;  4RN7 A;  4UEF A;  2WUU A;  4II9 A;  2RC4 A;  4MBU A;  4P4F A;  1LCP A;  4BIN A;  4G1P A;  2DXQ A;  4MRI A;  1CBX A;  4MCR A;  3GUX A;  3NH5 A;  4Q38 A;  1VIX A;  3BI1 A;  3FBU A;  4BD9 A;  5IB0 A;  3TOB A;  3R1K A;  4DUK A;  4NEX A;  2PR1 A;  1IY7 A;  4OC4 A;  4ZBG A;  5JM6 A;  4P6Y A;  3RAM A;  2OU2 A;  2GLJ A;  4U5Y A;  4UBR A;  2OH1 A;  2JDD A;  3JVN A;  1ZLH A;  2PJA A;  3NH4 A;  2REF A;  1XRY A;  4HPS A;  4CGP A;  1Z8L A;  5HVF A;  3H8G A;  4OP4 A;  2EK8 A;  3WT4 A;  1NE9 A;  1YW4 A;  1CPX A;  5CPA A;  4BMH A;  2OZG A;  3IC1 A;  4BBH A;  3GY9 A;  3RO0 A;  4LQ6 A;  1IB1 E;  4KSI A;  4PXB A;  3TO6 A;  2PIZ A;  4QBJ A;  3T9Y A;  1J4J A;  4QC6 A;  2AFM A;  5AGE A;  3EXN A;  4CAE A;  1S60 A;  2JLM A;  4NGR A;  4XPL A;  3B3T A;  2YNC C;  3NA6 A;  1A2Z A;  2Z11 A;  3FYN A;  2POK A;  5LRK A;  4MMO A;  5F46 A;  4KVM E;  4JZ0 A;  1ELM P;  2GIV A;  1VGY A;  3I3G A;  1HDU A;  5AG4 A;  3EC4 A;  5EC4 A;  2REE A;  3WR7 A;  2G3A A;  2YNC A;  1S7L A;  3PP9 A;  4KS9 A;  5IB9 A;  2A4N A;  2PR8 A;  5LRJ A;  2GE3 A;  4R7M A;  3WAB A;  1M44 A;  1YR0 A;  2IL4 A;  2JBK A;  2Q0Y A;  3NE7 A;  1Z9U A;  3FEC A;  2EO8 A;  2AFW A;  4A30 A;  3IFE A;  5C88 A;  1V0C A;  2YNE A;  2D4O A;  4F0X A;  2VBQ A;  5AG6 A;  3B35 A;  3A9L A;  3TX8 A;  5F49 A;  4P44 A;  4C2Y A;  4QB9 A;  2IMO A;  4R3L A;  4UFV A;  3IEH A;  4OAE A;  4UF4 A;  3TO7 A;  1CG2 A;  2B4B A;  3FX6 A;  2G9D A;  4KOS A;  1QSN A;  2J8M A;  3PRT A;  3W6S A;  2IJZ A;  1Z8X A;  4CAX A;  4OID A;  2ZXV A;  1FY7 A;  4MHP A;  4KOW A;  5KTC A;  4NF1 A;  4NJQ A;  1TF9 A;  2AFO A;  3LOD A;  1Q2Y A;  3QAY A;  1YX0 A;  3FF3 A;  1QSR A;  3DR8 A;  5A28 A;  1IYL A;  3FVL A;  1ON0 A;  4FD4 A;  2HQY A;  2VZZ A;  3CXS A;  2ANP A;  3I9S A;  5THW A;  2PE3 A;  4QUS A;  4UFW A;  3OWC A;  4P4J A;  4C2X A;  2ZOG A;  4NJR A;  4UWI A;  1YLE A;  4ORF A;  2G0B A;  1BAV A;  1EE3 P;  3VWE A;  1Y0Y A;  2QVP A;  5GCN A;  4MHN A;  4J3G A;  1TXR A;  3D7F A;  4M6G A;  5G1Z A;  4CPA A;  5C82 A;  4NGM A;  3DR6 A;  3NH8 A;  1S3Z A;  4HKF A;  2Q4Y A;  4UA3 A;  3B2Y A;  2P6E A;  3H8E A;  3FRM A;  4MFK A;  2HUZ A;  3S6K A;  1OBR A;  4NGT A;  3GKR A;  4DYO A;  1Y9K A;  3KAS A;  4KZT A;  4LQG A;  1RTQ A;  4XNH C;  4O23 A;  4XPK A;  1ZO0 A;  3SJF A;  4E2A A;  4R76 A;  1S5K A;  2Q4V A;  3K9T A;  1MK4 A;  1VHE A;  2JDC A;  1S7N A;  2EWB A;  4OLL A;  2Q7S A;  3CDX A;  4X3R A;  1PCA A;  3SHP A;  3PB8 X;  3IU1 A;  3R95 A;  2ZED A;  5JH9 A;  4C7I A;  5IV0 A;  3KR5 A;  1R57 A;  1I1D A;  3D4U A;  1H8L A;  1B6B A;  2FXF A;  2HC9 A;  2ZEL A;  2ZPA A;  2CY2 A;  3DSB A;  3CPA A;  2X7B A;  4L8A A;  2ZEO A;  1YME A;  1XJO A;  2ZEH A;  2I3C A;  4MHY A;  2P6G A;  3CXP A;  3FXT A;  5K8P A;  1R3N A;  2QIR A;  4A39 A;  3I1U A;  4XPD C;  5BWA B;  4OC1 A;  1B87 A;  3KZW A;  2P6F A;  3KHZ A;  2ZEE A;  1LFW A;  2PJ7 A;  4B12 A;  4CRZ B;  3VH9 A;  3B3W A;  3GLJ A;  4NXY A;  2ABZ A;  2B5G A;  2C6C A;  3H8F A;  4A37 A;  1F2O A;  3V8I A;  1XBU A;  2Z3P A;  2PJ4 A;  4PSX A;  5HH1 A;  1Z2L A;  1IOI A;  2PJ9 A;  1S7F A;  5F47 A;  1AUG A;  2WSA A;  3ZJ0 A;  4U9Z A;  4KUB A;  3G3S A;  2CTB A;  1AMP A;  4P45 A;  1Z4E A;  2Z3N A;  4RI1 A;  3F0A A;  2Z3M A;  3SI1 A;  2GRE A;  3W91 A;  4C68 A;  3FIX A;  1LAM A;  5HVH A;  8CPA A;  1ZG8 A;  3CZX A;  4CYO A;  5D29 A;  4HNX B;  2VXK A;  2V8V A;  1ARL A;  3TO9 A;  2OB0 A;  4KOT A;  1F57 A;  5K8N A;  3G8W A;  3S9N A;  1IIC A;  4MHD A;  1KUV A;  5FVJ A;  1YVO A;  3PGP A;  2PSW A;  2PCU A;  1YLO A;  4Y49 B;  4RUH A;  1BPM A;  4A38 A;  3KL9 A;  2CNT A;  1QMU A;  3FMC A;  3RZA A;  3TTH A;  2ZW6 A;  2QYV A;  4KOX A;  3PFO A;  4K30 A;  4HNY B;  4X2T A;  2Q4Z A;  4PSW A;  4TNU A;  3T8W A;  4UWJ A;  2XEF A;  4DJL A;  2PJ6 A;  3IU2 A;  4FBE A;  2AJ6 A;  3SXN A;  3IWW A;  4NCZ A;  5F48 A;  4Q7A A;  1VHS A;  1PYT B;  2C1C A;  4PPZ A;  4KUA A;  2KCW A;  2VQY A;  3VAT A;  3EO4 A;  5E96 A;  2JBJ A;  4MCS A;  4PK2 A;  2OZH A;  1HDQ A;  1Y7E A;  2VL1 A;  4JYW A;  2QML A;  5D8N A;  3SJG A;  3R9F A;  4EFD A;  5JQ4 A;  1GYT A;  3LWU A;  4ZYQ A;  2G3T A;  2ZW4 A;  4I49 A;  5G20 A;  4UCP A;  2D4P A;  3EY5 A;  3MN8 A;  3D7H A;  3D7G A;  5JPH A;  3BJ8 A;  5KTA A;  3SXO A;  3JRU A;  4PXC A;  2J8N A;  4OAD A;  1VHO A;  2WPW A;  5JGF A;  1U6M A;  2FVG A;  4OC5 A;  5AG7 A;  2PQ8 A;  4CS0 B;  5KTD A;  2V8H A;  1KUY A;  4P4B A;  2PJ5 A;  2VEZ A;  5AG5 A;  4Z65 A;  4MFP A;  4KVO E;  1TKJ A;  3CXQ A;  2B3U A;  1CPS A;  3TT2 A;  5I4M A;  1ZG7 A;  4MY3 A;  4OC3 A;  2FIA A;  1RXT A;  1Z8W A;  4FD7 A;  1UFH A;  2J9A A;  3QB8 A;  1LRZ A;  2Q44 A;  1IYK A;  4UIA A;  2Q43 A;  4P4I A;  5F09 A;  2Q7B A;  3BXM A;  2GFQ A;  4KOY A;  2JEV A;  5HVG A;  2WPX A;  4AVA A;  1Z8T A;  2XEI A;  3CT9 A;  3D7D A;  4Y49 C;  1S7K A;  2O4H A;  5ELY A;  4ZY2 A;  2HV2 A;  1YSJ A;  2CNM A;  1PUA A;  4M3S A;  5LRG A;  3K2K A;  4UFX A;  1CP7 A;  3IO1 A;  4Q36 A;  2JEW A;  5H84 A;  2QEC A;  3SI0 A;  4U9Y A;  4A31 A;  2DPT A;  4CYN A;  5LYL A;  2ARH A;  1AYE A;  5G21 A;  4CGO A;  5K8M A;  3P2F A;  4MHZ A;  2GAN A;  4CAV A;  2Q04 A;  1HEE A;  2BUE A;  1MJA A;  4YGO A;  1DE4 C;  4OIW A;  5DWM A;  2CXA A;  1VKC A;  1YGH A;  3D2M A;  3K9U A;  2PJC A;  4AG9 A;  1X10 A;  2B3V A;  2DPS A;  4H2K A;  2IQ6 A;  4M6H A;  1M4D A;  4KOR A;  4NFR A;  1IGB A;  1YRE A; 
#chains in the Genus database with same CATH homology
 3RYO A;  4CGM A;  1MJ9 A;  4B13 A;  2BL1 A;  2ATR A;  4H89 A;  4JD6 A;  4CAW A;  1Y9W A;  2R98 A;  4CRY B;  2P0W A;  1K4J A;  5A27 A;  3ZZI A;  1GHE A;  1CM0 A;  4B5P B;  4MI4 A;  4GS4 A;  4AB7 A;  4YFJ A;  1P0H A;  4R3K A;  3GYA A;  3N7Z A;  4M85 A;  1M4I A;  4DNC A;  3D3S A;  5J8C A;  1CJW A;  2FCK A;  3BLN A;  1SQH A;  2Z0Z A;  2R1I A;  2Z10 A;  3PZJ A;  1Q2D A;  3F5B A;  1M4G A;  4CGL A;  1M1D A;  1BOB A;  1WWZ A;  2ZW5 A;  3EFA A;  4C2Z A;  5EBV A;  4LUA A;  2YND A;  1BO4 A;  4KSF A;  3C26 A;  4MFJ A;  3S6G A;  2K5T A;  3KKW A;  3H4Q A;  4MFL A;  3P2H A;  3S6H A;  2FL4 A;  4JXQ A;  2EUI A;  3IWE A;  2BSW A;  2ZW7 A;  4YRH A;  4KVX A;  2Z3L A;  2YGW A;  4QVT A;  4A2Z A;  4CYQ A;  4CGN A;  2PRB A;  3TCV A;  4B10 A;  2FE7 A;  1YK3 A;  4KOU A;  1XE4 A;  4JJX A;  1KZF A;  2B4D B;  4X5K A;  5DWN A;  3DDD A;  3DNS A;  4B11 A;  5J8F A;  2VZY A;  4MJ8 A;  1XEB A;  2AE6 A;  4FD5 A;  1XF8 A;  1QSO A;  4E8O A;  3W6X A;  4B5P A;  1Z4R A;  4A32 A;  1YVK A;  4IUS A;  1MJB A;  4F0Y A;  5I0C A;  4FD6 A;  4PK3 A;  4ONU A;  3S6F A;  5CNP A;  4LX9 A;  1KUX A;  4MFQ A;  3E0K A;  4KLV A;  4UCM A;  1RO5 A;  2CNS A;  3D2P A;  3LD2 A;  3B8G A;  4NSQ A;  4E0A A;  3QAH A;  3T90 A;  4B5O A;  3TFY A;  1I12 A;  4UCN A;  3R9G A;  4XNH B;  1L0C A;  3JTK A;  3TOA A;  4H6U A;  4EVY A;  2OZU A;  1XMT A;  1NMT A;  5ISV A;  2R8V A;  3MGD A;  4AG7 A;  4JLY A;  3JUW A;  2I79 A;  2B4D A;  1Q2C A;  2VI7 A;  2NMT A;  4CAF A;  3FB3 A;  1I21 A;  2B5G B;  4KLW A;  4KSA A;  1NSL A;  2BEI A;  4CYP A;  4XPD B;  4IF5 A;  4JWP A;  1OZP A;  5H86 A;  4RS2 A;  2Z3K A;  4KOV A;  2C27 A;  4B14 A;  2H5M A;  3R96 A;  2B58 A;  4A33 A;  1QST A;  2FIW A;  2Z3O A;  1WK4 A;  5IX3 A;  2EVN A;  3D8P A;  3F8K A;  4H6Z A;  1IID A;  1PU9 A;  3R9E A;  4R87 A;  2I00 A;  5G22 A;  4MY0 A;  4AVC A;  3VWD A;  2O28 A;  4MFZ A;  4R57 A;  4R9M A;  4ZGY B;  4F6A A;  4C7H A;  3TE4 A;  3UY5 A;  4A95 A;  2J8R A;  2FSR A;  4AVB A;  2R7H A;  1N71 A;  3H5Z A;  1TIQ A;  3IWG A;  1P4N A;  2PC1 A;  3BJ7 A;  2F5I A;  2FT0 A;  4PV6 A;  4JXR A;  1XIX A;  1Y7R A;  2PDO A;  1QSM A;  3IGR A;  2Y0M A;  4HNW B;  2FS5 A;  4L89 A;  5HMN A;  3FNC A;  4II9 A;  2WUU A;  2RC4 A;  4MBU A;  2DXQ A;  4Q38 A;  5IB0 A;  3FBU A;  3TOB A;  3R1K A;  4NEX A;  2PR1 A;  4ZBG A;  2OU2 A;  4U5Y A;  4UBR A;  5GCN A;  2OH1 A;  2JDD A;  3JVN A;  2REF A;  4CGP A;  1NE9 A;  4BMH A;  2OZG A;  4BBH A;  3GY9 A;  1IB1 E;  3TO6 A;  4QBJ A;  3T9Y A;  1J4J A;  4QC6 A;  5AGE A;  3EXN A;  4CAE A;  1S60 A;  2JLM A;  4XPL A;  2YNC C;  2Z11 A;  3FYN A;  5F46 A;  4KVM E;  2GIV A;  3I3G A;  5AG4 A;  3EC4 A;  5EC4 A;  2REE A;  3WR7 A;  2G3A A;  2YNC A;  1S7L A;  3PP9 A;  4KS9 A;  2A4N A;  2PR8 A;  2GE3 A;  1M44 A;  1YR0 A;  2IL4 A;  2Q0Y A;  3NE7 A;  1Z9U A;  4A30 A;  5C88 A;  1V0C A;  2YNE A;  2D4O A;  4F0X A;  2VBQ A;  5AG6 A;  3A9L A;  5F49 A;  4C2Y A;  4QB9 A;  4R3L A;  4UFV A;  4OAE A;  3TO7 A;  2B4B A;  4KOS A;  1QSN A;  2J8M A;  3W6S A;  4CAX A;  2ZXV A;  1FY7 A;  4KOW A;  5KTC A;  4NF1 A;  3LOD A;  1Q2Y A;  1YX0 A;  1QSR A;  3DR8 A;  5A28 A;  1IYL A;  1ON0 A;  4FD4 A;  2HQY A;  2VZZ A;  3CXS A;  3I9S A;  4QUS A;  4UFW A;  3OWC A;  4C2X A;  4UWI A;  1YLE A;  4ORF A;  2G0B A;  3VWE A;  4J3G A;  5C82 A;  5G1Z A;  3DR6 A;  1S3Z A;  4HKF A;  2Q4Y A;  4UA3 A;  2P6E A;  3FRM A;  4MFK A;  2HUZ A;  3S6K A;  3GKR A;  1Y9K A;  4KZT A;  4XNH C;  4XPK A;  1ZO0 A;  4E2A A;  1S5K A;  2Q4V A;  1MK4 A;  2JDC A;  1S7N A;  4OLL A;  3SHP A;  3R95 A;  3IU1 A;  4C7I A;  5IV0 A;  1R57 A;  1I1D A;  2FXF A;  1B6B A;  2ZPA A;  2CY2 A;  3DSB A;  2X7B A;  4L8A A;  2P6G A;  3CXP A;  3FXT A;  2QIR A;  4XPD C;  5BWA B;  1B87 A;  2P6F A;  4CRZ B;  4B12 A;  4NXY A;  2B5G A;  3V8I A;  2Z3P A;  5HH1 A;  4PSX A;  1S7F A;  5F47 A;  2WSA A;  3ZJ0 A;  4U9Z A;  4KUB A;  3G3S A;  1Z4E A;  2Z3N A;  4RI1 A;  3F0A A;  2Z3M A;  3W91 A;  4C68 A;  3FIX A;  4CYO A;  4HNX B;  2VXK A;  3TO9 A;  2OB0 A;  4KOT A;  3G8W A;  1IIC A;  4MHD A;  1KUV A;  5FVJ A;  1YVO A;  3PGP A;  2PSW A;  4Y49 B;  2CNT A;  3TTH A;  2ZW6 A;  4KOX A;  4K30 A;  4HNY B;  4PSW A;  4UWJ A;  3IU2 A;  2AJ6 A;  3SXN A;  5F48 A;  4NCZ A;  1VHS A;  4KUA A;  2KCW A;  2VQY A;  3EO4 A;  5E96 A;  4PK2 A;  2OZH A;  2QML A;  5JQ4 A;  3R9F A;  2G3T A;  2ZW4 A;  4I49 A;  5G20 A;  4UCP A;  2D4P A;  3EY5 A;  5KTA A;  5JPH A;  3BJ8 A;  3SXO A;  2J8N A;  4OAD A;  2WPW A;  1U6M A;  5AG7 A;  2PQ8 A;  4CS0 B;  5KTD A;  5AG5 A;  1KUY A;  2VEZ A;  4MFP A;  4KVO E;  3CXQ A;  2B3U A;  3TT2 A;  4MY3 A;  2FIA A;  1RXT A;  4FD7 A;  1UFH A;  3QB8 A;  1LRZ A;  2Q44 A;  1IYK A;  4KOY A;  2JEV A;  2WPX A;  4AVA A;  4Y49 C;  1S7K A;  2HV2 A;  2CNM A;  4M3S A;  1PUA A;  4UFX A;  4Q36 A;  5H84 A;  2QEC A;  4A31 A;  4U9Y A;  4CYN A;  2DPT A;  2ARH A;  5G21 A;  4CGO A;  3P2F A;  2GAN A;  4CAV A;  2Q04 A;  2BUE A;  1MJA A;  4YGO A;  5DWM A;  2CXA A;  1VKC A;  1YGH A;  3D2M A;  3K9U A;  4AG9 A;  2B3V A;  2DPS A;  1M4D A;  4KOR A;  2Q7B A;  1YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...