5F46A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample, apoenzyme form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f46A00
1R57A 3S6KA 1GHEA 3EY5A 1VKCA 1Y9KA 3T90A 2PRBA 3ZZIA 1WWZA 2H5MA 1NE9A 4OAEA 1QSOA 1M1DA 1YGHA 5JQ4A 2EUIA 1Q2YA 1QSMA 1QSNA 4KOWA 3UY5A 4YFJA 2OZHA 4JWPA 3R9EA 2K5TA 2VBQA 2VQYA 4NF1A 5J8FA 3FB3A 3T9YA 4MJ8A 4JXQA 4AVCA 4M3SA 2FE7A 3JUWA 4CAWA 1YX0A 3D2MA 4ONUA 2NMTA 5EC4A 1YLEA 2PQ8A 1WK4A 1S7NA 4AG7A 3TOBA 2CNSA 4KLVA 1K4JA 4H6UA 3R95A 1YK3A 3N7ZA 2Y0MA 4R87A 1CM0A 3ZJ0A 4NSQA 4NCZA 2B5GA 1I1DA 4CS0B 4MBUA 3S6FA 3TO6A 1BOBA 2B3VA 2Z0ZA 3TFYA 3GKRA 2REEA 3F0AA 2Q44A 3TOAA 4JJXA 1U6MA 4R57A 4ORFA 2A4NA 1KUXA 1S5KA 2J8RA 1XF8A 1IICA 4II9A 2Q0YA 2PDOA 4XNHB 1PU9A 4KOXA 2BSWA 2B58A 2CNMA 2OZGA 2ZW7A 3RYOA 2REFA 3DR6A 5KTAA 2GANA 3H4QA 1YVKA 3G8WA 3G3SA 4L89A 3BJ8A 3BLNA 1MJBA 2P6GA 3V8IA 4IUSA 2R8VA 4FD5A 3LODA 5F46A 4E8OA 1M4GA 4XPLA 4YRHA 2HV2A 4U9ZA 1L0CA 1CJWA 2CY2A 1KUVA 3BJ7A 4H89A 1M4DA 2FS5A 4LUAA 4KLWA 2P6FA 1NSLA 4MHDA 1B6BA 4R3KA 4B5OA 2Q4VA 4GS4A 4PV6A 3FYNA 5EBVA 1S3ZA 4KORA 2FSRA 3R96A 2CNTA 2B4DB 3TTHA 3TE4A 3DDDA 3DNSA 4F6AA 4AVAA 2IL4A 1Y7RA 5KTDA 4K30A 4JXRA 3TCVA 1XE4A 4Y49C 2F5IA 1XMTA 2VEZA 2BL1A 2QECA 4KVME 3W91A 3SXNA 3TO7A 4MY3A 3TT2A 3SHPA 3S6GA 5J8CA 5DWNA 2FXFA 2Q4YA 3VWEA 3LD2A 4E2AA 4KOSA 2ZXVA 3FRMA 1MJ9A 1BO4A 1V0CA 4QB9A 3QB8A 3NE7A 1IB1E 4FD4A 2ATRA 1PUAA 2G0BA 2OH1A 2Q04A 4EVYA 2EVNA 4JLYA 2ZW5A 4HNWB 4UWIA 2FIAA 2G3TA 4CRYB 2KCWA 3CXPA 3FNCA 1S7LA 2I79A 5IX3A 5H86A 1Y9WA 3D8PA 1XEBA 4CAVA 1QSRA 3IGRA 2D4PA 3F5BA 2QIRA 4XPDB 1Z4EA 3KKWA 1VHSA 4AB7A 4UWJA 4OLLA 2C27A 2AJ6A 3EXNA 4CRZB 1S60A 3WR7A 2OB0A 4OADA 4JD6A 2ZW4A 2I00A 3D3SA 3DSBA 3SXOA 4KUAA 3PP9A 4I49A 1I12A 4KVXA 4F0YA 2OU2A 3MGDA 4B5PB 2R98A 2GE3A 3R1KA 4PSWA 3CXQA 5F47A 4Y49B 2Q7BA 4KZTA 3GY9A 3JVNA 3D2PA 1MJAA 1RO5A 3PGPA 3VWDA 4FD6A 3EO4A 5JPHA 2HQYA 4KUBA 5IV0A 2JDDA 3S6HA 4HNYB 1YR0A 2R1IA 3PZJA 3W6SA 4PSXA 3FXTA 1KZFA 4H6ZA 1M44A 1QSTA 1YVOA 2O28A 4XNHC 1Z9UA 3QAHA 4NXYA 1YREA 4UA3A 2ARHA 4LX9A 2D4OA 5FVJA 2B3UA 4NEXA 4HKFA 5E96A 1IYKA 1P0HA 4FD7A 5KTCA 2PC1A 1XIXA 4HNXB 1OZPA 2DXQA 2R7HA 1B87A 2B4DA 2BEIA 4DNCA 1SQHA 1RXTA 2VZZA 1S7FA 3R9FA 3I3GA 4MI4A 2VI7A 5IB0A 2Z10A 2J8NA 4J3GA 3B8GA 4QC6A 2PR1A 2VZYA 1J4JA 5H84A 1ON0A 2ZPAA 2X7BA 1I21A 2B4BA 2VXKA 5DWMA 2B5GB 2OZUA 4E0AA 2JEVA 4U9YA 3E0KA 2GIVA 2AE6A 4KOVA 4AG9A 2RC4A 4XPKA 1UFHA 2HUZA 5C82A 1LRZA 3W6XA 3IWGA 4KOUA 3C26A 5I0CA 1IIDA 1Q2DA 2JDCA 5HH1A 4QBJA 1M4IA 4QVTA 1Z4RA 4M85A 2J8MA 3F8KA 3K9UA 4U5YA 4L8AA 4AVBA 2G3AA 4UBRA 4PK2A 5GCNA 3EFAA 1FY7A 3FIXA 2P6EA 1S7KA 4IF5A 2PSWA 2WPWA 4X5KA 1KUYA 5HMNA 2Z11A 1NMTA 2ZW6A 4KOTA 5C88A 5CNPA 2QMLA 4RI1A 3P2HA 3R9GA 2P0WA 4KOYA 1MK4A 1IYLA 4KVOE 3P2FA 2PR8A 1Q2CA 1TIQA 2FT0A 3FBUA 4R3LA 3GYAA 4CAXA 1N71A 4QUSA 4MY0A 4ZBGA 1P4NA 3TO9A 5F48A 3DR8A 4XPDC 4BMHA 5F49A 4RS2A 4B5PA 2FCKA 4R9MA 2JLMA 3CXSA 5ISVA 2FIWA 3EC4A 2WPXA 4PK3A 4YGOA 2FL4A 3I9SA 2BUEA 3OWCA
chains in the Genus database with same CATH superfamily
1R57A 3D7FA 3S6KA 1GHEA 3FX6A 2PCUA 3EY5A 2QVPA 1VKCA 1Y9KA 3T90A 1IGBA 2PRBA 3CPAA 3ZZIA 2WSAA 1WWZA 2H5MA 3RAMA 3PB6X 3HUVA 1NE9A 4OAEA 2AFOA 2XEFA 1QSOA 1M1DA 6CPAA 5HXDA 3IWEA 4UIBA 4Z65A 2NSMA 4CYQA 2DPSA 2HB6A 1YGHA 4YWYA 5JQ4A 3KQZA 4GXHA 4Q7AA 2EUIA 1Q2YA 2EK9A 3KGQA 1QSMA 4MHYA 3GUXA 1QSNA 2PRQA 3PRTA 4KOWA 4P4FA 3UY5A 4YFJA 4EWTA 2RB7A 1ARLA 2AFZA 2OZHA 3PB4X 4JWPA 3PFEA 5HVFA 4MXUA 5AGEA 2CTCA 4NGNA 3R9EA 4RUHA 2K5TA 4B14A 2VBQA 4OC5A 5I4MA 2VQYA 4NF1A 1YLOA 1ZG9A 5J8FA 1Z8WA 3FB3A 1M4LA 3NH5A 3T9YA 4MJ8A 4JXQA 3PBEA 4AVCA 3KZWA 4TNUA 2PE3A 5HVGA 4FBEA 4M3SA 3KL9A 2FE7A 3JUWA 4CAWA 2Z3OA 4B13A 1YX0A 3D2MA 4ONUA 5HVHA 2NMTA 5EC4A 1YLEA 2PQ8A 2PJ8A 1WK4A 1S7NA 4PXDA 2EWBA 4AG7A 5IB9A 5LYFA 1JQGA 1Y7EA 3TOBA 2CNSA 4KLVA 4MFJA 3IO1A 1K4JA 4ZX8A 4H6UA 3R95A 1YK3A 3N7ZA 2Y0MA 4PXBA 1CBXA 4P4EA 1HDUA 4R87A 1CM0A 4P4JA 4A95A 5LYLA 3ZJ0A 2CF4A 4FAIA 1X10A 1QMUA 3BI0A 4NSQA 4NCZA 2B5GA 1I1DA 3KHZA 3DLJA 4CS0B 2G9DA 2IJZA 4F8ZA 1FNOA 4MBUA 3S6FA 1YMEA 3TO6A 4M6GA 2POKA 2PJ4A 1BOBA 2B3VA 2CXAA 2Z0ZA 2ODFA 3KR4A 4B12A 3TFYA 3GKRA 1VHEA 2REEA 3F0AA 2XEIA 2Q44A 3TOAA 4CPAA 4JJXA 4KSIA 1ELLP 1KWMA 3BI1A 3PEIA 4DUKA 1U6MA 4MCRA 4ORFA 4R57A 2A4NA 1KUXA 1S5KA 2J8RA 1XF8A 4BBHA 1IICA 4II9A 2Q0YA 4ZI6A 2PDOA 2QYVA 4XNHB 1PU9A 4KOXA 2BSWA 3D7HA 2B58A 2CNMA 2OZGA 5CBMA 2Z3MA 3JTKA 2ZW7A 4CGOA 2PJAA 1Q7LA 3RYOA 4F0XA 4F9UA 4UFWA 3GB0A 3NH8A 2REFA 2GLJA 1ZG7A 3DR6A 5ELYA 5KTAA 2GANA 2Q43A 1DE4C 1ZO0A 4UIAA 2Z3PA 3H4QA 4UCMA 1YVKA 5G20A 4DYOA 3G8WA 3G3SA 4L89A 3BJ8A 3BLNA 1MJBA 2P6GA 4B6ZA 3T8WA 3B3CA 3GLJA 3V8IA 2GU2A 4IUSA 2R8VA 4WWVA 4FD5A 3LODA 5F46A 4OC4A 4E8OA 5AG4A 3WABA 4F0YA 2YGWA 1M4GA 4P45A 3PFOA 4XPLA 4YRHA 2HV2A 4U9ZA 4A2ZA 1L0CA 2DEAA 1CJWA 2CY2A 4QBJA 1KUVA 3BJ7A 4H89A 1Y0RA 2C6PA 1M4DA 2FS5A 3B35A 4PXCA 4LUAA 4KLWA 1DTDA 4ZYQA 2P6FA 1YW6A 1X12A 1NSLA 3VATA 4MHDA 1B6BA 5D29A 4R3KA 4B5OA 2Q4VA 3FEEA 4GS4A 3KQXA 4PV6A 3FYNA 3SJXA 4ZY1A 4ZX9A 2PJ2A 5EBVA 1S3ZA 1JWQA 4KORA 1TF9A 2FSRA 3R96A 2CNTA 2PJ0A 1XRYA 2B4DB 3JRUA 3TTHA 3TE4A 5J1QA 2PVVA 3FMCA 1IOFA 2GREA 4C68A 5JH9A 3DDDA 1CPSA 1NSAA 2PIZA 3DNSA 3IIBA 4AVAA 2WYRA 4F6AA 2IL4A 3RZAA 4P6YA 1Y7RA 5KTDA 1TKHA 4HPSA 4K30A 2XEGA 4MFQA 2AFXA 2C6GA 1XMBA 2PJBA 4JXRA 4P44A 3RNZA 3TCVA 4RN7A 1XE4A 4Y49C 2F5IA 4A30A 5A27A 3H8GA 4FUUA 4UEFA 1GYTA 1XMTA 4CYNA 2VEZA 2BL1A 4OC1A 2QECA 2EBJA 3IWWA 4KVME 3CPXA 3W91A 5JGFA 5D8NA 3SI1A 4A38A 3SXNA 2ZOFA 3TO7A 4MY3A 4UF4A 2PJ3A 3SHPA 3TT2A 4DJLA 3S6GA 3H8EA 4BD9A 5J8CA 4PXEA 5DWNA 3HLPA 4CGMA 2FXFA 2Q4YA 3VWEA 3LD2A 4E2AA 4KOSA 2ZXVA 3FH4A 2EO8A 4B11A 3FRMA 1AMPA 1MJ9A 3WC5A 4FWUA 2V8GA 4P4BA 1BO4A 1V0CA 3FEDA 4QB9A 4P4IA 5K8PA 3QB8A 4C2ZA 2EK8A 4Q36A 3NE7A 1IB1E 4FD4A 2ATRA 4KSFA 1PUAA 2G0BA 2OH1A 2Q04A 5G22A 4EVYA 2EVNA 2QJ8A 4JLYA 4C2XA 1TKJA 2ZW5A 4HNWB 4R6TA 4X3RA 4OC2A 1ZLHA 4KS9A 3D66A 1LAMA 4C7IA 4UWIA 4CAEA 4CYOA 8CPAA 2FIAA 2G3TA 3QNVA 4CRYB 2KCWA 2NYQA 3CXPA 3NH4A 2Z3NA 7CPAA 3FVLA 1AYEA 3FNCA 1TKFA 1S7LA 2I79A 2VL1A 5IX3A 1YQEA 3B3SA 5H86A 1Y9WA 3D8PA 4GM5A 1XEBA 4OP4A 1CP6A 4CAVA 1QSRA 4NGQA 2YNEA 3IGRA 2D4PA 3F5BA 1F57A 2QIRA 4XPDB 1PCAA 3B3TA 1Z4EA 3IJ3A 3KKWA 1VHSA 3GIUA 4ONWA 1EE3P 4AB7A 3QAYA 3BHXA 4OC3A 4YU9A 4UWJA 3CZXA 3FJUA 4OLLA 3WC7A 2C27A 3CDXA 1R3NA 2AJ6A 5CPAA 3EXNA 3IEHA 4CRZB 1S60A 4ZY2A 3WR7A 2OB0A 4MFZA 3BXMA 3DGVA 3I1UA 4MHNA 4ZGYB 4OADA 4JD6A 2ZW4A 3NFZA 3PB9X 1LCPA 2I00A 1VHOA 2V77A 3D3SA 3DSBA 3SXOA 4Q38A 2AFUA 2PJ6A 4KUAA 2F7VA 3KHXA 4NJRA 3PP9A 2OR4A 3A9LA 2BOAA 4I49A 1I12A 2ZEOA 3MN8A 4KVXA 2CTBA 4C2YA 5AG5A 3S9MA 2OU2A 2JBKA 1BPMA 3MGDA 2DPTA 4MCQA 1Z5RA 4OIWA 4A94A 4B5PB 2R98A 2GE3A 3R1KA 4UFXA 4PSWA 4MFKA 3CXQA 5F47A 4Y49B 1FT7A 2Q7BA 4KZTA 3RO0A 3GY9A 3JVNA 3D2PA 3K9TA 1MJAA 1RO5A 3PGPA 2ANPA 3VWDA 4C7HA 1ARMA 4FD6A 3EO4A 5JPHA 4A32A 3SJEA 2HC9A 2HQYA 4KUBA 5IV0A 1BAVA 1LANA 2F8HA 3NA6A 4R8FA 3V7ZA 2JDDA 3S6HA 2DF5A 4HNYB 4NGSA 1YR0A 2R1IA 3PZJA 3W6SA 2JBJA 1BPNA 4PSXA 3ISXA 3FXTA 1KZFA 4H6ZA 2ZELA 3FECA 1M44A 5AG7A 4MMOA 3VARA 1QSTA 1YVOA 1BLLE 2O28A 4XNHC 2ZENA 4M6IA 1VGYA 1Z9UA 4PPZA 3QAHA 4NXYA 2Z3KA 4OIDA 1YREA 4UA3A 2ARHA 2RFHA 2PIYA 4LX9A 4CGLA 3TX8A 3SI2A 2D4OA 5FVJA 2B3UA 4NEXA 5K8NA 4HKFA 4CGPA 4UEZA 5E96A 3CT9A 1IYKA 3TC8A 3H8FA 1P0HA 2GFQA 4FD7A 4LQ6A 4AXVA 5KTCA 2V8DA 2PC1A 4ZY0A 3NE8A 2XEJA 1Y0YA 5A28A 3FF3A 1XIXA 4HNXB 1OZPA 1XJOA 2DXQA 2R7HA 1B87A 2B4DA 2YNCA 2ZEEA 2BEIA 2Q4ZA 4DNCA 3SJFA 1R43A 1SQHA 1RXTA 2VZZA 1S7FA 3R9FA 3I3GA 3K2KA 3KR5A 4MI4A 4X2TA 2VI7A 4JZ0A 5IB0A 2BO9A 4MFLA 1ZLIA 2ABZA 1YSJA 2Z10A 2J8NA 5LYIA 4X8IA 4J3GA 4OC0A 3B8GA 4QC6A 2IMOA 3WT4A 4OKOA 3KI9A 2PR1A 2VZYA 1J4JA 4H2KA 4OMEA 5H84A 1ON0A 1H8LA 2ZPAA 4NGPA 3MRUA 4EFDA 3LMSA 1IU8A 2YNDA 5LRKA 2X7BA 1I21A 4MCSA 3V38A 3D67A 4TWEA 2AFWA 2B4BA 4UEEA 2VXKA 5BWAB 4B10A 5DWMA 2I3CA 2B5GB 1CG2A 1Z8XA 2OZUA 4E0AA 3IC1A 2JEVA 2YNCC 3PB8X 4U9YA 2WUUA 4BINA 3B3VA 3E0KA 2GIVA 2AE6A 4G1PA 4KOVA 2RC4A 4AG9A 2ZEHA 3LACA 1UFHA 4XPKA 3WC6A 2HUZA 4CGNA 4IHMA 5C82A 1HEEA 1LRZA 3W6XA 3IWGA 2ZEGA 3D4UA 1Z8TA 1CP7A 4KOUA 3S9LA 1XFOA 5EMIA 3S9NA 3C26A 2C1CA 3H5ZA 5I0CA 4MHZA 1Z2LA 1IIDA 4CYPA 1Q2DA 2JDCA 1TF8A 4O23A 4A39A 5HH1A 1LAPA 4NJQA 3D7DA 1TXRA 1LOKA 1F2PA 2FVGA 3B7IA 1XOVA 5THWA 2PJ1A 2CIJA 2ZEPA 4W9YA 5G1ZA 1M4IA 4QVTA 4F9VA 1Z4RA 4M85A 2J8MA 5G21A 3F8KA 5K8OA 4UFVA 3K9UA 3PB7X 2O4HA 4MRIA 2ZEMA 4PQAA 4U5YA 2Q7SA 3D7GA 4NGMA 4L8AA 4EMEA 4AVBA 2PJ7A 2G3AA 3PBBA 3B2YA 2ZEFA 4UBRA 4PK2A 5GCNA 2WZNA 3EFAA 1FY7A 3FIXA 2P6EA 1CPXA 1S7KA 4R7MA 4IF5A 4MCPA 5F09A 1LFWA 2PSWA 2WPWA 2Z3LA 2OOTA 4WJBA 2ZEDA 4R76A 4LQGA 1F2OA 2V8VA 4A37A 4X5KA 2O53A 4M6HA 5LYDA 1KUYA 1VIXA 5HMNA 2Z11A 1CX8A 1QQ9A 4KSAA 5AG6A 4NFRA 1NMTA 4K3NA 4MHPA 4UCPA 4IAVA 2ZW6A 3D68A 1ELMP 4KOTA 2QMLA 4JYWA 4NGRA 3P2HA 4P10A 4RI1A 5CNPA 5C88A 3R9GA 2P0WA 1Z8LA 4KOYA 1MK4A 1IYLA 1UWYA 4A33A 1XBUA 1OBRA 3SJGA 3RBUA 4CAFA 3L2NA 4KVOE 2Q51A 2JEWA 3P2FA 5LRGA 4A31A 2AFSA 2PJCA 2PR8A 3IU2A 1PYTB 1YW4A 5DS0A 1Q2CA 1TIQA 1RTQA 2J9AA 3ISZA 2C6CA 2FT0A 2V8HA 3FBUA 3IFEA 2PJ9A 3GYAA 4R3LA 1N71A 1IY7A 2BCOA 4P4DA 4QUSA 1ZG8A 4CAXA 4MY0A 4ZBGA 1A2ZA 3N5FA 1P4NA 3TO9A 5F48A 3DR8A 5LRJA 4XPDC 3SI0A 4BMHA 2ZOGA 5F49A 3VH9A 3KASA 1IOIA 4NGTA 4UCNA 4RS2A 4B5PA 3B3WA 2IQ6A 2PJ5A 2FCKA 4R9MA 2GLFA 2PVWA 1AUGA 2JLMA 1HDQA 3CXSA 3LWUA 5ISVA 2FIWA 3EC4A 2WPXA 4PK3A 4YGOA 2FL4A 3IU1A 3I9SA 5JM6A 5K8MA 2BUEA 4MFPA 3OWCA 2AFMA 4IK2A
chains in the Genus database with same CATH topology
1R57A 3S6KA 1GHEA 3EY5A 1VKCA 1Y9KA 3T90A 2PRBA 3ZZIA 2WSAA 1WWZA 2H5MA 1NE9A 4OAEA 1QSOA 1M1DA 3IWEA 4CYQA 2DPSA 1YGHA 5JQ4A 2EUIA 1Q2YA 1QSMA 1QSNA 4KOWA 3UY5A 4YFJA 2OZHA 4JWPA 5AGEA 3R9EA 2K5TA 4B14A 2VBQA 2VQYA 4NF1A 5J8FA 3FB3A 3T9YA 4MJ8A 4JXQA 4AVCA 4M3SA 2FE7A 3JUWA 4CAWA 2Z3OA 4B13A 1YX0A 3D2MA 4ONUA 2NMTA 5EC4A 1YLEA 2PQ8A 1WK4A 1S7NA 4AG7A 3TOBA 2CNSA 4KLVA 4MFJA 1K4JA 4H6UA 3R95A 1YK3A 3N7ZA 2Y0MA 4R87A 1CM0A 4A95A 3ZJ0A 4NSQA 4NCZA 2B5GA 1I1DA 4CS0B 4MBUA 3S6FA 3TO6A 1BOBA 2B3VA 2CXAA 2Z0ZA 4B12A 3TFYA 3GKRA 2REEA 3F0AA 2Q44A 3TOAA 4JJXA 1U6MA 4R57A 4ORFA 2A4NA 1KUXA 1S5KA 2J8RA 1XF8A 4BBHA 1IICA 4II9A 2Q0YA 2PDOA 4XNHB 1PU9A 4KOXA 2BSWA 2B58A 2CNMA 2OZGA 2Z3MA 3JTKA 2ZW7A 4CGOA 3RYOA 4F0XA 4UFWA 2REFA 3DR6A 5KTAA 2GANA 1ZO0A 2Z3PA 3H4QA 4UCMA 1YVKA 5G20A 3G8WA 3G3SA 4L89A 3BJ8A 3BLNA 1MJBA 2P6GA 3V8IA 4IUSA 2R8VA 4FD5A 3LODA 5F46A 4E8OA 5AG4A 2YGWA 1M4GA 4XPLA 4YRHA 2HV2A 4U9ZA 4A2ZA 1L0CA 1CJWA 2CY2A 1KUVA 3BJ7A 4H89A 1M4DA 2FS5A 4LUAA 4KLWA 2P6FA 1NSLA 4MHDA 1B6BA 4R3KA 4B5OA 2Q4VA 4GS4A 4PV6A 3FYNA 5EBVA 1S3ZA 4KORA 2FSRA 3R96A 2CNTA 2B4DB 3TTHA 3TE4A 4C68A 3DDDA 3DNSA 4F6AA 4AVAA 2IL4A 1Y7RA 5KTDA 4K30A 4MFQA 4JXRA 3TCVA 1XE4A 4Y49C 2F5IA 4A30A 5A27A 1XMTA 4CYNA 2VEZA 2BL1A 2QECA 4KVME 3W91A 3SXNA 3TO7A 4MY3A 3TT2A 3SHPA 3S6GA 5J8CA 5DWNA 4CGMA 2FXFA 2Q4YA 3VWEA 3LD2A 4E2AA 4KOSA 2ZXVA 4B11A 3FRMA 1MJ9A 1BO4A 1V0CA 4QB9A 3QB8A 4C2ZA 4Q36A 3NE7A 1IB1E 4FD4A 2ATRA 4KSFA 1PUAA 2G0BA 2OH1A 2Q04A 5G22A 4EVYA 2EVNA 4JLYA 4C2XA 2ZW5A 4HNWB 4KS9A 4C7IA 4UWIA 4CAEA 4CYOA 2FIAA 2G3TA 4CRYB 2KCWA 3CXPA 2Z3NA 3FNCA 1S7LA 2I79A 5IX3A 5H86A 1Y9WA 3D8PA 1XEBA 4CAVA 1QSRA 2YNEA 3IGRA 2D4PA 3F5BA 2QIRA 4XPDB 1Z4EA 3KKWA 1VHSA 4AB7A 4UWJA 4OLLA 2C27A 2AJ6A 3EXNA 4CRZB 1S60A 3WR7A 2OB0A 4MFZA 4ZGYB 4OADA 4JD6A 2ZW4A 2I00A 3D3SA 3DSBA 3SXOA 4Q38A 4KUAA 3PP9A 3A9LA 4I49A 1I12A 4KVXA 4F0YA 4C2YA 5AG5A 2OU2A 3MGDA 2DPTA 4B5PB 2R98A 2GE3A 3R1KA 4UFXA 4PSWA 4MFKA 3CXQA 5F47A 4Y49B 2Q7BA 4KZTA 3GY9A 3JVNA 3D2PA 1MJAA 1RO5A 3PGPA 3VWDA 4C7HA 4FD6A 3EO4A 5JPHA 4A32A 2HQYA 4KUBA 5IV0A 2JDDA 3S6HA 4HNYB 1YR0A 2R1IA 3PZJA 3W6SA 4PSXA 3FXTA 1KZFA 4H6ZA 1M44A 5AG7A 1QSTA 1YVOA 2O28A 4XNHC 1Z9UA 3QAHA 4NXYA 2Z3KA 1YREA 4UA3A 2ARHA 4LX9A 4CGLA 2D4OA 5FVJA 2B3UA 4NEXA 4HKFA 4CGPA 5E96A 1IYKA 1P0HA 4FD7A 5KTCA 2PC1A 5A28A 1XIXA 4HNXB 1OZPA 2DXQA 2R7HA 1B87A 2B4DA 2YNCA 2BEIA 4DNCA 1SQHA 1RXTA 2VZZA 1S7FA 3R9FA 3I3GA 4MI4A 2VI7A 5IB0A 4MFLA 2Z10A 2J8NA 4J3GA 3B8GA 4QC6A 2PR1A 2VZYA 1J4JA 5H84A 1ON0A 2ZPAA 2YNDA 2X7BA 1I21A 2B4BA 2VXKA 5BWAB 4B10A 5DWMA 2B5GB 2OZUA 4E0AA 2JEVA 2YNCC 4U9YA 2WUUA 3E0KA 2GIVA 2AE6A 4KOVA 4AG9A 2RC4A 4XPKA 1UFHA 2HUZA 4CGNA 5C82A 1LRZA 3W6XA 3IWGA 4KOUA 3C26A 3H5ZA 5I0CA 1IIDA 4CYPA 1Q2DA 2JDCA 5HH1A 4QBJA 5G1ZA 1M4IA 4QVTA 1Z4RA 4M85A 2J8MA 5G21A 3F8KA 4UFVA 3K9UA 4U5YA 4L8AA 4AVBA 2G3AA 4UBRA 4PK2A 5GCNA 3EFAA 1FY7A 3FIXA 2P6EA 1S7KA 4IF5A 2PSWA 2WPWA 2Z3LA 4X5KA 1KUYA 5HMNA 2Z11A 5AG6A 4KSAA 1NMTA 4UCPA 2ZW6A 4KOTA 5C88A 5CNPA 2QMLA 4RI1A 3P2HA 3R9GA 2P0WA 4KOYA 1MK4A 1IYLA 4A33A 4CAFA 4KVOE 3P2FA 4A31A 2PR8A 3IU2A 1Q2CA 1TIQA 2FT0A 3FBUA 4R3LA 3GYAA 4CAXA 1N71A 4QUSA 4MY0A 4ZBGA 1P4NA 3TO9A 5F48A 3DR8A 4XPDC 4BMHA 5F49A 4UCNA 4RS2A 4B5PA 2FCKA 4R9MA 2JLMA 3CXSA 5ISVA 2FIWA 3EC4A 2WPXA 4PK3A 4YGOA 2FL4A 3IU1A 3I9SA 2BUEA 4MFPA 3OWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R57 A;  3S6K A;  1GHE A;  3EY5 A;  1VKC A;  1Y9K A;  3T90 A;  2PRB A;  3ZZI A;  1WWZ A;  2H5M A;  1NE9 A;  4OAE A;  1QSO A;  1M1D A;  1YGH A;  5JQ4 A;  2EUI A;  1Q2Y A;  1QSM A;  1QSN A;  4KOW A;  3UY5 A;  4YFJ A;  2OZH A;  4JWP A;  3R9E A;  2K5T A;  2VBQ A;  2VQY A;  4NF1 A;  5J8F A;  3FB3 A;  3T9Y A;  4MJ8 A;  4JXQ A;  4AVC A;  4M3S A;  2FE7 A;  3JUW A;  4CAW A;  1YX0 A;  3D2M A;  4ONU A;  2NMT A;  5EC4 A;  1YLE A;  2PQ8 A;  1WK4 A;  1S7N A;  4AG7 A;  3TOB A;  2CNS A;  4KLV A;  1K4J A;  4H6U A;  3R95 A;  1YK3 A;  3N7Z A;  2Y0M A;  4R87 A;  1CM0 A;  3ZJ0 A;  4NSQ A;  4NCZ A;  2B5G A;  1I1D A;  4CS0 B;  4MBU A;  3S6F A;  3TO6 A;  1BOB A;  2B3V A;  2Z0Z A;  3TFY A;  3GKR A;  2REE A;  3F0A A;  2Q44 A;  3TOA A;  4JJX A;  1U6M A;  4R57 A;  4ORF A;  2A4N A;  1KUX A;  1S5K A;  2J8R A;  1XF8 A;  1IIC A;  4II9 A;  2Q0Y A;  2PDO A;  4XNH B;  1PU9 A;  4KOX A;  2BSW A;  2B58 A;  2CNM A;  2OZG A;  2ZW7 A;  3RYO A;  2REF A;  3DR6 A;  5KTA A;  2GAN A;  3H4Q A;  1YVK A;  3G8W A;  3G3S A;  4L89 A;  3BJ8 A;  3BLN A;  1MJB A;  2P6G A;  3V8I A;  4IUS A;  2R8V A;  4FD5 A;  3LOD A;  5F46 A;  4E8O A;  1M4G A;  4XPL A;  4YRH A;  2HV2 A;  4U9Z A;  1L0C A;  1CJW A;  2CY2 A;  1KUV A;  3BJ7 A;  4H89 A;  1M4D A;  2FS5 A;  4LUA A;  4KLW A;  2P6F A;  1NSL A;  4MHD A;  1B6B A;  4R3K A;  4B5O A;  2Q4V A;  4GS4 A;  4PV6 A;  3FYN A;  5EBV A;  1S3Z A;  4KOR A;  2FSR A;  3R96 A;  2CNT A;  2B4D B;  3TTH A;  3TE4 A;  3DDD A;  3DNS A;  4F6A A;  4AVA A;  2IL4 A;  1Y7R A;  5KTD A;  4K30 A;  4JXR A;  3TCV A;  1XE4 A;  4Y49 C;  2F5I A;  1XMT A;  2VEZ A;  2BL1 A;  2QEC A;  4KVM E;  3W91 A;  3SXN A;  3TO7 A;  4MY3 A;  3TT2 A;  3SHP A;  3S6G A;  5J8C A;  5DWN A;  2FXF A;  2Q4Y A;  3VWE A;  3LD2 A;  4E2A A;  4KOS A;  2ZXV A;  3FRM A;  1MJ9 A;  1BO4 A;  1V0C A;  4QB9 A;  3QB8 A;  3NE7 A;  1IB1 E;  4FD4 A;  2ATR A;  1PUA A;  2G0B A;  2OH1 A;  2Q04 A;  4EVY A;  2EVN A;  4JLY A;  2ZW5 A;  4HNW B;  4UWI A;  2FIA A;  2G3T A;  4CRY B;  2KCW A;  3CXP A;  3FNC A;  1S7L A;  2I79 A;  5IX3 A;  5H86 A;  1Y9W A;  3D8P A;  1XEB A;  4CAV A;  1QSR A;  3IGR A;  2D4P A;  3F5B A;  2QIR A;  4XPD B;  1Z4E A;  3KKW A;  1VHS A;  4AB7 A;  4UWJ A;  4OLL A;  2C27 A;  2AJ6 A;  3EXN A;  4CRZ B;  1S60 A;  3WR7 A;  2OB0 A;  4OAD A;  4JD6 A;  2ZW4 A;  2I00 A;  3D3S A;  3DSB A;  3SXO A;  4KUA A;  3PP9 A;  4I49 A;  1I12 A;  4KVX A;  4F0Y A;  2OU2 A;  3MGD A;  4B5P B;  2R98 A;  2GE3 A;  3R1K A;  4PSW A;  3CXQ A;  5F47 A;  4Y49 B;  2Q7B A;  4KZT A;  3GY9 A;  3JVN A;  3D2P A;  1MJA A;  1RO5 A;  3PGP A;  3VWD A;  4FD6 A;  3EO4 A;  5JPH A;  2HQY A;  4KUB A;  5IV0 A;  2JDD A;  3S6H A;  4HNY B;  1YR0 A;  2R1I A;  3PZJ A;  3W6S A;  4PSX A;  3FXT A;  1KZF A;  4H6Z A;  1M44 A;  1QST A;  1YVO A;  2O28 A;  4XNH C;  1Z9U A;  3QAH A;  4NXY A;  1YRE A;  4UA3 A;  2ARH A;  4LX9 A;  2D4O A;  5FVJ A;  2B3U A;  4NEX A;  4HKF A;  5E96 A;  1IYK A;  1P0H A;  4FD7 A;  5KTC A;  2PC1 A;  1XIX A;  4HNX B;  1OZP A;  2DXQ A;  2R7H A;  1B87 A;  2B4D A;  2BEI A;  4DNC A;  1SQH A;  1RXT A;  2VZZ A;  1S7F A;  3R9F A;  3I3G A;  4MI4 A;  2VI7 A;  5IB0 A;  2Z10 A;  2J8N A;  4J3G A;  3B8G A;  4QC6 A;  2PR1 A;  2VZY A;  1J4J A;  5H84 A;  1ON0 A;  2ZPA A;  2X7B A;  1I21 A;  2B4B A;  2VXK A;  5DWM A;  2B5G B;  2OZU A;  4E0A A;  2JEV A;  4U9Y A;  3E0K A;  2GIV A;  2AE6 A;  4KOV A;  4AG9 A;  2RC4 A;  4XPK A;  1UFH A;  2HUZ A;  5C82 A;  1LRZ A;  3W6X A;  3IWG A;  4KOU A;  3C26 A;  5I0C A;  1IID A;  1Q2D A;  2JDC A;  5HH1 A;  4QBJ A;  1M4I A;  4QVT A;  1Z4R A;  4M85 A;  2J8M A;  3F8K A;  3K9U A;  4U5Y A;  4L8A A;  4AVB A;  2G3A A;  4UBR A;  4PK2 A;  5GCN A;  3EFA A;  1FY7 A;  3FIX A;  2P6E A;  1S7K A;  4IF5 A;  2PSW A;  2WPW A;  4X5K A;  1KUY A;  5HMN A;  2Z11 A;  1NMT A;  2ZW6 A;  4KOT A;  5C88 A;  5CNP A;  2QML A;  4RI1 A;  3P2H A;  3R9G A;  2P0W A;  4KOY A;  1MK4 A;  1IYL A;  4KVO E;  3P2F A;  2PR8 A;  1Q2C A;  1TIQ A;  2FT0 A;  3FBU A;  4R3L A;  3GYA A;  4CAX A;  1N71 A;  4QUS A;  4MY0 A;  4ZBG A;  1P4N A;  3TO9 A;  5F48 A;  3DR8 A;  4XPD C;  4BMH A;  5F49 A;  4RS2 A;  4B5P A;  2FCK A;  4R9M A;  2JLM A;  3CXS A;  5ISV A;  2FIW A;  3EC4 A;  2WPX A;  4PK3 A;  4YGO A;  2FL4 A;  3I9S A;  2BUE A;  3OWC A; 
#chains in the Genus database with same CATH topology
 1R57 A;  3D7F A;  3S6K A;  1GHE A;  3FX6 A;  2PCU A;  3EY5 A;  2QVP A;  1VKC A;  1Y9K A;  3T90 A;  1IGB A;  2PRB A;  3CPA A;  3ZZI A;  2WSA A;  1WWZ A;  2H5M A;  3RAM A;  3PB6 X;  3HUV A;  1NE9 A;  4OAE A;  2AFO A;  2XEF A;  1QSO A;  1M1D A;  6CPA A;  5HXD A;  3IWE A;  4UIB A;  4Z65 A;  2NSM A;  4CYQ A;  2DPS A;  2HB6 A;  1YGH A;  4YWY A;  5JQ4 A;  3KQZ A;  4GXH A;  4Q7A A;  2EUI A;  1Q2Y A;  2EK9 A;  3KGQ A;  1QSM A;  4MHY A;  3GUX A;  1QSN A;  2PRQ A;  3PRT A;  4KOW A;  4P4F A;  3UY5 A;  4YFJ A;  4EWT A;  2RB7 A;  1ARL A;  2AFZ A;  2OZH A;  3PB4 X;  4JWP A;  3PFE A;  5HVF A;  4MXU A;  5AGE A;  2CTC A;  4NGN A;  3R9E A;  4RUH A;  2K5T A;  4B14 A;  2VBQ A;  4OC5 A;  5I4M A;  2VQY A;  4NF1 A;  1YLO A;  1ZG9 A;  5J8F A;  1Z8W A;  3FB3 A;  1M4L A;  3NH5 A;  3T9Y A;  4MJ8 A;  4JXQ A;  3PBE A;  4AVC A;  3KZW A;  4TNU A;  2PE3 A;  5HVG A;  4FBE A;  4M3S A;  3KL9 A;  2FE7 A;  3JUW A;  4CAW A;  2Z3O A;  4B13 A;  1YX0 A;  3D2M A;  4ONU A;  5HVH A;  2NMT A;  5EC4 A;  1YLE A;  2PQ8 A;  2PJ8 A;  1WK4 A;  1S7N A;  4PXD A;  2EWB A;  4AG7 A;  5IB9 A;  5LYF A;  1JQG A;  1Y7E A;  3TOB A;  2CNS A;  4KLV A;  4MFJ A;  3IO1 A;  1K4J A;  4ZX8 A;  4H6U A;  3R95 A;  1YK3 A;  3N7Z A;  2Y0M A;  4PXB A;  1CBX A;  4P4E A;  1HDU A;  4R87 A;  1CM0 A;  4P4J A;  4A95 A;  5LYL A;  3ZJ0 A;  2CF4 A;  4FAI A;  1X10 A;  1QMU A;  3BI0 A;  4NSQ A;  4NCZ A;  2B5G A;  1I1D A;  3KHZ A;  3DLJ A;  4CS0 B;  2G9D A;  2IJZ A;  4F8Z A;  1FNO A;  4MBU A;  3S6F A;  1YME A;  3TO6 A;  4M6G A;  2POK A;  2PJ4 A;  1BOB A;  2B3V A;  2CXA A;  2Z0Z A;  2ODF A;  3KR4 A;  4B12 A;  3TFY A;  3GKR A;  1VHE A;  2REE A;  3F0A A;  2XEI A;  2Q44 A;  3TOA A;  4CPA A;  4JJX A;  4KSI A;  1ELL P;  1KWM A;  3BI1 A;  3PEI A;  4DUK A;  1U6M A;  4MCR A;  4ORF A;  4R57 A;  2A4N A;  1KUX A;  1S5K A;  2J8R A;  1XF8 A;  4BBH A;  1IIC A;  4II9 A;  2Q0Y A;  4ZI6 A;  2PDO A;  2QYV A;  4XNH B;  1PU9 A;  4KOX A;  2BSW A;  3D7H A;  2B58 A;  2CNM A;  2OZG A;  5CBM A;  2Z3M A;  3JTK A;  2ZW7 A;  4CGO A;  2PJA A;  1Q7L A;  3RYO A;  4F0X A;  4F9U A;  4UFW A;  3GB0 A;  3NH8 A;  2REF A;  2GLJ A;  1ZG7 A;  3DR6 A;  5ELY A;  5KTA A;  2GAN A;  2Q43 A;  1DE4 C;  1ZO0 A;  4UIA A;  2Z3P A;  3H4Q A;  4UCM A;  1YVK A;  5G20 A;  4DYO A;  3G8W A;  3G3S A;  4L89 A;  3BJ8 A;  3BLN A;  1MJB A;  2P6G A;  4B6Z A;  3T8W A;  3B3C A;  3GLJ A;  3V8I A;  2GU2 A;  4IUS A;  2R8V A;  4WWV A;  4FD5 A;  3LOD A;  5F46 A;  4OC4 A;  4E8O A;  5AG4 A;  3WAB A;  4F0Y A;  2YGW A;  1M4G A;  4P45 A;  3PFO A;  4XPL A;  4YRH A;  2HV2 A;  4U9Z A;  4A2Z A;  1L0C A;  2DEA A;  1CJW A;  2CY2 A;  4QBJ A;  1KUV A;  3BJ7 A;  4H89 A;  1Y0R A;  2C6P A;  1M4D A;  2FS5 A;  3B35 A;  4PXC A;  4LUA A;  4KLW A;  1DTD A;  4ZYQ A;  2P6F A;  1YW6 A;  1X12 A;  1NSL A;  3VAT A;  4MHD A;  1B6B A;  5D29 A;  4R3K A;  4B5O A;  2Q4V A;  3FEE A;  4GS4 A;  3KQX A;  4PV6 A;  3FYN A;  3SJX A;  4ZY1 A;  4ZX9 A;  2PJ2 A;  5EBV A;  1S3Z A;  1JWQ A;  4KOR A;  1TF9 A;  2FSR A;  3R96 A;  2CNT A;  2PJ0 A;  1XRY A;  2B4D B;  3JRU A;  3TTH A;  3TE4 A;  5J1Q A;  2PVV A;  3FMC A;  1IOF A;  2GRE A;  4C68 A;  5JH9 A;  3DDD A;  1CPS A;  1NSA A;  2PIZ A;  3DNS A;  3IIB A;  4AVA A;  2WYR A;  4F6A A;  2IL4 A;  3RZA A;  4P6Y A;  1Y7R A;  5KTD A;  1TKH A;  4HPS A;  4K30 A;  2XEG A;  4MFQ A;  2AFX A;  2C6G A;  1XMB A;  2PJB A;  4JXR A;  4P44 A;  3RNZ A;  3TCV A;  4RN7 A;  1XE4 A;  4Y49 C;  2F5I A;  4A30 A;  5A27 A;  3H8G A;  4FUU A;  4UEF A;  1GYT A;  1XMT A;  4CYN A;  2VEZ A;  2BL1 A;  4OC1 A;  2QEC A;  2EBJ A;  3IWW A;  4KVM E;  3CPX A;  3W91 A;  5JGF A;  5D8N A;  3SI1 A;  4A38 A;  3SXN A;  2ZOF A;  3TO7 A;  4MY3 A;  4UF4 A;  2PJ3 A;  3SHP A;  3TT2 A;  4DJL A;  3S6G A;  3H8E A;  4BD9 A;  5J8C A;  4PXE A;  5DWN A;  3HLP A;  4CGM A;  2FXF A;  2Q4Y A;  3VWE A;  3LD2 A;  4E2A A;  4KOS A;  2ZXV A;  3FH4 A;  2EO8 A;  4B11 A;  3FRM A;  1AMP A;  1MJ9 A;  3WC5 A;  4FWU A;  2V8G A;  4P4B A;  1BO4 A;  1V0C A;  3FED A;  4QB9 A;  4P4I A;  5K8P A;  3QB8 A;  4C2Z A;  2EK8 A;  4Q36 A;  3NE7 A;  1IB1 E;  4FD4 A;  2ATR A;  4KSF A;  1PUA A;  2G0B A;  2OH1 A;  2Q04 A;  5G22 A;  4EVY A;  2EVN A;  2QJ8 A;  4JLY A;  4C2X A;  1TKJ A;  2ZW5 A;  4HNW B;  4R6T A;  4X3R A;  4OC2 A;  1ZLH A;  4KS9 A;  3D66 A;  1LAM A;  4C7I A;  4UWI A;  4CAE A;  4CYO A;  8CPA A;  2FIA A;  2G3T A;  3QNV A;  4CRY B;  2KCW A;  2NYQ A;  3CXP A;  3NH4 A;  2Z3N A;  7CPA A;  3FVL A;  1AYE A;  3FNC A;  1TKF A;  1S7L A;  2I79 A;  2VL1 A;  5IX3 A;  1YQE A;  3B3S A;  5H86 A;  1Y9W A;  3D8P A;  4GM5 A;  1XEB A;  4OP4 A;  1CP6 A;  4CAV A;  1QSR A;  4NGQ A;  2YNE A;  3IGR A;  2D4P A;  3F5B A;  1F57 A;  2QIR A;  4XPD B;  1PCA A;  3B3T A;  1Z4E A;  3IJ3 A;  3KKW A;  1VHS A;  3GIU A;  4ONW A;  1EE3 P;  4AB7 A;  3QAY A;  3BHX A;  4OC3 A;  4YU9 A;  4UWJ A;  3CZX A;  3FJU A;  4OLL A;  3WC7 A;  2C27 A;  3CDX A;  1R3N A;  2AJ6 A;  5CPA A;  3EXN A;  3IEH A;  4CRZ B;  1S60 A;  4ZY2 A;  3WR7 A;  2OB0 A;  4MFZ A;  3BXM A;  3DGV A;  3I1U A;  4MHN A;  4ZGY B;  4OAD A;  4JD6 A;  2ZW4 A;  3NFZ A;  3PB9 X;  1LCP A;  2I00 A;  1VHO A;  2V77 A;  3D3S A;  3DSB A;  3SXO A;  4Q38 A;  2AFU A;  2PJ6 A;  4KUA A;  2F7V A;  3KHX A;  4NJR A;  3PP9 A;  2OR4 A;  3A9L A;  2BOA A;  4I49 A;  1I12 A;  2ZEO A;  3MN8 A;  4KVX A;  2CTB A;  4C2Y A;  5AG5 A;  3S9M A;  2OU2 A;  2JBK A;  1BPM A;  3MGD A;  2DPT A;  4MCQ A;  1Z5R A;  4OIW A;  4A94 A;  4B5P B;  2R98 A;  2GE3 A;  3R1K A;  4UFX A;  4PSW A;  4MFK A;  3CXQ A;  5F47 A;  4Y49 B;  1FT7 A;  2Q7B A;  4KZT A;  3RO0 A;  3GY9 A;  3JVN A;  3D2P A;  3K9T A;  1MJA A;  1RO5 A;  3PGP A;  2ANP A;  3VWD A;  4C7H A;  1ARM A;  4FD6 A;  3EO4 A;  5JPH A;  4A32 A;  3SJE A;  2HC9 A;  2HQY A;  4KUB A;  5IV0 A;  1BAV A;  1LAN A;  2F8H A;  3NA6 A;  4R8F A;  3V7Z A;  2JDD A;  3S6H A;  2DF5 A;  4HNY B;  4NGS A;  1YR0 A;  2R1I A;  3PZJ A;  3W6S A;  2JBJ A;  1BPN A;  4PSX A;  3ISX A;  3FXT A;  1KZF A;  4H6Z A;  2ZEL A;  3FEC A;  1M44 A;  5AG7 A;  4MMO A;  3VAR A;  1QST A;  1YVO A;  1BLL E;  2O28 A;  4XNH C;  2ZEN A;  4M6I A;  1VGY A;  1Z9U A;  4PPZ A;  3QAH A;  4NXY A;  2Z3K A;  4OID A;  1YRE A;  4UA3 A;  2ARH A;  2RFH A;  2PIY A;  4LX9 A;  4CGL A;  3TX8 A;  3SI2 A;  2D4O A;  5FVJ A;  2B3U A;  4NEX A;  5K8N A;  4HKF A;  4CGP A;  4UEZ A;  5E96 A;  3CT9 A;  1IYK A;  3TC8 A;  3H8F A;  1P0H A;  2GFQ A;  4FD7 A;  4LQ6 A;  4AXV A;  5KTC A;  2V8D A;  2PC1 A;  4ZY0 A;  3NE8 A;  2XEJ A;  1Y0Y A;  5A28 A;  3FF3 A;  1XIX A;  4HNX B;  1OZP A;  1XJO A;  2DXQ A;  2R7H A;  1B87 A;  2B4D A;  2YNC A;  2ZEE A;  2BEI A;  2Q4Z A;  4DNC A;  3SJF A;  1R43 A;  1SQH A;  1RXT A;  2VZZ A;  1S7F A;  3R9F A;  3I3G A;  3K2K A;  3KR5 A;  4MI4 A;  4X2T A;  2VI7 A;  4JZ0 A;  5IB0 A;  2BO9 A;  4MFL A;  1ZLI A;  2ABZ A;  1YSJ A;  2Z10 A;  2J8N A;  5LYI A;  4X8I A;  4J3G A;  4OC0 A;  3B8G A;  4QC6 A;  2IMO A;  3WT4 A;  4OKO A;  3KI9 A;  2PR1 A;  2VZY A;  1J4J A;  4H2K A;  4OME A;  5H84 A;  1ON0 A;  1H8L A;  2ZPA A;  4NGP A;  3MRU A;  4EFD A;  3LMS A;  1IU8 A;  2YND A;  5LRK A;  2X7B A;  1I21 A;  4MCS A;  3V38 A;  3D67 A;  4TWE A;  2AFW A;  2B4B A;  4UEE A;  2VXK A;  5BWA B;  4B10 A;  5DWM A;  2I3C A;  2B5G B;  1CG2 A;  1Z8X A;  2OZU A;  4E0A A;  3IC1 A;  2JEV A;  2YNC C;  3PB8 X;  4U9Y A;  2WUU A;  4BIN A;  3B3V A;  3E0K A;  2GIV A;  2AE6 A;  4G1P A;  4KOV A;  2RC4 A;  4AG9 A;  2ZEH A;  3LAC A;  1UFH A;  4XPK A;  3WC6 A;  2HUZ A;  4CGN A;  4IHM A;  5C82 A;  1HEE A;  1LRZ A;  3W6X A;  3IWG A;  2ZEG A;  3D4U A;  1Z8T A;  1CP7 A;  4KOU A;  3S9L A;  1XFO A;  5EMI A;  3S9N A;  3C26 A;  2C1C A;  3H5Z A;  5I0C A;  4MHZ A;  1Z2L A;  1IID A;  4CYP A;  1Q2D A;  2JDC A;  1TF8 A;  4O23 A;  4A39 A;  5HH1 A;  1LAP A;  4NJQ A;  3D7D A;  1TXR A;  1LOK A;  1F2P A;  2FVG A;  3B7I A;  1XOV A;  5THW A;  2PJ1 A;  2CIJ A;  2ZEP A;  4W9Y A;  5G1Z A;  1M4I A;  4QVT A;  4F9V A;  1Z4R A;  4M85 A;  2J8M A;  5G21 A;  3F8K A;  5K8O A;  4UFV A;  3K9U A;  3PB7 X;  2O4H A;  4MRI A;  2ZEM A;  4PQA A;  4U5Y A;  2Q7S A;  3D7G A;  4NGM A;  4L8A A;  4EME A;  4AVB A;  2PJ7 A;  2G3A A;  3PBB A;  3B2Y A;  2ZEF A;  4UBR A;  4PK2 A;  5GCN A;  2WZN A;  3EFA A;  1FY7 A;  3FIX A;  2P6E A;  1CPX A;  1S7K A;  4R7M A;  4IF5 A;  4MCP A;  5F09 A;  1LFW A;  2PSW A;  2WPW A;  2Z3L A;  2OOT A;  4WJB A;  2ZED A;  4R76 A;  4LQG A;  1F2O A;  2V8V A;  4A37 A;  4X5K A;  2O53 A;  4M6H A;  5LYD A;  1KUY A;  1VIX A;  5HMN A;  2Z11 A;  1CX8 A;  1QQ9 A;  4KSA A;  5AG6 A;  4NFR A;  1NMT A;  4K3N A;  4MHP A;  4UCP A;  4IAV A;  2ZW6 A;  3D68 A;  1ELM P;  4KOT A;  2QML A;  4JYW A;  4NGR A;  3P2H A;  4P10 A;  4RI1 A;  5CNP A;  5C88 A;  3R9G A;  2P0W A;  1Z8L A;  4KOY A;  1MK4 A;  1IYL A;  1UWY A;  4A33 A;  1XBU A;  1OBR A;  3SJG A;  3RBU A;  4CAF A;  3L2N A;  4KVO E;  2Q51 A;  2JEW A;  3P2F A;  5LRG A;  4A31 A;  2AFS A;  2PJC A;  2PR8 A;  3IU2 A;  1PYT B;  1YW4 A;  5DS0 A;  1Q2C A;  1TIQ A;  1RTQ A;  2J9A A;  3ISZ A;  2C6C A;  2FT0 A;  2V8H A;  3FBU A;  3IFE A;  2PJ9 A;  3GYA A;  4R3L A;  1N71 A;  1IY7 A;  2BCO A;  4P4D A;  4QUS A;  1ZG8 A;  4CAX A;  4MY0 A;  4ZBG A;  1A2Z A;  3N5F A;  1P4N A;  3TO9 A;  5F48 A;  3DR8 A;  5LRJ A;  4XPD C;  3SI0 A;  4BMH A;  2ZOG A;  5F49 A;  3VH9 A;  3KAS A;  1IOI A;  4NGT A;  4UCN A;  4RS2 A;  4B5P A;  3B3W A;  2IQ6 A;  2PJ5 A;  2FCK A;  4R9M A;  2GLF A;  2PVW A;  1AUG A;  2JLM A;  1HDQ A;  3CXS A;  3LWU A;  5ISV A;  2FIW A;  3EC4 A;  2WPX A;  4PK3 A;  4YGO A;  2FL4 A;  3IU1 A;  3I9S A;  5JM6 A;  5K8M A;  2BUE A;  4MFP A;  3OWC A;  2AFM A;  4IK2 A; 
#chains in the Genus database with same CATH homology
 1R57 A;  3S6K A;  1GHE A;  3EY5 A;  1VKC A;  1Y9K A;  3T90 A;  2PRB A;  3ZZI A;  2WSA A;  1WWZ A;  2H5M A;  1NE9 A;  4OAE A;  1QSO A;  1M1D A;  3IWE A;  4CYQ A;  2DPS A;  1YGH A;  5JQ4 A;  2EUI A;  1Q2Y A;  1QSM A;  1QSN A;  4KOW A;  3UY5 A;  4YFJ A;  2OZH A;  4JWP A;  5AGE A;  3R9E A;  2K5T A;  4B14 A;  2VBQ A;  2VQY A;  4NF1 A;  5J8F A;  3FB3 A;  3T9Y A;  4MJ8 A;  4JXQ A;  4AVC A;  4M3S A;  2FE7 A;  3JUW A;  4CAW A;  2Z3O A;  4B13 A;  1YX0 A;  3D2M A;  4ONU A;  2NMT A;  5EC4 A;  1YLE A;  2PQ8 A;  1WK4 A;  1S7N A;  4AG7 A;  3TOB A;  2CNS A;  4KLV A;  4MFJ A;  1K4J A;  4H6U A;  3R95 A;  1YK3 A;  3N7Z A;  2Y0M A;  4R87 A;  1CM0 A;  4A95 A;  3ZJ0 A;  4NSQ A;  4NCZ A;  2B5G A;  1I1D A;  4CS0 B;  4MBU A;  3S6F A;  3TO6 A;  1BOB A;  2B3V A;  2CXA A;  2Z0Z A;  4B12 A;  3TFY A;  3GKR A;  2REE A;  3F0A A;  2Q44 A;  3TOA A;  4JJX A;  1U6M A;  4R57 A;  4ORF A;  2A4N A;  1KUX A;  1S5K A;  2J8R A;  1XF8 A;  4BBH A;  1IIC A;  4II9 A;  2Q0Y A;  2PDO A;  4XNH B;  1PU9 A;  4KOX A;  2BSW A;  2B58 A;  2CNM A;  2OZG A;  2Z3M A;  3JTK A;  2ZW7 A;  4CGO A;  3RYO A;  4F0X A;  4UFW A;  2REF A;  3DR6 A;  5KTA A;  2GAN A;  1ZO0 A;  2Z3P A;  3H4Q A;  4UCM A;  1YVK A;  5G20 A;  3G8W A;  3G3S A;  4L89 A;  3BJ8 A;  3BLN A;  1MJB A;  2P6G A;  3V8I A;  4IUS A;  2R8V A;  4FD5 A;  3LOD A;  5F46 A;  4E8O A;  5AG4 A;  2YGW A;  1M4G A;  4XPL A;  4YRH A;  2HV2 A;  4U9Z A;  4A2Z A;  1L0C A;  1CJW A;  2CY2 A;  1KUV A;  3BJ7 A;  4H89 A;  1M4D A;  2FS5 A;  4LUA A;  4KLW A;  2P6F A;  1NSL A;  4MHD A;  1B6B A;  4R3K A;  4B5O A;  2Q4V A;  4GS4 A;  4PV6 A;  3FYN A;  5EBV A;  1S3Z A;  4KOR A;  2FSR A;  3R96 A;  2CNT A;  2B4D B;  3TTH A;  3TE4 A;  4C68 A;  3DDD A;  3DNS A;  4F6A A;  4AVA A;  2IL4 A;  1Y7R A;  5KTD A;  4K30 A;  4MFQ A;  4JXR A;  3TCV A;  1XE4 A;  4Y49 C;  2F5I A;  4A30 A;  5A27 A;  1XMT A;  4CYN A;  2VEZ A;  2BL1 A;  2QEC A;  4KVM E;  3W91 A;  3SXN A;  3TO7 A;  4MY3 A;  3TT2 A;  3SHP A;  3S6G A;  5J8C A;  5DWN A;  4CGM A;  2FXF A;  2Q4Y A;  3VWE A;  3LD2 A;  4E2A A;  4KOS A;  2ZXV A;  4B11 A;  3FRM A;  1MJ9 A;  1BO4 A;  1V0C A;  4QB9 A;  3QB8 A;  4C2Z A;  4Q36 A;  3NE7 A;  1IB1 E;  4FD4 A;  2ATR A;  4KSF A;  1PUA A;  2G0B A;  2OH1 A;  2Q04 A;  5G22 A;  4EVY A;  2EVN A;  4JLY A;  4C2X A;  2ZW5 A;  4HNW B;  4KS9 A;  4C7I A;  4UWI A;  4CAE A;  4CYO A;  2FIA A;  2G3T A;  4CRY B;  2KCW A;  3CXP A;  2Z3N A;  3FNC A;  1S7L A;  2I79 A;  5IX3 A;  5H86 A;  1Y9W A;  3D8P A;  1XEB A;  4CAV A;  1QSR A;  2YNE A;  3IGR A;  2D4P A;  3F5B A;  2QIR A;  4XPD B;  1Z4E A;  3KKW A;  1VHS A;  4AB7 A;  4UWJ A;  4OLL A;  2C27 A;  2AJ6 A;  3EXN A;  4CRZ B;  1S60 A;  3WR7 A;  2OB0 A;  4MFZ A;  4ZGY B;  4OAD A;  4JD6 A;  2ZW4 A;  2I00 A;  3D3S A;  3DSB A;  3SXO A;  4Q38 A;  4KUA A;  3PP9 A;  3A9L A;  4I49 A;  1I12 A;  4KVX A;  4F0Y A;  4C2Y A;  5AG5 A;  2OU2 A;  3MGD A;  2DPT A;  4B5P B;  2R98 A;  2GE3 A;  3R1K A;  4UFX A;  4PSW A;  4MFK A;  3CXQ A;  5F47 A;  4Y49 B;  2Q7B A;  4KZT A;  3GY9 A;  3JVN A;  3D2P A;  1MJA A;  1RO5 A;  3PGP A;  3VWD A;  4C7H A;  4FD6 A;  3EO4 A;  5JPH A;  4A32 A;  2HQY A;  4KUB A;  5IV0 A;  2JDD A;  3S6H A;  4HNY B;  1YR0 A;  2R1I A;  3PZJ A;  3W6S A;  4PSX A;  3FXT A;  1KZF A;  4H6Z A;  1M44 A;  5AG7 A;  1QST A;  1YVO A;  2O28 A;  4XNH C;  1Z9U A;  3QAH A;  4NXY A;  2Z3K A;  1YRE A;  4UA3 A;  2ARH A;  4LX9 A;  4CGL A;  2D4O A;  5FVJ A;  2B3U A;  4NEX A;  4HKF A;  4CGP A;  5E96 A;  1IYK A;  1P0H A;  4FD7 A;  5KTC A;  2PC1 A;  5A28 A;  1XIX A;  4HNX B;  1OZP A;  2DXQ A;  2R7H A;  1B87 A;  2B4D A;  2YNC A;  2BEI A;  4DNC A;  1SQH A;  1RXT A;  2VZZ A;  1S7F A;  3R9F A;  3I3G A;  4MI4 A;  2VI7 A;  5IB0 A;  4MFL A;  2Z10 A;  2J8N A;  4J3G A;  3B8G A;  4QC6 A;  2PR1 A;  2VZY A;  1J4J A;  5H84 A;  1ON0 A;  2ZPA A;  2YND A;  2X7B A;  1I21 A;  2B4B A;  2VXK A;  5BWA B;  4B10 A;  5DWM A;  2B5G B;  2OZU A;  4E0A A;  2JEV A;  2YNC C;  4U9Y A;  2WUU A;  3E0K A;  2GIV A;  2AE6 A;  4KOV A;  4AG9 A;  2RC4 A;  4XPK A;  1UFH A;  2HUZ A;  4CGN A;  5C82 A;  1LRZ A;  3W6X A;  3IWG A;  4KOU A;  3C26 A;  3H5Z A;  5I0C A;  1IID A;  4CYP A;  1Q2D A;  2JDC A;  5HH1 A;  4QBJ A;  5G1Z A;  1M4I A;  4QVT A;  1Z4R A;  4M85 A;  2J8M A;  5G21 A;  3F8K A;  4UFV A;  3K9U A;  4U5Y A;  4L8A A;  4AVB A;  2G3A A;  4UBR A;  4PK2 A;  5GCN A;  3EFA A;  1FY7 A;  3FIX A;  2P6E A;  1S7K A;  4IF5 A;  2PSW A;  2WPW A;  2Z3L A;  4X5K A;  1KUY A;  5HMN A;  2Z11 A;  5AG6 A;  4KSA A;  1NMT A;  4UCP A;  2ZW6 A;  4KOT A;  5C88 A;  5CNP A;  2QML A;  4RI1 A;  3P2H A;  3R9G A;  2P0W A;  4KOY A;  1MK4 A;  1IYL A;  4A33 A;  4CAF A;  4KVO E;  3P2F A;  4A31 A;  2PR8 A;  3IU2 A;  1Q2C A;  1TIQ A;  2FT0 A;  3FBU A;  4R3L A;  3GYA A;  4CAX A;  1N71 A;  4QUS A;  4MY0 A;  4ZBG A;  1P4N A;  3TO9 A;  5F48 A;  3DR8 A;  4XPD C;  4BMH A;  5F49 A;  4UCN A;  4RS2 A;  4B5P A;  2FCK A;  4R9M A;  2JLM A;  3CXS A;  5ISV A;  2FIW A;  3EC4 A;  2WPX A;  4PK3 A;  4YGO A;  2FL4 A;  3IU1 A;  3I9S A;  2BUE A;  4MFP A;  3OWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...