5F46A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample, apoenzyme form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f46A00
2Z0ZA 4CRYB 3GYAA 1P4NA 2JDCA 3EC4A 4QUSA 1I1DA 2KCWA 4KUAA 5J8FA 3D2MA 3EO4A 1QSMA 5F46A 1KZFA 4KVOE 4UWJA 5EBVA 2VEZA 1I12A 3JUWA 2ZW4A 1NE9A 4OLLA 3GY9A 2OZHA 2FIAA 3TTHA 2G3AA 3CXSA 4U9YA 2JLMA 2P6FA 4CS0B 3KKWA 4KLVA 1FY7A 2I00A 2B3VA 4QVTA 2PDOA 1VKCA 4R87A 2RC4A 2P0WA 5F48A 4AB7A 2DXQA 1XE4A 3TE4A 2ATRA 2FL4A 1M4DA 3QB8A 2B5GB 1IB1E 2G3TA 2D4OA 1ON0A 4KOSA 2B5GA 4HNXB 1S7FA 1YVOA 3DSBA 2OB0A 1MJBA 2AE6A 2Z11A 1XIXA 4KORA 1IYKA 1M44A 3DDDA 4CAXA 1NSLA 3UY5A 1S5KA 4KUBA 2FCKA 4FD4A 5E96A 3R9EA 4ONUA 3TT2A 1N71A 2BSWA 2I79A 1MJAA 1S7LA 4MBUA 1Z4EA 5H84A 4R57A 3D2PA 1XEBA 3MGDA 3PGPA 2REFA 2VXKA 2FSRA 4XNHC 2VI7A 4NF1A 3R1KA 3CXPA 3R9GA 4NEXA 4F0YA 2Q0YA 1XMTA 3H4QA 1KUXA 4GS4A 1KUYA 1PU9A 4M3SA 2HUZA 4PSXA 4I49A 4FD5A 1QSOA 4ZBGA 4PK3A 3D3SA 4JD6A 2Q04A 3C26A 4MY3A 4MHDA 4UBRA 4KVME 1S7KA 1L0CA 2B4DB 2QIRA 4B5PB 3FB3A 2EVNA 2Y0MA 5IV0A 3CXQA 4M85A 3W6SA 3S6HA 1Z9UA 2K5TA 2IL4A 1LRZA 2J8NA 3F8KA 4MJ8A 4HNWB 2OZUA 3TO6A 4FD7A 3B8GA 4DNCA 5H86A 2J8MA 4QBJA 1Y7RA 2H5MA 3PP9A 3FXTA 4XPDC 2PR8A 4QB9A 4UA3A 2QMLA 4UWIA 1Q2CA 1B6BA 5C88A 4CRZB 3TOAA 1YVKA 2F5IA 2J8RA 1IICA 3ZJ0A 1WWZA 2FT0A 4U5YA 5J8CA 3G8WA 5F47A 4AVCA 4LX9A 3QAHA 3DR6A 2ZPAA 1CJWA 2PRBA 2VBQA 1BO4A 4YGOA 3R96A 4B5OA 3P2HA 4B5PA 3FIXA 1S7NA 1J4JA 1R57A 2B4BA 2B4DA 1PUAA 2P6GA 1YGHA 1YR0A 4RI1A 3IWGA 3T90A 3TFYA 3E0KA 2R7HA 2ZW7A 3TO7A 3BLNA 4H89A 2BUEA 2WPWA 3T9YA 3F0AA 4R3LA 5DWMA 1QSTA 3W6XA 2VZZA 4YRHA 2G0BA 2CNSA 2GE3A 2FS5A 4KOUA 4AVBA 3W91A 4KVXA 4KOXA 4JLYA 2FXFA 3I9SA 3PZJA 2FIWA 1RO5A 4E8OA 2HV2A 4KZTA 4NXYA 2CNMA 4KLWA 4XPKA 2HQYA 3S6FA 3FBUA 2NMTA 4E2AA 2GIVA 5IX3A 1M1DA 5GCNA 5JQ4A 2OH1A 3R95A 3R9FA 5KTCA 3F5BA 3SXOA 3DR8A 3SXNA 1IYLA 4PSWA 4NCZA 4KOYA 4KOWA 4L8AA 4HNYB 3JVNA 3V8IA 5DWNA 4R9MA 4LUAA 3TO9A 2VZYA 2Q4VA 1OZPA 4IF5A 3DNSA 1Y9WA 4MI4A 4Y49C 1QSNA 1WK4A 4YFJA 1YREA 4JJXA 2Q7BA 1KUVA 4QC6A 2WPXA 1K4JA 4U9ZA 5FVJA 4KOTA 3P2FA 4EVYA 2QECA 4FD6A 1MJ9A 1S60A 1B87A 3FYNA 3FRMA 4F6AA 2ZXVA 4L89A 4Y49B 2JEVA 1P0HA 2ZW6A 2A4NA 4XNHB 4XPLA 5ISVA 4E0AA 4II9A 4JWPA 3NE7A 2OZGA 4X5KA 1TIQA 2B58A 3I3GA 4KOVA 3K9UA 4J3GA 2R8VA 1BOBA 2B3UA 2PSWA 1Q2YA 5KTAA 3IGRA 2PR1A 3LD2A 3LODA 1QSRA 1M4GA 3EXNA 1S3ZA 3SHPA 4CAWA 2PC1A 2R98A 1V0CA 5F49A 3G3SA 1Z4RA 4R3KA 3RYOA 2CY2A 1I21A 2BL1A 5IB0A 3BJ8A 4IUSA 4BMHA 1RXTA 4H6UA 5HMNA 4OADA 1YX0A 5C82A 1Q2DA 2Q44A 2X7BA 5I0CA 3BJ7A 4AVAA 3OWCA 1IIDA 3TOBA 1YLEA 2P6EA 2PQ8A 1YK3A 2O28A 3GKRA 1U6MA 1UFHA 4XPDB 2FE7A 1NMTA 2VQYA 2CNTA 3EFAA 4ORFA 1SQHA 4NSQA 1GHEA 2Z10A 4RS2A 2JDDA 2EUIA 2AJ6A 5CNPA 2C27A 4JXQA 4PV6A 4H6ZA 2BEIA 4K30A 3N7ZA 2D4PA 4PK2A 3VWDA 1MK4A 3TCVA 2ARHA 2ZW5A 5JPHA 4JXRA 3S6GA 4AG7A 4MY0A 1CM0A 5EC4A 1VHSA 3S6KA 2R1IA 3VWEA 3ZZIA 3EY5A 2GANA 2REEA 3D8PA 1XF8A 5HH1A 4AG9A 4CAVA 3WR7A 1M4IA 2OU2A 5KTDA 2Q4YA 3FNCA 1Y9KA 4HKFA 4OAEA
chains in the Genus database with same CATH superfamily
4UCPA 3IU1A 3LMSA 4ZY0A 3B3TA 2Z0ZA 2VL1A 2JEWA 4CGLA 4CRYB 5BWAB 3GYAA 1BLLE 3T8WA 4C2ZA 1P4NA 4UFXA 4A95A 1QMUA 2AFZA 2QJ8A 2WZNA 2JDCA 3EC4A 4QUSA 3CT9A 3IU2A 4KSFA 4B13A 5HVFA 1I1DA 2KCWA 4KUAA 5CBMA 5J8FA 3D2MA 2XEGA 2GLFA 3EO4A 1QSMA 1ZLIA 5F46A 1KZFA 4P4DA 2C1CA 2CF4A 4M6HA 4KVOE 4UWJA 5EBVA 4X3RA 2VEZA 4C7HA 1I12A 3JUWA 2ZW4A 1NE9A 5K8MA 4YU9A 1CP6A 4OLLA 3GY9A 1TF8A 3SJEA 1Z8XA 1CPXA 4OP4A 2YNEA 2WUUA 1VHOA 2OZHA 2FIAA 3TTHA 5AG7A 2NSMA 2G3AA 4CYNA 3IWWA 5LYDA 3CXSA 1ZG7A 4MCRA 4PXCA 4KSAA 4F8ZA 4RUHA 4ZX9A 5JM6A 4U9YA 2JLMA 1R3NA 5LYIA 4P4FA 2Z3PA 4CGNA 2AFSA 2P6FA 2PJCA 4CS0B 4IK2A 2EWBA 1LFWA 2DF5A 2ZEOA 3KKWA 4KLVA 4WWVA 1FY7A 2I00A 3H8FA 3IFEA 2B3VA 4CYQA 4EFDA 2V8DA 4QVTA 4UIBA 2PDOA 1VKCA 4F9VA 4R87A 4MMOA 2RC4A 2P0WA 2PE3A 4IAVA 2C6CA 3KZWA 4PQAA 2PJ9A 3FJUA 5F48A 4AB7A 2DXQA 3D7GA 4KSIA 4H2KA 1XE4A 3IJ3A 4Z65A 3TE4A 2ATRA 2FL4A 1M4DA 2ZENA 2JBKA 4GXHA 4NGPA 4R6TA 2Z3KA 3QB8A 4DUKA 2B5GB 1IB1E 2G3TA 4MRIA 2D4OA 1ON0A 4KOSA 2B5GA 4HNXB 3LACA 1S7FA 1YVOA 3DSBA 2CIJA 4BINA 2OB0A 4MFLA 1VIXA 3PB9X 1MJBA 2AE6A 2Z11A 1XIXA 3RZAA 4KORA 1IYKA 4CPAA 1ZG8A 2GREA 1M44A 3DDDA 4CAXA 1NSLA 4C7IA 3UY5A 1S5KA 4KUBA 2FCKA 4FD4A 5E96A 3R9EA 4ONUA 3TT2A 4CAFA 1N71A 2Q51A 2JBJA 2BSWA 2I79A 4ZX8A 1MJAA 1S7LA 4MBUA 1ELLP 3GB0A 1Z4EA 8CPAA 2ZOGA 4R57A 5H84A 1Z2LA 2DPTA 3D2PA 4MCQA 1XEBA 3MGDA 3B3SA 3PGPA 2RB7A 2REFA 4ONWA 2VXKA 1DE4C 4R76A 1IOIA 2FSRA 4XNHC 2C6PA 2VI7A 4MFQA 4NF1A 4ZY2A 3CXPA 3KL9A 3R1KA 3R9GA 3FH4A 1BPNA 5G20A 4NEXA 4F0YA 2Q0YA 1XMTA 3H4QA 2ZEFA 4EMEA 1KUXA 4GS4A 1KUYA 1PU9A 2IQ6A 4M3SA 4OKOA 4A37A 4FAIA 2HUZA 4PSXA 3MRUA 4I49A 4FD5A 1QSOA 3PB8X 5AG5A 3CPXA 4ZBGA 4PK3A 3S9NA 2YNDA 3D3SA 1HDQA 4JD6A 2Q04A 3C26A 4MY3A 4MHDA 3KQZA 4UBRA 4KVME 4ZI6A 3D66A 2PVWA 2YGWA 1S7KA 1F2OA 1L0CA 2B4DB 4CYPA 2QIRA 2AFXA 2PRQA 4B5PB 3FB3A 2Q43A 2AFWA 2EVNA 2ODFA 4OIWA 2V77A 2Y0MA 4UEFA 2ZEGA 4NGSA 5IV0A 3CXQA 4FWUA 4M85A 3W6SA 3S6HA 2PJBA 1Z9UA 2K5TA 1ZLHA 2IL4A 2AFUA 1LRZA 2J8NA 3F8KA 4MJ8A 5K8PA 3KR5A 4HNWB 2OZUA 1YW4A 4FD7A 3TO6A 3B8GA 3DGVA 4DNCA 5H86A 2J8MA 4QBJA 2Z3OA 1OBRA 4NGTA 1Y7RA 2H5MA 3PP9A 3NE8A 4ZGYB 3FXTA 3D67A 4HPSA 4JYWA 2PR8A 4QB9A 4XPDC 3BI0A 1YMEA 4A33A 4UA3A 4Q36A 1CBXA 2QMLA 3PBEA 4UWIA 1IOFA 1Q2CA 1B6BA 3PB4X 5ELYA 4PXEA 5C88A 3SJGA 4CRZB 3TOAA 2AFOA 1XFOA 1YVKA 2Z3LA 3SJFA 1TKFA 2F5IA 2J8RA 2ZEPA 3D4UA 1IICA 3GIUA 1WWZA 3IWEA 1IY7A 3ZJ0A 1Z5RA 4P44A 1ARLA 2FT0A 4U5YA 4TWEA 4YWYA 5J8CA 1CX8A 3G8WA 3NH4A 5F47A 4JZ0A 2PIYA 2Z3MA 4AVCA 4LX9A 3QAHA 3SI2A 3DR6A 2ZPAA 5THWA 1CJWA 4MFKA 1JWQA 2Q7SA 4UCNA 2PRBA 2XEJA 2VBQA 1BO4A 3A9LA 1XMBA 2V8GA 4PPZA 4YGOA 3R96A 4B5OA 4A94A 2BO9A 1ELMP 4CAEA 2G9DA 3P2HA 4A39A 4B5PA 4C2YA 3FIXA 4NGRA 3KQXA 4CGPA 1S7NA 1J4JA 1TKJA 1A2ZA 4OC4A 4PXBA 3SI0A 2PJ4A 4F9UA 3NH8A 2FVGA 1R57A 1CP7A 2B4BA 2B4DA 1PUAA 2P6GA 2XEIA 1YGHA 1YR0A 4RI1A 3RO0A 1M4LA 5LRGA 3IWGA 3T90A 3TFYA 3E0KA 5LRJA 1BPMA 5G22A 2R7HA 4OC0A 1NSAA 2WYRA 2ZW7A 2BCOA 3TO7A 4MFJA 3BLNA 4H89A 2BUEA 2V8HA 2WPWA 3T9YA 3TC8A 5AG4A 3F0AA 4R3LA 5DWMA 1QSTA 4Q38A 3W6XA 2VZZA 3GUXA 5HVHA 5K8NA 4LQGA 4ZYQA 4A31A 1BAVA 4YRHA 2BOAA 2G0BA 2CNSA 4B11A 2GE3A 2FS5A 3PEIA 4KOUA 1LAPA 1IU8A 3FECA 1YLOA 4AVBA 2WSAA 3S9MA 3W91A 5HVGA 4KVXA 1UWYA 3PB6X 5LRKA 1R43A 1GYTA 2EK9A 3K9TA 4KOXA 4JLYA 2FXFA 3KI9A 3H5ZA 2YNCA 3BHXA 4Q7AA 4P45A 3I9SA 4C68A 5AG6A 3PZJA 3B7IA 3VH9A 3WABA 3IEHA 2FIWA 1RO5A 4E8OA 2HB6A 2HV2A 5A27A 4KZTA 4NXYA 2CNMA 2PJ6A 4KLWA 2HC9A 2HQYA 1QQ9A 4XPKA 3RAMA 3S6FA 2CXAA 3KHZA 4P4BA 3FBUA 2NMTA 4E2AA 5LYLA 1LOKA 1RTQA 2RFHA 3FMCA 2GIVA 1TKHA 3PRTA 5IX3A 1M1DA 2ANPA 5GCNA 4P4IA 5JQ4A 4O23A 1LAMA 2OH1A 2YNCC 3D7HA 4X2TA 3R9FA 3R95A 5KTCA 3F5BA 3H8GA 3V38A 4CGMA 4P4JA 4DYOA 4ZY1A 3SXOA 3DR8A 2IMOA 4OC5A 2C6GA 3CDXA 1IGBA 2PCUA 2CTCA 5AGEA 2DPSA 5G21A 3SXNA 3WC5A 1IYLA 3FVLA 2NYQA 5I4MA 4PSWA 4NCZA 4KOYA 4OIDA 4OC3A 3FF3A 3CZXA 4KOWA 2GFQA 4L8AA 3RBUA 1X12A 3SI1A 2EBJA 2O53A 3IO1A 3D68A 4HNYB 5D29A 3JVNA 3V8IA 5DWNA 2PJ7A 4R9MA 4M6GA 4LUAA 3BXMA 4MHZA 2PJ2A 3HUVA 1EE3P 2PIZA 3NFZA 1LANA 4UEEA 3TO9A 2VZYA 4MHYA 4P6YA 1CG2A 2I3CA 4P10A 1AMPA 2Q4VA 3TX8A 3WC6A 4CYOA 4X8IA 1OZPA 4BBHA 3QNVA 4IF5A 1LCPA 2EO8A 3VARA 2ZEMA 3DNSA 5JH9A 1Y9WA 3MN8A 4MI4A 4Y49C 4OMEA 1QSNA 4TNUA 1WK4A 4YFJA 1YREA 4JJXA 2Q7BA 4B12A 1KUVA 3IC1A 3JRUA 3NH5A 4QC6A 2WPXA 4B6ZA 2POKA 1K4JA 1F57A 3FEEA 4U9ZA 5FVJA 4KOTA 3GLJA 3P2FA 3V7ZA 1TF9A 1XOVA 3JTKA 4NGMA 4BD9A 4EVYA 2F8HA 2ZEDA 1AUGA 2QECA 4FD6A 3L2NA 1MJ9A 4B14A 1S60A 2PJ1A 1B87A 3FYNA 2ZELA 1Y7EA 2PJ8A 3FRMA 1Q7LA 4F6AA 2ZXVA 4L89A 4RN7A 2AFMA 4Y49B 2JEVA 1P0HA 2ZW6A 3K2KA 5LYFA 2A4NA 2Z3NA 4XNHB 4XPLA 5CPAA 5ISVA 4E0AA 4II9A 3NE7A 4JWPA 4UF4A 2OZGA 4FBEA 3PB7X 4UEZA 4X5KA 1TIQA 2B58A 1YW6A 1CPSA 2F7VA 3I3GA 4KOVA 3K9UA 4J3GA 2R8VA 1BOBA 4MFPA 2B3UA 3ISXA 1ZG9A 2PSWA 1Z8WA 2OOTA 4NJRA 2PJ5A 1Q2YA 3N5FA 3IGRA 2PR1A 3LD2A 3LODA 3WT4A 5KTAA 1QSRA 1M4GA 1HDUA 3LWUA 3EXNA 4UIAA 2ZEHA 5J1QA 4A2ZA 1S3ZA 5HXDA 3SHPA 4K3NA 1KWMA 2PC1A 2R98A 4CAWA 1FT7A 2PJ3A 2ABZA 1PCAA 2QVPA 4NFRA 4F0XA 1Z8TA 1XBUA 2V8VA 4MCPA 1Z8LA 4MXUA 1V0CA 2PVVA 5F49A 3B3WA 3G3SA 1Z4RA 3I1UA 4R3KA 3RYOA 3PBBA 1XJOA 2CY2A 4C2XA 2PJAA 1I21A 3PFOA 4UCMA 4NJQA 4UFVA 2BL1A 4P4EA 5IB0A 3BJ8A 4IUSA 4BMHA 3WC7A 1RXTA 4A32A 4H6UA 2IJZA 3H8EA 4MHNA 7CPAA 1H8LA 1TXRA 4OADA 5HMNA 3B35A 4IHMA 5DS0A 1Y0RA 5JGFA 1XRYA 1VGYA 1VHEA 3B3CA 1YX0A 5C82A 1HEEA 1Q2DA 2Q44A 3B3VA 2X7BA 5D8NA 4NGNA 5I0CA 3BI1A 3DLJA 3BJ7A 4R7MA 4AVAA 3OWCA 1IIDA 3TOBA 5IB9A 1YLEA 3FEDA 3KGQA 4OC1A 4A38A 5K8OA 2P6EA 2PQ8A 2XEFA 3PFEA 3RNZA 4GM5A 1YK3A 2O28A 3GKRA 1U6MA 1UFHA 4MCSA 4XPDB 2FE7A 1NMTA 1DTDA 2VQYA 3S9LA 2CNTA 3EFAA 4ORFA 4W9YA 4R8FA 1SQHA 2GLJA 4NSQA 6CPAA 1GHEA 2Z10A 4RS2A 2JDDA 2EUIA 3D7FA 4M6IA 2AJ6A 5CNPA 2C27A 1F2PA 4JXQA 5F09A 4PV6A 4H6ZA 4UFWA 2BEIA 3B2YA 3HLPA 5A28A 4K30A 3KR4A 3N7ZA 3QAYA 3KHXA 3IIBA 4KS9A 2CTBA 4MHPA 2Q4ZA 4MFZA 3FX6A 3KASA 4OC2A 4FUUA 5EMIA 2D4PA 4EWTA 4DJLA 4CGOA 2DEAA 1ARMA 4G1PA 4PK2A 3NA6A 3VWDA 4B10A 1MK4A 3TCVA 1Y0YA 3ISZA 2ARHA 2O4HA 2ZW5A 4A30A 5JPHA 4JXRA 5G1ZA 3S6GA 4AG7A 4MY0A 1CM0A 4WJBA 5EC4A 2GU2A 2OR4A 4NGQA 1VHSA 1AYEA 1FNOA 3SJXA 3S6KA 2R1IA 3VWEA 3ZZIA 3EY5A 2GANA 1PYTB 3D7DA 4LQ6A 2REEA 2PJ0A 3D8PA 1XF8A 5HH1A 4PXDA 4AG9A 3CPAA 4CAVA 1JQGA 2EK8A 2QYVA 3WR7A 1ZO0A 1X10A 1M4IA 2ZOFA 2OU2A 5KTDA 2ZEEA 1YSJA 2Q4YA 3FNCA 4AXVA 1Y9KA 4HKFA 4OAEA 2J9AA 1YQEA 3VATA
chains in the Genus database with same CATH topology
4UCPA 3IU1A 2Z0ZA 4CRYB 4CGLA 5BWAB 3GYAA 4C2ZA 1P4NA 4UFXA 4A95A 2JDCA 3EC4A 4QUSA 3IU2A 4KSFA 4B13A 1I1DA 2KCWA 4KUAA 5J8FA 3D2MA 3EO4A 1QSMA 5F46A 1KZFA 4KVOE 4UWJA 5EBVA 2VEZA 4C7HA 1I12A 3JUWA 2ZW4A 1NE9A 4OLLA 3GY9A 2YNEA 2WUUA 2OZHA 2FIAA 3TTHA 5AG7A 2G3AA 4CYNA 3CXSA 4KSAA 4U9YA 2JLMA 2Z3PA 4CGNA 2P6FA 4CS0B 3KKWA 4KLVA 1FY7A 2I00A 2B3VA 4CYQA 4QVTA 2PDOA 1VKCA 4R87A 2RC4A 2P0WA 5F48A 4AB7A 2DXQA 1XE4A 3TE4A 2ATRA 2FL4A 1M4DA 2Z3KA 3QB8A 2B5GB 1IB1E 2G3TA 2D4OA 1ON0A 4KOSA 2B5GA 4HNXB 1S7FA 1YVOA 3DSBA 2OB0A 4MFLA 1MJBA 2AE6A 2Z11A 1XIXA 4KORA 1IYKA 1M44A 3DDDA 4CAXA 1NSLA 4C7IA 3UY5A 1S5KA 4KUBA 2FCKA 4FD4A 5E96A 3R9EA 4ONUA 3TT2A 1N71A 2BSWA 2I79A 1MJAA 1S7LA 4MBUA 1Z4EA 5H84A 4R57A 2DPTA 3D2PA 1XEBA 3MGDA 3PGPA 2REFA 2VXKA 2FSRA 4XNHC 2VI7A 4MFQA 4NF1A 3R1KA 3CXPA 3R9GA 5G20A 4NEXA 4F0YA 2Q0YA 1XMTA 3H4QA 1KUXA 4GS4A 1KUYA 1PU9A 4M3SA 2HUZA 4PSXA 4I49A 4FD5A 1QSOA 5AG5A 4ZBGA 4PK3A 2YNDA 3D3SA 4JD6A 2Q04A 3C26A 4MY3A 4MHDA 4UBRA 4KVME 2YGWA 1S7KA 1L0CA 2B4DB 4CYPA 2QIRA 4B5PB 3FB3A 2EVNA 2Y0MA 5IV0A 3CXQA 4M85A 3W6SA 3S6HA 1Z9UA 2K5TA 2IL4A 1LRZA 2J8NA 3F8KA 4MJ8A 4HNWB 2OZUA 3TO6A 4FD7A 3B8GA 4DNCA 5H86A 2J8MA 4QBJA 2Z3OA 1Y7RA 2H5MA 3PP9A 4ZGYB 3FXTA 4XPDC 2PR8A 4QB9A 4A33A 4UA3A 4Q36A 2QMLA 4UWIA 1Q2CA 1B6BA 5C88A 4CRZB 3TOAA 2Z3LA 1YVKA 2F5IA 2J8RA 3IWEA 1IICA 3ZJ0A 1WWZA 2FT0A 4U5YA 5J8CA 3G8WA 5F47A 2Z3MA 4AVCA 4LX9A 3QAHA 3DR6A 2ZPAA 1CJWA 4MFKA 4UCNA 2PRBA 2VBQA 1BO4A 3A9LA 4YGOA 3R96A 4B5OA 4CAEA 3P2HA 4B5PA 4C2YA 3FIXA 4CGPA 1S7NA 1J4JA 1R57A 2B4BA 2B4DA 1PUAA 2P6GA 1YGHA 1YR0A 4RI1A 3IWGA 3T90A 3TFYA 3E0KA 5G22A 2R7HA 2ZW7A 3TO7A 4MFJA 3BLNA 4H89A 2BUEA 2WPWA 3T9YA 5AG4A 3F0AA 4R3LA 5DWMA 1QSTA 4Q38A 3W6XA 2VZZA 4A31A 4YRHA 2G0BA 2CNSA 4B11A 2GE3A 2FS5A 4KOUA 4AVBA 2WSAA 3W91A 4KVXA 4KOXA 4JLYA 2FXFA 3H5ZA 2YNCA 3I9SA 4C68A 5AG6A 3PZJA 2FIWA 1RO5A 4E8OA 2HV2A 5A27A 4KZTA 4NXYA 2CNMA 4KLWA 4XPKA 2HQYA 3S6FA 2CXAA 3FBUA 2NMTA 4E2AA 2GIVA 5IX3A 1M1DA 5GCNA 5JQ4A 2OH1A 3R95A 2YNCC 3R9FA 5KTCA 3F5BA 4CGMA 3SXOA 3DR8A 5G21A 3SXNA 5AGEA 2DPSA 1IYLA 4PSWA 4NCZA 4KOYA 4CAFA 4KOWA 4L8AA 4HNYB 3JVNA 3V8IA 5DWNA 4R9MA 4LUAA 3TO9A 2VZYA 4CYOA 2Q4VA 1OZPA 4BBHA 4IF5A 3DNSA 1Y9WA 4MI4A 4Y49C 1QSNA 1WK4A 4YFJA 1YREA 4JJXA 2Q7BA 4B12A 1KUVA 4QC6A 2WPXA 1K4JA 4U9ZA 5FVJA 4KOTA 3P2FA 3JTKA 4EVYA 2QECA 4FD6A 1MJ9A 4B14A 1S60A 1B87A 3FYNA 3FRMA 4F6AA 2ZXVA 4L89A 4Y49B 2JEVA 1P0HA 2ZW6A 2A4NA 2Z3NA 4XNHB 4XPLA 5ISVA 4E0AA 4II9A 4JWPA 3NE7A 2OZGA 4X5KA 1TIQA 2B58A 3I3GA 4KOVA 3K9UA 4J3GA 2R8VA 1BOBA 4MFPA 2B3UA 2PSWA 1Q2YA 5KTAA 3IGRA 2PR1A 3LD2A 3LODA 1QSRA 1M4GA 3EXNA 4A2ZA 1S3ZA 3SHPA 4CAWA 2PC1A 2R98A 4F0XA 1V0CA 5F49A 3G3SA 1Z4RA 4R3KA 3RYOA 2CY2A 4C2XA 1I21A 4UCMA 4UFVA 2BL1A 5IB0A 3BJ8A 4IUSA 4BMHA 4A32A 1RXTA 4H6UA 5HMNA 4OADA 1YX0A 5C82A 1Q2DA 2Q44A 2X7BA 5I0CA 3BJ7A 4AVAA 3OWCA 1IIDA 3TOBA 1YLEA 2P6EA 2PQ8A 1YK3A 2O28A 3GKRA 1U6MA 1UFHA 4XPDB 2FE7A 1NMTA 2VQYA 2CNTA 3EFAA 4ORFA 1SQHA 4NSQA 1GHEA 2Z10A 4RS2A 2JDDA 2EUIA 2AJ6A 5CNPA 2C27A 4JXQA 4PV6A 4H6ZA 4UFWA 2BEIA 5A28A 4K30A 3N7ZA 4KS9A 4MFZA 2D4PA 4CGOA 4PK2A 3VWDA 4B10A 1MK4A 3TCVA 2ARHA 2ZW5A 4A30A 5JPHA 4JXRA 5G1ZA 3S6GA 4AG7A 4MY0A 1CM0A 5EC4A 1VHSA 3S6KA 2R1IA 3VWEA 3ZZIA 3EY5A 2GANA 2REEA 3D8PA 1XF8A 5HH1A 4AG9A 4CAVA 3WR7A 1ZO0A 1M4IA 2OU2A 5KTDA 2Q4YA 3FNCA 1Y9KA 4HKFA 4OAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0Z A;  4CRY B;  3GYA A;  1P4N A;  2JDC A;  3EC4 A;  4QUS A;  1I1D A;  2KCW A;  4KUA A;  5J8F A;  3D2M A;  3EO4 A;  1QSM A;  5F46 A;  1KZF A;  4KVO E;  4UWJ A;  5EBV A;  2VEZ A;  1I12 A;  3JUW A;  2ZW4 A;  1NE9 A;  4OLL A;  3GY9 A;  2OZH A;  2FIA A;  3TTH A;  2G3A A;  3CXS A;  4U9Y A;  2JLM A;  2P6F A;  4CS0 B;  3KKW A;  4KLV A;  1FY7 A;  2I00 A;  2B3V A;  4QVT A;  2PDO A;  1VKC A;  4R87 A;  2RC4 A;  2P0W A;  5F48 A;  4AB7 A;  2DXQ A;  1XE4 A;  3TE4 A;  2ATR A;  2FL4 A;  1M4D A;  3QB8 A;  2B5G B;  1IB1 E;  2G3T A;  2D4O A;  1ON0 A;  4KOS A;  2B5G A;  4HNX B;  1S7F A;  1YVO A;  3DSB A;  2OB0 A;  1MJB A;  2AE6 A;  2Z11 A;  1XIX A;  4KOR A;  1IYK A;  1M44 A;  3DDD A;  4CAX A;  1NSL A;  3UY5 A;  1S5K A;  4KUB A;  2FCK A;  4FD4 A;  5E96 A;  3R9E A;  4ONU A;  3TT2 A;  1N71 A;  2BSW A;  2I79 A;  1MJA A;  1S7L A;  4MBU A;  1Z4E A;  5H84 A;  4R57 A;  3D2P A;  1XEB A;  3MGD A;  3PGP A;  2REF A;  2VXK A;  2FSR A;  4XNH C;  2VI7 A;  4NF1 A;  3R1K A;  3CXP A;  3R9G A;  4NEX A;  4F0Y A;  2Q0Y A;  1XMT A;  3H4Q A;  1KUX A;  4GS4 A;  1KUY A;  1PU9 A;  4M3S A;  2HUZ A;  4PSX A;  4I49 A;  4FD5 A;  1QSO A;  4ZBG A;  4PK3 A;  3D3S A;  4JD6 A;  2Q04 A;  3C26 A;  4MY3 A;  4MHD A;  4UBR A;  4KVM E;  1S7K A;  1L0C A;  2B4D B;  2QIR A;  4B5P B;  3FB3 A;  2EVN A;  2Y0M A;  5IV0 A;  3CXQ A;  4M85 A;  3W6S A;  3S6H A;  1Z9U A;  2K5T A;  2IL4 A;  1LRZ A;  2J8N A;  3F8K A;  4MJ8 A;  4HNW B;  2OZU A;  3TO6 A;  4FD7 A;  3B8G A;  4DNC A;  5H86 A;  2J8M A;  4QBJ A;  1Y7R A;  2H5M A;  3PP9 A;  3FXT A;  4XPD C;  2PR8 A;  4QB9 A;  4UA3 A;  2QML A;  4UWI A;  1Q2C A;  1B6B A;  5C88 A;  4CRZ B;  3TOA A;  1YVK A;  2F5I A;  2J8R A;  1IIC A;  3ZJ0 A;  1WWZ A;  2FT0 A;  4U5Y A;  5J8C A;  3G8W A;  5F47 A;  4AVC A;  4LX9 A;  3QAH A;  3DR6 A;  2ZPA A;  1CJW A;  2PRB A;  2VBQ A;  1BO4 A;  4YGO A;  3R96 A;  4B5O A;  3P2H A;  4B5P A;  3FIX A;  1S7N A;  1J4J A;  1R57 A;  2B4B A;  2B4D A;  1PUA A;  2P6G A;  1YGH A;  1YR0 A;  4RI1 A;  3IWG A;  3T90 A;  3TFY A;  3E0K A;  2R7H A;  2ZW7 A;  3TO7 A;  3BLN A;  4H89 A;  2BUE A;  2WPW A;  3T9Y A;  3F0A A;  4R3L A;  5DWM A;  1QST A;  3W6X A;  2VZZ A;  4YRH A;  2G0B A;  2CNS A;  2GE3 A;  2FS5 A;  4KOU A;  4AVB A;  3W91 A;  4KVX A;  4KOX A;  4JLY A;  2FXF A;  3I9S A;  3PZJ A;  2FIW A;  1RO5 A;  4E8O A;  2HV2 A;  4KZT A;  4NXY A;  2CNM A;  4KLW A;  4XPK A;  2HQY A;  3S6F A;  3FBU A;  2NMT A;  4E2A A;  2GIV A;  5IX3 A;  1M1D A;  5GCN A;  5JQ4 A;  2OH1 A;  3R95 A;  3R9F A;  5KTC A;  3F5B A;  3SXO A;  3DR8 A;  3SXN A;  1IYL A;  4PSW A;  4NCZ A;  4KOY A;  4KOW A;  4L8A A;  4HNY B;  3JVN A;  3V8I A;  5DWN A;  4R9M A;  4LUA A;  3TO9 A;  2VZY A;  2Q4V A;  1OZP A;  4IF5 A;  3DNS A;  1Y9W A;  4MI4 A;  4Y49 C;  1QSN A;  1WK4 A;  4YFJ A;  1YRE A;  4JJX A;  2Q7B A;  1KUV A;  4QC6 A;  2WPX A;  1K4J A;  4U9Z A;  5FVJ A;  4KOT A;  3P2F A;  4EVY A;  2QEC A;  4FD6 A;  1MJ9 A;  1S60 A;  1B87 A;  3FYN A;  3FRM A;  4F6A A;  2ZXV A;  4L89 A;  4Y49 B;  2JEV A;  1P0H A;  2ZW6 A;  2A4N A;  4XNH B;  4XPL A;  5ISV A;  4E0A A;  4II9 A;  4JWP A;  3NE7 A;  2OZG A;  4X5K A;  1TIQ A;  2B58 A;  3I3G A;  4KOV A;  3K9U A;  4J3G A;  2R8V A;  1BOB A;  2B3U A;  2PSW A;  1Q2Y A;  5KTA A;  3IGR A;  2PR1 A;  3LD2 A;  3LOD A;  1QSR A;  1M4G A;  3EXN A;  1S3Z A;  3SHP A;  4CAW A;  2PC1 A;  2R98 A;  1V0C A;  5F49 A;  3G3S A;  1Z4R A;  4R3K A;  3RYO A;  2CY2 A;  1I21 A;  2BL1 A;  5IB0 A;  3BJ8 A;  4IUS A;  4BMH A;  1RXT A;  4H6U A;  5HMN A;  4OAD A;  1YX0 A;  5C82 A;  1Q2D A;  2Q44 A;  2X7B A;  5I0C A;  3BJ7 A;  4AVA A;  3OWC A;  1IID A;  3TOB A;  1YLE A;  2P6E A;  2PQ8 A;  1YK3 A;  2O28 A;  3GKR A;  1U6M A;  1UFH A;  4XPD B;  2FE7 A;  1NMT A;  2VQY A;  2CNT A;  3EFA A;  4ORF A;  1SQH A;  4NSQ A;  1GHE A;  2Z10 A;  4RS2 A;  2JDD A;  2EUI A;  2AJ6 A;  5CNP A;  2C27 A;  4JXQ A;  4PV6 A;  4H6Z A;  2BEI A;  4K30 A;  3N7Z A;  2D4P A;  4PK2 A;  3VWD A;  1MK4 A;  3TCV A;  2ARH A;  2ZW5 A;  5JPH A;  4JXR A;  3S6G A;  4AG7 A;  4MY0 A;  1CM0 A;  5EC4 A;  1VHS A;  3S6K A;  2R1I A;  3VWE A;  3ZZI A;  3EY5 A;  2GAN A;  2REE A;  3D8P A;  1XF8 A;  5HH1 A;  4AG9 A;  4CAV A;  3WR7 A;  1M4I A;  2OU2 A;  5KTD A;  2Q4Y A;  3FNC A;  1Y9K A;  4HKF A;  4OAE A; 
#chains in the Genus database with same CATH topology
 4UCP A;  3IU1 A;  3LMS A;  4ZY0 A;  3B3T A;  2Z0Z A;  2VL1 A;  2JEW A;  4CGL A;  4CRY B;  5BWA B;  3GYA A;  1BLL E;  3T8W A;  4C2Z A;  1P4N A;  4UFX A;  4A95 A;  1QMU A;  2AFZ A;  2QJ8 A;  2WZN A;  2JDC A;  3EC4 A;  4QUS A;  3CT9 A;  3IU2 A;  4KSF A;  4B13 A;  5HVF A;  1I1D A;  2KCW A;  4KUA A;  5CBM A;  5J8F A;  3D2M A;  2XEG A;  2GLF A;  3EO4 A;  1QSM A;  1ZLI A;  5F46 A;  1KZF A;  4P4D A;  2C1C A;  2CF4 A;  4M6H A;  4KVO E;  4UWJ A;  5EBV A;  4X3R A;  2VEZ A;  4C7H A;  1I12 A;  3JUW A;  2ZW4 A;  1NE9 A;  5K8M A;  4YU9 A;  1CP6 A;  4OLL A;  3GY9 A;  1TF8 A;  3SJE A;  1Z8X A;  1CPX A;  4OP4 A;  2YNE A;  2WUU A;  1VHO A;  2OZH A;  2FIA A;  3TTH A;  5AG7 A;  2NSM A;  2G3A A;  4CYN A;  3IWW A;  5LYD A;  3CXS A;  1ZG7 A;  4MCR A;  4PXC A;  4KSA A;  4F8Z A;  4RUH A;  4ZX9 A;  5JM6 A;  4U9Y A;  2JLM A;  1R3N A;  5LYI A;  4P4F A;  2Z3P A;  4CGN A;  2AFS A;  2P6F A;  2PJC A;  4CS0 B;  4IK2 A;  2EWB A;  1LFW A;  2DF5 A;  2ZEO A;  3KKW A;  4KLV A;  4WWV A;  1FY7 A;  2I00 A;  3H8F A;  3IFE A;  2B3V A;  4CYQ A;  4EFD A;  2V8D A;  4QVT A;  4UIB A;  2PDO A;  1VKC A;  4F9V A;  4R87 A;  4MMO A;  2RC4 A;  2P0W A;  2PE3 A;  4IAV A;  2C6C A;  3KZW A;  4PQA A;  2PJ9 A;  3FJU A;  5F48 A;  4AB7 A;  2DXQ A;  3D7G A;  4KSI A;  4H2K A;  1XE4 A;  3IJ3 A;  4Z65 A;  3TE4 A;  2ATR A;  2FL4 A;  1M4D A;  2ZEN A;  2JBK A;  4GXH A;  4NGP A;  4R6T A;  2Z3K A;  3QB8 A;  4DUK A;  2B5G B;  1IB1 E;  2G3T A;  4MRI A;  2D4O A;  1ON0 A;  4KOS A;  2B5G A;  4HNX B;  3LAC A;  1S7F A;  1YVO A;  3DSB A;  2CIJ A;  4BIN A;  2OB0 A;  4MFL A;  1VIX A;  3PB9 X;  1MJB A;  2AE6 A;  2Z11 A;  1XIX A;  3RZA A;  4KOR A;  1IYK A;  4CPA A;  1ZG8 A;  2GRE A;  1M44 A;  3DDD A;  4CAX A;  1NSL A;  4C7I A;  3UY5 A;  1S5K A;  4KUB A;  2FCK A;  4FD4 A;  5E96 A;  3R9E A;  4ONU A;  3TT2 A;  4CAF A;  1N71 A;  2Q51 A;  2JBJ A;  2BSW A;  2I79 A;  4ZX8 A;  1MJA A;  1S7L A;  4MBU A;  1ELL P;  3GB0 A;  1Z4E A;  8CPA A;  2ZOG A;  4R57 A;  5H84 A;  1Z2L A;  2DPT A;  3D2P A;  4MCQ A;  1XEB A;  3MGD A;  3B3S A;  3PGP A;  2RB7 A;  2REF A;  4ONW A;  2VXK A;  1DE4 C;  4R76 A;  1IOI A;  2FSR A;  4XNH C;  2C6P A;  2VI7 A;  4MFQ A;  4NF1 A;  4ZY2 A;  3CXP A;  3KL9 A;  3R1K A;  3R9G A;  3FH4 A;  1BPN A;  5G20 A;  4NEX A;  4F0Y A;  2Q0Y A;  1XMT A;  3H4Q A;  2ZEF A;  4EME A;  1KUX A;  4GS4 A;  1KUY A;  1PU9 A;  2IQ6 A;  4M3S A;  4OKO A;  4A37 A;  4FAI A;  2HUZ A;  4PSX A;  3MRU A;  4I49 A;  4FD5 A;  1QSO A;  3PB8 X;  5AG5 A;  3CPX A;  4ZBG A;  4PK3 A;  3S9N A;  2YND A;  3D3S A;  1HDQ A;  4JD6 A;  2Q04 A;  3C26 A;  4MY3 A;  4MHD A;  3KQZ A;  4UBR A;  4KVM E;  4ZI6 A;  3D66 A;  2PVW A;  2YGW A;  1S7K A;  1F2O A;  1L0C A;  2B4D B;  4CYP A;  2QIR A;  2AFX A;  2PRQ A;  4B5P B;  3FB3 A;  2Q43 A;  2AFW A;  2EVN A;  2ODF A;  4OIW A;  2V77 A;  2Y0M A;  4UEF A;  2ZEG A;  4NGS A;  5IV0 A;  3CXQ A;  4FWU A;  4M85 A;  3W6S A;  3S6H A;  2PJB A;  1Z9U A;  2K5T A;  1ZLH A;  2IL4 A;  2AFU A;  1LRZ A;  2J8N A;  3F8K A;  4MJ8 A;  5K8P A;  3KR5 A;  4HNW B;  2OZU A;  1YW4 A;  4FD7 A;  3TO6 A;  3B8G A;  3DGV A;  4DNC A;  5H86 A;  2J8M A;  4QBJ A;  2Z3O A;  1OBR A;  4NGT A;  1Y7R A;  2H5M A;  3PP9 A;  3NE8 A;  4ZGY B;  3FXT A;  3D67 A;  4HPS A;  4JYW A;  2PR8 A;  4QB9 A;  4XPD C;  3BI0 A;  1YME A;  4A33 A;  4UA3 A;  4Q36 A;  1CBX A;  2QML A;  3PBE A;  4UWI A;  1IOF A;  1Q2C A;  1B6B A;  3PB4 X;  5ELY A;  4PXE A;  5C88 A;  3SJG A;  4CRZ B;  3TOA A;  2AFO A;  1XFO A;  1YVK A;  2Z3L A;  3SJF A;  1TKF A;  2F5I A;  2J8R A;  2ZEP A;  3D4U A;  1IIC A;  3GIU A;  1WWZ A;  3IWE A;  1IY7 A;  3ZJ0 A;  1Z5R A;  4P44 A;  1ARL A;  2FT0 A;  4U5Y A;  4TWE A;  4YWY A;  5J8C A;  1CX8 A;  3G8W A;  3NH4 A;  5F47 A;  4JZ0 A;  2PIY A;  2Z3M A;  4AVC A;  4LX9 A;  3QAH A;  3SI2 A;  3DR6 A;  2ZPA A;  5THW A;  1CJW A;  4MFK A;  1JWQ A;  2Q7S A;  4UCN A;  2PRB A;  2XEJ A;  2VBQ A;  1BO4 A;  3A9L A;  1XMB A;  2V8G A;  4PPZ A;  4YGO A;  3R96 A;  4B5O A;  4A94 A;  2BO9 A;  1ELM P;  4CAE A;  2G9D A;  3P2H A;  4A39 A;  4B5P A;  4C2Y A;  3FIX A;  4NGR A;  3KQX A;  4CGP A;  1S7N A;  1J4J A;  1TKJ A;  1A2Z A;  4OC4 A;  4PXB A;  3SI0 A;  2PJ4 A;  4F9U A;  3NH8 A;  2FVG A;  1R57 A;  1CP7 A;  2B4B A;  2B4D A;  1PUA A;  2P6G A;  2XEI A;  1YGH A;  1YR0 A;  4RI1 A;  3RO0 A;  1M4L A;  5LRG A;  3IWG A;  3T90 A;  3TFY A;  3E0K A;  5LRJ A;  1BPM A;  5G22 A;  2R7H A;  4OC0 A;  1NSA A;  2WYR A;  2ZW7 A;  2BCO A;  3TO7 A;  4MFJ A;  3BLN A;  4H89 A;  2BUE A;  2V8H A;  2WPW A;  3T9Y A;  3TC8 A;  5AG4 A;  3F0A A;  4R3L A;  5DWM A;  1QST A;  4Q38 A;  3W6X A;  2VZZ A;  3GUX A;  5HVH A;  5K8N A;  4LQG A;  4ZYQ A;  4A31 A;  1BAV A;  4YRH A;  2BOA A;  2G0B A;  2CNS A;  4B11 A;  2GE3 A;  2FS5 A;  3PEI A;  4KOU A;  1LAP A;  1IU8 A;  3FEC A;  1YLO A;  4AVB A;  2WSA A;  3S9M A;  3W91 A;  5HVG A;  4KVX A;  1UWY A;  3PB6 X;  5LRK A;  1R43 A;  1GYT A;  2EK9 A;  3K9T A;  4KOX A;  4JLY A;  2FXF A;  3KI9 A;  3H5Z A;  2YNC A;  3BHX A;  4Q7A A;  4P45 A;  3I9S A;  4C68 A;  5AG6 A;  3PZJ A;  3B7I A;  3VH9 A;  3WAB A;  3IEH A;  2FIW A;  1RO5 A;  4E8O A;  2HB6 A;  2HV2 A;  5A27 A;  4KZT A;  4NXY A;  2CNM A;  2PJ6 A;  4KLW A;  2HC9 A;  2HQY A;  1QQ9 A;  4XPK A;  3RAM A;  3S6F A;  2CXA A;  3KHZ A;  4P4B A;  3FBU A;  2NMT A;  4E2A A;  5LYL A;  1LOK A;  1RTQ A;  2RFH A;  3FMC A;  2GIV A;  1TKH A;  3PRT A;  5IX3 A;  1M1D A;  2ANP A;  5GCN A;  4P4I A;  5JQ4 A;  4O23 A;  1LAM A;  2OH1 A;  2YNC C;  3D7H A;  4X2T A;  3R9F A;  3R95 A;  5KTC A;  3F5B A;  3H8G A;  3V38 A;  4CGM A;  4P4J A;  4DYO A;  4ZY1 A;  3SXO A;  3DR8 A;  2IMO A;  4OC5 A;  2C6G A;  3CDX A;  1IGB A;  2PCU A;  2CTC A;  5AGE A;  2DPS A;  5G21 A;  3SXN A;  3WC5 A;  1IYL A;  3FVL A;  2NYQ A;  5I4M A;  4PSW A;  4NCZ A;  4KOY A;  4OID A;  4OC3 A;  3FF3 A;  3CZX A;  4KOW A;  2GFQ A;  4L8A A;  3RBU A;  1X12 A;  3SI1 A;  2EBJ A;  2O53 A;  3IO1 A;  3D68 A;  4HNY B;  5D29 A;  3JVN A;  3V8I A;  5DWN A;  2PJ7 A;  4R9M A;  4M6G A;  4LUA A;  3BXM A;  4MHZ A;  2PJ2 A;  3HUV A;  1EE3 P;  2PIZ A;  3NFZ A;  1LAN A;  4UEE A;  3TO9 A;  2VZY A;  4MHY A;  4P6Y A;  1CG2 A;  2I3C A;  4P10 A;  1AMP A;  2Q4V A;  3TX8 A;  3WC6 A;  4CYO A;  4X8I A;  1OZP A;  4BBH A;  3QNV A;  4IF5 A;  1LCP A;  2EO8 A;  3VAR A;  2ZEM A;  3DNS A;  5JH9 A;  1Y9W A;  3MN8 A;  4MI4 A;  4Y49 C;  4OME A;  1QSN A;  4TNU A;  1WK4 A;  4YFJ A;  1YRE A;  4JJX A;  2Q7B A;  4B12 A;  1KUV A;  3IC1 A;  3JRU A;  3NH5 A;  4QC6 A;  2WPX A;  4B6Z A;  2POK A;  1K4J A;  1F57 A;  3FEE A;  4U9Z A;  5FVJ A;  4KOT A;  3GLJ A;  3P2F A;  3V7Z A;  1TF9 A;  1XOV A;  3JTK A;  4NGM A;  4BD9 A;  4EVY A;  2F8H A;  2ZED A;  1AUG A;  2QEC A;  4FD6 A;  3L2N A;  1MJ9 A;  4B14 A;  1S60 A;  2PJ1 A;  1B87 A;  3FYN A;  2ZEL A;  1Y7E A;  2PJ8 A;  3FRM A;  1Q7L A;  4F6A A;  2ZXV A;  4L89 A;  4RN7 A;  2AFM A;  4Y49 B;  2JEV A;  1P0H A;  2ZW6 A;  3K2K A;  5LYF A;  2A4N A;  2Z3N A;  4XNH B;  4XPL A;  5CPA A;  5ISV A;  4E0A A;  4II9 A;  3NE7 A;  4JWP A;  4UF4 A;  2OZG A;  4FBE A;  3PB7 X;  4UEZ A;  4X5K A;  1TIQ A;  2B58 A;  1YW6 A;  1CPS A;  2F7V A;  3I3G A;  4KOV A;  3K9U A;  4J3G A;  2R8V A;  1BOB A;  4MFP A;  2B3U A;  3ISX A;  1ZG9 A;  2PSW A;  1Z8W A;  2OOT A;  4NJR A;  2PJ5 A;  1Q2Y A;  3N5F A;  3IGR A;  2PR1 A;  3LD2 A;  3LOD A;  3WT4 A;  5KTA A;  1QSR A;  1M4G A;  1HDU A;  3LWU A;  3EXN A;  4UIA A;  2ZEH A;  5J1Q A;  4A2Z A;  1S3Z A;  5HXD A;  3SHP A;  4K3N A;  1KWM A;  2PC1 A;  2R98 A;  4CAW A;  1FT7 A;  2PJ3 A;  2ABZ A;  1PCA A;  2QVP A;  4NFR A;  4F0X A;  1Z8T A;  1XBU A;  2V8V A;  4MCP A;  1Z8L A;  4MXU A;  1V0C A;  2PVV A;  5F49 A;  3B3W A;  3G3S A;  1Z4R A;  3I1U A;  4R3K A;  3RYO A;  3PBB A;  1XJO A;  2CY2 A;  4C2X A;  2PJA A;  1I21 A;  3PFO A;  4UCM A;  4NJQ A;  4UFV A;  2BL1 A;  4P4E A;  5IB0 A;  3BJ8 A;  4IUS A;  4BMH A;  3WC7 A;  1RXT A;  4A32 A;  4H6U A;  2IJZ A;  3H8E A;  4MHN A;  7CPA A;  1H8L A;  1TXR A;  4OAD A;  5HMN A;  3B35 A;  4IHM A;  5DS0 A;  1Y0R A;  5JGF A;  1XRY A;  1VGY A;  1VHE A;  3B3C A;  1YX0 A;  5C82 A;  1HEE A;  1Q2D A;  2Q44 A;  3B3V A;  2X7B A;  5D8N A;  4NGN A;  5I0C A;  3BI1 A;  3DLJ A;  3BJ7 A;  4R7M A;  4AVA A;  3OWC A;  1IID A;  3TOB A;  5IB9 A;  1YLE A;  3FED A;  3KGQ A;  4OC1 A;  4A38 A;  5K8O A;  2P6E A;  2PQ8 A;  2XEF A;  3PFE A;  3RNZ A;  4GM5 A;  1YK3 A;  2O28 A;  3GKR A;  1U6M A;  1UFH A;  4MCS A;  4XPD B;  2FE7 A;  1NMT A;  1DTD A;  2VQY A;  3S9L A;  2CNT A;  3EFA A;  4ORF A;  4W9Y A;  4R8F A;  1SQH A;  2GLJ A;  4NSQ A;  6CPA A;  1GHE A;  2Z10 A;  4RS2 A;  2JDD A;  2EUI A;  3D7F A;  4M6I A;  2AJ6 A;  5CNP A;  2C27 A;  1F2P A;  4JXQ A;  5F09 A;  4PV6 A;  4H6Z A;  4UFW A;  2BEI A;  3B2Y A;  3HLP A;  5A28 A;  4K30 A;  3KR4 A;  3N7Z A;  3QAY A;  3KHX A;  3IIB A;  4KS9 A;  2CTB A;  4MHP A;  2Q4Z A;  4MFZ A;  3FX6 A;  3KAS A;  4OC2 A;  4FUU A;  5EMI A;  2D4P A;  4EWT A;  4DJL A;  4CGO A;  2DEA A;  1ARM A;  4G1P A;  4PK2 A;  3NA6 A;  3VWD A;  4B10 A;  1MK4 A;  3TCV A;  1Y0Y A;  3ISZ A;  2ARH A;  2O4H A;  2ZW5 A;  4A30 A;  5JPH A;  4JXR A;  5G1Z A;  3S6G A;  4AG7 A;  4MY0 A;  1CM0 A;  4WJB A;  5EC4 A;  2GU2 A;  2OR4 A;  4NGQ A;  1VHS A;  1AYE A;  1FNO A;  3SJX A;  3S6K A;  2R1I A;  3VWE A;  3ZZI A;  3EY5 A;  2GAN A;  1PYT B;  3D7D A;  4LQ6 A;  2REE A;  2PJ0 A;  3D8P A;  1XF8 A;  5HH1 A;  4PXD A;  4AG9 A;  3CPA A;  4CAV A;  1JQG A;  2EK8 A;  2QYV A;  3WR7 A;  1ZO0 A;  1X10 A;  1M4I A;  2ZOF A;  2OU2 A;  5KTD A;  2ZEE A;  1YSJ A;  2Q4Y A;  3FNC A;  4AXV A;  1Y9K A;  4HKF A;  4OAE A;  2J9A A;  1YQE A;  3VAT A; 
#chains in the Genus database with same CATH homology
 4UCP A;  3IU1 A;  2Z0Z A;  4CRY B;  4CGL A;  5BWA B;  3GYA A;  4C2Z A;  1P4N A;  4UFX A;  4A95 A;  2JDC A;  3EC4 A;  4QUS A;  3IU2 A;  4KSF A;  4B13 A;  1I1D A;  2KCW A;  4KUA A;  5J8F A;  3D2M A;  3EO4 A;  1QSM A;  5F46 A;  1KZF A;  4KVO E;  4UWJ A;  5EBV A;  2VEZ A;  4C7H A;  1I12 A;  3JUW A;  2ZW4 A;  1NE9 A;  4OLL A;  3GY9 A;  2YNE A;  2WUU A;  2OZH A;  2FIA A;  3TTH A;  5AG7 A;  2G3A A;  4CYN A;  3CXS A;  4KSA A;  4U9Y A;  2JLM A;  2Z3P A;  4CGN A;  2P6F A;  4CS0 B;  3KKW A;  4KLV A;  1FY7 A;  2I00 A;  2B3V A;  4CYQ A;  4QVT A;  2PDO A;  1VKC A;  4R87 A;  2RC4 A;  2P0W A;  5F48 A;  4AB7 A;  2DXQ A;  1XE4 A;  3TE4 A;  2ATR A;  2FL4 A;  1M4D A;  2Z3K A;  3QB8 A;  2B5G B;  1IB1 E;  2G3T A;  2D4O A;  1ON0 A;  4KOS A;  2B5G A;  4HNX B;  1S7F A;  1YVO A;  3DSB A;  2OB0 A;  4MFL A;  1MJB A;  2AE6 A;  2Z11 A;  1XIX A;  4KOR A;  1IYK A;  1M44 A;  3DDD A;  4CAX A;  1NSL A;  4C7I A;  3UY5 A;  1S5K A;  4KUB A;  2FCK A;  4FD4 A;  5E96 A;  3R9E A;  4ONU A;  3TT2 A;  1N71 A;  2BSW A;  2I79 A;  1MJA A;  1S7L A;  4MBU A;  1Z4E A;  5H84 A;  4R57 A;  2DPT A;  3D2P A;  1XEB A;  3MGD A;  3PGP A;  2REF A;  2VXK A;  2FSR A;  4XNH C;  2VI7 A;  4MFQ A;  4NF1 A;  3R1K A;  3CXP A;  3R9G A;  5G20 A;  4NEX A;  4F0Y A;  2Q0Y A;  1XMT A;  3H4Q A;  1KUX A;  4GS4 A;  1KUY A;  1PU9 A;  4M3S A;  2HUZ A;  4PSX A;  4I49 A;  4FD5 A;  1QSO A;  5AG5 A;  4ZBG A;  4PK3 A;  2YND A;  3D3S A;  4JD6 A;  2Q04 A;  3C26 A;  4MY3 A;  4MHD A;  4UBR A;  4KVM E;  2YGW A;  1S7K A;  1L0C A;  2B4D B;  4CYP A;  2QIR A;  4B5P B;  3FB3 A;  2EVN A;  2Y0M A;  5IV0 A;  3CXQ A;  4M85 A;  3W6S A;  3S6H A;  1Z9U A;  2K5T A;  2IL4 A;  1LRZ A;  2J8N A;  3F8K A;  4MJ8 A;  4HNW B;  2OZU A;  3TO6 A;  4FD7 A;  3B8G A;  4DNC A;  5H86 A;  2J8M A;  4QBJ A;  2Z3O A;  1Y7R A;  2H5M A;  3PP9 A;  4ZGY B;  3FXT A;  4XPD C;  2PR8 A;  4QB9 A;  4A33 A;  4UA3 A;  4Q36 A;  2QML A;  4UWI A;  1Q2C A;  1B6B A;  5C88 A;  4CRZ B;  3TOA A;  2Z3L A;  1YVK A;  2F5I A;  2J8R A;  3IWE A;  1IIC A;  3ZJ0 A;  1WWZ A;  2FT0 A;  4U5Y A;  5J8C A;  3G8W A;  5F47 A;  2Z3M A;  4AVC A;  4LX9 A;  3QAH A;  3DR6 A;  2ZPA A;  1CJW A;  4MFK A;  4UCN A;  2PRB A;  2VBQ A;  1BO4 A;  3A9L A;  4YGO A;  3R96 A;  4B5O A;  4CAE A;  3P2H A;  4B5P A;  4C2Y A;  3FIX A;  4CGP A;  1S7N A;  1J4J A;  1R57 A;  2B4B A;  2B4D A;  1PUA A;  2P6G A;  1YGH A;  1YR0 A;  4RI1 A;  3IWG A;  3T90 A;  3TFY A;  3E0K A;  5G22 A;  2R7H A;  2ZW7 A;  3TO7 A;  4MFJ A;  3BLN A;  4H89 A;  2BUE A;  2WPW A;  3T9Y A;  5AG4 A;  3F0A A;  4R3L A;  5DWM A;  1QST A;  4Q38 A;  3W6X A;  2VZZ A;  4A31 A;  4YRH A;  2G0B A;  2CNS A;  4B11 A;  2GE3 A;  2FS5 A;  4KOU A;  4AVB A;  2WSA A;  3W91 A;  4KVX A;  4KOX A;  4JLY A;  2FXF A;  3H5Z A;  2YNC A;  3I9S A;  4C68 A;  5AG6 A;  3PZJ A;  2FIW A;  1RO5 A;  4E8O A;  2HV2 A;  5A27 A;  4KZT A;  4NXY A;  2CNM A;  4KLW A;  4XPK A;  2HQY A;  3S6F A;  2CXA A;  3FBU A;  2NMT A;  4E2A A;  2GIV A;  5IX3 A;  1M1D A;  5GCN A;  5JQ4 A;  2OH1 A;  3R95 A;  2YNC C;  3R9F A;  5KTC A;  3F5B A;  4CGM A;  3SXO A;  3DR8 A;  5G21 A;  3SXN A;  5AGE A;  2DPS A;  1IYL A;  4PSW A;  4NCZ A;  4KOY A;  4CAF A;  4KOW A;  4L8A A;  4HNY B;  3JVN A;  3V8I A;  5DWN A;  4R9M A;  4LUA A;  3TO9 A;  2VZY A;  4CYO A;  2Q4V A;  1OZP A;  4BBH A;  4IF5 A;  3DNS A;  1Y9W A;  4MI4 A;  4Y49 C;  1QSN A;  1WK4 A;  4YFJ A;  1YRE A;  4JJX A;  2Q7B A;  4B12 A;  1KUV A;  4QC6 A;  2WPX A;  1K4J A;  4U9Z A;  5FVJ A;  4KOT A;  3P2F A;  3JTK A;  4EVY A;  2QEC A;  4FD6 A;  1MJ9 A;  4B14 A;  1S60 A;  1B87 A;  3FYN A;  3FRM A;  4F6A A;  2ZXV A;  4L89 A;  4Y49 B;  2JEV A;  1P0H A;  2ZW6 A;  2A4N A;  2Z3N A;  4XNH B;  4XPL A;  5ISV A;  4E0A A;  4II9 A;  4JWP A;  3NE7 A;  2OZG A;  4X5K A;  1TIQ A;  2B58 A;  3I3G A;  4KOV A;  3K9U A;  4J3G A;  2R8V A;  1BOB A;  4MFP A;  2B3U A;  2PSW A;  1Q2Y A;  5KTA A;  3IGR A;  2PR1 A;  3LD2 A;  3LOD A;  1QSR A;  1M4G A;  3EXN A;  4A2Z A;  1S3Z A;  3SHP A;  4CAW A;  2PC1 A;  2R98 A;  4F0X A;  1V0C A;  5F49 A;  3G3S A;  1Z4R A;  4R3K A;  3RYO A;  2CY2 A;  4C2X A;  1I21 A;  4UCM A;  4UFV A;  2BL1 A;  5IB0 A;  3BJ8 A;  4IUS A;  4BMH A;  4A32 A;  1RXT A;  4H6U A;  5HMN A;  4OAD A;  1YX0 A;  5C82 A;  1Q2D A;  2Q44 A;  2X7B A;  5I0C A;  3BJ7 A;  4AVA A;  3OWC A;  1IID A;  3TOB A;  1YLE A;  2P6E A;  2PQ8 A;  1YK3 A;  2O28 A;  3GKR A;  1U6M A;  1UFH A;  4XPD B;  2FE7 A;  1NMT A;  2VQY A;  2CNT A;  3EFA A;  4ORF A;  1SQH A;  4NSQ A;  1GHE A;  2Z10 A;  4RS2 A;  2JDD A;  2EUI A;  2AJ6 A;  5CNP A;  2C27 A;  4JXQ A;  4PV6 A;  4H6Z A;  4UFW A;  2BEI A;  5A28 A;  4K30 A;  3N7Z A;  4KS9 A;  4MFZ A;  2D4P A;  4CGO A;  4PK2 A;  3VWD A;  4B10 A;  1MK4 A;  3TCV A;  2ARH A;  2ZW5 A;  4A30 A;  5JPH A;  4JXR A;  5G1Z A;  3S6G A;  4AG7 A;  4MY0 A;  1CM0 A;  5EC4 A;  1VHS A;  3S6K A;  2R1I A;  3VWE A;  3ZZI A;  3EY5 A;  2GAN A;  2REE A;  3D8P A;  1XF8 A;  5HH1 A;  4AG9 A;  4CAV A;  3WR7 A;  1ZO0 A;  1M4I A;  2OU2 A;  5KTD A;  2Q4Y A;  3FNC A;  1Y9K A;  4HKF A;  4OAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...