5F4ZA

The crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
388
structure length
388
Chain Sequence
MEPFRIVIPQADLDDLHRRLDATRWPSEIPGTGWSRGVPLDYLKELVGYWRDGYDWRAAEDRLNTVPQFTTEIDGTNVHFMHIRSAEPDALPMIITHGWPGSVAEFLDVIDPLTNPRAHGGDPADAFHLVIPSLPGFGFSGPTPEPGWNLPRVASAWAELMRRLGYSRYAVQGGDLGAWTSLTLSGVDHEHVVGTHVNFLITPPSGDPADLAGLGEQDLARLQLLAEFGAEGSGYMKIQSTRPQTLSYSLTDSPVGQLAWVVEKFMEWGDTDKSPEDAVDRDRLLTNVMIYWLTATAGSSAHFYYEISDVLPTAPTPPPPAPPLPTPLGVAVYPADSAKPVRRFAERAFPNIVHWAELERGGHFAALEQPGLFVSDLRAFARALRTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an epoxide hydrolase from Streptomyces carzinostaticus subsp. neocarzinostaticus
rcsb
source organism Streptomyces carzinostaticus subsp. neocarzinostaticus
molecule tags Hydrolase
molecule keywords Epoxide hydrolase
total genus 129
structure length 388
sequence length 388
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06441 EHN Epoxide hydrolase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f4zA00
2Z8ZA 1CUWA 3DOIA 4Q34A 2XI4A 1K6EA 1MX9A 4QWMA 1MPXA 4RGYA 1ZD2P 1E3QA 1R88A 5ALDA 2CB9A 1U8EA 4QLOA 3ZWQA 3F96A 2G5TA 3STUA 2YH2A 5HFAA 1JI3A 3OTQA 4JYMA 5ALLA 5A7HA 5ALEA 1BU8A 2XUQA 5CT5A 1GXSA 2XQKA 1GKLA 1LBTA 1MN6A 2Y2UA 4EUSA 4OSEA 3H2HA 4UHHA 3WQHA 1VXOA 2I3ZA 3SX4A 1M33A 4C01A 4J0IA 4AN0A 4E46A 1TCAA 1QGED 1QZ3A 3R3ZA 4S0XA 3ESDA 2DHDA 3BIWA 1N1MA 2I03A 2ZJFA 2C4HA 2OXEA 2YYSA 4U2FA 1FFEA 5LYYA 5AM0A 3DOHA 1CEXA 3AIMA 1CIJA 2W22A 1HL7A 5K3BA 2JGLA 4Y7DA 4X6XA 1XZGA 4QNNA 5D6OA 2FJ0A 1WHSA 2RI6A 3S8YA 2GBFA 3PE6A 4CG2A 1UKCA 2QT9A 4J3JA 3O9MA 5AK4A 4Y2QA 4CIAA 2QVBA 3ZI7A 4XIIA 4DIUA 2RIPA 1GT6A 1KEZA 2WFLB 1K8QA 3VVLA 5SYNA 3PF8A 5CT8A 1LPNA 5AK3A 2QUAA 1ETHA 1VLQA 2XMGA 1VA4A 1YASA 4DLNA 2XUPA 4K6KA 1LPMA 4QE3A 4CCYB 5C7YA 3QMWA 1DU4A 1LPBB 1DWQA 3OC0A 2BJHA 1WB4A 1CUAA 2ACKA 5ALWA 4E15A 2BKLA 5CMLA 3FYUC 4Y2UA 3STXA 1CUYA 1LLFA 3ANSA 2BAGA 3FCYA 4HRXA 1W6RA 3QPAA 3KOOA 2DHEA 2XUFA 4EA6A 1CUDA 4RE5A 4EHBA 2ONCA 5AIBA 1EINA 2YASA 1GQSA 4EZIA 1OXMA 5D3KA 1XZKA 4H7FA 5FPPA 1FFDA 3PICA 5FP0A 4I19A 4YPVA 5HF5A 3HEAA 4L72A 5CXUA 2DCMA 4LXGA 3T4UA 1AC5A 1BS9A 3LLCA 2WIKA 1XKLA 4Y2VA 2Z3ZA 4TPKA 1XZHA 3C43A 2JGMA 3WKBA 1EA5A 2PL5A 2GZRA 3LIIA 2O2HA 4N8EA 4DGQA 1XRRA 3ICWA 2RHTA 4G8DA 3G9ZA 4G1FA 1H22A 1HKHA 1IVYA 4M0MA 4W1PA 2XMDA 4CCWA 5JAOA 4AZ3A 1L7AA 5K3FB 2HA0A 3R3YA 3WZMA 1CUCA 3RM3A 4EY6A 5ALXA 3STYA 1XZMA 4WY8A 3WWCA 4ETWA 4BYMA 1CUHA 4MYSA 3T52A 4H7DA 3VXKA 4QLAA 3DYIA 4KYVA 3WK4A 2ZJ7A 5DYTA 1HLGA 3LIPA 1MX1A 2XUIA 4E14A 3LCRA 2I3DA 3QYJA 5HZGA 4RE6A 3M83A 2WHQA 2WUGA 3HC7A 1XQVA 5ISMA 3QZUA 3GUUA 4UFPA 3WYNA 3WL8A 2H1IA 5DJ5A 5DTIA 5AI8A 1RYYA 4TVKA 2WFLA 3C70A 2J3DA 3Q8WA 2J4CA 5EFZA 1ZD3A 3W06A 4U2EA 4MWTA 2FUKA 5KBYA 4M0EA 1AUOA 4UUQA 1TCCA 4FDMA 4FLFA 4OB8A 1THGA 1QONA 4BCCA 2OGZA 2XQIA 1EK1A 4X6UA 3WKAA 3V1KA 5AKHA 1LPSA 3WJ1A 1C7JA 5ALRA 1ZJ4A 4OYYA 2WHRA 3H19A 2JF0A 3FLAA 2ZYHA 4UHEA 4NMWA 4CI9A 5AHXA 2XUKA 1QOZA 1A7UA 2R8BA 1J07A 5FPQA 1EX9A 5DNWA 1E89A 2FX5A 4XVCA 3DCNA 5BWBA 1CUGA 3WWOA 1JU4A 3DYVA 4WY5A 4MQMA 5AKEA 5E4JA 3WA7A 5AOBA 3GELA 2B9VA 1ORWA 4MJ3A 1G42A 3W9UA 4Y2PA 1F0NA 4X94A 5LLSA 3D59A 4WFKA 3ESAA 1Q84A 2BGRA 5K3CA 3RARA 3B5EA 2WU3A 4N8DA 4QDOA 4H0CA 2OCGA 3QBJA 3O0DA 4ZXFA 1CUIA 2YXPX 5FDFA 5SYMA 4FNMA 2LIPA 4X71A 5I8PA 3EBLA 5DNUA 3AZQA 4JH0A 1SCKA 2O2IA 2WFMA 3KDAA 1E66A 4M0FA 1XRPA 4EY7A 5CH8A 4UHCA 1YA4A 1ACJA 3G9TA 3G0IA 3KWJA 5FLKA 3EQ8A 2Y1KA 2QMQA 4UBIA 1AMNA 4QDTA 2O2GA 4Q3KA 2HA7A 1CR6A 1R9MA 2VJBA 2DHCA 1BCRA 1XZAA 4NVRA 2PU7A 4BC0A 5AM3A 1CVLA 1E5TA 4KAJA 3V1LA 2CZQA 1RWQA 2IITA 4FOLA 5IVHA 2HFJA 4XWGA 4DMHA 3H17A 4B83A 5CTAA 3FSGD 4ZREA 1YSCA 4BB0A 2Q0XA 2VF2A 2GBGA 2WHPA 1QJ4A 1ACLA 3AILA 5DLPA 1H2ZA 2C5GA 2WIFA 4PW0A 2JGJA 3G0BA 3E4DA 3WIBA 5JD5A 1EHYA 3D0KA 3R3WA 4CIBA 2VA9A 5EHNA 3HYSA 2WG2A 1R3DA 3B3QA 4G4IA 1VZ2A 3WA6A 1AQLA 1U2EA 4DMCA 5KREA 4LXHA 2NW6A 4B84A 1A8SA 3BJMA 2DQZA 4Y9SA 3IUMA 4PF1A 1THTA 4XX1A 2PUHA 4IO0A 3S2ZA 1QE3A 4FBMA 4BTVA 3WKEA 4AZ0A 1JT2A 1K5PA 4ARAA 5IH7A 3E0XA 4J03A 3DDUA 2WILA 1SOMA 2B20A 2ES4A 1FJ2A 1LZLA 4QDZA 4XJVA 2E3JA 1Q0RA 2HL6A 5LZ9A 4GHWA 2PSDA 2OQIA 4DSAA 3SC2A 4CFSA 4UFNA 1Y7HA 2BUCA 5EGNA 3WK8A 1EXWA 3DL4A 4OUKX 3WYDA 3R41A 5AM2A 1GKKA 3A2LA 2OLEA 3BXPA 1U4NA 5BV7A 1UOOA 4OU5A 4FHZA 1T4MA 4DYHA 3C5WP 4HZGA 2OGSA 1WB6A 4QDUA 3D2BA 5AKKA 5C8XA 4BTLA 5HK8A 1WB5A 1VOTA 1ZOIA 2WIDA 4DM7A 4NS4A 2XUOA 2XMBA 3O4JA 3D2AA 3K6KA 4ZWNA 1UK9A 4K6GA 3BF7A 1HDEA 1R4ZA 1X2BA 3JWEA 1DWPA 4RNCA 5AM1A 2PPLA 4HVTA 1AZWA 4OU4A 5HF9A 4QA9A 4ROTA 2VT6A 5ESRA 4U2DA 3C8DA 3WL5A 5E2IA 2EDCA 1ODSA 3IUJA 2ZYRA 4OYLA 4Y2XA 3O4IA 4G8BA 1NX9A 1LPAB 4CG3A 5JZ9A 4UHFA 4X97A 1UK6A 1MAAA 5AI6A 2PVSA 1LNSA 3EQ9A 2Z5GA 2HU7A 1EB8A 2XMQA 1XZFA 4X6YA 3ZLVA 2JGEA 1TK3A 3FWHA 5ALOA 4A23A 3R40A 1J1IA 2WIJA 1SFRA 1XZLA 4BDTA 1R50A 1XKTA 1AX9A 5AK6A 3DKRA 3H04A 3BE8A 5AP9A 4O08A 4FFVA 4DTCA 1DQYA 4ZI5A 4BCDA 5EIHA 2G4LA 1W75A 3FYUB 2QTBA 1TIBA 1SC9A 5HKAA 1UXOA 4WCVA 3SWWA 2PSEA 5A71A 4QEKA 3DL7A 3KSRA 5JAPA 5K3AA 4B80A 1GPLA 3STVA 3KXPA 1EDDA 5ALMA 3GA7A 2O7VA 1TCBA 4KJXA 4AO6A 5CH3A 3DQZA 2HIHA 5ALTA 1EDBA 3QH4A 4L3WA 3VVMA 4J0JA 4ZV9A 2H7CA 4BZZA 1IZ7A 3UMJA 1BEEA 3PUIA 3I1IA 1TAHA 3WKCA 3M81A 1XRLA 5CT6A 3L1HA 3PF9A 5LZ7A 3I2IA 3IBTA 1BROA 2HRRA 4LHEA 1DX6A 1CUEA 3AFIA 1XZDA 1EVEA 2HA5A 4CCYA 5CT4A 3OURA 4C87A 5E4TA 2QKYA 4YX9A 2PSFA 3WK7A 3QPDA 2JIDA 3C6YA 4BCBA 1XLVA 1JJFA 1QTIA 3ICVA 1JJBA 2VTVA 4B9EA 2WJ3A 4B6GA 4EY8A 4C4XA 5JD4A 1UFOA 4KR0A 1F0PA 2JEZA 3NGMA 1YB6A 3PDCA 3EQ7A 3OOSA 4OPMA 1R9NA 3V1MA 1UOPA 5CXXA 3I2KA 3FYTA 1NU6A 2VAVA 1JFRA 3QPCA 1DQZA 4G5XA 5JYCA 1EB9A 4BBZA 1QIKA 5YASA 1X70A 2ROQA 5A7FA 4H7IA 1C7IA 5IVDA 5ALIA 3H2KA 4AX4A 2XUJA 3CN9A 5BOVA 2WTNA 4BATA 3WK5A 3I6MA 1UT6A 5T4BA 1EK2A 1JKMA 1QO7A 3WL6A 2QS9A 4JYPA 3X3HA 4H7HA 1A88A 1BRTA 2RGUA 4H35A 1P0PA 2GZSA 3DEAA 3D2CA 4X3CA 3G0DA 4G4GA 1HQDA 1QIGA 1VXRA 3WWPA 1BCSA 4UPDA 3IUNA 1LZKA 1ISPA 2WSLA 2ECFA 4BVKA 2QOEA 2PKYX 5F4ZA 2WKWA 2XDWA 2AJDA 2B61A 4FLMA 4JNCA 1CUVA 2HHAA 4UHBA 3QMVA 3UUFA 2JGKA 1CQZA 5ALGA 4GECA 3G8YA 1H2YA 4B81A 3ILSA 1GPNA 4FNGA 3BF8A 3I6ZA 1OCEA 1CUSA 2C0QA 4MEBA 4AMZA 5HKBA 3I28A 5JZSA 1QIIA 1VZ3A 1LGYA 5HFNA 5LKRA 1Y37A 4W63A 3ZLTA 4X00A 3FCXA 3ZLUA 2VJCA 2H7XA 1T2NA 2CUTA 2CMFA 2WG0A 4DNQA 5JADA 4Y2TA 1CUFA 3V9AA 2AJ8A 4H7EA 5JARA 3VKFA 1CRLA 2QUBA 3PFCA 2WU4A 3AINA 5AK5A 4DNOA 3G0CA 2XQFA 3RLIA 2JEYA 3HZOA 1VE6A 4BP8A 2K2QB 4ZV7A 4QZVA 4C6HA 3KD2A 3EF3A 2B4KA 3ED1A 5CURA 4QDXA 4L0CA 3G9XA 3E1GA 4UBLA 2GBIA 1DT5A 4X92A 3C6BA 1IZ8A 2HM7A 2Y2VA 2OG1A 3C6XA 1YAHA 1ZGCA 4BRSA 4Y2JA 3AIOA 3TEJA 1A8UA 1MT3A 5ALYA 4BZWA 3A70A 5LZ4A 3W2TA 2DQYA 5D7BA 5IVIA 4IQ4A 4H7KA 4LKOA 2D5LA 5IKXA 3WMRA 1UOQA 3N0TA 4C88A 2Y6UA 4E11A 1IUNA 3AZPA 1JU3A 1J2EA 3K2IA 5AOAA 4KEAA 1UZAA 1ZD4A 4AN1A 1W4LA 1XZJA 3IA2A 1FFCA 2OPHA 4EB0A 3SK0A 3FLBA 4BAUA 1MU0A 4BDSA 1XQWA 3I2HA 1P0IA 2RONA 3HRHA 2OCKA 1K4YA 3IIIA 3L1JA 3A6ZA 4I4CA 5AM5A 7YASA 3JYHA 1WCYA 4INZA 4W1QA 3R3VA 2XT0A 4F21A 2IIVA 3MVEA 1YB7A 2VJAA 5AKIA 5LZ2A 4MEAA 2QJWA 5LIPA 4Q1VA 1O6GA 1QIHA 2Z3WA 4G9EA 2CKMA 2ZYIA 4OCZA 2RHWA 1WPXA 1ODCA 4PSCA 4U2GA 3C87A 4GEGA 5DNVA 1S8OA 1UKBA 4PQEA 1VA5A 3O4HA 2VQ6A 2EEPA 4OD0A 2OAEA 5AKJA 3F9CA 1QIDA 1W1IA 4IHAA 1UKAA 5DYWA 3V1NA 2UZ0A 4LIPD 4YASA 4PV7A 1AGYA 1B6GA 1XROA 4FLEA 2XE4A 2RAUA 3M82A 2WHPB 5JATA 5AM4A 1VJ5A 1N5RA 4V2IA 3OM8A 5FUMA 1NU8A 2VJDA 4U2BA 4BP9A 1QIEA 5KWJA 3FBWA 3HABA 3WZLA 5HCUA 3I2FA 4X85A 2HA2A 5FXMA 5AKZA 5C8VA 4AXBA 3PI6A 1ZD5A 1CFJA 1ZIYA 2XUGA 4MYDA 1G66A 4OB7A 2JGFA 1CUJA 2HA6A 3JW8A 2X76A 1BEZA 2AJBA 5C8ZA 3GBSA 2J4FA 4G8CA 3IURA 5AKLA 2WUFA 2G63A 4HXEB 4KE9A 5DYYA 1SCQA 2WQZA 1QIJA 4D9JA 2X8BA 4X90A 4FBLA 4BVLA 1GZ7A 3BWXA 4BC1A 4DNFA 2C5FA 1ORVA 2R11A 3GROA 6YASA 5HF6A 1USWA 4KRXA 4X93A 1YA8A 5FV4A 3H2GA 3WKDA 5FKJA 2BUAA 3VJLA 4DSZA 4KACA 3PFBA 2I78A 3FVTA 4B85A 1FSSA 1GGVA 2G5PA 3C45A 5H3HA 4J0HA 1F8UA 2GYVA 3PUHA 3VJMA 4FWBA 3VISA 5EHQA 1QO9A 1UK8A 3U0VA 4KE8A 4Y2RA 5K3DA 2XMRA 1ZICA 4ZGBA 2ZSIA 5JZBA 1AURA 5CRIA 4IH1A 2VATA 4BRZA 4LYEA 1YAJA 3DLTA 3L1IA 4HRYA 2XMCA 3WK6A 4N5IX 1DX4A 3MUOA 2VEOA 1E8MA 1WOMA 3ZV7A 4P9NA 5T4FA 3TGLA 5A62A 2QZPA 1OILA 1H2WA 5C81A 5A6VA 4FKBA 2X5XA 1XRNA 3HJUA 5CW2A 2VT7A 3DNMA 2HA3A 3O4GA 1CLEA 1DTEA 2PSHA 4F0JA 2FJPA 4GI1A 5AOCA 5K3FA 1IUOA 4Y2YA 1XZCA 4ARBA 4AQDA 3M3DA 3HXKA 4H77A 5BWCA 4Q82A 4C4YA 3WLAA 1QIMA 1JJIA 3HSSA 3CCBA 3QMMA 4YK7A 4HAIA 1XFDA 4PNZA 3F67A 4UBMA 3GZJA 3N2ZB 1MO2A 1XZBA 1BN7A 2QXUA 5T4EA 3HI4A 1P0MA 2QR5A 1CUUA 1MJ5A 4HS9A 3BJRA 2XQGA 1TQHA 2PBLA 3H2IA 3QVMA 4DNPA 4G9GA 4B0PA 5AKGA 1UK7A 2C58A 2OCLA 4BE4A 5CH5A 4IH9A 1MX5A 5LZ5A 5AO9A 1W76A 1KU6A 2EDAA 1FFAA 1DWOA 3D3NA 4C89A 5ALZA 3FNBA 3IUQA 3RKSA 3D7RA 3R3XA 1WPRA 2HU8A 2HU5A 2CJPA 4NZZA 4MXDA 3H2JA 1UWCA 3BL8A 1GQRA 1HPLA 1YS2X 1XRMA 1L7QA 3C8HA 3NOXA 3LP5A 3HACA 5D3ZA 2XQJA 1AKNA 3R3UA 4X7BA 1O6FA 3NUZA 4FMPA 3P2MA 1QLWA 5ALQA 4F5ZA 3BIXA 1QFMA 2OGTA 2QM0A 5ALJA 4WFJA 2Z8XA 4Q3OA 1K63A 1WM1A 5ALHA 5FRDA 3O95A 2HDWA 1QTRA 5K3EA 1YR2A 3O9VA 4Q05A 3IVMA 3K9BA 1Q0ZA 4UBNA 1F6WA 1KU0A 1YS1X 4DMKA 1CUZA 2BGNA 2AJCA 4K5QA 4B82A 4B9AA 2WUDA 2OQVA 3NWOA 3D5EA 1BE0A 2ZSHA 5ALPA 3HLKA 4FTWA 1J06A 5AH0A 2DFPA 1HBJA 5I7UA 1XLUA 2ZYSA 2WM2A 2W6CX 3MGAA 1EH5A 3DJYA 3OG9A 2CEKA 4U2CA 1ZI9A 3WJ2A 1TKRA 4X91A 5ALVA 3VJKA 3A2MA 1Z68A 1H2XA 4PSDA 2JGIA 1PV1A 1XLWA 4OB6A 2WLSA 5J3JA 3STWA 5AKYA 5KWIA 2QJRA 5EIEA 1RP1A 1BN6A 3AUKA 2DSNA 2WTMA 4TGLA 1SCIA 2O7RA 4A5SA 4GXNA 1TRHA 4C4ZA 5JIBA 4HXGA 2XMZA 3I6YA 4J0GA 2AJLI 5EIAA 4EBBA 3C6ZA 3ESCA 1I6WA 5ALUA 4JUIA 3DKKA 1ZI6A 4W1SA 1MTZA 4EY4A 1CUXA 3Q0TA 3BDVA 3KWFA 2IX9A 1Q83A 2BCEA 3IB3A 1U65A 2WFZA 5ALKA 1XZIA 4HTAA 4FFWA 5AICA 2VSQA 3H1AA 4IH4A 3LS2A 2ACEA 2Y6VA 4MWSA 4RPCA 2HRQA 4DMFA 1YCDA 4J0KA 3GFFA 4AO7A 3AZOA 4I3FA 4ZRDA 3I2JA 5E4YA 1VE7A 4PO3X 1LBSA 1QIFA 3WI7A 1MAHA 2GYUA 2V96A 2XLBA 3G02A 3ESBA 3U1TA 3FYUA 4N8SA 2PU5A 4G4JA 4JEIA 5A2GA 2QRUA 4WDRA 3V48A 5K5EA 5LZ8A 3F8SA 5HQ3B 5LKAA 2P8SA 5IVKA 1PJAA 2ZJ6A 5DTJA 3DS8A 3CXUA 3VDXA 5AI9A 2XB6A 2WIGA 3W04A 3H1BA 4WFIA 1DINA 3STTA 1G5FA 1ZGBA 5AIAA 4H7JA 4P08A 3OPMA 1ZJ5A 4BAZA 3RK4A 4J0CA 3I1YA 4J0DA 4GWLA 2XMSA 3R0VA 1EI9A 5ALNA 3QITA 3IULA 4K6HA 5DWDA 4UFOA 2JBWA 3TJMA 2XUDA 1H23A 1MNAA 1ZIXA 2V9ZA 5ALSA 1EVQA 1CQWA 1XQXA 3FOBA 4KE7A 4AB1A 2PX6A 1ODTC 4UHDA 2VAXA 1G4HA 3CCCA 2GYWA 4KE6A 1Y7IA 4AMYA 1XZEA 4W9RA 2HADA 1P0QA 5JAHA 2C7BA 1MNQA 3FLEA 4Y2SA 1PFQA 1B41A 3BDIA 4J7AA 5HK9A 1XRQA 4GLBA 5CT9A 3IDAA 4GDMA 3UUEA 3WL7A 3WIOA 4UBOA 2BFNA 4UBJA 1FFBA 4QWWA 4HXFB 4BAGA 2C0PA 2DR0A 5T4HA 2D0DA 4GW3A 1LPPA 1C4XA 1A8QA 5A7GA 3F97A 2HFKA 4LXIA 2PUJA 4K2AA 1JMKC 5JALA 5JANA 5EHXA 2BUBA 4BE9A 4AO8A 1CPYA 5CBKA 4EY5A 5HF8A 4B7ZA 1XQYA 1E8DA 5FOQA 1JMYA 2H9YA 3DD5A 3C5VA 1L7RA 4GBGA 3YASA 5JD6A 3G9UA 2GBCA 2ZVDA 3H0CA 4W1RA 3WWDA 1EDEA 4X95A 3EIOA 2PM8A 4UBKA 3I2GA 3ZPXA 1W52X 4F60A 2OAGA 5EI5A 3G0GA 5JASA 2XUHA 4WDQA 2WJ6A 4WJLA 3F98A 4LYDA 2J3QA 3H18A 3A2NA 5AKXA 1R1DA 3AIKA 2H7YA 1LPOA 2V97A 4CG1A 4BVJA 1CV2A 2QXTA 2WUEA 2XUAA 1QFSA 1N8SA 5AI4A 2WG1A 3FVRA 5AI0A 3G7NA 3WK9A 1X2EA 5ALFA 5LP1A 3TRDA 1VKHA 2XLCA 4H18A 5AJHA 1IUPA 5I9IA 4N5HX 4B0OA 3CN7A 3W05A 1GPKA 4Q3LA 2PSJA 3FSGA 4Z49A 1ZI8A 2ORYA 1DT3A 3AJAA 5HQ3A 5AI5A 4MQLA 3ANTA 1CUBA 4P92A 4KAFA 3FAKA 1E8NA 2WJ4A 3MUNA 3W9BA 1IMJA 4KRYA 4PSUA 4P93A 3QM1A 4KAAA 5JAUA 2OCIA 4A16A 2AXEA 2V98A 4L9AA 4ITVA 1N5MA 2HA4A 1D07A 1WHTA 5EHZA 3B12A 2CBGA 3E3AA 3D4LA 3WWEA
chains in the Genus database with same CATH superfamily
3F6SA 2Z8ZA 1Z33A 1RVV1 3L46A 2PUCA 1CFZA 3MTBA 2RHJA 4H4DA 3QEMB 1DTWA 4C7OB 3W5BA 1IEXA 3DOIA 4Q34A 2XI4A 3DEKA 4K26A 4TMZA 3VR5H 4DUGD 3BQNB 4KDEA 5LU8A 5B1IA 2CXQA 1N3LA 1F8GA 1X94A 4UKDA 5IJAA 3H11B 3EULA 4Q24A 4ZRMA 3WQBA 1IOWA 1HE4A 4EO7A 1WV0A 3TX6A 4QPPA 3JASB 4YP9A 121PA 1Z2PX 4H3KB 1G5PA 5ENDA 5JO9A 4MGHA 2P9TA 3EB9A 3I5XA 4QEZA 1USKA 2QNIA 3ZHSA 1NZFA 4C05A 4DJDC 4HC4A 2LBPA 3ADCA 3MTJA 3X1KA 1OIXA 1T10A 1C5KA 3KVOA 4YCCA 4PZUA 3KQOA 4DIKA 2GNPA 4NU6A 4R1QA 3BQ9A 2GDJA 3C98A 1VG8A 1J5PA 1JR3E 4RSHA 4PC6A 4U39A 3HDQA 5CITA 1WKBA 3D9QX 3ND8A 5FEMA 2ZYAA 3VRHA 1CQXA 2R00A 3JPWA 3O82A 4KQFA 1QYVA 4AF8A 2GT1A 3U9SA 4ZT6A 1TYEB 4I99A 4ARUA 1FRFS 1SC3A 3CURA 4U7WA 3ZD8A 5ICMA 1U2DA 1V37A 3MRTA 3UB3A 2VHXA 4HNTA 2ZSEA 1Z4JA 3DE7X 1D6MA 2D00A 4CRWB 4J7UA 2P78A 3E3LA 4TV8F 3S2EA 2QRNA 3VH4A 3U61B 1A1VA 1Y6RA 1Q7GA 3VPXA 4WJZA 3QMPA 3DLCA 1GKLA 2JZOA 1X1DA 3UWSA 1OSNA 3H6KA 4QAQA 3T3MB 2YHBA 1MN6A 4RZQA 3ZHCA 3AFNA 4UHHA 1YHNA 2AG8A 2TYSB 4BKQA 1GA6A 4IG4A 3EXG2 2Z9CA 3B53X 3VR6A 4C4AA 1H5NA 2VDPB 2MJLA 3A6JA 1KAHA 3HU2A 4OL9A 1G21B 1K88A 3EGVA 4MYTA 3R8XA 3SX4A 4GRAA 5EXSA 2IHVA 4C01A 2AZTA 4J0IA 2PRKA 1U9IC 3PRHA 1BSVA 1KI4A 1V7QA 3KDSE 4CMEC 3FCUB 4F8JA 4XYEA 2YN2A 1TXGA 4ER7A 2ZWPA 1QGED 1W9MA 4MVJF 1G2QA 4CM1A 3TZQA 1L7VC 1KZ7B 4S0XA 2V5AA 3H4MA 3GZNA 1VSUA 2TMGA 5TNXA 3P1JA 3PJFA 2ZUBA 4M36A 1BD3A 2DHDA 4YJ3F 2ZJ4A 3OPYA 4AP9A 1J9EA 2I03A 1QGAA 4KNVA 3N05A 4D43A 2OXEA 3INGA 3H4TA 2VZEA 1YIOA 3LX5A 4HWSA 4RSMA 5CNMA 1M1UA 5KAMA 5KNBD 5IBRA 4JLDA 4JNKA 3IAEA 4HGZA 5AM0A 3K1TA 5IUKC 3DOHA 5FJIA 1EGMB 1GV1A 1WY7A 1CIJA 2X3FA 2O2ZA 2PX5A 2IHTA 3HJHA 3GP8A 2Q41A 2F64A 4JBIA 2OHJA 1JQDA 2PK3A 3L7DA 4OP3A 5A4IS 5HWSA 2WDZA 2CMHA 2XH8A 3UCEA 1OPRA 5K0EA 1WHSA 3OPYB 1C8VB 4C2UA 3KRTA 4WLVA 2W2KA 4FVTA 4NLLA 5AD1A 4R01A 4AIRA 1TRKA 2IYOA 4B4WA 1RHMA 4C1NA 2VNJA 2W2QA 3O9MA 5TLSA 4HYTA 1NW6A 1F38A 3O21A 3QUQA 1GYRA 2D1TA 2B0JA 3LLUA 3CTPA 3NM6B 1M5UA 1ESDA 2D5AA 2HZBA 1VJ0A 3Q87B 4TZKA 3TLYA 1OYVA 3ZVRA 3TL3A 1DG9A 3PF8A 3ADDA 1HDIA 1LPNA 4YP1A 1ETHA 5AVRA 1VLQA 2RK4A 2VJNA 4LSMA 1DEHA 2C99A 3EPJA 1RS0A 3PT5A 1HZZC 4MRAA 3FDIA 2GBLA 4XXHA 1RJ9A 1JHRA 1Z9BA 3KZKA 3CJQA 1A72A 1NMSA 2QL5A 3C3WA 1MOQA 4HYYA 2P5TB 2J9RA 4MUJA 1TQ4A 3DV0A 1Y1SA 4HGNA 1UXIA 4NZOA 1KYXA 2IXEA 2JCSA 1V71A 1QO0A 4MVJE 2Q6IA 1LPMA 1M8JA 1OQAA 1DCTA 3JQAB 4XIGS 5C7YA 2FUCA 1ZH8A 1UMKA 2VHVA 1DEKA 1N2BA 2V58A 3RGGA 1MCZA 2HCBA 1ZK1A 1DWQA 3QBDA 1CUAA 1OLXB 2HDOA 2JCGA 2ACKA 2JARA 3TPFA 4D8XA 2BPOA 2G9VA 1C30B 2JKYA 5CW1A 1ZUWA 3MWDB 4B4VA 2JEOA 4N5MA 4P0TA 4BQPA 4PZCA 2Z9DA 3U7IA 621PA 2PX0A 3FYUC 2BMJA 1JQ3A 4LYHA 2ZW9A 1XN4A 1R15A 4Y2UA 4Z9XA 3EXHB 3TTSA 4BLUA 1SG0A 4DFDA 1FZTA 2J0VA 5FWAA 3VR5D 2J85A 2Q4EA 4WVLA 2WLTA 3ENVA 2P8JA 3LHDA 3S2UA 3FCYA 4M1SA 4Q1FA 2VYVA 4NEQA 1Y5LA 3QPAA 1FEZA 2V03A 4E08A 2IZ5A 4QU5A 4CU5A 4A8HA 1D2AA 3ZIAA 1RHJA 3OZXA 3RSLA 1EE1A 5DTRA 3AI7A 4X1IA 1KAEA 5ILOA 1WXEA 3O1JC 2W2LA 3S5UA 5CB8A 1OZGA 4QM6A 2BBOA 4MIKA 1M7GA 2YASA 2HYDA 1U0LA 1NVDA 1RADA 3PLRA 3HJCA 2XJ4A 3TW8A 4JI7B 1YUNA 3WYCA 2XRFA 1JG3A 2WIBA 1Y7TA 1OXMA 2W4IA 4XI9A 5I7VA 3ZJUA 1NBWB 1QNFA 2F43B 4ZFNA 3OD1A 4H7FA 1DTWB 4NY1A 3S8EA 1EUCA 4HDMA 1RLUA 1SIBE 4BLOA 4L4SA 4RM3A 3RUCA 5H59A 3H3FA 3PICA 3TZEA 4IXDA 3A37A 2XA9A 1XMXA 2G9ZA 4K0KB 1M74A 4LF4B 4LHWA 5HF5A 3HB9A 2ZK7A 2AEEA 1WZUA 3HEAA 4P82A 1ZNZA 1TUIA 3BXGA 1J90A 3DJFA 1FDIA 1T6YA 4L72A 4UUOA 4C03A 1C81A 1QK5A 3AG6A 3KKZA 4YP7A 7REQA 3A6PC 3QLJA 1JPUA 2R1VA 4LJSA 3T4UA 2J87A 5DX1A 4MMXB 4ZK2A 4DLWA 2GLUA 1XKLA 5THKA 5J1SB 3CBQA 3SHQA 2I71A 2VPIA 4JXKA 1C7FA 3U4GA 4D9NA 5CXSA 1M73E 2QTAA 4YALA 4G0WA 1XZHA 2HIMA 1L5RA 3U7JA 1U28C 1EMDA 2VDWB 3OSUA 2AHRA 3T6KA 3O4VA 2JDID 1GTJ1 4XM0A 1IN1A 2F3TA 2GZRA 4XQGA 3W1WA 2CNLA 2G07A 2GAFA 4A5OA 1E3WA 4F4DA 1P5JA 1SZJG 3MUFA 1C50A 3W90A 3K5HA 2CL5A 2R8XA 3BMCB 5TMDA 4B4OA 2OSVA 1Z62A 2JJ8A 2R68A 2NPOA 3OZEA 3ZS9A 4KQMA 1HE2A 1Q7CA 2YV4A 2R96A 4PIMA 4WHMA 3SR3A 4KR6A 5FBWB 3DT6A 1JE0A 1QG0A 1H22A 3R6DA 4M6WA 4O2BF 4PU0A 3QI2A 2YC4C 4MK4A 4PQFA 4ZC8A 5EKXA 1D0SA 2FUNB 4H08A 4WADA 2PA3A 1WABA 1ZOSA 2XMDA 2H1LA 4TN1A 3ZW9A 4K86A 4D3FA 3A9SA 4R0VA 2BCJQ 3M33A 4P3YA 4F92B 1L7AA 1RQLA 1LI7A 3PYMA 3ZX5A 2A9QA 1M0EA 5K3FB 1DAEA 3CFYA 3RVNA 1N2CA 5KOHB 3C7DB 2HA0A 3DE6X 1II8B 4EA7A 4EMSA 4G5GA 3BE5A 2WWYA 2FRDA 4RH3A 1CUCA 5DBFA 4KSYA 1TQ2A 2OCDA 5IT9A 3DLBA 4O2BA 3H5VA 4Q48A 4YMSA 1C7ZA 1IAQA 1VLMA 4DDMA 3BX1A 1VM6A 4IFTA 2GCPA 3TMYA 2I66A 3WWCA 4ETWA 1GL3A 4BYMA 9ABPA 3C24A 1CUHA 1ABBA 1RM0A 5GIOE 1OFHA 2F1RA 3F6BX 1EESA 3BS4A 2ATXA 4OX9Y 4D8UA 1N25A 1RKQA 2FRDC 4FGKA 4MW9A 4TLDA 4DUZB 1E63A 5K3SA 4UEJA 1TPYA 1CR4A 1EUQA 2K4MA 1ZU4A 4MW1A 1XVIA 5DYTA 4ALJA 4JLOA 3LIPA 1Z5WA 3UB2A 1I3CA 3NTVA 4P7KA 3USZA 5MF6A 5CTJA 2PIDA 2XUIA 3CSSA 3IP7A 5K51A 1QGOA 1FU8A 1YQQA 2EKZA 4QATA 5DVZA 2YZNA 3PEVA 5ECYA 1IPHA 3BERA 2VO1A 3IYLW 1ZY2A 1KKLA 4DBLE 1LX7A 3TNFA 2WUGA 3HC7A 4XJTA 1W8DA 1WMEA 4IIUA 5ISMA 2H0RA 1F2TA 3I12A 3PHHA 1V4NA 5HUJA 1M10A 2H1IA 4TT3D 4M9ZA 4RKFA 2MU1A 3M1IA 2P62A 2QQ0A 1UMCA 3ENQA 3V00A 5I9LA 2J3DA 4PRKA 2EJVA 3ONVA 1YRLA 1SM4A 1FTYA 1ZD3A 5EFZA 4G01B 3R75A 3V8BA 1JV2B 4AUMA 3F5DA 5F7XA 2VP5A 4C9BA 1QVAA 4M0EA 4JITA 3KXIA 1AU9A 1Q0UA 2ZIXA 1TCCA 3CH5A 5A3RA 2WNSA 4DN6A 1Z73A 3Q3IA 1YK1A 1ZJWA 4OB8A 1DIGA 1BDHA 1ID1A 1R66A 1RBZA 1THGA 2AFIB 5BO5A 1G59A 3NWEA 2Q8QA 3DEZA 4E51A 3TN7A 1IATA 1QR6A 3OEED 2ZSUA 5IYZF 4PAWA 1V3TA 2PMBA 3WJ1A 5ALRA 3NP9A 5DDIP 1ZJ4A 3M9LA 1T0HB 3S70A 3HBLA 3ELWA 4DCGA 3H19A 5KC9A 2C96A 4BNXA 4UHEA 4JS0A 5G0SA 4KN5A 3SXPA 3PC2A 1ZKDA 4D7AA 1RRFA 1Z0KA 3WNQA 2HQBA 5AHXA 3OSZA 4GOXA 4KWEA 2XUKA 4MLDA 1TPZA 2WYHA 3OOWA 3T5CA 4EZBA 1X86B 3JD0A 5B64A 3NQ41 2HO5A 1ZA1A 1LWNA 3AJEA 1X7ZB 2FF7A 2V1XA 5DNWA 3RV3A 1USVA 2YDXA 2FX5A 4XVCA 2C2MA 1AKRA 1B8NA 2JAPA 1LDMA 2VWHA 1SRRA 3A6EA 3DCNA 2HZ7A 3ORFA 4KUHA 4O5OA 1YKSA 2GD6A 3RASA 4F9GA 1ZHHA 3BJZA 3JPYA 3L82B 1VE3A 3TKLA 4AKHA 5K99A 4TT8A 3U37A 3NXKA 2GAOA 2AE2A 3MWYW 4UU8A 5DN9A 4MQMA 1I2ZA 2HUNA 2XZOA 3I04M 3WA7A 1DFIA 4ZYYA 1GPBA 2ORVA 4FQ5A 4KO1S 1TM7E 3GELA 2V74B 4AULA 4DPLA 4R0MA 2Q28A 4B3CA 1OH6A 4MJ3A 1VCIA 2RC6A 1F0NA 1NQOA 4F9EA 2Q5OA 1MQSA 1TMGE 2WF9A 5GVRA 5JECA 4U7GA 2ORWA 1TZJA 4IWXA 1ZMBA 3NRCA 4W82A 2O19A 2PAAA 2AKEA 2ZRHA 4Z0NA 4ARVA 4IRXA 5K3CA 1NXSA 2QMOA 1B73A 2PANA 3PX3A 4CTMA 1QBGA 4OF4A 4QDOA 3E8SA 3H3XA 3KTOA 3NKLA 5I7RA 2BP7A 1FFYA 1E18A 4QJBA 1OHHA 2OV3A 1VRWA 2NU9A 2IQ5A 1UMDB 2CXPA 3LY8A 1IBRA 4DC1A 1JHQA 4M1QA 1EX1A 2OCGA 2BCGY 1U5BB 3DDWA 4L8FA 3J7AC 4IX9A 4UU1A 5DULA 1KZ6A 4PXYA 3W8RA 3NHZA 3HGTA 3JAWB 3PFKA 4RKQA 1JDUA 3TBFA 4BTEA 3QF7A 5LMCA 1HV8A 1SQ0A 1LLQA 4D4LA 2P4HX 4X71A 3X2EA 5FPYA 4KITB 2C3UA 4ZO6A 4XGQA 2R62A 2ZREA 1KZGB 3FF1A 3TMAA 3AZQA 2OZLB 1ECLA 4G85A 4GLFA 1SCKA 4HQOA 1XEXA 1Z7WA 5C4MA 2C9YA 4O4JA 5EMHA 5CB4F 1FJGB 1NVMB 3VKGA 3KDAA 2VZ0A 1BEUB 3NHRA 1ZO8A 2YC2C 2E55A 3OZGA 5TPWB 3I5UA 3OT5A 1YA4A 2KPOA 3OZFA 5B1DA 3LW8A 3INNA 3RFXA 2ZKIA 3KQPA 3DW3X 2BTEA 2D1YA 3EDMA 2D0OB 2X9GA 1A95A 4UBIA 1AMNA 3QX8A 4QDTA 5J2TA 3MMPA 1IC6A 1T24A 5K7SA 3DV2A 3LY5A 3WIDA 4JI2B 1Z83A 3EGIA 4D9IA 3C8UA 2UZIR 4R3WA 4CGZA 1BCRA 2D4HA 3Q9LA 3LDAA 4O6VA 1T35A 5K0LA 1FP7A 1EDOA 2O7NA 2PU7A 4NJEB 4BC0A 5FAKA 1VL2A 1YKFA 2ISQA 4FCCA 1ZGHA 3AJ9A 3QU5A 4FZJA 4PC1A 4XIYA 5T67A 3ZE2B 3DGEC 4XEUA 2QN1A 1D2RA 3HY4A 3P97A 1OLUA 5IVHA 1RCFA 3C2QA 2HFJA 1J2UA 2OILA 3HE3A 3AYZB 4RTPA 2WJWA 3H8JA 4LDJA 4MRMB 1BCRB 3U3OA 5K0FA 2J9XB 4WNCA 5LL6P 3VR1A 2XCUA 3BGWA 4IXMA 3FSGD 1WCIB 1YSCA 2Z2XA 4NJOA 1ZHOA 4GRDA 1QU2A 2VF2A 4EMUA 4V0QA 4HSEA 2ZUDA 1QJ4A 3SOPA 1NR7A 3QA9A 2C8VA 2ATVA 4IINA 1EUYA 2AOXA 3F49S 3GNSA 1O08A 4I55F 1WUHS 3B60A 4WKNA 4XYMA 2WIFA 5DLPA 3KSBC 2VDRB 1YE8A 1YXMA 2VWPA 4GBJA 4TL9A 3FTCA 4UEOA 2ZJZA 5CGQB 3M5DA 1V25A 3B6ZA 1GRVA 1U2GC 5TARA 3PR1A 1C3LA 2GD1O 4G0PA 4I1VA 4Q4HB 4BQFA 2JLWA 3FB1A 4R7GA 1PVDA 3LUPA 5AVKA 1J6UA 4YLEA 1VSQA 2AT1A 4YACA 4OQFA 4JLMA 3AUYA 3GQBB 4LHXA 4QOEA 3K73O 1R2QA 3N8IA 4YGXB 2IYEA 3TLMA 1GPAA 1T8UA 4LK3A 1Z63A 3DCJA 1JHOA 3I5MA 5IWAB 2VH2A 1OZAA 1B6RA 5ICSA 4DIOA 1AQLA 3OU7A 4YI3A 3SX2A 1U2EA 5ED4A 1ZRNA 4R54A 1XEAA 2BP7B 3PQ5A 4RHEA 2RSLA 4D3XA 5LQCA 1OZFA 2PA0A 1A8SA 1GFWA 2ZU0C 4H16A 4JIGA 1DC7A 1QGUA 3B13B 4FGUA 3CE6A 4JSRA 5TF0A 1GDDA 5DHSA 4BZPA 3L05A 5C37A 2DKOA 3PLNA 4D4MA 1CEYA 3HHEA 1QFXA 3FB4A 2VZ9A 4Y9SA 3SXUA 1L5OA 1ZUD1 5HM6A 4GZMA 4MS1A 4FQ7A 5FR1A 4CDRA 2DWOA 2YWRA 1UCFA 1ESMA 1DAIA 2RHRA 3DMPA 3GBPA 4GMHA 4PF1A 3ZTTA 4XCVA 5EJMA 3SZGA 4ETIA 2G9RA 4F4FA 5T57A 4XX1A 3GFRA 5DWVA 5KX5B 2OHOA 4PZLA 3MFYA 1GADO 3LPMA 3IE2A 3KOXA 4PYQA 3RJMA 5CDFA 4ENWA 3W79A 5ANRB 4YQZA 3S2ZA 2ZRQA 1QE3A 5JJCA 1OZ0A 3TL6A 1U2GA 3HGMA 2YJ6A 3OO0A 4G86A 4Y9DA 2XB2A 1OWMA 1UJNA 3PGLA 4FOPA 5C53B 3WRWA 3F5QA 4LI0A 5BVGA 2QRKA 1Y5IA 3NLLA 3Q6NA 3CB4A 4CMEA 4ARAA 1F7UA 1WPQA 4I4TA 2PT5A 4BN0A 1IXKA 3K1YA 1WV1A 3V1TC 3GT4A 1XDDA 2ZJ0A 1SIOA 4DMRA 1X1EA 4PGGA 3UGJA 3CG4A 2ES4A 4U9IS 5GONB 5M3BA 3AW9A 4UASA 4YMIA 1H2EA 4JKOA 4AYWA 3TG8A 2F9LA 2IP2A 2QM3A 3GEPA 3N9IA 3NT2A 2F3PA 3RI3A 3RODA 5KVVA 1Y63A 4RELA 2K7FA 5FOXA 2E85A 5DHRA 3D7MA 1WW8A 1S3SA 1JR3A 4YWJA 3WGYA 1P4GA 4LZNA 4UEQA 4I50B 1NQVA 3SC2A 5IMBA 5KUTA 3AF2A 4E4YA 3BFJA 4P3NA 4OHCA 2QEQA 4CKXA 3PVCA 4HFJA 1VPWA 2W6QA 1ACMA 2AE1A 4L22A 4OUKX 4NE9A 4CF3A 2IDMA 3FCEA 3E61A 2ONJA 5AM2A 3A2LA 2G0TA 4FW8A 3FFAA 2OLEA 1EFTA 4HKTA 1UAAA 1T4BA 2W4QA 3GOQA 4J1TC 1RQ7A 1YR3A 4KN8A 5CPFA 3S0JA 4BGIA 1Y8CA 1T4MA 5HUQA 1YWGO 4NULA 1RNLA 2P9CA 3EG9A 1BX3A 3JQCA 1ZOPA 4FWIB 3K0SA 3EGXA 3D2BA 4LC0A 3TRHA 2BTOA 1JILA 1WB5A 2HRDA 4NDAA 3DCYA 4ZTZB 2GGSA 2II6A 5ARCA 3TRFA 3VC2A 1E98A 2DPGA 4P6VF 1HZZA 1RTKA 2VDMB 2XMBA 3Q7PA 5L6MB 3OZIA 2EFYA 1Y80A 2BHRA 2FMTA 1MB4A 1PWHA 4EDHA 1EA7A 2Q8PA 3PHBE 2JHCA 3TFOA 3O73A 2CMKA 5B4VA 1FF9A 2ZQ5A 1UL1X 3BF7A 3II6X 4NBWA 3JWEA 2I54A 2PPLA 1XTRA 3EAQA 4KIFA 1XU7A 4B74A 1ZVJA 2OV6A 1HG1A 3UMSA 4DXHA 4CXMA 1JZTA 2XHEA 5KTSA 5LMZA 1SKYE 2IU3A 1OLSA 1YZHA 4S3MA 4QOIA 5HF9A 1OWOA 5ESRA 2PWYA 4U2DA 1OF1A 3WL5A 2ZE5A 2PLNA 4Q9JA 3CUUA 5IJ0B 3R7LA 2AW3A 4PTLA 5TS3A 4FMBB 3R6GA 5LXTF 1L6RA 1WZEA 5BRJA 3NBXX 2GEJA 2OCXA 3UHPA 5E3HA 2WBLC 1N7HA 4U7FA 4O2BB 2ZTSA 3AT1A 5B2EA 4UE3S 1C14A 1JL3A 1UFQA 1X92A 2BDUA 1YD7A 3EEBA 3P4UA 3PUWA 4P31A 3U3ZA 4U2KA 4RTKA 3FNFA 1LPAB 1NV8A 4DREA 2XDAA 3I1FA 5EE5B 3B1FA 1QHHB 3DMHA 4E3WA 1Y4ZA 3G7UA 1U0EA 3NHUA 2V8BA 4HTFA 5K6RA 1KMHA 4FYHA 4BO4A 1LNSA 1DP4A 4MVJA 5KMGB 1EX6A 4M1MA 3NNSA 1HO3A 2GHTA 1SVKA 3PRYA 5EIWA 4EITA 4R2WA 3AHCA 3M5PA 2IKQA 4TZ6A 1NMEA 2BHNA 4X6YA 4J1QA 2HDHA 3R9XA 5EFOA 3LP8A 1NN5A 2QJTA 1K08A 1MV8A 3JZMA 3PR3A 4A23A 1J1IA 3BA6A 4FX5A 4BWYA 4F46A 3KR0A 4M3NA 2IH2A 2NVBA 1YVEI 3BILA 3BMCA 1XZLA 1Q16A 3BMNA 4MVCA 4CTOA 1I3KA 2NNWB 3EVZA 1R50A 2FPRA 3FR7A 1XKTA 2GK7A 4GP9A 5FTWA 3PU6A 4OQ4A 5TR9A 1JKJB 2JI4A 1K5GA 2X2FA 3ACDA 3V8RA 1JWBB 2A5LA 2CXNA 4AY3A 3HP4A 2PZGA 2UZAA 2ECKA 1DKQA 3BGVA 4NCIA 3WHPA 3IP6A 3B9QA 2VDWA 3LUJA 3TUIC 4OK5A 1CIVA 5F77A 5C1BA 2BZGA 3REQA 2QTRA 2IYYA 1DQYA 4GI2A 4ZI5A 1VIDA 4D3YA 4R2KA 4JOQA 3BIFA 3KLNA 4BCDA 1PFWA 1YB5A 4FYWA 1Z4QA 1Y5NA 3ORSA 9GPBA 1PBNA 3Q12A 4IF6A 4ZVTA 3OEHD 2CLMB 3H2YA 3SICE 1UXOA 3VR3D 2BD0A 2DRIA 3N8KA 1QZXA 2PSEA 1XHFA 2BMAA 3GPCA 2JKVA 4P3KA 3ONWA 5I9TA 5E7MA 1DHTA 5CDTA 4UZFA 5K3AA 4F04A 4F85A 4B80A 1SURA 2VH1A 1Q1GA 5KYXA 1EDDA 3MLAA 5ULLA 3ML1A 1TIKA 3QLVC 3TYXA 2MYUA 1X3LA 2EBWA 3ZJVA 2IHJA 2HBRA 1BHQ1 5B36A 3VNSA 5E38A 1JQBA 2O7VA 4PLFA 2BOVA 4AO6A 2CC2A 2KJQA 2GF2A 3BXEA 3NR2A 5H70A 3TFWA 2BFDB 4EO9A 2IBTA 2VXBA 2ZITA 4BQIA 3RC8A 3AF6A 1Z6GA 3SG0A 1AUPA 3DQZA 1RWMA 3D54D 1LSUA 4N47A 4CDNA 1NLFA 2OZEA 2PBFA 3L1KA 3QVTA 4B3SB 2F4NA 3RK1A 2ENWA 3EIEA 5ALTA 2AFIE 1HRDA 2ONZA 5CW2A 1B42A 1U5AA 2PMWB 4UATA 2JAXA 3VVMA 5C8DA 3VR3A 2WWTA 3N6VA 1HFEL 4NIMA 3WQRA 5D85A 3LQ2A 1B8OA 4W7HA 1N2XA 4ZV9A 2H7CA 4YBRA 3V1UA 4FFPA 4R40A 2IYSA 4PYNA 1YMUA 1TGYA 4AG3A 5CVDA 4BZZA 1LJUA 2HPAA 5IDWA 3I1IA 2I65A 2HK9A 3E8MA 4Q93A 1TAHA 1DC8A 3M81A 1WBDA 1A27A 3K7EA 3HVHA 4Q7MB 3SFZA 5FFMA 1EFCA 2CDRA 3EXHA 2ZRIA 3L1HA 2NNLD 1W4AA 1XYGA 2CVZA 2HJ9A 3PF9A 3KLOA 1GFIA 1GG5A 2OFWA 1Q22A 5HDQA 2RHMA 2Y27A 1Q50A 3MWDA 4LQ4A 1E32A 1VP9A 4F4IA 3FETA 2QAGB 3I2IA 2XNSA 1DG3A 3IBTA 3KYCB 2H52A 4M7WA 5EJGA 1BX1A 1NXOA 2VRWA 4XLLA 3IVCA 3B1KA 2M9MA 4LQDA 4MA5A 4D81A 4Z7NB 1JSRA 3DXZA 4K3VA 3UN1A 5KPJA 1XZDA 2QL7A 4JROA 2ZAGA 2HA5A 2LUOA 1LS1A 4IFEA 3UJ8A 4CCYA 2GEUA 4PAQA 5J4KA 3IILA 5DLEA 1PLJA 1DKNA 1L5HB 3D1VA 4E5KA 3PQCA 1R0WA 5AJYA 3ZQJA 5E4TA 2HDNB 4LS3A 2PE5A 2ZT6A 1E4OA 1S2LA 1CR2A 1E2DA 3QPDA 3C6YA 5F9MA 3S5JA 4BCBA 1W2GA 3Q8KA 2KMLA 1N8NA 1PJ4A 1BC5A 5JH7F 2R2AA 4KQIA 1JSLA 1JJFA 1DEAA 1QTIA 1XMJA 1JJBA 2GETA 2OHFA 2VTVA 3ICVA 4U9HS 5BMVF 3VSEA 2FP4B 4UCQA 4IGIA 4B6GA 3AU8A 4IWYA 1P2TA 1PR5A 4LSWA 4C4XA 5JD4A 4NG5A 1QQ7A 1UFOA 2JANA 4TMFA 3RC9A 1KI9A 2PMCA 4FYKA 1J4AA 1H2FA 4DQVA 4PPQA 1AK1A 2PJZA 3NH6A 3UAOA 5L4LA 3VPFA 1R9GA 2VJKA 5I7SA 4OPMA 4N54A 1RYNA 2QX4A 4RJKA 1EM6A 2JBAA 1ZCFA 4M4SA 2ZCVA 2YDYA 3OU2A 5F33A 5JMTA 1RPZA 1D8TA 1CX9B 4BNYA 2VAWA 2R2GA 2YCBA 3QIAA 1OV4A 1NE2A 3A3NA 3JWPA 5CVVA 2A1UA 1RRPA 5G3YA 1Z6QA 3UJDA 1FPQA 2L69A 5SV2A 1YZNA 2I8AA 3UOWA 1G8PA 4WZAE 2PT6A 2JVJA 3PQDA 4BBZA 1QIKA 2Z4TA 3S68A 4Q3DA 4RNDB 1X70A 4QLBA 4EJMA 2GN4A 2Q6LA 1FLDA 1M8GA 4H7IA 1EQAA 1G0NA 1Z0JA 3GZNB 3PQEA 4FR0A 2BEJA 4NNOA 3P2YA 1CKEA 4DA8A 3D4IA 3E7FA 4GE0A 4NMHA 3KJIA 3VZBA 1K3UB 2KS6A 2RB4A 5NULA 3VAAA 4A2QA 3KQMA 3RYTC 1Y48E 4AX4A 2W90A 3L0YA 1EXDA 1W73A 4L4RA 1CDOA 4RCYA 2R6R1 4IBOA 2Q0QA 1AQNA 4LWOA 4H1UA 1JAYA 5EOVA 3UT6A 9LDBA 3WV5A 3DBOB 3IO5A 3W6PA 4OHMA 4RANA 3ER6A 3I6MA 5TX7A 5BSMA 4D8WA 1GNLA 5T4BA 5CEFA 3LVRE 3ZCSA 4Q9LA 2H1OA 3KQQA 1XYVA 2QS9A 4CMBA 5B58C 3L01A 4UMDA 3UC9A 1JKIA 4BQSA 2YFYA 3SF0A 3QVSA 3B3JA 1PT6A 1AIPA 1RQ2A 1XTSA 1V11B 2H00A 3C4JA 3GRVA 3C1TA 3VH1A 1OIWA 5I4CA 1BRTA 1M8PA 1T9ZA 1BDIA 3RTCA 3RSFA 2X0JA 2P9FA 2RGUA 1Q1ZA 1E4EA 2QE7D 5DSXA 4OI1A 1J2RA 2GZSA 1ZIDA 3O8QB 4ALIA 2XRMA 4G4GA 1TL7C 4R68A 1Z08A 3CF0A 1J25A 2EZTA 4BMPB 4L75A 2CL6X 4XPZA 4S2EA 4XEHA 3DFIA 3ETCA 4Q0MA 5DP1A 2I7CA 1MJGA 2ECFA 2ORED 3KB2A 5A05A 4EYKA 5CA1A 1N77A 1N3YA 3TQSA 2I6FA 1VKNA 2Q2OA 2WKWA 4NYJR 4GM0A 2GRJA 2H1RA 2X19A 1CUVA 1ORRA 4QO7A 2VPWA 2WD9A 3IESA 4DMKA 3QMVA 3QTBA 4QGAA 3IEMA 3UUFA 3NCTA 1XKQA 4ZEWA 1CQZA 4WV3A 1CETA 1ECJA 4AJNA 3U56A 2JIZD 1RD4A 1JAIA 4B81A 1KYYA 4P7BA 4ZJYA 3M3HA 7ABPA 3EDYA 3L7OA 3OUUA 4FNGA 2OXRA 4NR0A 3BK7A 4M1WA 1UF9A 5JCOC 1J5EB 2KQUA 3SX0A 4EA9A 3CEJA 1OCEA 3H9QA 1T1SA 1DJPA 2C0QA 2ZIZA 4MEBA 3WICA 4AMZA 1ZK4A 4BXOB 2O7QA 3I28A 3N6XA 1QIIA 1VIVA 3RFCA 2I99A 4A10A 4DR7B 2FZKA 4DG9A 2C0CA 1WBBA 3MTAA 2VBFA 4WNAA 2DB3A 3VNQA 1TCVA 3NOOA 4IPTA 4NESA 2EIHA 1JVSA 3WDMA 4W63A 2QAGC 4XPIB 4YRFA 4B8ZA 5D87A 4X00A 3JVVA 1LQUA 3GEGA 2DY1A 4J2TA 5CLQA 1ETUA 4HATA 2GM4A 4PHTA 4IJKA 1E7MA 1DC4A 1T29A 2VJCA 2W4MA 2XXJA 4HPJB 3NIGB 4GXTA 4QIHA 4C4TA 1E5VA 3DTVD 3L7LA 4GL2A 3H0EA 3O9ZA 1W46A 1T2NA 1MB3A 3WGJA 3ZXXA 5LR6A 2SHKA 5J63A 3AKDA 3E3NA 4YFVA 4PXSA 4TMKA 5CYOA 1U7HA 3DBVO 3ER9A 4JWTA 3R76A 4Y2TA 1CUFA 3V9AA 3WL3A 4PYMA 3X43A 2H1SA 3GARA 3T7SA 2AJ8A 2DHRA 4LRWA 4Z8YA 4UVGA 5CHEA 2QQ5A 2BMDA 2EFHB 3VKFA 2FV8A 3LXMA 4EFLA 3WYFA 4FILA 2YBEA 3B5JA 5FBHA 3AGPA 3U7RA 2B4YA 2AQKA 2QG9A 2WU4A 1P77A 1C2TA 3AINA 4LTMA 4JEUA 4BNLA 3R5JA 2XADA 2A59A 2ZTLA 3G0CA 2R9VA 3GJ8A 2H54A 3Q6IA 1LQ2A 3BM5A 2CWDA 1QRAA 2KWIA 3T7RA 1ZBDA 2Q8NA 4ZV7A 3TW0A 4AN4A 3LJKA 3ZV3A 3ZCXA 3UJHA 3GVIA 1BH6A 3G49A 3GRPA 2FUG6 3L7NA 4WH0A 4C6HA 5D3MB 4S1PA 3EK2A 1QTQA 1QWOA 2CXRA 3AXSA 1ZEMA 1G291 2ZP1A 3R3SA 1NMZA 1W2HA 4QRIA 3SSNA 4ASUA 5K2OA 3JYLA 3G9XA 3E1GA 2WFAA 1KJ8A 1M1NB 1KR5A 3DMRA 1GA1A 4YCAA 2FEKA 2V6JA 1N5JA 5AESA 1KK0A 4FT4A 4M1EA 3K0CA 1V4VA 1AB6A 1X9IA 2IQIA 3SDZA 5K0TA 4XGKA 1L4BA 2OQ2A 2HMAA 1U7PA 3UK1A 3V6MA 1SUBA 2CLOB 3IOMA 4L51A 4WWHA 5IJ0A 1L8XA 4BVGA 2OG1A 1QV6A 2GVNA 3RHZA 1QP4A 2D2XA 2XNKA 1QYRA 3C6XA 1YAHA 1BS1A 4KTTE 2IVZA 3VYTB 2Q7OE 2ZTUA 1ZGCA 4P3OA 4BMSA 4TWRA 4ZOLF 3FPGA 3I37X 4BRSA 4B76A 4DLZA 1IY1A 1FSZA 1LDGA 3IJRA 3K5PA 3KKMA 3L7IA 4FGZA 3OE4A 2JRLA 1MT3A 3TR0A 2ZRDA 2YYZA 5LZ4A 3BD7A 1GRRA 1NDUA 1IDN1 1M6VB 1VGRA 3IAUA 3ETLA 4U5XA 5J5AA 2PPVA 4N6OA 1W0KD 2C9OA 1GNRA 5D7BA 2VDLB 5KYVA 2CF6A 5KSOA 4MJ7A 1KMIY 2OTCA 3JQ8A 2C29D 5IJ9B 1XEWX 2CWWA 1HDYA 1EAMA 1R6BX 2A67A 2Q6OA 3L1VA 3PDIA 2B3TA 4FMDB 1PP4A 2D5LA 4NG4A 1P8AA 3ORHA 1GU0A 3NJ4A 3PL1A 3H5WA 4C88A 3K70D 4Q7KA 1W9HA 3QGMA 4G5OA 1IUNA 3QVJA 3AZPA 4G5HA 1J2EA 4FCVA 5G1NA 1UZAA 4V0OA 1W4LA 3OE7D 4I4LA 4EUFA 3A9CA 1ZP6A 1OX6A 4RXTA 2ZJBA 1JMVA 3MOIA 4MO2A 4TTPA 4B4UA 2IW3A 3MILA 3E15A 2AG0A 4OMDA 4Y18A 2Z98A 5F2EA 1NLZA 4EB0A 3OT1B 4RXMA 2XTNA 3T06B 4BAUA 1RRGA 2P6NA 2ZXFA 4BDSA 3MN1A 3FGZA 2YJ5A 9MHTA 1T3HA 1G16A 2G6TA 1K4YA 2X5OA 2Z56A 3IIIA 3KVRA 1POXA 4MGKR 2XKKA 2ONKA 2YBDA 3ZQKA 5BW4A 2XXAA 3JYHA 4INZA 1R0BA 3FPEA 5CNJA 3OT4A 1HYQA 4BNKA 2BH9A 2IWRA 4F1KA 3DTTA 1IBKB 4V0KA 3V4VB 2IU0A 1HX7A 4LZAA 2IIVA 2JASA 2ZS8A 3GCGA 4LBZA 4CG0A 4ITRC 1QYXA 1UP7A 4QGFA 1ZQ9A 2EFEB 2BR3A 2VDJA 4N9QA 3TTUA 4D9MA 5JQWA 3QUSA 2A0XA 1R5NA 3KUCA 4GNRA 1QYWA 3I9MA 3F71A 3OH8A 3OLZA 4AZ0B 4BGEA 1V3VA 5LMNB 1B6TA 4G5SA 3B1JA 2IOQA 4D80A 1O6GA 1QIHA 3E8XA 3OLCX 1WXFA 2Z3WA 1M75A 1OXKB 3H8SA 2CKMA 3SSMA 5JHHB 4GP7A 3C8ZA 4AYXA 2HPHA 3H42B 1X9HA 3C1OA 1PFGA 4ESVA 4MPRA 4FX2A 9LDTA 1UEIA 4XSVA 2MIIA 4NK5A 3TJZA 2ZSFA 4TKUB 3P96A 2C9MA 3ANLA 4TRMA 1G8HA 3ADKA 2PO7A 1ODCA 4GYWA 3W6NA 4IQGA 5KOIA 1NOKA 1GGNA 4BNTA 3WWYA 1CJMA 1T6BY 3SXUB 4GI3A 5JTUA 2QN2A 1VHQA 1S8OA 1XB2A 4O2AB 2FFQA 1MENA 3KJXA 3HFJA 4CDGA 3JQ7B 1O8BA 4Q4JB 1JHMA 4XM1A 3IAM1 4LSGA 4RA9A 4EABA 2FWRA 3G2HA 4O2RA 3MOGA 2WB4A 2VQ6A 2AC4A 5BXQC 2I2XB 4X20A 3ZZMA 2ECQA 2Y4OA 2YV1A 5BRNA 2OAEA 3TSWA 5AKJA 1I9CA 2I3AA 3K9QO 2UYYA 4N9WA 3IO3A 1A5BB 2F59A 1QIDA 4RY8A 4FE4A 1GUZA 4Y0NA 2VQEB 4AKIA 2VSFA 4IHAA 2DUMA 4KK4A 2VNHA 4UU0A 1M6NA 3PXEA 4LF5B 2WF5A 3GX1A 1NQTA 4HFMA 5DYWA 2H48A 2Y66A 2PYDA 5GJCA 4Q3NA 1WWKA 1NVVR 3V1NA 4ZOCA 1NXWA 4Q4HA 4LIPD 4S1NA 1BVRA 3FHOA 4MKHA 3DT9A 4BVBA 2H1FA 2TECE 4D74A 5JRDS 1C8BA 5CIYA 1AGYA 3C3EA 3P8ZA 3UYKA 4CIXA 4ZTUB 4ENVA 4DLAA 4FLEA 4ND8B 3LO8A 2FGKA 2XE4A 3MB5A 4I2VA 4OXKA 4DTIA 4WZAA 3M82A 3CZ4A 3T4XA 4AK9A 4OATA 5AHWA 5HEKA 1I0ZA 4ENQA 3E9NA 3ZNQA 1JP7A 3NALA 1W0JD 1G8MA 4WZ6A 5JATA 4FI3C 3BXFA 3ZBQA 2O8CA 3W5JA 2G08A 1VJ5A 2UAGA 4FDUA 4V2IA 4X1YB 4AMVA 1J0DA 1KO5A 2CLHB 3GIWA 1MFZA 2J6BA 5FBLB 1IXRC 4BP9A 5LNK1 2ZUEA 3IPLA 1YZKA 2DH6A 1AV6A 4Q7JB 3UG7A 4ZQGA 2DVMA 4AG5A 3Q4GA 4IDQA 1XC7A 3PR2B 2NG1A 3RUAA 4AF6A 2VEDA 1G98A 1P61B 1XMSA 5EMLA 4AXBA 3G0HA 2W83A 5AK0A 4KIGA 1DMRA 1CFJA 2HBYA 1KQPA 2QT0A 5E9JA 4B71A 1PG5A 4OB7A 3KV1A 5FI3A 2JGFA 2OV8A 1EP9A 3V32A 4DSTA 1KMMA 4EJ0A 3P9PA 2VTKA 4E5SA 4RO0A 3JW8A 4Y1FA 4M8IA 5FO1A 3ZNPA 4EFNA 1F4LA 2PKCA 4L0QA 4UEWA 2P7IA 2J3MA 1MEJA 1Z2NX 1XIVA 2KBFA 4HDKA 4XE5A 4O4LF 4OX9B 1BE8A 2MSKA 2PZMA 4G8CA 5TPWA 4MRSA 3UJ7A 1FDWA 2MTBA 4TS1A 3QKIA 1PWEA 1KHTA 2PV7A 4MLCA 1A5SB 3WMFA 5HZKA 2R6DA 1ZH4A 3M4ZA 4BO0A 1WETA 2NUTA 3W6UA 1TECE 2ALJA 2NZYA 5E3JA 3VHQA 4E30A 5GZ3A 1IHXA 4LF8B 1U8YA 1V9LA 2DWUA 4OP1A 4BEJA 1O95C 4G0VA 1XZNA 3IJ5A 2MMGA 1GUDA 3WR5A 2LKCA 3P0EA 3R0JA 4LYAA 3ZWAA 3AVOA 4EW6A 1OWPA 2ZIUB 4BL5A 1QIJA 4J49A 4KYUA 4RZUA 3LUGA 3Q3HA 1RWWA 521PA 4I8DA 2PGOA 3QUBA 1B00A 2XB8A 4US2R 2UV8A 5J47A 3X1JA 2GFIA 3BWMA 4FBLA 3IIJA 4KXQA 2C31A 1QFJA 3N2KB 2Z6AA 2BW0A 4BC1A 3KT3A 3OLWA 2I6GA 2Q50A 3A1TA 4NDZA 2O6HA 2XYVA 1XTBA 3U4MA 3QV1A 1B6SA 3MIZA 3NZEA 3RU9A 1PS0A 4B6SA 3ZD7A 2AKYA 4Q9DA 5JWHA 1NJGA 1USWA 2RH4A 1PJCA 2IXBA 1U04A 3DE0X 5DYIA 4JR0A 1JFLA 1U3VA 5FLXA 5FV4A 4J90A 1E7QA 2I4IA 4WZBE 5C8YB 1VE5A 1GZVA 3ROEA 1JG7A 1A9RA 2REBA 3PFNA 3OE7A 4PQYA 1CULC 1F12A 5CIWA 5C1PA 1T15A 4M9UA 3PNKA 1TM5E 2Z6UA 1AMUA 2O3TA 1B14A 4QOJA 2O9JA 4L4YA 3OQOA 3IDQA 4B85A 3G9QA 4M87A 2ZZNA 1YFKA 5A3SA 3R0XA 1SUWA 2EGHA 2HSZA 1Y6QA 1F51E 4MAMA 4DANA 2CDAA 2IP1A 2Q3JA 5EP1A 5LBIA 4C7MA 1J7JA 2G8LA 2I4NA 4JMPA 4IDGA 1QCYA 4RZHA 2WK1A 1HNNA 4BBPA 5CVJA 5H3HA 1U63A 5EZYB 3H75A 1E7RA 2A0UA 4F84A 4B3GA 4V0SA 3WE7A 5JBQA 4OI0A 3D3JA 3IMGA 4KR9A 2P77A 3PUHA 2CV2A 4B3FX 4CEJB 3UZUA 4DJJA 3CNEA 4MV4A 1T3LA 3WBKA 2JBHA 2QLNA 4CW7A 4EHDA 3VZQA 5BOSA 1OTHA 3HI6A 1BGVA 1RBQA 2GUGA 1LW6E 3ZW8A 5D5PA 3EYWA 1Y34E 5AT1A 3E7DA 4KE8A 3LPLA 2R751 1X1QA 2P2YA 3CW9A 3LHKA 2CUZA 3M4XA 4GXRA 2KB0A 2PBZA 4K6MA 5DMHA 1XQ6A 4I5IA 3OT1A 2ZSIA 3QQ5A 2PXHA 3OFNA 5DTMA 5JZBA 1AURA 1KYQA 1W4BA 3AKZA 1VC2A 4DLLA 4GKJB 2IUYA 4AZWA 5CRIA 2GARA 1NFRA 1DRWA 3VO1A 1FJXA 4TWZA 1YQEA 4QPCA 4IH1A 4X5OA 3OQ6A 3GAMA 3KVVA 2WE8A 1YJXA 3NT5A 3PGKA 5EJFA 1KO7A 5L3ZA 5IAAA 3RUIA 3P5BA 5BN3B 2DFVA 3QWAA 3HCPA 4GPBA 3U4HA 1OYOA 4X54A 3CRMA 5ENVA 1L3CA 1I4EB 4HRYA 1OAOC 5KYWA 2EFJA 2COKA 2NTEA 3KYDB 3ZI4A 4PSAA 2P4EA 3E5MA 2IEBA 3MUOA 4D96A 1Z6TA 3JQ8B 4U5QA 3BXZA 1TCUA 1LX6A 3EMVA 3NB0A 2XKJE 4NWIA 5F4BA 3RWBA 1F2TB 1Y6ZA 2ATIA 3VYWA 4P9NA 3SSOA 3TGLA 2IUFA 2L18A 5A62A 3Q8XB 4ZI2A 4WK4B 1H2WA 4P0QB 4P5EA 4CU2A 4DXDA 3WNZA 1TZ2A 2FCRA 3K8QA 1AXGA 2ZSJA 2JIMA 4OH7A 2FPOA 4UHKA 4D41A 4LUCA 1IZ0A 4AS2A 4KCGA 1R37A 2HC9A 1FSPA 1SB9A 1S7CA 3KBOA 3NHJA 1BMFD 1E2UA 3TO5A 3ZVKA 2FE4A 5DFAA 5U1PA 4MKIA 1XSEA 1GL6A 5D3QA 4EPVA 1TLLA 1JEEA 3GVHA 3QHPA 1KI6B 3ZDZB 3JALB 2ZI9A 3BPSA 4A73A 2Y1EA 1C1HA 1LNQA 8ADHA 4A91A 1DTEA 2LXNA 1B15A 4MKZA 3REFA 2GXQA 1D2EA 4LXQA 1M1NA 5JXIA 4X63A 4O4IB 4FKZA 5BV1A 2M1ZA 2NTJA 1II8A 5CG1A 4D0SA 3UXYA 5I7FA 1BFUA 1XPUA 1XVVA 4IHJA 4X3OA 4Y2YA 2CVHA 1CE8A 2G77B 4ARBA 1Z4PX 4BO3A 1F8YA 2ZDQA 3UBMA 2QSUA 4ZCIA 3HYRA 3T99A 3WGTA 1SCUA 4NS1A 4MUAA 2YVUA 3TH5A 2WKRA 1T2VA 2OB1A 3FFXA 3K9WA 2G04A 3GRFA 2QIPA 3NBUA 1YZUA 2ZUWA 5KC8A 2BGWA 1BMFA 2WJHA 4R8VA 4YV1A 1V8OA 5JR3A 2VP2A 1D6SA 1JJIA 3HPQA 2O2YA 1EHCA 3HSSA 3IOYA 2PLRA 3CCBA 3DL0A 1DDIA 3QMMA 1N2OA 4YK7A 5AVYA 1A9PA 3M89A 4PNZA 1AXEA 3B1ZA 2DFDA 4N48A 3TXYA 2QTHA 3E5NA 4ZDKA 3N2ZB 4WKOA 2HX1A 2JAUA 3TOVA 1THMA 2QYSA 1H93A 1S4MA 2UYGA 4NENB 2WYWA 3SAJA 1TMKA 2CV1A 1ZFNA 3C3BA 3FSRA 2RKBA 1T2AA 3HI4A 4XWKA 3COYA 5H82A 3OQNA 2W8BA 4OJYA 5HE9A 3ZHUA 2AC7A 4S12A 3PDUA 1L1EA 2BR4A 2RH9B 3PNYA 5JO0A 2EVWX 8GPBA 1VL8A 3N8DA 4YECA 4D9HA 4W5JA 4E09A 3D8SA 1B26A 3Q0IA 2XQGA 3ACBA 1W581 4QFDA 4N49A 5MDHA 2DTXA 1ORTA 2DMRA 1P7VA 1UK7A 2OCLA 4B35A 2NYUA 4ZZ2A 4DPKA 3C48A 2UZ4A 2AW5A 1N7GA 1HQCA 4ZT3A 1UM9B 1RAAA 4X8MA 2H1WA 4HYQA 5HCIA 1DWOA 3DSRA 4I55A 5CU7A 5IKMA 1GTZA 3UGTA 3ZZUA 4BXOA 3FNBA 5EHIA 4IJ5A 4K6FA 4DV1B 4OJTA 4DQUA 3OJWA 3R3XA 5HPYB 3OFVA 2BRUC 3MF4A 4R69A 5KQRA 5CDGA 4MOWA 4NZZA 1RSZA 3QELB 3THWB 1R74A 4DPMA 4I2NA 3H2JA 3ZE8A 1GZ3A 2P68A 3DTNA 3LW7A 2QX6A 3GZTB 3VAZA 3DZJA 4D3SA 4M88A 1A7AA 1WTAA 1DDOA 4FDLA 5EIFA 2OORA 3CYFA 5LBTA 5I7EA 4HT3B 4IJMA 5AJXA 1O6CA 3QG5A 1SUDA 4F4UA 5CJ2A 4PG8A 1AO0A 3V4SA 1XRMA 1Z5VA 3UAYA 4AP5A 3UVEA 4ZQEA 4FMCB 1MP0A 1LK5A 4JFAA 4NCBA 3NOXA 4DCMA 2HQSA 3HCNA 3SBDA 5LLTA 2GZMA 3IHWA 2AH5A 2B8TA 1PZEA 3AMVA 5KNCA 3D3QA 5CB4B 3R3UA 4X7BA 1P3Y1 3MA0A 1O6FA 3C5EA 3FNGA 4OEHA 1DTSA 4RMIA 5BW5A 5EE1A 3D8TA 2CNWA 4B31A 4F5ZA 4UM9D 1BXZA 1AVTA 1HYEA 3R5XA 1AHIA 1NVGA 1OZHA 3K5IA 4AKEA 1I7SB 5DGHA 1T5LA 4LYYA 5ALJA 2W42A 3O8QA 4WFJA 1K8YB 3NAZA 3BXHA 4GE3A 3G8AA 1OLXA 4MS3A 1GTL1 3KPJA 1O96A 3WDKA 2FQQA 1ISFA 3Q41A 4FSHA 4L76A 3TLEA 1BWQA 3I8OA 1WM1A 4ZAZA 4CM6A 1KF0A 3LI2A 3JQAA 4TUYF 1C9NA 4LFCB 1AE1A 4LFBB 1MQ9A 1FP6A 4E70A 1DPGA 2IU4A 2HDWA 3V97A 3ZZ1A 5K3EA 3HWSA 2HMTA 1I51A 1Y9AA 1CJCA 3F4LA 3ZGVA 1WRBA 2AYYA 4CM5A 4YV7A 2B1JA 1F6WA 4MVJH 3HWRA 1D9ZA 2RG7A 3P9ZA 1SOAA 4JJFA 4YUVA 2C9BA 1PZGA 2IJGX 1XVUA 2PL3A 3PC4A 2RHLA 3PNMA 4O2LA 1Z4NA 4MTLA 4WL0A 4IFBA 2OBBA 1EHIA 1XK7A 3LHIA 4C07A 4QM7A 4K5QA 2J6HA 4B82A 2FMUA 2CEAA 1Q0QA 4J16A 5EE3A 4DQ0A 4L8LA 5J58A 4QPDA 2QRZA 4C0WA 4EGQA 2EAUA 3P2OA 4RX1A 5EAIA 2OQVA 2YJGA 1U1IA 3AEKA 1YGYA 1H8HA 2W2KB 1OASA 5FI0B 4D42A 1BE0A 3VO8A 5TV2A 1L5SA 1A2BA 4BASA 1AN9A 1G7CA 4DUGA 2J0SA 4OHYA 2IH5A 2C7QA 1HSOA 2XHZA 3CLSC 3JTMA 5AH0A 3KLPX 3C4VA 1A2QA 3DC7A 5JPIA 2D2VA 1V1JA 3NJ8A 3A1WA 4ETNA 1HBJA 1MQAA 4PVDA 1DBRA 2JNWA 4XASA 1MJHA 2ZYSA 4L57A 1KI8A 1R4NA 4AJKA 2HH9A 3D43A 2NU8A 2HK7A 2WT8A 3VUEA 1JALA 4BHTA 3WGUA 3UMCA 3GFTA 5P8WA 1YR6A 2ZRBA 3P0HA 3ZOKA 4BWGA 4GVLA 4KBYA 4DV6B 2AK2A 2BBWA 3QSYA 1KSHA 2IC5A 2MYTA 4Z7JA 5B1EA 3TCKA 3N5KA 3U39A 5CJPA 3Q1KA 1YE5A 1F6BA 4EMTA 2HEGA 1Z68A 2OBFA 3U4QA 1RYZA 3PWKA 2CD7A 4PSDA 4MKRA 3K32A 1RJGA 1JLHA 3PEUA 3DOOA 3N07A 4KLZA 5A5DA 3M6VA 1G5IA 1SVLA 1TFUA 4GI7A 4AURA 4EHKA 2G80A 4F7WA 2CV0A 1Y9EA 3B70A 2R6HA 1L7EA 4ZKEA 3QP9A 2QVLA 4KFRA 3WQQA 5B7GA 1QM5A 3STWA 4EHFA 1FYEA 5K0GA 1EVLA 4QT0A 1COWD 1K9VF 2FCAA 2RGCA 1L5HA 2EW8A 1J24A 3HU3A 5FUBA 5EIEA 2H06A 1U0GA 2NU6A 1ULZA 1VSTA 3RSCA 2G5GX 2OV4A 4TGLA 3ZCTA 2B4QA 3G1TA 4LGYA 1XR3A 1A8IA 4JSYA 4KQJA 3JYPA 4A5SA 3RVQA 2WJAA 4WK2B 4GXNA 2R48A 2CBZA 3F3YA 4LGMA 2OBYA 1EX7A 2GXSA 4KHZA 2FK7A 3JD4A 4O3FA 1JYEA 4JOSA 3I6YA 2QTZA 4KVFA 4M37A 4V2UA 1DBPA 1JYFA 1L7BA 1WXHA 2NACA 5EIAA 4EBBA 1J8MF 1NDHA 1PYDA 4KREA 2J4DA 3ZDBA 1I6WA 4IR7A 5L3QB 3FAZA 5HSGA 3L07A 5EJ2A 1UANA 4RS3A 1G9SA 4JLSA 1E7SA 1HFJA 1ZI6A 1OD6A 3SM3A 1JEYB 1QK4A 3OM0A 1E9RA 5HW0A 2WWXA 1X0VA 3OTHA 4EY4A 1CUXA 3Q8MA 2H31A 3IKLA 1G9XA 4FC7A 4RMHA 1APBA 3NANA 5KNCD 3O03A 4EGCB 2ZIAA 1XPJA 3TEFA 5LN1A 3HJBA 1E1RD 2VQFB 1H5UA 1U65A 5C7IO 5F1OA 1U0NA 2WICA 4CEHA 1KI3A 4FFWA 3L8GA 2VSQA 3H11A 4NXNB 3HBMA 3KWMA 4D0LB 1M1YE 2TMKA 3LS2A 7AT1A 3JARA 3FZNA 4NYJQ 4UQOA 4KO3S 3EG5A 4BJ5A 4ECAA 1QVRA 4MTCA 4B3TB 4MWSA 1NQWA 4ZO4A 3R7WA 1PL0A 4RPCA 3NTXA 4F6LA 5B7PA 6AT1A 4DMFA 1P60A 1DRUA 1SCDA 2GPTA 3GWZA 4G0MA 4QQRA 3AVVA 2QPAA 4KRGA 4HQKA 2F8LA 2YKGA 3EAGA 4TKVB 4FYMA 3WDSA 3E22B 3BKWA 4G5QA 4Z4EA 5EWJB 4EG7A 1M6YA 4ABYA 4A8JB 1NVKA 2H5LA 3EIUA 1UPAA 4GC5A 2H4WA 4HNRA 1VE7A 5C80A 1OVGA 4HYEA 4BO6A 2IZ0A 5LUBA 2Y1XA 2RH8A 3KQWA 4YGYA 1RHRA 5DXAA 1JB9A 3NATA 2PMFA 3CVYA 2YXEA 2OD9A 1E5QA 2J33A 3EXIA 3MWJA 3D4PA 4EI2A 2JLUA 1T1EA 2W37A 3NKFA 4I1RA 4ZA2A 3VTFA 2PU5A 4MCJA 1GHTA 1I4DD 1XXHE 2C9ZA 1ND5A 4IIEA 1K97A 5IJWA 3V48A 5K5EA 5C52B 2E49A 3G5LA 3MD9A 4DYVA 5LZ8A 3F8SA 4FFSA 4KPEC 2IOFA 5KSZA 5IVKA 4WBNB 3BWDD 3H5IA 1KIFA 1GZSA 4WLUA 3DS8A 1SEVA 2YXLA 3F3MA 5AI9A 3GFVA 1XJWA 3BMNB 4IKEA 4NBLA 4UJ3A 1M6EX 1TT5B 1JLMA 1NM5A 4QXRA 1Q15A 2B6NA 3W04A 3W3AH 3JSAA 3OF5A 4RIEA 4KX3A 4HI0E 2GZ2A 1T9AA 4A27A 1RKBA 2IY9A 1B7GO 3K3PA 4P08A 3ZCRA 3OPMA 2XV1A 1ZJ5A 2RH5A 5DM1A 1XP5A 2NXNA 3P7MA 4BAZA 4J0CA 1QX3A 1JZQA 4YEDA 4AROA 4FZ5A 4QFCA 1KMHB 2FZEA 1VSBA 4J0DA 1PW5A 4QGHA 2J9FB 1JA1A 4WCFC 5F2NA 3FOCA 3JTEA 2XMSA 3VPGA 1ZRMA 4LJ6A 5ITWA 2JHGA 1EI9A 2BMFA 3AEQA 1I2MA 1ZD1A 3H4VA 5ALNA 3IULA 5DWDA 3HU5A 3SZOA 2JBWA 3BIOA 2Y71A 3IBSA 5HMLA 3TJMA 2XUDA 4K88A 5IFLA 3DP7A 1GUYA 4TRRA 1FNDA 3S3TA 3TQTA 1NSTA 1OREA 4DMMA 1MNAA 1UKVY 4HOYA 2ZRCA 3QPWA 5B6JA 1G8SA 2B92A 1UBRS 2IY8A 2Q5FA 1JBEA 4HUQB 4YPFA 3QOYA 4RHCA 4AMBA 4R2XA 2PX6A 1ODTC 3AL2A 2E5WA 4S1VA 4AB1A 2C3OA 2Z30A 4GKVA 4B73A 1ZA2A 3LBHA 2X6TA 3G17A 3F1LA 1NWHA 2XX3A 4PPNA 4ZGWA 1Y8ZA 3O4FA 5GWXA 1WQ1R 2ZE8A 3LRXA 2Y4NA 5BN4B 4GR9A 3U3JA 2V3VA 4H4CA 4TLEA 1D2NA 2GYWA 2WM3A 4LYFA 4OHFA 4RM2A 1H85A 5DK4A 4KE6A 4L8GA 3K96A 1XZEA 5JPCA 1PSDA 1N1EA 3VGPA 3U5TA 1P0QA 3T5PA 4UNSA 5JAHA 3ILYA 2POQX 4JP8A 3I32A 2QN8A 1TEVA 4JLPA 3HYLA 5E6UB 3FLEA 1F0YA 1XVTA 2I87A 3IXLA 2AZ4A 3OZRA 3PL5A 3SU8A 2G1PA 1ULTA 3GCXA 5JTTA 1SXJC 2P9BA 2YHAA 5CXQA 2WWRA 5JAIA 1Y7PA 3EXAA 2NLOA 1SUAA 1XRQA 1CRPA 3KVYA 5CT9A 3IDAA 4O4IF 1KERA 5JWOA 3UUEA 4YLGA 1U7ZA 4N12A 3PA6A 2PS1A 4PC3A 1ZXXA 1LSJA 2DGDA 3K9GA 4HGQA 3DFFA 3HCRA 5EWMA 3WOVA 1XALA 2PD6A 2OZPA 2PZKA 4ZODA 2YWCA 3U3XA 4DLTA 1JQJC 4HXFB 4BAGA 2Q9AA 5FTJA 1B93A 1WIWA 4DWWA 4ZN6A 3S8MA 5D01A 1DAGA 3ASUA 1PGJA 4RMNA 2B0CA 2J3JA 3KC2A 1EIWA 2QU8A 1ATZA 2ZYTX 1Y3DE 1C4XA 3PNSA 4FFOA 4EELA 2QNBA 3CONA 3KAQA 1I30A 3F97A 5CJJA 1VJTA 3DWIA 4HAUA 4WACA 4K2AA 5LQRA 5LYJB 1L7MA 5H9VA 3HJGA 3ZX4A 3LYLA 4DQKA 1E6LA 2XR1A 3D0RA 4HJRA 3G1UA 4AO8A 1NY5A 1P1BA 3ONEA 1BQEA 3PWSA 5HF8A 3BSFA 2I8CA 3UV6A 1SXPA 1E1QD 4EB6B 4PYOA 1X0XA 1OPXA 2JH3A 2RK6A 3NIWA 2A3NA 4JJZA 5BW8A 9ATCA 1CJSA 1N7IA 1ESCA 1VI5A 4K9KA 1ZN7A 1L7RA 5EYPB 1YC5A 1NF3A 4QBFA 1M2EA 3F47A 4LX8A 2QYTA 4GFDA 3F2VA 1B0PA 2ZVDA 4HPXB 2R1TA 4P81A 4EL0A 5HOEA 3TZCA 3HWX1 1EDEA 1Y1TA 1PNTA 2FLWA 3BB4A 3C6QA 3EIOA 4UBKA 4X95A 5F51A 3I2GA 4B7UA 5BPFA 3I8SA 1BYUA 1BNCA 3LBFA 4I9UA 3VYVA 3ZPXA 2V7VA 1H42A 3AL3A 3NDPA 4A1FA 3PJDA 1Y3AA 4F60A 4MW4A 1KP3A 4KMMA 3TVTA 3EEIA 4PYRA 3G0GA 4OHBA 4UMFA 2NQ8A 4DCNA 3A2KA 2WJ6A 3OZUA 2M6SA 4WJLA 4GR4A 2M6RA 2XKAA 1W85B 4RYDA 4JCCA 1R10A 4R9VA 3PEWA 2Z1DA 5I4BA 1RYHA 1M1ZA 3OPQA 3FCOA 1D2CA 1PSZA 3EZFA 3K1ZA 3OMLA 3V2IA 5JZOA 4BNFA 1R1DA 3TLXA 1SUEA 4AY5A 3NGLA 3W5CA 1QKKA 1VG0B 1XU4A 2H7YA 4FGLA 1JHYA 4IDNA 2CLKB 1KTVA 2F1IA 1LPOA 1I7LA 2IGBA 3OFSA 3A3PA 2VPZA 3NPAA 1XWWA 1SHKA 3P94A 5B2FA 1GG8A 2OMKA 4OGGA 5KTPA 3HV2A 4YAEA 1OBFO 2CCJA 1D4ZA 1CLUA 3GIDA 2OLKA 4PX5A 1OTXA 2EYUA 3R0IA 2FW6A 4MB2A 3FVRA 5AI0A 6Q21A 5K0SA 4ZT7A 1KJYA 3PUKA 3SJCA 4OM8A 3RSZA 2J3IA 3ABZA 3TIFA 1X2EA 4JI4B 4GT1A 4OQDA 3OMXA 3V8PA 5LP1A 4L1KA 3IBGA 3ETGA 5F78A 5I9IA 4TLLB 1VG1A 5I47A 1NY6A 3IGFA 1OH8A 3GY0A 1N3BA 4TTAA 2W00A 4YDRA 4B0OA 3AB7A 1S9HA 4BGVA 4QKQA 3HB4X 2RD2A 1N33B 1K3FA 2ZIWB 3CR8A 3GFPA 4WEQA 1I36A 3E2IA 4IW3B 4DW8A 1WW2A 1GL9B 3Q7RA 4MV3A 4FD2A 2Q9CA 1NL3A 1IK4A 1AKQA 1QHIA 3DB2A 3O2JA 4Q3LA 3QFFA 5TVGA 5A4JA 5GINE 2C4UA 2PSJA 3QU4A 2A9RA 3KHSA 5CUQA 1I80A 1SVUA 4MAFA