5F4ZA

The crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
388
structure length
388
Chain Sequence
b'MEPFRIVIPQADLDDLHRRLDATRWPSEIPGTGWSRGVPLDYLKELVGYWRDGYDWRAAEDRLNTVPQFTTEIDGTNVHFMHIRSAEPDALPMIITHGWPGSVAEFLDVIDPLTNPRAHGGDPADAFHLVIPSLPGFGFSGPTPEPGWNLPRVASAWAELMRRLGYSRYAVQGGDLGAWTSLTLSGVDHEHVVGTHVNFLITPPSGDPADLAGLGEQDLARLQLLAEFGAEGSGYMKIQSTRPQTLSYSLTDSPVGQLAWVVEKFMEWGDTDKSPEDAVDRDRLLTNVMIYWLTATAGSSAHFYYEISDVLPTAPTPPPPAPPLPTPLGVAVYPADSAKPVRRFAERAFPNIVHWAELERGGHFAALEQPGLFVSDLRAFARALRTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxide hydrolase
molecule tags Hydrolase
source organism Streptomyces carzinostaticus subsp. neocarzinostaticus
publication title The crystal structure of an epoxide hydrolase from Streptomyces carzinostaticus subsp. neocarzinostaticus
rcsb
total genus 129
structure length 388
sequence length 388
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06441 EHN Epoxide hydrolase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f4zA00
2RI6A 3QYJA 4BRZA 2WJ6A 4BRSA 1EDDA 3VISA 1AMNA 3H04A 1CUCA 3ED1A 1QIEA 3DCNA 3LCRA 5LLSA 2XUDA 1QIKA 4B80A 4OSEA 3RARA 3WLAA 3G0CA 1MN6A 5AK5A 3W9UA 4J0GA 1GGVA 4QLOA 2RGUA 1XKTA 1BEZA 4MYSA 2WILA 5ALFA 3H2HA 2IITA 2WIKA 4L0CA 1LPNA 1DTEA 5T4EA 4DIUA 4L3WA 2EEPA 2QT9A 4U2FA 1BCRA 4J0CA 1JI3A 2O2IA 3B5EA 4H0CA 1QE3A 2OCGA 4KE8A 2XUHA 3VVMA 1QTIA 2AJDA 4UPDA 1WPXA 4QDOA 5HQ3B 5ALQA 1E8MA 3C45A 3DD5A 3QMWA 1A8SA 2Y2VA 2HA3A 1U8EA 4AO7A 2E3JA 4BAGA 1UWCA 4X71A 4ZV7A 2HRRA 4L9AA 1TKRA 2QJRA 1BEEA 1QIGA 2HA0A 4EHBA 2R8BA 3ZPXA 1VKHA 1TQHA 4J7AA 1W76A 1YA8A 4C6HA 3I1YA 1L7QA 4B7ZA 1FFDA 3OTQA 5JAPA 4Y2JA 5EIHA 3ZWQA 1CVLA 1DT3A 3EBLA 5ALLA 2OCLA 5AIBA 4ZI5A 4BVJA 1FFCA 1CUVA 4WCVA 5JATA 1WPRA 5K5EA 2GYVA 1C7IA 2PSFA 3SC2A 3WZLA 1L7RA 3E1GA 1R50A 2B4KA 1CIJA 4J0HA 3PUIA 4HRYA 4QA9A 4ETWA 2WIFA 3HACA 2DSNA 4GW3A 4K5QA 3TRDA 1XRLA 3BJMA 5JADA 1XLUA 2WG1A 3I2JA 2OAGA 5LZ4A 1GXSA 1K63A 4FNGA 2QTBA 3EQ9A 3PFCA 2XUAA 1TCAA 3F67A 5FPQA 3T4UA 3RKSA 2XQGA 3MUNA 5AKIA 4N8EA 3EIOA 4DNPA 1MX1A 1QIHA 4W1QA 2J3DA 4MQMA 4PV7A 4UHFA 4DLNA 1ACJA 2K2QB 1ODTC 3QM1A 4BC0A 4YPVA 2IIVA 1HKHA 1EVQA 2VT6A 3L1JA 1PFQA 3STXA 1XRPA 5FP0A 5LZ2A 4C4YA 4GWLA 3SX4A 4E46A 2ZYSA 5A7GA 5HZGA 5IH7A 3QPDA 3N2ZB 3JYHA 2PL5A 1YR2A 3FSGA 4MQLA 5LKRA 2G5TA 3AZOA 1BCSA 4UHCA 4Z49A 4H7DA 5FOQA 1VE7A 2D5LA 4AZ0A 4KJXA 5AI0A 4DYHA 5ESRA 1PJAA 1LBSA 2XI4A 2FJPA 2XUIA 3GZJA 4A5SA 3R3WA 3AZPA 4Y9SA 1QZ3A 3D4LA 4B83A 2QZPA 2JGEA 4DM7A 5AP9A 4KAAA 3I6MA 4L72A 2CUTA 5HQ3A 4BC1A 3WK7A 1LPBB 3WWEA 2G4LA 2Z3ZA 3V1LA 3IIIA 2O7VA 3RM3A 2QOEA 1EINA 4ZXFA 1P0MA 5IVHA 5EGNA 5ALHA 1E66A 3AUKA 5CT4A 3WWCA 1JMYA 2XUGA 3F96A 2GBGA 3WWOA 3KXPA 1AKNA 3EQ8A 2VAVA 5A6VA 2DHEA 1J1IA 4JYMA 2BUAA 3C8HA 2W22A 4DSZA 3C6BA 5CXXA 1CUUA 2VJDA 2O2GA 2XUKA 4FFVA 3EQ7A 4K6GA 2ZYRA 5LZ8A 1QONA 2CJPA 4FLEA 5DNVA 1LZKA 4J3JA 1A8UA 5CTAA 4BZZA 1FSSA 1R4ZA 2V96A 3G8YA 1CUJA 5ALYA 5ALTA 5LKAA 1EI9A 1GPNA 3FAKA 4FBLA 1ETHA 1OILA 3C6XA 2VTVA 5ALOA 1GQRA 1MX9A 3WI7A 4QZVA 3TGLA 2I3ZA 1WB5A 2AJBA 5SYNA 2B9VA 3STYA 5AICA 5A2GA 1ZIYA 4GEGA 1QLWA 1YS2X 5HF6A 4U2CA 4BCDA 4Q3OA 2PSEA 3KSRA 1CUFA 4CFSA 3D59A 1VLQA 3R3YA 3H19A 3W05A 3BJRA 4X6YA 4LXIA 1M33A 2CKMA 2HFJA 3DEAA 5JAUA 3WK8A 3HJUA 3X3HA 2WFLA 1IZ7A 1AX9A 1Q0ZA 2BKLA 3GELA 1CQWA 1CUAA 2GYUA 3JW8A 1RWQA 4J0IA 1Q83A 2HRQA 3QZUA 4QWMA 4RE6A 4Y7DA 1D07A 3WYNA 5AKXA 1XLWA 4XVCA 2HFKA 5JD5A 1EDEA 1QFSA 3C43A 1I6WA 2JGKA 2Y2UA 4ROTA 3ZV7A 2DR0A 2VAXA 4TGLA 4E14A 3FBWA 2WHPA 3G9UA 1DWOA 4MWTA 2YH2A 4U2DA 4RE5A 3U1TA 3MVEA 2DCMA 3HRHA 4AN1A 2HIHA 1YSCA 2WU3A 4KEAA 1DU4A 2PUHA 2PKYX 2X76A 4F5ZA 3O4IA 2V97A 3WA7A 5D3KA 1G5FA 5AM2A 5DYYA 5EHZA 1UKAA 5LZ7A 3WK9A 1PV1A 1ZD5A 4J0DA 5FPPA 4CG3A 1OXMA 3IDAA 1P0IA 3WK4A 5AM4A 3WIBA 3ESBA 4XX1A 1YS1X 1RP1A 5CT5A 1E89A 2GZRA 1R9MA 4N5HX 4PSDA 5ALZA 2H7CA 4H7KA 2BCEA 5J3JA 4RPCA 1QJ4A 3L1IA 3RK4A 1EB9A 1H2YA 2PU7A 5JALA 5T4HA 4B9EA 3FLBA 3PI6A 4BVLA 3BF7A 1UXOA 4X94A 3QMVA 3O9MA 3STTA 3BWXA 1LPOA 2FUKA 5AKKA 1H22A 4UBNA 2G5PA 4EY8A 2I03A 1JJFA 3VJMA 3DNMA 3VXKA 1XROA 5DTJA 3QBJA 4LIPD 1MO2A 4JUIA 3FCYA 4XWGA 4B81A 2ZVDA 4WFIA 4MEAA 4BZWA 3WK5A 1LBTA 1LZLA 2VSQA 2VA9A 4F0JA 1VXOA 2J4FA 4UBJA 2NW6A 5DNWA 4ZRDA 1O6GA 3N0TA 5HFAA 4G8CA 3O4GA 4INZA 5CMLA 1MX5A 1N8SA 3WQHA 4FDMA 5KREA 3B3QA 4CI9A 2PSHA 1CUGA 2OXEA 2XMSA 1EH5A 4G4JA 1YA4A 1JU4A 4EY4A 3GROA 4PQEA 4Y2SA 3H2JA 2WTMA 1GKKA 2VJCA 1P0QA 2WG0A 5CT6A 2OCIA 1N5MA 3IULA 4H7HA 4WJLA 2XMDA 4J0KA 1FFAA 1KU0A 2WTNA 4IQ4A 2IX9A 1W6RA 4FTWA 5ALIA 4Y2TA 3ESAA 1XZLA 3D2CA 1YASA 2HA4A 2WFLB 4FLFA 1C7JA 5H3HA 4PNZA 1E3QA 5ALKA 3W2TA 3ICVA 2FX5A 4BP8A 3TEJA 2JEZA 2Z5GA 1CR6A 2C4HA 4BE4A 1Z68A 2XDWA 4RNCA 2C58A 2V98A 1XZFA 4U2EA 4KE7A 2B20A 3OPMA 4UHBA 1GKLA 1MAAA 4UHHA 4MEBA 1R9NA 1QO7A 5ALVA 2QKYA 1UK8A 1BN6A 1W4LA 3DL7A 1R3DA 1IUOA 2BGRA 2WFMA 3VJKA 1CUBA 3U0VA 1YCDA 4BP9A 5AK3A 5A7FA 3K6KA 4K6HA 3FYUC 3R3ZA 1DQZA 4CIBA 2XMQA 4X00A 3PUHA 3WIOA 3VJLA 3PDCA 5AKYA 3WKEA 4AXBA 3C6ZA 1L7AA 3QPAA 1DX6A 5JD4A 4OB6A 4B0PA 2CEKA 5HFNA 5CT9A 2LIPA 4OB8A 4BDSA 2XE4A 3STUA 1W75A 3E3AA 2Z8ZA 3I2FA 2XMZA 3AINA 1T2NA 2HU8A 4AB1A 2ES4A 2WUDA 1UKCA 3OURA 4GXNA 3I2KA 3V1KA 3TJMA 5LIPA 5IVDA 4P08A 2C5FA 2OG1A 4E11A 1XLVA 4AO6A 1XQXA 4Q05A 1QFMA 3WYDA 3STWA 5JIBA 2QM0A 1T4MA 7YASA 3QH4A 4HXEB 1DQYA 1WHTA 5CW2A 3G0IA 4KRXA 1EX9A 1XQWA 5ALEA 2UZ0A 3NOXA 3CN7A 1BU8A 2ECFA 2VF2A 3C5WP 3AZQA 2PM8A 3I2IA 1N1MA 1WOMA 1QIMA 4QE3A 3JWEA 2GYWA 3M3DA 4C88A 1GPKA 1ORWA 1AGYA 5T4BA 5BOVA 4OCZA 3FYTA 5ALSA 2YXPX 1IMJA 4OU5A 3AIKA 4X3CA 2DHDA 3GA7A 3ANSA 2GBCA 4LHEA 1NU8A 3IUMA 4B84A 4CG1A 1H2XA 3DQZA 1MAHA 4PF1A 2HL6A 4QEKA 4X6XA 5E2IA 4G9EA 4C89A 5ISMA 2XB6A 3ZLVA 2P8SA 4I19A 4DMHA 3D0KA 2B61A 1ZI8A 4BE9A 4G1FA 2AJ8A 1XRQA 3E4DA 4KE9A 5ALJA 4EBBA 5AK6A 3QITA 3DYVA 4FLMA 2AJCA 1AUOA 1EXWA 3KWJA 4QWWA 3PF8A 4IHAA 4OYYA 4M0FA 5AKGA 2ZYIA 2WM2A 2XUFA 1EK2A 4WDQA 1TAHA 2ORYA 2WLSA 5CH5A 4FFWA 3G9XA 2QS9A 4GECA 2H1IA 2JIDA 3QPCA 4N5IX 1ZIXA 1SFRA 4HVTA 1HL7A 3V1MA 1A7UA 3WKDA 1CRLA 2QJWA 3VVLA 1LGYA 3A2MA 4DNFA 5HK8A 5KBYA 3BE8A 2PSJA 2WUFA 1JFRA 1ZD3A 3DKKA 3WL7A 4IO0A 3G0DA 4XJVA 1ODCA 2WJ3A 4H7FA 5ALRA 1LPAB 2BAGA 3I1IA 4BATA 2DQZA 2JGMA 4BVKA 5JZSA 3ESCA 3R41A 1IUPA 3IA2A 4DMKA 5AO9A 1Q84A 3D7RA 4MYDA 1XZMA 4NVRA 2JGFA 2JF0A 2XMBA 2WHRA 3FVTA 3WJ1A 1WCYA 3W06A 2FJ0A 5JAOA 4B9AA 1YAJA 3I6YA 5EIAA 1CUHA 2DHCA 2Y6UA 5FXMA 1G42A 3KD2A 5ALDA 4GI1A 4DNOA 4NS4A 5DLPA 1SC9A 4X7BA 4HTAA 4H7IA 2J3QA 1ZGCA 1QGED 5AI4A 4AMZA 1U4NA 1QIJA 2RAUA 4K6KA 3BDVA 2X8BA 4H35A 1QO9A 3FCXA 1JJBA 4Y2VA 4PSUA 5JZBA 1JMKC 1MU0A 3ANTA 1SOMA 3G9ZA 3IB3A 3D2AA 4FBMA 1XZEA 1GPLA 5C81A 3WZMA 4WY8A 5ALWA 1SCKA 4YASA 4UBKA 4AO8A 1TIBA 3OM8A 1GQSA 2Z8XA 3PICA 1ZD4A 2JBWA 3NUZA 1TK3A 4TPKA 1XZIA 1F6WA 4PSCA 4OYLA 2PVSA 1FFEA 3I2GA 2Q0XA 3S8YA 3O9VA 1BRTA 4KYVA 3HC7A 5AK4A 4H77A 1YB7A 2RHWA 5BWCA 5ALUA 5CURA 4EY7A 3VKFA 3A2LA 1XRNA 3G0BA 5I7UA 3C70A 3T52A 3AIOA 2I3DA 2GBFA 3UUEA 3STVA 1XKLA 2WHPB 1XFDA 4W9RA 4BB0A 5JYCA 2OQIA 2HA6A 5DNUA 3GFFA 1GT6A 1XQYA 3HXKA 4V2IA 4JEIA 5CXUA 3BF8A 4DNQA 1K6EA 1A8QA 1Y7HA 4DMFA 4GLBA 5AI5A 2QVBA 2VATA 3WWPA 4CCYB 2XUQA 3R0VA 4OD0A 1HQDA 4MXDA 2HDWA 1CUSA 4MJ3A 2XQJA 1ZOIA 1FFBA 2BGNA 4X91A 3C5VA 4LYDA 5AI8A 4PO3X 5FRDA 4OB7A 2ZYHA 4WFJA 4N8DA 3WL6A 2XQKA 4P9NA 1KEZA 1DWPA 3S2ZA 4C87A 1BE0A 3HSSA 5YASA 4U2GA 2OGZA 1ZJ4A 1AURA 4H7JA 4X92A 4UUQA 2RHTA 5AI9A 5D3ZA 2ZSIA 3BL8A 4DGQA 4UFNA 1ZD2P 4KE6A 2C7BA 2D0DA 2ZJ7A 1G4HA 2BUCA 4C01A 3VDXA 4Y2YA 1UK9A 3W9BA 4BAZA 3OC0A 3A70A 1G66A 4UBOA 4UHEA 4AX4A 3IUNA 2WIJA 4HAIA 1CUXA 1ZI9A 1VE6A 3QMMA 4Y2RA 4DTCA 1CUYA 1F8UA 4Q82A 1F0PA 4JH0A 3C87A 1UK7A 4U2BA 4FMPA 5FV4A 3DS8A 5AH0A 5A7HA 2WIDA 2PSDA 3EF3A 1DT5A 1VZ2A 1LPPA 3M82A 2C0QA 5F4ZA 4KAFA 1HBJA 4KR0A 5C8XA 2R11A 3ICWA 5AHXA 4HXGA 1B6GA 4J0JA 4EB0A 5K3CA 4Y2XA 1JT2A 4NMWA 4EY6A 3KOOA 1JKMA 3C8DA 4M0MA 1CUWA 3PFBA 5KWIA 2QR5A 4HXFB 2ZJFA 4WY5A 4YX9A 4HZGA 1XRMA 1MPXA 1VJ5A 4Y2QA 1TCCA 3R3VA 1X2EA 4CCWA 5ALNA 3F98A 4JYPA 1H23A 3IVMA 2CBGA 4HS9A 4G4GA 5FKJA 1UZAA 4EZIA 2OAEA 1XRRA 4XIIA 2YASA 4BTVA 1F0NA 3AILA 5A62A 4EA6A 4MWSA 4Q34A 3WWDA 4E15A 4B82A 1GZ7A 5JAHA 1K4YA 4M0EA 4IH4A 4K2AA 4ARAA 3DYIA 1U65A 1XZHA 5LP1A 1X2BA 4HRXA 2ACEA 1BROA 2DFPA 4G4IA 1ORVA 4G8BA 3WJ2A 2AXEA 3F8SA 5K3AA 5EIEA 2PX6A 5A71A 2QRUA 1AZWA 3HYSA 3IUJA 1K8QA 2Z3WA 1VA5A 4UFPA 3FYUB 3V9AA 2WHQA 4KACA 1Y37A 2OLEA 2O7RA 2Y1KA 4FKBA 1QIIA 1UOQA 1MT3A 2EDCA 2I78A 1E8NA 4BCBA 1A88A 3MGAA 2BUBA 3D5EA 2ONCA 2YYSA 4W1PA 5I8PA 2OCKA 3GBSA 1XZDA 5ALPA 1UFOA 4X90A 3AFIA 5D7BA 3I28A 1C4XA 1ZI6A 2HA7A 2X5XA 1AC5A 3IUQA 3L1HA 1UT6A 4ZWNA 1CPYA 2ZJ6A 5AI6A 5AKEA 1LPSA 4F60A 1B41A 1XZGA 1IVYA 1ODSA 3E0XA 4QDTA 4X95A 3LIPA 1THGA 1OCEA 5HF5A 3CXUA 2VT7A 3O4HA 1CUIA 2XUOA 4LYEA 5HKAA 2Y6VA 5AM0A 4GHWA 3YASA 4WFKA 2VEOA 5CRIA 5E4TA 1U2EA 2PUJA 3WKBA 3DKRA 1EDBA 5JANA 3C6YA 5DJ5A 4GBGA 4W63A 4UHDA 3A6ZA 3G02A 5DWDA 1RYYA 1K5PA 4Y2UA 2WUGA 1H2ZA 1IZ8A 2XUJA 5BWBA 2V9ZA 3F97A 4W1SA 2BJHA 3NGMA 1CUDA 1CUEA 1FJ2A 1XZKA 3CCBA 3ZLUA 4BDTA 3CCCA 3H18A 3LLCA 2GBIA 1Y7IA 3DL4A 3QVMA 5HK9A 4BCCA 3BIWA 3FSGD 4Q3KA 5K3EA 2CB9A 5HF8A 4CG2A 1VOTA 1BN7A 1Q0RA 4CIAA 4UFOA 1XQVA 5ALXA 5EI5A 5AKJA 1O6FA 1HDEA 3D2BA 5K3DA 1ZJ5A 1X70A 4QNNA 5HCUA 2JGIA 5JZ9A 2PPLA 1ZGBA 1IUNA 2G63A 1XZJA 2OPHA 5C8ZA 1XZBA 3AJAA 4ARBA 4CCYA 5HKBA 3O0DA 5LYYA 3F9CA 1LNSA 1QOZA 5IVKA 3FWHA 5K3FA 5CBKA 4EY5A 2BFNA 1E8DA 1R1DA 3H17A 4AZ3A 1EK1A 4P93A 3HZOA 2QXTA 3G9TA 3M81A 1USWA 3BIXA 3BXPA 1EVEA 5AOAA 2J4CA 4N8SA 5AKZA 2WG2A 2HA5A 5LZ5A 3FLEA 1VA4A 1MJ5A 2XMGA 1ACLA 4J03A 4NZZA 3O95A 2ROQA 4ZREA 5SYMA 4Y2PA 3FOBA 3H0CA 2VQ6A 4AQDA 1E5TA 3H2KA 5AIAA 4DSAA 4D9JA 5HF9A 5I9IA 3WA6A 4C4ZA 1W52X 3G7NA 1VZ3A 2QXUA 3SWWA 1XZAA 1WM1A 1WHSA 4ZGBA 4KRYA 1QTRA 4X85A 5CH3A 3W04A 1CUZA 4F21A 2HADA 4ITVA 2WJ4A 3HLKA 4BAUA 4FNMA 5AOBA 4LKOA 5AM5A 4EUSA 4H7EA 2XMCA 5FLKA 3HABA 1UK6A 2QUAA 4QDUA 2RONA 1H2WA 2ACKA 4B85A 4Q3LA 3UUFA 2AJLI 3IURA 3FVRA 4I4CA 4OPMA 1R88A 3P2MA 2DQYA 4FHZA 2WQZA 5IKXA 3WL5A 3DJYA 2OQVA 3FYUA 3I2HA 4GDMA 4QDXA 1MNAA 3R3XA 4X93A 2HM7A 2XQFA 1J06A 2EDAA 5CH8A 3Q8WA 5EHQA 3PF9A 3LS2A 3OOSA 5CT8A 4P92A 2HU7A 4FWBA 1JJIA 1SCIA 1KU6A 5BV7A 3ZLTA 2CMFA 4X6UA 4JNCA 4A23A 1LLFA 3WKCA 1VXRA 1NX9A 5IVIA 3K2IA 4AN0A 4WDRA 3DOIA 3OG9A 5D6OA 2PU5A 4UBMA 5DYTA 1W1IA 3PE6A 2H7YA 4G8DA 4I3FA 4B0OA 4DMCA 5KWJA 5E4JA 3R40A 4TVKA 1QIFA 4G5XA 3BDIA 5LZ9A 5AJHA 2WSLA 3LP5A 4LXGA 4FOLA 5C8VA 2XLCA 3ILSA 2GZSA 2XMRA 3O4JA 1LPMA 3ZI7A 5EHNA 3HEAA 1N5RA 3B12A 4H18A 2C5GA 1CFJA 1UKBA 1HPLA 1BS9A 5EHXA 1UOPA 1CV2A 4A16A 1UOOA 3DDUA 4LXHA 3V48A 5ALGA 1MNQA 2HU5A 3WL8A 5C7YA 1J07A 2WFZA 3A2NA 1ZICA 3SK0A 3H1AA 2WUEA 5DTIA 2XT0A 4B6GA 5T4FA 1MTZA 2ZSHA 4O08A 3MUOA 5K3BA 3H2GA 1EB8A 3DOHA 5DYWA 3NWOA 1P0PA 2O2HA 1EA5A 1QIDA 2HHAA 2WIGA 4UBLA 5JARA 4YK7A 5AKLA 2JGJA 2VJBA 4RGYA 2JGLA 2XUPA 3M83A 2JEYA 5ALMA 5JASA 4C4XA 3WK6A 1SCQA 1CLEA 3FNBA 1NU6A 6YASA 3GUUA 4X97A 5FDFA 1WB4A 2H7XA 3DLTA 1THTA 3D3NA 1DX4A 4BYMA 2CZQA 1WB6A 2H9YA 4G9GA 3RLIA 3WMRA 5EFZA 3UMJA 1YB6A 4IH1A 1AQLA 3Q0TA 5K3FB 4W1RA 3FLAA 1TRHA 2XQIA 4S0XA 1CEXA 1HLGA 2W6CX 4IH9A 3IBTA 1CQZA 1DWQA 4Q1VA 1ISPA 3I6ZA 2VJAA 3KWFA 2WU4A 5E4YA 4QLAA 5JD6A 2QUBA 5AM1A 3WKAA 4OUKX 1S8OA 3H2IA 3HI4A 1YAHA 5AKHA 3R3UA 3V1NA 4AMYA 2OGTA 2HA2A 2QMQA 4KAJA 3CN9A 4PW0A 3KDAA 1TCBA 5FUMA 4OU4A 4BBZA 4QDZA 5AOCA 3ESDA 3G0GA 4ZV9A 3H1BA 1J2EA 1EHYA 1JU3A 2RIPA 2XLBA 3K9BA 2OGSA 2C0PA 5AM3A 4BTLA 3LIIA 3AIMA 4UBIA 2WKWA 2PBLA 1XZCA 1DINA
chains in the Genus database with same CATH superfamily
4R8MA 3JU3A 2WKRA 4HAVA 4IGIA 2I6TA 2OK7A 5BMVA 4UUMA 2JAWA 4UOZA 2O9JA 3K0SA 4BRSA 3CE9A 3B82A 4IMRA 4P7BA 1LC0A 3EF0A 1KQOA 1PJ8A 4MICA 3K70B 1ZU4A 2XVZA 5DM4A 3GEIA 2FN8A 3OU7A 4HQ0A 1SIBE 1QIEA 1KEKA 1X92A 3DCNA 4AS3A 5SZJA 2PRJA 3E48A 5HZHA 2F00A 3HCOA 3REOA 1XTZA 2ZYUX 2B69A 5JWHA 1F7VA 5IAEA 2A0XA 4YJDA 5CPBA 1U90A 4TRJA 3EFOA 1QIKA 5KOIA 1DUVG 1JWBB 1B74A 2EGGA 2GEUA 2KWIA 3K8ZA 4KB5A 4ARVA 4JOSA 4B80A 2NQ8A 3CUEF 3UW3A 3I6QA 2JLCA 2VDVE 3TD2A 3WLAA 1QHHA 2HMWA 3W9UA 2KX7A 1X8JA 3PQFA 2O59A 2ARKA 3EDQA 1OH8A 4M8IA 1T9AA 1JEOA 3W78A 1QYRA 4MP8A 2HO4A 2IXTA 3T9FA 2PMEA 1G2IA 3TQFA 3NT2A 4JC5A 3CUTA 2WILA 5I7RA 4I50A 3I64A 1RQ2A 1L7EA 1YVEI 1ZNZA 3IKJA 4QUGA 1QDUA 1ZSNA 3PR3A 2PJRA 2O8CB 4PZPA 4ZT4A 4XEUA 1DTEA 2FZLA 4L3WA 3KQOA 4OLFA 3T1NA 4HS4A 2B8NA 1U7TA 2EEPA 4J6FA 4KLRA 4ZK6A 2LE0A 4LN1A 2GM9A 2R62A 4FYKA 2JGAA 3BMNB 4EKEA 5LDDC 2ZRFA 4XGIA 1AV6A 3NTUA 1PWYE 1TJ4A 2QQFA 4GX5A 4ZOBA 1BCRA 3C3MA 3SDSA 3RYHA 4F3YA 1KK1A 5E6UA 1QG4A 4H0CA 4B2PA 6REQB 1QE3A 1QVRA 2PS0A 3MB8A 4LC0A 4ARZB 3ZHBA 4HFMA 4KE8A 3ZCTA 4GNRA 2RHBA 3HP1A 2Q6VA 4GQIA 1XCPA 3VVMA 4LNAA 2AJDA 1L7VC 1LRJA 2Q28A 3FMOB 4UPDA 5E1BA 1L4HA 2CGEA 1UBOS 3MB5A 1K97A 3KO8A 1JA9A 2BF4A 1HZJA 2JI4A 1YNOA 2QYTA 5ALQA 2QTLA 1LLQA 5EJ7A 1RWVA 4TVBA 4KPEC 4XPIB 3QQPA 1RLUA 2C5LA 2WSSD 4HQNA 5AQ1A 2GARA 4M55A 4DADA 4PM4A 4EG8A 1JSLA 5E8RA 3HDGA 4BNKA 2Y2VA 3FCOA 3DVAB 3PRKE 3K1AA 4CQLA 5E1OA 5A9TA 2XYHA 3SM9A 3K72B 2HA3A 2HSEA 4AO7A 3IAS6 3MBIA 5IVPA 2O8DA 4N48A 3CSDA 3HDTA 4EDHA 1XCJA 4P5PA 2CJYA 2HRRA 2IW1A 4M21A 4IL5A 4KNWA 1CY0A 2CDRA 1SCUA 1BH2A 2P4HX 1O6BA 2QJRA 4GOXA 4J43A 3KUKA 4PG8A 1DO8A 2PQ6A 1ZQ1A 3N53A 3ZPXA 4ER3A 4DQDA 3VGJA 1VKHA 3OC6A 3U9TA 1G8JA 5B6PA 2CLFB 3A1FA 3HCRA 3IVRA 3MTBA 4QT4A 1OXXK 1IY0A 2M6RA 5KMGB 3EULA 5I4IA 2TMDA 2ZAOA 4TXLA 1II0A 2HGSA 3IAAA 1RR6A 1L5HB 1UC5B 4ZP1A 1EE2A 1FFDA 3MLAA 3OTQA 3HBLA 3R6WA 4DA6A 4MROA 3ROPA 2HF7A 4I5IA 4UCQA 2WWYA 5SY4A 1S7CA 4JKOA 1NLMA 5P21A 3SZLA 3VPGA 1H1LA 5EIHA 2PZLA 3ZWQA 5BUZA 5IKPA 3CLRD 5FLYA 1JQLB 1KGDA 4F12A 1RW4A 4UKDA 1K68A 4YJHB 3E8MA 4JSTA 1Z6YA 5F1OA 3AT1A 3C5HA 3PYMA 3JQGA 3CMCO 5ALLA 4D46A 1HLDA 1U7UA 1AV7A 3O2SB 1C0PA 1WE2A 4PQRA 4GYYA 4WI1A 3C3DA 5AIBA 3AMVA 2OK8A 3EPHA 4DA8A 1NVBA 2VF4X 1E6LA 2I29A 4FDTA 5JATA 3QU4A 4WOKA 4ENRA 1LV8A 4R0MA 3O8DA 5FNVA 1H1TA 2FRDA 2IEGA 4I8IA 4GOLD 3DLAA 3TSZA 4QYTA 3ZWVA 4AIIA 2PSFA 2XVMA 3OVMA 5BN1A 4P0PB 1E7QA 1OC4A 1L7RA 3E1GA 2E4WA 2ISSD 2P2DA 1V8DA 1N57A 2HNAA 3PUIA 2PE5A 4XCVA 5BUSA 1SHTX 2WWGA 3O94A 1ZBQA 4HDKB 4QA9A 2PTGA 4UAVA 4EGCB 1R3UA 2BSQA 1REQA 4GW3A 1RJGA 1U5BA 1E4EA 1OROA 1UUFA 1JYSA 1G41A 3CNEA 1XRLA 2CUKA 3RODA 3K6SA 2R6AA 3KQPA 2VP2A 3JARA 5F64A 2NPFA 1CY8A 2AOTA 1IEQA 1J8YF 2C4KA 2TMGA 3T7JA 4CM1A 4EM6A 5JADA 2O0MA 1O0SA 1WXQA 1ZW6A 3MGGA 4JGIA 1G5PA 1CQJA 1FTWA 1MFPA 1QFJA 3OE4A 2VK1A 3DFMA 1GPH1 2TRSB 4F4HA 3GFOA 2NTNA 5LZ4A 3TNLA 4RAOA 1D6SA 1MDBA 2QTBA 4IDNA 1N2OA 5DWVA 2AYZA 2O0HA 2XUAA 4CIWA 2FGKA 3EH2A 1ZL0A 3SQMA 1X19A 3LKBA 4L7VA 5FPQA 3T4UA 2XT6A 1P9RA 2XQGA 2NU6B 4BXOA 2I99A 1SRRA 5AKIA 3ZQ6A 1Z2EA 4YXWD 1X8KA 3A11A 4RAQA 5LJLA 4GLJA 3BZUA 5B57C 2BP7B 1B8UA 2PMCA 3NIFB 1NKVA 1PGQA 1OLUB 3AK4A 5CNKA 1JS1X 1QIHA 4W1QA 3G0HA 3UK7A 4R71A 4UHFA 2VWQA 1K2WA 1UFRA 3QE3A 1QH1B 2IUTA 2OHGA 2BEUA 4ZPXA 5G1OA 4MMZB 1KFEB 2P35A 3H9GA 1C3VA 2XSZD 4BC0A 1UJ6A 4RU1A 2AWNA 1BVHA 3G5UA 2QNIA 2J9FA 3Q8KA 3SS9X 2XECA 3IAM1 3PJDA 1HKHA 4A1FA 2WOOA 2Z30A 4MA4A 1KAOA 3EN0A 3OH8A 3BC1A 1LBHA 2F3UA 4RACA 3TH5A 3HDJA 3LQYA 2AN9A 4M0UA 4BV3A 2QU8A 1X7YA 1YO6A 2R48A 1Z0DA 2JA2A 3RWOA 1PFQA 4DTIA 1KHHA 3STXA 5K0ZA 2FPIB 2IEBA 2A4KA 1S3SA 3G8CA 5AJXA 1CR4A 5FP0A 4M98A 4KITB 1OPRA 3R3HA 3SX4A 2G7ZA 3LW8A 3VR6A 3OLVA 3TCKA 3JPYA 5SZIA 1OBVA 3ES9A 4RZIA 2R5FA 2C2XA 2FDXA 3MRTA 4JR2A 5EAIA 3N2ZB 2ATEA 3BCUA 4LRWA 4JQYA 3DL0A 4M7PA 3A4YA 4V2UA 3O6VA 4BL5A 1AQJA 4GP6A 3EMKA 3FSGA 4LBZA 3DWGA 4QYXA 2G5TA 5JAZA 3MWLA 2IF0A 3TN7A 2EFEB 1XTIA 1BU5A 5AR1A 1TT5A 5FOQA 1VE7A 2NZVG 3DE6X 1CSEE 3GJYA 1NVAA 3FZNA 3TQQA 4AZ0A 2E4XA 3DHNA 2YJ6A 3NKFA 3AL0C 5BSFA 1TM5E 821PA 5CP8A 1OU0A 2YWCA 1TW3A 1A97A 1DO0A 1VG1A 2V4MA 2FJPA 3GZJA 2CYAA 5IMSA 3IOYA 4IPTA 2NOAA 3AZPA 2G1UA 3H13A 4CTNA 1GNRA 1QZ3A 4GNKA 4J49A 4EJSA 1RYNA 2J85A 3H05A 4GPBA 4WEQA 3RRJA 3ULKA 2QZPA 2SNIE 4OFBA 3TLBA 4DM7A 2W6NA 4FS8A 1TECE 5KOJA 3GPDG 1UEIA 2FG5A 3E27A 2J7KA 3LT4A 4D0RA 1IOZA 5HQ3A 4BC1A 3N1UA 3GUCA 4URXR 3VKHA 1NE2A 1JX6A 4OM7A 5SZHB 5TMBA 2P30A 2EEZA 2ZRLA 4BFUA 3EZ6A 3RAFC 1VKOA 4YV0A 3VSDA 1LPBB 4PYLA 2Z3ZA 4M8LA 2QVLA 3F90A 2HPHA 3IIIA 3BREA 1W1UA 4K8OA 1EINA 1ZIOA 2D0IA 3DPUA 3PL5A 2BH9A 3FTEA 3K70D 2HRBA 2WKQA 4XJSA 3VX3A 1HH4A 1SU4A 3FZYA 1ZD8A 2PKXA 3HDVA 3NVDA 5ALHA 2NU8A 5ARCA 4E30A 3ND7A 1IBKB 2R5WA 4BMVA 4AJ1A 4BQNA 3IJ5A 4M6WA 3VU9B 4Q4JB 3KKKA 3NHJA 3F96A 1E3MA 3PV0A 4UU7A 2GBGA 3TX6A 3GLFE 3NPMA 2QTCA 1PK7A 4Y1RB 3TZBA 5A6VA 5CIQA 5EMHA 2YBDA 1C1DA 1RHMA 1JIVA 5BSVA 2ECPA 3DZKA 3SJAA 4I9GA 4DV0B 1I1NA 3DT6A 2CK3D 4L8GA 4JYMA 3PQ3A 3C8HA 3R9XA 2DF8A 1P2DA 2CKDA 2W22A 4LNUA 4TTAA 4WA7A 3FRIA 3U3JA 5IXSA 1C7EA 4MP3A 1Q0HA 3OQBA 2VJDA 2O2GA 2AEMA 1KWGA 3EQ7A 4P0QB 3KUUA 3PFNA 4MS4A 3B78A 2F1HA 3NBZC 2ZYRA 4TT8A 4DYVA 2CJPA 3W0LB 2YV4A 1JHRA 2QDXA 3KHUA 4QJ3A 5D86A 4J3JA 3Q4GA 1EVLA 1HRDA 3PD7A 4OMDA 3KETA 4MH0R 4P3OA 5IU6A 3PG5A 3TIXB 2PH1A 4EW3A 1S4QA 2NNLD 3B85A 3EVAA 4EATA 4FM9A 4H2DA 2D2IA 3G8YA 2H52A 1SUIA 3GRUA 4LHVA 4KYTA 1TJ3A 5ALYA 3ROXA 3VM6A 4N9WA 2F1IA 1T25A 6LDHA 2AYXA 3B7GA 3EXEA 4R3NA 5I3ZA 4ASUD 5KDDA 1CG6A 1P2SA 2D74A 4LQ4A 5HCIA 3NHLA 1CYDA 1I7QB 1GTVA 3ABOB 3VGPA 2JHAA 1UDAA 5BSEA 1PK8A 1G1AA 2IDZA 4M2LA 1SHUX 4ZTUB 3KOMA 4ONEA 1F38A 3FAKA 3SXUB 3R6GA 1YZVA 4L8WB 3PKZA 1E1KA 5JXHA 2EV9A 2XCOA 3SG0A 2VTVA 3QGMA 4C7MA 3FMVA 4EARA 1GQRA 1MX9A 2OL4A 1FB5A 1DAHA 4YWJA 4CV0A 3TLCA 1ESEA 3WV5A 5IM4F 2IYEA 3LDFA 621PA 2EJUA 2Y1LA 2HUPA 4IFIA 1ADGA 1G0NA 1U1FA 2JZOA 1E2GA 4CLOA 5SYNA 4YP9A 4F4IA 4WK6A 4W4TA 5AICA 2ZU0C 5CAEB 1M0EA 1XEWX 2MYPA 2GM5A 2H0AA 1W0CA 4E31A 5CG2A 1KKMA 1GWNA 1DI0A 3QOFA 3L4BA 4J7UA 2GF2A 2J0UA 1JNXX 1F2TA 4L15A 4GI5A 5DLEA 2Q1SA 5KYWA 1ODLA 2JLAA 4JBYA 3WMGA 1NHWA 4GMGA 4RGVA 1WCV1 1B2LA 1LV7A 2OORC 3IUBA 3MD0A 2I66A 3USCS 3W5VA 1FRNA 4ITUA 1BZYA 3X2EA 4UU8A 3ROZA 2Y9PB 1J5PA 1EE9A 2YCLA 3LMKA 1IAVA 4NK5A 3WGIA 1KJJA 4AMVA 1I3OA 3QKRA 1CDEA 4JEHA 3CC8A 3COWA 3MINB 1G60A 4JMPA 4EPVA 5KNBH 2WFLA 4RSGA 2O8EB 2ZREA 3VOSA 4QQNA 2BKLA 3WB1A 2ZI7A 4NNPA 3KZ1E 3OPYI 1CUAA 2BRUC 3HCPA 4QGGA 4MCAA 3TTYA 4IWYA 4UDOA 4PSKA 4X8LA 3ZC3A 4C7OB 3NTLA 3BWEA 5CJJA 3RWBA 4EF5A 3RJ9A 2UYOA 3PT5A 3LQKA 4BLOA 3OBIA 1YGYA 1IQUA 2HRQA 3HH8A 2XD9A 3QK7A 3ZI0A 3ZTTA 3MG9A 1AS2A 4KIJA 2H59A 4YRAA 3GW8A 3ELWA 3A3NA 3OECA 4Q03A 4TV8A 2PWPA 1YS4A 4G0VA 4MW0A 4JJGA 3WYNA 3RU7A 5AKXA 3BGWA 3TUZC 5EZ5A 1PJTA 1US8B 4MYCA 1XLWA 4NF2A 4PLYA 3M4ZA 4GX1A 1EDEA 1QFSA 3HU1A 4WCFB 2JGKA 2JIZD 3HQ4O 1KI9A 3HY6A 2IWHA 2C8VA 2ZSUA 4ROTA 3KKLA 4WBXC 4X63A 4ZQHA 1Q6YA 1YC2A 4CCAA 1GTSA 4GU5A 5KYXA 4PQGA 4TM8A 2ZUVA 2DR0A 2IPOA 2D7JA 3MNFA 4NICA 4HGNA 4NQZA 1ZX1A 1TLLA 2BJWA 2YOGA 3DDWA 1DWOA 1NNUA 5C4IA 4A6EA 3JX9A 4O63O 5LL6P 1W0KD 4O6VA 4ZTBA 3OZBA 1DQNA 1NP3A 2QSUA 4TT3D 4BO1A 2OCXA 1NN1A 4RE5A 2Y0CA 3ZGNA 5C4MA 1D0VA 2KLHA 2QU7A 2BGLA 3E0QA 4IWXA 3FPFA 2QUHA 4NJOA 3L6EA 4JUFA 5C37A 4NATA 2GFQA 3E53A 5TPWB 1Y1KE 3EXG2 3U0BA 2ZE7A 2VKTA 1O94C 2H4XA 3RJZA 3RU2A 2OBFA 1OWMA 4UREA 4ZRNA 1ADBA 3KJFA 4KQEA 5ECYA 3FI9A 2P3OA 3EVDA 3WA7A 1BHO1 2NXWA 2B34A 2H4JA 1AXRA 1CR1A 1E3DA 3E6AA 1NGSA 1YC5A 1ZS9A 2FSUA 1BX1A 1YI0A 2V6GA 3KJEA 3KUDA 4Q24A 3RVQA 5DZSA 1LBQA 4LMRA 5LLDA 3GLFA 4PNHA 1XXHE 3SVTA 2ABWA 3IBCA 3SR0A 3TQTA 2O50A 2PUFA 4RLSA 5TB5A 1GQYA 5FPPA 4HRVA 2FMKA 5EKTA 5L3VA 5IJ0B 4MVJD 1FNNA 4KSYA 1O5IA 5PNTA 4CG3A 4EEZA 4DIEA 1ZUNB 3T0IA 1FXUA 4HRAA 1UDXA 4PHHA 3O4RA 1GTG1 2QQ5A 4TWAA 3OUUA 2NP7A 2PIAA 3LQ4A 2XY4A 3OZDA 5EXPA 1XDWA 3OZFA 4Q3NA 1CS4C 2GZRA 2ZKIA 1G20B 1R9MA 1J00A 3HADA 2Q3LA 2VP3A 1CX9B 3B8EA 3RDPA 3VTAA 2X0JA 1CR0A 4H7KA 5EXSA 4BNDA 2MHCA 3MRVA 4QU0A 5J3JA 2ZCJA 3IKLA 2XA1A 1EB9A 2XT9A 5HNKA 3R0JA 4YUAA 5F1KA 5J2TA 1YQEA 5LNK1 2A5DA 5I4CA 5JJBA 2VHWA 4RVNA 5T4HA 1JRLA 5HPYB 1E9AA 4O4LB 2XKAA 2VXBA 3L43A 4MOWA 3AI3A 2GXAA 1E2MA 2AOUB 3A6FA 4JU9A 5F1YA 1WR8A 5LBUA 5GZ1A 3PI6A 4QULA 4BVLA 4FGLA 4N1AA 1UXOA 4XQEA 3A6EA 4NU8X 4NHOA 3NM6B 4HB2A 1VKJA 4X94A 3UWMA 1BVRA 4AUMA 2ZRCA 1KRWA 1RYDA 3D6AA 5B4VA 3L7AA 5HMMA 4IOMA 3TBFA 4TQUS 4LJSA 1DIBA 2CXXA 1V4BA 4YHHB 3T3MB 3IP9A 3FKSD 3IUYA 2VAWA 4JI1B 3QRWA 4GYKA 4HSEA 4NNOA 3QEOA 4U39A 5CHEA 1G2OA 1RQRA 1XK6A 3ELYA 3LUBA 3K31A 2G5PA 2H3HA 4NPCA 5GOTA 4Y6GB 5HWSA 5JDCA 3UY4A 3VJMA 2WK1A 4EX6A 4EUEA 4GAEA 5CBPB 3WLPA 3GOHA 4HSGA 3V4LA 4RCVA 3QVSA 2MTBA 5DTJA 1KPIA 4KRGA 2B83A 3K1JA 3GP3A 4DM4A 5MGNA 1W5SA 1SVUA 4LPKA 2ERYA 4JUIA 3O74A 4IS3A 3ZY5A 4AULA 4D3DA 3TS1A 4YMLA 4NZOA 5C1OA 3ZVLA 1Z22A 3F1LA 4K8RB 4IEIA 2FSPA 3JTEA 4WFIA 4NDZA 3TW6A 3N2GB 4R4JA 5CCBA 2P9YA 3L8CA 4ESEA 3B13B 4E4YA 4JQCA 2VSQA 2QSJA 3PRHA 4IVQA 4UHJA 1XP5A 2MU1A 1S7GA 3BQMB 4YQEA 4ZZ2A 2R6FA 3HI6A 3UAXA 1OW3B 4I4TB 4TM7A 1VXOA 1T8YA 1TEXA 3RRNA 4UBJA 4BQQA 3FETA 3BHIA 3AC0A 2J87A 3FF4A 1UZLA 5DNWA 2NUTA 1SKYE 1WSDA 3IMCA 5HFAA 4DLTA 2H5LA 4JZYA 4Z9FA 3KB8A 4AJEA 2GZDA 4O1IA 4CUKA 3G49A 4INZA 5CMLA 2AB0A 3WICA 1N5DA 4M9ZA 2EFJA 1J1ZA 3B51X 1N8SA 1UMDB 3WDSA 2PSHA 2EWMA 1KVQA 3K0AB 3OIYA 3S3TA 4LF7B 2JJ8A 2ORVA 3KLMX 4YFYA 2V45A 3N58A 4U63A 3KZCA 2REOA 2GK3A 3TM5A 2EBWA 5D5PA 1VJ1A 5MDHA 1W5EA 2C97A 5FA6A 4JLPA 2EG5A 2FSGA 3GLKA 4R51A 1JFSA 4EY4A 1UBHS 4WXHA 1AM4D 4IV0A 1YULA 2O6HA 4LXUA 2RGEA 1M6NA 2DWCA 3H2JA 1N6PA 3DNFA 4JB0A 5EP2A 1R8YA 3IQFA 1P0QA 3JQAA 4DV1B 1MHTA 2G9UA 4QATA 4Y7CA 5CT6A 2J33A 4KQGA 4RY2A 2OMKA 2YMPA 3IULA 2GQ0A 1YQXA 2BHLA 3JASA 2QRHA 3N6RA 4H7HA 1G4AE 1G8KA 2PZAA 2R85A 4J0KA 1KU0A 4LOJA 4Z0PA 3UM9A 4B7UA 4YONB 3WGVA 1A2BA 1F4VA 4NBKA 1XD2B 2IX9A 2W90A 3RUHA 5TJ9A 4MR9B 1FSZA 3A6JA 1M7BA 3ONWA 2CLOB 1TZCA 2EFCB 2FE4A 2VBGA 1W6RA 2R6GA 2WR8A 1Z0ZA 1WF6A 1KOGA 2X15A 1IN7A 3CH5A 2OMEA 1Y9EA 3H7IA 3SQDA 3K8OE 2ESRA 1DV2A 4HWTA 3L4BC 2G25A 2R00C 3O7MA 4L0QA 5IEJA 4E7PA 2L42A 3RTBA 1B7GO 3EVNA 1C7JA 4FLFA 5H3HA 2BKXA 4L3VA 2BEKA 1S2NA 4J16A 3FNFA 3TRKA 1PHPA 2H65A 2YV2A 4ZC1A 5DT2A 1MJGA 2BFAA 1YVDA 4X6LA 2Z6AA 1WKCA 4KQCA 2GJ4A 3ETGA 4PYNA 2JI9A 1YS9A 2EP7A 2Y0EA 2JEZA 4JC8A 3TEJA 1L4MA 5FWNA 1QQAA 1IY2A 5T67A 2GD0A 4FXPA 1V5WA 4YP5A 4BE4A 1EVJA 1EPUA 1MEOA 1EA7A 2EZUA 4MSUA 3CY6A 1W85B 1PZEA 2P1RA 1TJNA 2YHUA 3DZJA 4TRRA 5DRYA 1WU7A 3S2GA 3F5FA 4J2HA 3D54D 4D9MA 4PRKA 2C58A 3BD7A 3DQPA 4Q4DA 2EFDB 4NJMB 2WMNB 3PITA 5B7GA 4GXTA 2QJOA 5CX1B 2PUCA 3BZWA 2C2MA 1JIKA 2FB9A 4GOOD 4UHBA 4JT8A 6Q21A 1P5JA 1YTLA 4HNRA 4G1BA 2ZRKA 1Z6QA 1MOQA 1NBEA 2X8AA 2VO1A 1UJ4A 4D0NA 1SBZA 2VQSA 2G9NA 4TWBA 1J8DA 4A6XA 2A88A 3KTOA 4C0LA 3E9RA 1SB8A 5ALVA 2X2EA 3OEWA 4BNTA 3ICEA 2LCQA 1MXFA 3T3PB 2GPTA 3RF6A 1SKUA 5EVCA 2RFLA 4AYWA 3F7OA 1B42A 1KXZA 1G20E 1Q7GA 4LE1A 5COBA 3ZWCA 4DCUA 3DL7A 1PN3A 1R3DA 1X77A 4F97A 3ILYA 1Z2CA 1Z0SA 2YOFA 3JQ8B 3T41A 1QZZA 3AIIA 3C8ZA 3KJIA 5EP1A 5CLFA 2W2QA 3L7MA 4NAHA 3IDSA 3FFTA 1Q17A 3Q0IA 3R5SA 5AK3A 1P6UA 1UODA 4MJ7A 3ZWKA 13PKA 1TZJA 3RBVA 2OENG 1YFLA 4HDCA 2QP4A 5IJ9A 3NJ8A 4HN4B 3FYUC 5K8LA 2QTVB 1KA9H 1P4GA 5L53A 5K8IA 1PNVA 3D6TB 3OM1A 2GERA 1U1EA 1DQZA 3BOSA 3BORA 3VHXB 4DJEC 1N5LA 1GVHA 1YDFA 4X00A 2NZXA 3L7CA 3WIOA 3ENWA 1JZTA 2Z9BA 4BIMA 1QORA 2V5AA 3VJLA 2AD1A 4UNSA 3QNMA 4CV2A 5BNTA 1JYFA 1VP3A 1ZZGA 3LPAA 2QL6A 4DB4A 2OFPA 3BE6A 4NE9A 5JZMA 2GK4A 4DILA 4MRRA 4J9VA 4AXBA 2HSZA 2IVZA 2R86A 1YRQA 1L7AA 5JD4A 4B0PA 4K9NA 5JYDA 4HATA 1QC5A 3FE2A 1UADA 3LUAA 3RIMA 1KPHA 2OR3A 1O1YA 1YQUA 3SJBA 4DZRA 1LFDB 2ZPTX 3L8GA 5L3RA 1FDSA 3KLNA 4XWTA 3GJ7A 3STUA 1NJ8A 1JQDA 4LF6B 4IHJA 4EHLA 4QUHA 2KB0A 3NG1A 3DTVD 4XH9B 2WYUA 4JENA 5AHRA 4CCSA 3T9CA 1RI3A 4RVHA 1JIUA 5CVTA 4CTMA 4ALNA 3AM4A 4JWTA 5CA1B 2ODNA 3AINA 4HVCA 1RJEA 2BLLA 5TX7A 1NI4A 4EB6B 1J0AA 1JHOA 2BWJA 2CWDA 4AB1A 5B64A 3DR5A 4PANA 3ZDXB 3GNTA 1L6RA 1KVRA 1UKCA 2REBA 5GVRA 3LCUA 5A4JA 5KSWB 1L3CA 3V1KA 3THOA 2P6RA 3TJMA 3TDNA 2JCYA 3KT8A 4KKXB 1Z5UA 4FIDA 1U8CB 2C5FA 4YRTA 3NYQA 2OG1A 2IU0A 2OO5A 4IIFA 4OHKA 4Z2YA 2DULA 1HTBA 3M34A 5F7XA 4JXZA 2NAFA 2YC2C 1IZ9A 2H16A 3OICA 2F8LA 5TMPA 3M9LA 1X39A 2R87A 1BSVA 1XQXA 3KALA 3QWFA 5KYTA 3ABQB 4YR7A 3STWA 2P2GA 3S2SA 3JQAD 1BQ3A 1J24A 3O7WA 3B6MA 4M9UA 1D3AA 1COWA 4IJ5A 3I53A 2HYDA 3LVRE 3F7TA 1RXSA 5BSRA 3QSGA 2X3YA 1Y1RA 4KRXA 5I8ZA 4IIYA 3CSUA 5ALEA 3QLTA 3LYUA 1EVIA 2GO1A 3JQ9C 3NOXA 3S99A 2HJ9A 4PNEA 1W2GA 6ABPA 1Q1QA 3C5WP 5F1PA 3AZQA 2PGDA 1B6SA 2HF2A 3Q7RA 3O8RA 4AZVA 1N1MA 4CNQA 4LVCA 2FQ1A 2H4YA 4BMCA 3MW8A 3ETDA 4FGUA 3H3XA 4WZZA 2GYWA 2XW6A 2WF6A 2QZJA 3MJ4A 4KR6A 3FPSA 3HUTA 1B43A 1G63A 1TPYA 2C3MA 1VB5A 1E4YA 1ORWA 2DRIA 2H2IA 5JNSA 4D7AA 5JFTA 2Q6OA 3DBHB 5T4BA 2RH5A 5LSAA 4RVUA 3VO1A 2ZFUA 5JAIA 3L8ZA 2I7VA 3W5DA 1SIUA 2K6GA 5G0SA 5FD8A 1SEVA 2PIDA 4FDLA 4YRKA 1ODFA 4D3FA 1H0HA 2A0FA 4YLEA 1I3MA 5DF1A 1HOTA 1CP2A 2YRXA 4KQ9A 3BJZA 2YXPX 4HC4A 8OHMA 5MN4A 2PUVA 3HKDB 1IMJA 4JSRA 2YZ7A 3ZWDA 3BD6A 3GPIA 1J20A 2LVBA 4BBPA 4FUTA 4ZVUA 1WXGA 2C0CA 3EZ7A 3LY7A 4N0QA 1ZMBA 3S1AA 4ALLA 1JYEA 4B84A 1H2XA 4CG1A 8ATCA 5U1PA 2NADA 1PJ3A 5AW2A 3CRNA 1KSHA 3NV9A 4G4SO 4ZO4A 1JLRA 3V7YA 1Y4ZA 4DV5B 2V1UA 1MAHA 2J07A 4NV3A 4D8UA 4G9EA 3UNXA 4C89A 3ZLVA 5KDOA 2JFPA 2FOIA 4W82A 3UPUA 1UBEA 1MEEA 2VJPA 4DMHA 2VNHA 3QVLA 3KYDB 3BWBA 4CE6A 2BCGY 2ZM6B 1MJHA 1TVCA 2GMWA 4R3WA 1I33A 5AVXA 5FI3A 4OY3A 1ELOA 2QW0X 3F3MA 3B1VA 1XRQA 1W85A 3RT9A 1U3CA 1GOTA 3RWMB 3COVA 3SHQA 5JMWA 3JZFA 3VPFA 3DEYX 1JPVA 3EXHA 5LQSA 1A4IA 3MLBA 3Q10A 4N7MA 1PDWA 3TCXB 1USIA 3OJFA 1AUOA 1KMCA 2VHQA 4GE3A 4JDPA 4UVHA 4E5UA 1KI4A 1QANA 1U0NA 2DQSA 1M2VA 3PF8A 4IHAA 4OYYA 5AUOB 5AKGA 2YZMA 2GEDA 4LVNA 2X23A 2GVZC 2ZYIA 3N2NA 2FDRA 3CKKA 2A84A 4JLBA 4UMDA 1G2QA 2QMZA 4MV1A 2EAUA 2JIPA 3G0OA 2VIIA 3HCEA 5HILA 2AG1A 3PC6A 4OH1A 4WDQA 2ORYA 1SOVA 1JHDA 3L4JA 4MEJA 4LDRA 2RDMA 1X1BA 4LZNA 1AUPA 4DUGD 3LFTA 3U4DA 4C0BA 3G9XA 4DDTA 1SCJA 4GECA 3EXHC 1NKSA 4BWVA 4HNVA 2H1IA 5AW1A 2JIDA 1TIPA 2OCYC 2XDQA 2GPSA 3QV1A 1ZIXA 3EQ6A 5H81A 4FQ8A 4ED9A 2B2CA 2OG2A 4LYHA 3WX0A 1SFRA 3A4TA 1ZGHA 3JASB 2CCKA 4B4UA 1XNQB 3HCWA 1YMQA 3PGMA 3T5TA 2G09A 3T12A 3N8NA 1GRCA 1H8ED 1HL7A 1XB2A 4NBRA 3R7LA 4LYJA 2VRCD 4JGGA 1MLDA 2RBKA 4QU8A 5IDWA 1M1XB 1ORRA 3QOYA 1Z4IA 2EKPA 3H4IA 4NMHA 4RADA 4PG6A 2R97A 4R8SA 2FOXA 3A2MA 3D6HA 5LBTA 4XW2A 2NUAB 2O0JA 3BE8A 1YRAA 1T9GS 2PSJA 2YR0A 2ZI6A 3P20A 2DTDA 1ESNA 4FX2A 1N5JA 5ENZA 1I94B 3U7IA 3G0DA 3N2KA 1YB2A 3RV3A 1GILA 3KZNA 5T5QA 1CQPA 3N7UA 1H0RA 2P11A 3UCEA 4YR9A 2QBYB 1T3LA 4B8YA 1XZ8A 4ZYZA 4H7FA 4A8JC 5D3QA 4HYYA 2D1YA 2DUMA 1XQ6A 4F72A 3OQ1A 4XDZA 2VZEA 1UT5A 3GDWA 4RQAA 1L4GA 1LDMA 9LDBA 5JJLA 4GQBA 2A3RA 2IU3A 5BV0A 3P96A 4NTZA 1AK2A 4A2WA 1K08A 4BFVA 1YQWA 1C7ZA 5F5XA 5HIKA 5JZSA 1Q5PA 3R41A 5JEEA 2NGRA 3L7KA 1ZKDA 3QXSA 4YP7A 2RKOA 4DMKA 1NJ2A 2F64A 1BMFD 3L7LA 5AO9A 4MUKA 3T9EA 2QZ4A 1UJMA 3D02A 2Q7OE 1WNTA 2GD2A 2FW8A 3BG5A 1RAIA 3N2GA 4MWDA 3VPCA 1W47A 3VZQA 5K8UA 4MMXB 2CE2X 3VH4A 5CVCA 4G0OA 1C9YA 2QG4A 3P5BA 2JGFA 3WP1B 4EA7A 4WOCA 2XZDA 2BY4A 5IT0A 4NZPA 4EDFA 4DMMA 2QUZA 2HD4A 2V6JA 2W8BA 4I46A 4LZPA 3VNAA 1LQUA 1VTKA 4WKNA 4ZQGA 5IWAB 3OFND 3UMGA 1TF7A 5DOVA 2ID4A 1SHKA 4DCOA 2CV1A 1YTUA 1YAJA 1ZKMA 2V6FA 3ZWAA 1NVTA 1Z2PX 2P65A 2WY2D 4BUCA 2IEIA 1KBZA 1PD0A 3QHAA 4QEZA 3VU1A 4WUVA 4Q93A 1GZUA 5AJYA 2P9JA 3FGNA 5ALDA 3INGA 2AI3A 1YHNA 1L7OA 1SC9A 2VAPA 3BTUA 3BKWA 4HTAA 4X41A 4IO1A 1YZGA 2PO7A 1T3SA 4Z7QB 1ZGCA 1BMFA 5ECDA 3G23A 4IIDA 4L22A 1GTZA 2AFVA 1LVGA 1SGWA 2Z4SA 4YH1A 4CF7A 3GRYA 3ORQA 4QRHA 1FTNA 2RAUA 2A9OA 3KEGA 4RTQA 3SFVA 3B20A 3BDVA 3K7EA 2X42A 2H1WA 3F5SA 3NOOA 2B94A 4H35A 4ZOAA 4C4RA 3KVNA 2KS6A 2GEKA 4QYSA 3UA4A 4DLYA 1BJKA 1HO3A 1JJBA 1Z5NA 2Q2NA 1E9VA 4PSUA 3MUEA 5KQMA 4Y9RA 1JVNA 1HOXA 1QP8A 3ANTA 1PR6A 4FWTA 3G9ZA 4GD3Q 4LVOA 1J23A 3AHJA 3N87A 2FPGB 4OLHA 3EC2A 1FXWA 3FRJA 5DWQA 1DCFA 3AOEC 3EDMA 4FBMA 1XZEA 4AF7A 1GPLA 2O5RA 2HCFA 4D82A 5FEUA 4D99A 1L5RA 4TS1A 5DW3A 1S0UA 2UVQA 3PXDA 5GGXA 3ZCVA 3UHFA 3H5LA 2VDUE 3T99A 1GUYA 3E5RA 1NQUA 2IY7A 2ONKA 4TMWA 9MHTA 3CRZA 1VJTA 4YAKA 5IFLA 3P2KA 2XE7A 1K7FB 1GQSA 3L8EA 4OMCA 1F9AA 3VSEA 4AWAA 3HO6A 4W5TA 1ZD4A 2GPNA 3QLEA 1AVTA 3EGDA 5IJ0A 3EQ2A 5J58A 4TTSA 3OFNA 2HLDA 2FZ4A 3W8RA 4Y1EA 5C8YA 2JD0A 1C29B 1HNXB 5IUKC 2VDOB 3P0FA 1EM6A 3ND6A 4AMUA 4D8YA 1RI4A 1TK9A 3JWJA 3I2GA 2PZMA 2RGGA 2FPRA 3RQSA 2ZIVB 2VBIA 1GT91 3ADCA 1B26A 3HC7A 3LOUA 2XE8A 4FFOA 2AXNA 5I5GA 4AWBA 1W0JD 4E2ZA 2YINC 4JMLA 2I1QA 5BYAA 5CJPA 1YB7A 2POCA 2VSOA 4MLCA 3N6XA 3DJFA 4GX2A 3U2QA 1J0DA 3DE2X 3GPLA 2Q3HA 3FZEA 4JL8A 3P0EA 3TUJC 3NM4A 4ENPA 1BKYA 4EY7A 5C5IA 3A2LA 3GRPA 3KR2A 1H2EA 2ZJYA 1TT7A 1ENPA 1XRNA 1YJ8A 2XYRA 4M1SA 2HHHB 1X7DA 3T52A 3NATA 1S8AA 4ISCA 1PR2A 5LMZA 3NX4A 4TMXA 1DBPA 1QRTA 1H93A 1KVTA 4TTJA 5EPOA 5KJCA 4BB0A 2F43A 2AHOA 3H86A 4DARA 3AVWA 4TYQA 1P73A 4COOA 3W7AA 5EN4A 1GT6A 3GRVA 4OGFA 2X0NA 1P62B 1XQYA 2G0TA 4V2IA 2IUYA 2XV1A 1BXKA 3RUFA 3W1VA 5C53B 3O8CA 2EJBA 5C51B 2WVJA 3DP7A 4RK4A 2VTDA 3JALA 5CIYA 4L4UA 2IV7A 5T57A 3WGTA 1WXFA 3C98A 1YQGA 1SQFA 3IS3A 1A8QA 3SOPA 4DMFA 4GLBA 1KMHB 3OJOA 2LXNA 2GHTA 3KEQA 1MG5A 4PR3A 2IH4A 2G80A 4LOIA 4RF5A 4CCYB 4D8TA 2XUQA 1ML3A 4PO9A 3I39X 1Y1LA 5TT0A 4AJJA 1XE3A 4OD0A 5EE5B 4LSWA 4PE5B 4IXMA 4AICA 2C8LA 4G0WA 4ZAYA 3F8WA 4A27A 4MJ3A 3QEJA 1K3UB 2X3UA 2XQJA 2ZJ3A 1GFSA 1ZOIA 3BXXA 1JV2B 3I45A 3KTAB 4FGJA 5CYFA 2FPLA 5ER9A 5GP1A 5JLAA 2BGNA 3O3CA 5FFNA 5EWJB 2C7VA 3FM9A 2FFQA 3PGJA 4W5HA 3I58A 3KTAA 8ABPA 1AKVA 5ADVA 3VYSB 5TLSA 2ZETA 1CYEA 3ZD8A 2VT3A 2V7TA 2XGGA 4FWIB 2FWRA 2PV7A 4RKEA 4E1AA 1DAEA 4WFJA 5A4MS 3EEOA 4O2AB 4JJFA 3WLMA 5THKA 2XQKA 1ZEJA 2WJVA 3LZCA 1DWPA 3F2VA 2LCFA 1TA9A 3T5GA 1K8RA 4GI7A 2LKCA 4FNAA 4C29A 3RFTA 1KVSA 4XWWA 3H8JA 3KKNA 1QK3A 5NLLA 5YASA 5JH7F 3RH0A 1JDJA 4H4EA 3OBBA 4QUKA 5KTKA 2OGZA 1L5WA 3E82A 5ITSA 4OQNA 1BRMA 2G8NA 2CL5A 2P0YA 2V4ZA 1HTTA 4QTUB 4X92A 2Y9MB 2Y0DA 3B6KA 1X3SA 1J56A 1RYFA 5IM4A 1IB0A 4QT0A 4WZBE 1SOWA 2PAFA 1K6IA 1NM5A 5D3ZA 3QLJA 4CLOB 5K0BA 1NXXA 1IPFA 2N47A 4PHGA 4DGQA 1YRYE 2C57A 1HQYE 4ESHA 1U7DA 3DLBA 1ZD2P 2G83A 1MORA 3R76A 3S5JA 1DUIA 4KXUA 1X7XB 3H6GA 3X1KA 2C7BA 3LAWA 5JO0A 1KBOA 2NO0A 2D0DA 2JLBA 4RKWA 2YC4C 4BKUA 3PXBA 1GO2A 4Q3AA 3RRFA 2CMKA 3MTDA 4MIOA 4C01A 3NIDB 2AFIA 4GDFA 2CJWB 3VV3A 3W9BA 3KB2A 3LVBA 2YFHA 5AXBA 1G66A 2IDJA 3OLWA 3EEFA 1M1ZA 3OIUA 1KI6A 4ON9A 3W79A 4BFXA 3KPVA 5FIUA 3JAWA 4R9SA 1CUXA 3EXEB 3LKVA 3GEHA 3O5AA 3PWZA 2GAJA 3EPKA 1U2ZA 2Q8PA 1PVDA 1VE6A 2GHIA 4YJFB 3B7WA 4DTCA 3TOVA 3TFQA 3GVPA 5BQ5A 4EEXA 4R1OA 3OESA 4LNHA 1MF7A 2AF3C 2CUNA 4PZAA 4RVCA 1GZVA 1HQCA 1Y6ZA 1APBA 1SD1A 5GV8A 2IE0A 1QRSA 2XRFA 4FYJA 4U2BA 5G1PA 1L1RA 3HEBA 1F48A 4H60A 4DLXA 4B3CA 4D4KA 4RS4A 2IIQA 5AH0A 4YCSA 1IPHA 1Z6ZA 1S3GA 4JXKA 5CNMA 4R16A 2A14A 2UYCA 4QBFA 1HV8A 3P2EA 1DT5A 1VZ2A 2I6SA 3PC8C 2UKDA 1LPPA 1W4ZA 4P80A 4PINA 3DT8A 5F2EA 5A0VA 2CYCA 2RJOA 4YALA 4PLPA 5IYZB 4WA8A 4FFLA 1MEJA 1PP4A 3M8KA 3WQSB 2EIHA 2OOKA 1M74A 2G70A 1XZNA 2PX5A 3NWBA 3LQRA 3QX7A 1SO8A 2XNDA 1BG6A 4S1WA 4TTRA 1TAGA 1HGXA 4FE4A 4N0DA 4RELA 1S4MA 5C8XA 3T7IA 1DJLA 1XF1A 2WA1A 2OAP1 4AVYA 2EQAA 1L4BA 2PX8A 3GFPA 3M6WA 4QAQA 1NJSA 1C7QA 5K2MA 4B7AA 3UAGA 1MQSA 4D9CA 4YT8A 5ITZA 4WN3A 2O5CA 3VHRA 4ZVRA 1KC3A 3Q41A 3UAOA 2C2BA 1RADA 1WZUA 1X94A 5EA2A 3WBJA 2XXAA 1YCGA 3KK0A 4YROA 1JE1A 2DP4E 3P52A 3PFIA 2J41A 1QRAA 1K7YA 3B9PA 4TZTA 2P9CA 1JT2A 2MSNA 4NMWA 3KOOA 4YJ3B 4HMQA 3OY7A 4JKIA 4DOMA 1B76A 4W7HA 1HUQA 4MW2A 4P8RA 5CCDA 3EVCA 3OLZA 5A0TA 3C8DA 3U6BA 4PYIA 4JXJA 1G98A 3EB9A 3KKOA 2JJQA 2QXYA 1TLTA 1Y9ZA 3REFA 2ZIEA 1N32B 1HT1E 1J9GA 1MO5A 2QM8A 2QR5A 3QPUA 4HXFB 4WY5A 4XD7D 3AR4A 3RHTA 3RFUA 4YX9A 4PRZA 5K7SA 4JBIA 3EK2A 3I37X 1VJ5A 2QD3A 4RORA 3OQMA 4Y2QA 4RLQA 1IZYA 4E22A 4X1KB 2GD1O 3ZDRA 3MD9A 4JB2A 3E15A 3OJCA 1N36B 3FA2A 1LVHA 4PLTA 4DMLA 1U3WA 3WB0A 4EW1A 3GEPA 4JYPA 3GDFA 3OX3A 4LRUA 2YW2A 4HGOA 1OYWA 2J5RA 3D6VA 3PK0A 3TXAA 4LDPA 4Q7QA 2CBGA 3QYAA 5LQJA 1G1MA 4XVQA 3L02A 1SR8A 2ZRBA 5HDBB 4BP3A 3G5MA 3IHWA 3IYLW 3PUWA 3OZSA 2OAEA 1CY6A 1AGRA 1MBZA 1AUXA 2EW1A 2QJTA 3AXTA 1G7SA 1BXGA 1XTSA 2YASA 3HDYA 3KEFA 3UOGA 4L07A 2Q3MA 3GLVA 3UT6A 3ZX4A 1WF3A 2VWPA 4KH0A 5BW6B 4JUAA 1RWNA 4OHWA 3CR3C 1EFCA 2VZ8A 5HFJA 4P2BA 4F96A 2EJTA 3HG7A 1KJWA 2BTQB 1O5TA 1BGWA 1R4MA 1KXJA 1J7JA 2WVHA 3O84A 3V8EA 3WAKA 3MSXA 3WC4A 4B82A 1GZ7A 1RHRA 4EITA 1AB5A 1VFNA 3DEJA 5EY5B 2FKNA 3LDAA 4F06A 4Q7EA 4EVQA 1DRVA 1CEEA 2HCBA 4GPIB 4M0EA 2PFGA 3AI7A 2HRZA 1Z3CA 3T54A 1PDVA 1SJ9A 2OUKA 3LKZA 3DYIA 4HEHA 2I22A 1XZHA 4QICA 4RK7A 1E79A 4DQLA 1VHWA 1X2BA 3GPCA 1NAHA 3L8HA 1K7CA 3ONDA 4F8JA 5JSZB 3GB9A 4RPKA 4D97A 2JFQA 4QXOA 1ORVA 2I1LA 4G25A 2C3UA 3HYLA 5FI5A 2VDQB 3WJ2A 3TTUA 3AUUA 1FTGA 1Q6ZA 5J4HA 1VE3A 4FDAA 4KO2S 3QBTA 1HE5A 2GEFA 3OMWA 3OO0A 2QRUA 3OI7A 1CDDA 1OXTA 1YB4A 4LE2A 2YZKA 3IUJA 4YBRA 2Z3WA 1J7KA 3Q7TA 3LC2O 5H80A 4LJAA 1JKXA 4YEDA 3RJTA 3FSEA 4LGVA 2YMLA 2J9FB 2X7JA 2ZG6A 1E2PA 3VH2A 5FPYA 2C29D 2W48A 4KACA 4BNZA 4CLRB 1L2TA 1ZEMA 4E32A 4MARA 2WWFA 5B2EA 1BMDA 4PC6A 1XCOA 5DHUA 1LSJA 1QH1A 5JT1A 2UUBB 4XAQA 5KKAA 1QIIA 2FF5A 1UOQA 2X77A 3W5CA 3FOFC 1VYVA 3RS4A 1MT3A 3W4KA 4YRBA 1SK8A 4F46A 1OLUA 5FQNA 1E8NA 1S8NA 2Y93A 4PBTA 1UMCA 1GPYA 3M9XA 4URYR 1QDEA 2WD8A 2YYSA 3B1YA 2PYDA 4KFUA 2BTQA 3GBSA 2DWOA 3FPCA 1COWD 3GGPA 3ZY2A 1M6VB 1OZGA 3NH9A 2GXSA 4AP5A 2O8NA 2PRKA 2R2AA 3IX7A 1RI1A 1GUZA 2HA7A 2JH9A 3EOZA 3IRUA 5C9ZA 1JIQA 3IUQA 1KI3A 4JVLA 2IOQA 2GCIA 4H0FA 2ZQYA 3B36A 4PR0A 5CLGA 4GLOA 5AKEA 3Q5EA 4U2KA 4KVGA 4LJKA 3INTA 1SM4A 1HFEL 3BRSA 2HU2A 2OV2A 3CF4G 4S1VA 1LPSA 2PMWB 2NMVA 4EO9A 5L51A 3HXLA 1ZZEA 2ZOSA 4FXOA 1DAIA 2VCHA 5GZ6A 4KMOA 4URWR 3TEMA 2RHMA 4HH0A 4TLLB 4FMBB 3UVEA 5MHTA 2H18A 2B98A 2JEOA 1ZK3A 1B0ZA 1XI2A 1T35A 4HDKA 1GZ3A 3UGTA 2F67A 2W2LA 3L4SO 4M0DA 1THGA 2F6RA 2KHZA 2NG1A 4U8HA 1MVOA 4BUZA 5AW6A 1U6IA 1N6RA 5FO0A 5CDYA 1PFUA 2JFBA 4ACAA 2PWYA 4INAA 4Q4AB 1D2EA 2W6JD 5P8WA 4CTJA 4PONA 2IX3A 1IATA 3JQ7B 1S2DA 1M6EX 1XPRA 4LYEA 4BX8A 5HKAA 4RTNA 4JSYA 1FJXA 2A5LA 4NOJA 1TAUA 1NN3A 1X1TA 1EGQA 3T15A 4J90A 4YRPA 4OATA 5LU9A 4IHQA 4R0VA 3OETA 4C08A 4ZOLA 2ISQA 2ZP1A 2WZBA 3BRWA 3SYLA 4B7CA 5K4GA 4RV5A 5I9BA 1JP7A 3VVCA 1IXSB 3EXFB 3AUTA 1CQIB 1SXJA 3MOGA 4A5OA 2FUNB 2VUSA 3FWYA 3GH3A 5K3OA 2PUJA 1Q3TA 1O03A 4UDNA 5CM9C 5ILGA 4CVNA 4ERXA 2Z5LA 4G86A 3FDXA 5FTNA 4W8GA 3RC7A 1EX6A 1EDBA 3NW9A 2J1LA 2JFGA 4N49A 3C6YA 1O95D 2IIBA 4JLWA 4M0CA 1NPYA 2IXDA 4LWZA 4KN6A 5DJ5A 1NA5A 4ZMSA 4JLSA 1LXCA 1O5OA 1X80B 2I65A 3ZHSA 1LSUA 2BM8A 4OKSA 4XIJA 4D79A 1G18A 1LKZA 2Y99A 1UMBB 4DT1A 1N78A 1GU0A 5LQCA 3UJBA 1K5PA 2FGJA 1I7PA 1UKEA 2VHUA 2ZAGA 3GFTA 2A5JA 2PHZA 1A9ZA 1XVAA 3PU6A 3UK1A 4BQSA 4N03A 2WUGA 1OFGA 1IZ0A 4OBWA 2MSLA 4DXHA 5BXQC 1AKUA 2QP3A 3LBAA 2XUJA 3EW9A 2IZ6A 4HAYA 4DA0A 4B2IA 1UC4B 1WB9A 1WCXA 4H9GA 1E2LA 5LP6A 2NTVA 2P78A 2JFXA 1Z33A 2BEWB 5DGCA 2BJHA 5A9SB 2AOXA 3RUPA 3UTCA 1XELA 1YUBA 4JI8B 1WG8A 3SYMA 3GP8A 1ZC4A 3JAWB 2H54A 2SKEA 1KI6B 4YA6A 1CUEA 3K1AB 1FJ2A 3U7JA 1P7YA 1U3GA 3AKYA 4WK4B 3WHIA 1O3YA 2CJWA 1E79D 4ZV4A 1U2TA 5FPSA 4BRUA 2I34A 3TNJA 3PTZA 1SIOA 2I4LA 3VI3B 1QQ6A 4A0RA 2YVUA 5EKXA 4BMYA 1JSZA 2PRSA 2VVTA 3CCCA 4RULA 1VJDA 1UPBA 5F33A 3OKPA 2XCSB 1CJSA 3FUUA 2HJSA 2I6GA 2P1ZA 5C8YF 3FN4A 3FNIA 4F56A 4LXYA 3QXXA 1IG3A 4P0TA 4HOYA 4BCCA 1FVOA 1OGYA 3IR5A 2R65A 4YWHA 1UEJA 3V46A 2YQZA 4MQEA 4M8NE 1G5HA 1ODJA 1VBFA 3IHLA 3PE3A 3QWBA 4OYHA 2Z4TA 4QBKA 5ECWA 1IHPA 1ZCAA 1D9ZA 1QF9A 1EWVA 2RG7A 4C7VA 3GX1A 2QIOA 1SD5A 4G63A 1QV7A 1D8TA 2ZDGA 4OI1A 4HYTA 1LU9A 4U4AA 2CHGA 1JJAA 2H1CA 4EPYA 4LPSA 2TYSB 1UANA 3FBGA 5ALXA 1SVLA 521PA 3G8DA 4BV9A 5EI5A 2PBRA 2VYQA 3IELA 4M76B 4O2AA 5BNIA 3ASYA 4U7FA 3WSWA 1LF5A 1JSXA 2YV5A 4TKLA 1N34B 1QCZA 1SVOA 3I0ZA 1DBVO 1C0KA 1C3XA 1GPBA 4CM6A 4QNNA 1FS6A 2EC5A 2Y67A 1JWAB 1P19A 5NULA 1JH9A 5JZ9A 3LHIA 1FW8A 2PPLA 3DAFA 1CVRA 4PZ0A 2XXBA 2BHSA 1JR3A 2GM3A 3U3OA 5FX2A 5KQLA 3VR4A 3L0PA 1UIMA 5C1DA 2OPHA 4WUTA 5KNBA 1QHHB 3UHOA 1DX9A 1Z0JA 4ZOCA 1LQTA 1QVVA 1VP9A 2ETVA 3ZBPA 4BO0A 2BGGA 1U0SY 3AJAA 3WMEA 3FTPA 4I1OA 4UOQA 5KCZA 2X86A 3LNTA 3D5QA 4CCYA 2G76A 5K8TA 4PVDA 2IPMA 3SR3A 4NV0A 2CWWA 2D1RA 3I92A 2PJZA 2HLHA 2QTVA 3VZCA 3FWHA 3IQWA 3G85A 1BCSB 1OD6A 1RQNA 5ILQA 5A3JA 5CBKA 2DVMA 2IS6A 1T9ZA 3B3GA 4KN9S 3T6KA 1EK1A 3CLTD 1R2QA 1W4RA 1AGNA 1X80A 2NYUA 3DV2A 3M81A 1EESA 3HHEA 2ZXEA 1CU1A 2G5CA 3BIXA 3JQ8A 4GMXA 5DP2A 4G07A 1GNQA 3GPBA 4OXQA 1VHJA 3PZRA 3C8UA 4IDFA 1NYTA 4YGXB 1W73A 5LQUA 3MTIA 4IIBA 1TGYA 1NP6A 3FCSB 5J5CA 4ALKA 1NMEA 2JGNA 1S89A 3GJ4A 1AXGA 1HM5A 1KQPA 1YRLA 1Y3IA 3ITKA 1BMQA 1ZA2A 3BEDA 3EXFA 3KFVA 3QVOA 1ZJJA 2OLJA 2OO7A 4JL5A 4ZOLB 2GOYA 1RLMA 2ZS7A 2OE2A 4L0MA 3PUKA 1K0FA 1DDOA 2VQ6A 1BA2A 4AQDA 4BYGA 5DB4A 5DM1A 2ZPUA 4MRMB 4CR8A 2GXUA 2CFRA 1C1XA 2D59A 3P0HA 4FYPA 4P31A 4GKBA 2PUDA 4Q4AA 3HJTA 3KNZA 4IWNA 1VIDA 2OESA 4D9JA 1QYCA 4RLHA 4QGFA 1KHTA 2WV9A 1RSZA 2Y92A 3W6UA 5BSWA 1TZMA 3WRXC 5IZCA 3G7NA 4GVLA 2P0EA 2GWHA 2JIZA 3PSAA 1PNRA 1WHSA 2AC7A 1F60A 1MAWA 2W6QA 3IALA 2PD3A 4EK9A 1PW7A 4X85A 1QNLA 2YYZA 4I2VA 5FYQA 3MT8A 3UWDA 2H2GA 3VTKA 2RCNA 1AS0A 2HQOA 2HADA 1KY3A 3BL5A 3FD8A 1EMDA 1NZFA 1N4DA 2CDAA 4ZICA 2P6NA 2C2KA 4G1VA 3RU3A 3BMCB 4UPEA 5H9WA 3MHTA 3T3HA 4U9UA 5G3YA 3W8DA 2I4NA 1L5GB 1J8QA 3D4NA 2DLCX 3I04M 2PUGA 4HH3C 4HWRA 1P7WA 3DWEX 3DZIA 1P9OA 1X42A 1XMVA 2W4IA 3PBKA 2DGDA 2CLIB 3EGXB 5AM5A 3RR2A 4TTIA 1M5UA 3JWHA 3AHIA 4JVMA 1HYEA 1Y1SA 3ID6C 2XMCA 5KB3A 1E9DA 5F35A 1D2MA 1XZPA 1FLAA 1NVUQ 3WRXA 5B36A 3HABA 5CFZA 5IZCC 5HYVA 3O26A 1QYVA 4PQYA 4RNDB 4G67A 3U80A 2A0YA 4NG4A 4QDUA 1H2WA 2QUKA 2ZI5A 4WZBA 1DKOA 3SXJA 1V3QE 1B15A 5D01A 4BQIA 3JZDA 3UUFA 1NW6A 4L6AA 1XWIA 4M9RA 5J63A 3LA8A 3F6YA 1C3LA 5IJXA 1SURA 5ICSA 1S1CA 3AY0A 3HS3A 4UE3S 3PQ6A 3I30X 4JLOA 1ISRA 2IP1A 5IAGA 1Q0TA 3MJCA 4MQ6A 4CLRA 1NF2A 3FYSA 4K9OA 2D3TA 5IKXA 1ST2A 3C48A 1QHIA 1XJWA 3DJYA 4C3ZA 4DANA 3F6BX 2Q6KA 3AF4A 4IHKA 1VIAA 2J5XA 4Z7OB 2AN3A 3VYTB 4C0QC 3TQHA 1L8XA 4GDMA 2IHZA 4QDXA 4KL8S 4BO8A 3BSSA 4WVLA 5JCPA 3KZMA 4AWXA 4ABTA 3ETNA 2ZATA 3JYPA 1J06A 4BFZA 2FQXA 2JKYA 1CVIA 4GRIA 1EM8A 4O5AA 2R8EA 3S8MA 4BECA 2IU4A 1PBTA 2HU7A 3KJNA 1TAQA 2EF1A 1T9BA 4YV2A 1KU6A 1FP4A 3AFMA 1PZFA 2IPAB 2VH2A 2BC9A 3LP8A 4JYCA 2YFYA 4TQAA 3EIHA 3LUHA 4UULA 4AC9A 7ADHA 4MAFA 4A23A 5AVQA 1Q7RA 3DGEC 1VXRA 2HB6A 1NX9A 1Y9JA 1BAPA 2X4LA 2CT8A 3GWZA 3LWZA 3QLUC 3LT0A 4FB5A 1U9ZA 2JAXA 3K15A 3BFVA 1FNMA 3G17A 1Q57A 1QFXA 4BLTA 5KWVA 5AVSA 2K7FA 3C24A 2YN4A 3HUFA 1A72A 3QHPA 4BRWA 3RAEC 4HH4A 1TYCA 3ICPA 1BXGB 1T6BY 1ULBA 1JA1A 3AJRA 4L8VA 2RB4A 4QUBA 1LC3A 3KJZA 3TIFA 4I3FA 5JPCA 1GDHA 1ISMA 3PI7A 1J0XO 3N86A 2ZVPX 3I0NA 2FWJA 1EM8B 3O21A 2EGHA 1ZVKA 3P9CA 3QPWA 1HEIA 2QPOA 2VAMA 3I52A 4TVKA 4Q9HA 5IXJA 1STOA 2R7NA 3NAZA 1QIFA 3VI4B 3UH1A 3NVMB 1X7HA 1BD3A 3JQFA 4XTRA 3BMQA 1WULS 3ZU6A 2CXNA 2ZK7A 4G5XA 4ENWA 5LDHA 1RRKA 2NUAA 5AJHA 1MXHA 4DR6B 2LV8A 1EZ1A 1XMJA 2WSLA 1Z7WA 4L5AA 2G08A 1YU6A 4U9HS 4CZ2A 3BULA 3ILSA 2Q2WA 2AH5A 5TGTA 3RYFB 1WCIB 3UJHA 5IF9A 1HRKA 3KLOA 1MJFA 3L9XA 5JCJD 1QOPB 3VYUB 1ZCJA 4RL4A 3PXEA 4HFNA 5EZSA 1LPMA 3ZI7A 1T2FA 3B9BA 3QJ5A 3T7DA 4MVJF 5M34A 2ZR7A 4MQFB 3I01M 3W1WA 2C5GA 1WBBA 1TQ6A 2ZAIA 4JJZA 4YJ3A 5AD1A 1VL0A 1LSSA 4AAYA 1HDOA 4G2NA 3S2EA 2DM6A 3UWPA 2WP0A 2H51A 2ZUWA 1NKTA 1D6MA 1PSZA 1RPTA 3TBKA 4HDQB 1NNSA 3TKYA 3DDUA 3E22A 1PFKA 3N9IA 4UAJA 2ZJBA 3NANA 4ER0A 1OLOA 3A9VA 4QYMA 2V9PA 3WL3A 1XMIA 2RCYA 2HU5A 1PDOA 4ACBA 3AUYA 1EK6A 3BGVA 5C7YA 4JWKA 2WFZA 1H4QA 4WNIA 1HDZA 2FPSA 1KMIY 2H1VA 2HI0A 2OHHA 2REXB 1NNLA 2QQGA 3ZX5A 2C1ZA 1O0CA 2J5BA 5G41A 1WMFA 4D1YA 3SK0A 3RTGA 2JHPA 4EVRA 1RU3A 3UIEA 3VC7A 3T7SA 3H1AA 3GGCA 3TTSA 4EIWA 2XT0A 1NUHA 4B6GA 3UGQA 4ZJZA 3Q6IA 4O08A 3RS5A 4KRFA 1S2GA 5TE9A 5AFSA 3TMAA 5JI3E 2DTXA 3C0KA 2I2XB 3HJNA 3KWLA 1AQUA 1WHSB 2XIQA 3KOUA 3KAKA 2GEJA 3R7FA 1D5WA 3H2GA 1KZ4A 2CSUA 3SC4A 3E1KA 4REMA 1RPJA 5TXGA 3JQCA 3KBOA 1JBEA 5MFPA 1PUIA 2GBLC 2R96A 3H2SA 3VBCA 3CX6A 1G291 4L7QA 4GZ3A 4UBLA 2QX4A 4AUKA 4ND7A 2Z83A 1WXDA 3LJKA 1XXHB 4MRMA 5GY7A 5JAQA 2JGJA 1N0HA 4DV4B 1GZ5A 3INRA 3USES 2FSHA 3CEPB 5IKOA 3LCVB 3ZHYA 5C32A 5ICCA 2JEYA 3EWAA 4AW9A 4DLSA 5JASA 3ED5A 1X13A 4XE5A 4XJXA 4PLFA 4NRDA 1W8DA 3WK6A 4WESB 4TVOA 3EEYA 4E33A 2VPYA 5AQEA 3UAVA 1FYVA 1OWPA 1TRKA 2P5YA 3M6UA 4ZAFA 3MTAA 2HTEA 3RYIB 1ESCA 2BM9A 2H7XA 1THTA 2HXYA 2OFOA 2B8EA 3RPEA 1DX4A 4E6PA 3WNCA 1TA0A 1PTJC 2QG6A 4LDZA 3FYDA 3UJ3X 1SBIA 4P1ZA 1PEYA 3DUFB 1V5IA 2H9YA 3RLIA 1MZVA 1ZSVA 1KJIA 1L1EA 5ABPA 1MZPA 4FB4A 3SQLA 3H2BA 1FMLA 3AM3A 4KHZA 1Q16A 3BBPA 4AIRA 5EE1A 4V24A 4KR2A 1Y6RA 4V0QA 3FHJA 1WABA 2ERXA 3HXTA 5AW0A 1RI2A 3WQRA 2Q49A 2OWDA 3P19A 1Y7LA 1BDBA 3FLAA 4M1OA 4N3NA 1RC8A 2H7VA 3HU2A 4MRAA 2HIMA 2EZTA 1IU9A 1CEXA 1FSPA 4HEA6 2W6CX 1V96A 1JQJC 2B99A 3M6FA 1P80A 4AJ4A 3OJWA 3JQPA 4TZ0A 3PNYA 2BFOA 2ZE5A 2ZYTX 3AOEA 3F3KA 1Q20A 4Q1VA 4V3BA 2OZLB 3X1WA 2BFCA 1ISPA 3BB3A 4PYRA 2VJAA 1DRWA 3TE7A 4CBVA 3KWFA 2B0JA 2WU4A 3DZBA 3E3MA 3NHPA 1YB1A 2OZLA 1QP7A 1KNQA 2DCUA 2VOEA 4KX5A 4AXXA 1GV1A 2VPQA 4Z4FA 4ZCIA 3F7NA 1RAGA 4FKZA 1Y81A 3DT9A 4EHJA 1YD7A 4PXSA 2FWAA 1N3YA 1QG2A 5DCUA 3IT3A 2GTPA 4O0MA 3ZJUA 1RRMA 2I4TA 5G1NA 1YAHA 4YRQA 4B32A 2FQYA 3R44A 4WLFA 1KMHA 4PHTA 5KYWB 1AQIA 2V7XA 3DVQX 4UU0A 2C42A 3RC2A 5AT1A 1UPCA 3S2IA 2HA2A 1M1YE 3L7DA 3PNBA 2O7NA 3LW7A 1Q1AA 2CNWA 3V33A 5K01A 2QL9A 3V3KA 5IRCD