5F5EA

The crystal structure of mll1 set domain with n3816i/q3867l mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
148
Chain Sequence
LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase 2A
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 148
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f5eA00
4LDGA 3M53A 5AYFA 1MVXA 5T0KA 3M57A 5HQ8A 3PDNA 3KMAA 4O30A 4JDSA 1MVHA 3F9XA 3MO5A 5EG2A 2W5ZA 5LSXA 5KJNA 3N71A 3SW9A 5F6LA 3KMJA 5JIYA 2IGQA 3KMTA 3F9ZA 3K5KA 4YPAA 3CBPA 4QEOA 3F9YA 4AU7A 3M59A 3OXLA 5CPRB 4IJ8A 3VV0A 5CCLA 3S7BA 4YNDA 2O8JA 3OXGA 5KJMA 3MO0A 4WUYA 4FMUA 1XQHA 3HNAA 5ARGA 5TTFA 3S7DA 3QWVA 5EX3A 1PEGA 5F59A 5KJLA 3VUZA 4NVQA 2F69A 3M5AA 4JLGA 5JHNA 2R3AA 4BUPA 3RU0A 1N6CA 4J7IA 3S7FA 4C1QA 4YPUA 5F6KC 3M58A 4YNMA 3OOIA 1N6AA 4YPEA 4O6FA 4IJDA 3OXFA 3M55A 4NJ5A 3OS5A 4QEPA 4H12A 5JINA 4RZ0A 3RQ4A 2BQZA 3FPDA 5JJ0A 4MI5A 5F5EA 3M54A 1N3JA 3QWWA 4YNPA 2QPWA 3MO2A 3RJWA 5LSZA 3DALA 1MUFA 3EP0A 5T5GA 5TEGA 3RAYA 3TG5A 5HI7A 3S7JA 3OPEA 3TG4A 3DB5A 3SWCA 3BO5A 3IHXA 3QWPA 5ARFA 3CBOA 4E47A 5EX0A 4J83A 3S8PA 3RIBA 3F9WA 2JV0A 3MEKA 4J7FA 1ML9A 3CBMA 4I51A 1ZKKA 1O9SA 1H3IA 4MI0A 5TH7A 5T0MA 3M56A 4J8OA 2G46A 4Z4PA 5CCMA 2RFIA 5KJKA 4QENA 2W5YA 1MT6A
chains in the Genus database with same CATH superfamily
4LDGA 3M53A 5AYFA 1MVXA 5T0KA 3M57A 5HQ8A 3PDNA 3KMAA 4O30A 4JDSA 1MVHA 3F9XA 3MO5A 5EG2A 2W5ZA 5LSXA 5KJNA 3N71A 3SW9A 5F6LA 3KMJA 5JIYA 2IGQA 3KMTA 3F9ZA 3K5KA 4YPAA 3CBPA 4QEOA 3F9YA 4AU7A 3M59A 3OXLA 5CPRB 4IJ8A 3VV0A 5CCLA 3S7BA 4YNDA 2O8JA 3OXGA 5KJMA 3MO0A 4WUYA 4FMUA 1XQHA 3HNAA 5ARGA 5TTFA 3S7DA 3QWVA 5EX3A 1PEGA 5F59A 5KJLA 3VUZA 4NVQA 2F69A 3M5AA 4JLGA 5JHNA 2R3AA 4BUPA 3RU0A 1N6CA 4J7IA 3S7FA 4C1QA 4YPUA 5F6KC 3M58A 4YNMA 3OOIA 1N6AA 4YPEA 4O6FA 4IJDA 3OXFA 3M55A 4NJ5A 3OS5A 4QEPA 4H12A 5JINA 4RZ0A 3RQ4A 2BQZA 3FPDA 5JJ0A 4MI5A 5F5EA 3M54A 1N3JA 3QWWA 4YNPA 2QPWA 3MO2A 3RJWA 5LSZA 3DALA 1MUFA 3EP0A 5T5GA 5TEGA 3RAYA 3TG5A 5HI7A 3S7JA 3OPEA 3TG4A 3DB5A 3SWCA 3BO5A 3IHXA 3QWPA 5ARFA 3CBOA 4E47A 5EX0A 4J83A 3S8PA 3RIBA 3F9WA 2JV0A 3MEKA 4J7FA 1ML9A 3CBMA 4I51A 1ZKKA 1O9SA 1H3IA 4MI0A 5TH7A 5T0MA 3M56A 4J8OA 2G46A 4Z4PA 5CCMA 2RFIA 5KJKA 4QENA 2W5YA 1MT6A
chains in the Genus database with same CATH topology
4LDGA 3M53A 5AYFA 1MVXA 5T0KA 3M57A 5HQ8A 3PDNA 3KMAA 4O30A 4JDSA 1MVHA 3F9XA 3MO5A 5EG2A 2W5ZA 5LSXA 5KJNA 3N71A 3SW9A 5F6LA 3KMJA 5JIYA 2IGQA 3KMTA 3F9ZA 3K5KA 4YPAA 3CBPA 4QEOA 3F9YA 4AU7A 3M59A 3OXLA 5CPRB 4IJ8A 3VV0A 5CCLA 3S7BA 4YNDA 2O8JA 3OXGA 5KJMA 3MO0A 4WUYA 4FMUA 1XQHA 3HNAA 5ARGA 5TTFA 3S7DA 3QWVA 5EX3A 1PEGA 5F59A 5KJLA 3VUZA 4NVQA 2F69A 3M5AA 4JLGA 5JHNA 2R3AA 4BUPA 3RU0A 1N6CA 4J7IA 3S7FA 4C1QA 4YPUA 5F6KC 3M58A 4YNMA 3OOIA 1N6AA 4YPEA 4O6FA 4IJDA 3OXFA 3M55A 4NJ5A 3OS5A 4QEPA 4H12A 5JINA 4RZ0A 3RQ4A 2BQZA 3FPDA 5JJ0A 4MI5A 5F5EA 3M54A 1N3JA 3QWWA 4YNPA 2QPWA 3MO2A 3RJWA 5LSZA 3DALA 1MUFA 3EP0A 5T5GA 5TEGA 3RAYA 3TG5A 5HI7A 3S7JA 3OPEA 3TG4A 3DB5A 3SWCA 3BO5A 3IHXA 3QWPA 5ARFA 3CBOA 4E47A 5EX0A 4J83A 3S8PA 3RIBA 3F9WA 2JV0A 3MEKA 4J7FA 1ML9A 3CBMA 4I51A 1ZKKA 1O9SA 1H3IA 4MI0A 5TH7A 5T0MA 3M56A 4J8OA 2G46A 4Z4PA 5CCMA 2RFIA 5KJKA 4QENA 2W5YA 1MT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDG A;  3M53 A;  5AYF A;  1MVX A;  5T0K A;  3M57 A;  5HQ8 A;  3PDN A;  3KMA A;  4O30 A;  4JDS A;  1MVH A;  3F9X A;  3MO5 A;  5EG2 A;  2W5Z A;  5LSX A;  5KJN A;  3N71 A;  3SW9 A;  5F6L A;  3KMJ A;  5JIY A;  2IGQ A;  3KMT A;  3F9Z A;  3K5K A;  4YPA A;  3CBP A;  4QEO A;  3F9Y A;  4AU7 A;  3M59 A;  3OXL A;  5CPR B;  4IJ8 A;  3VV0 A;  5CCL A;  3S7B A;  4YND A;  2O8J A;  3OXG A;  5KJM A;  3MO0 A;  4WUY A;  4FMU A;  1XQH A;  3HNA A;  5ARG A;  5TTF A;  3S7D A;  3QWV A;  5EX3 A;  1PEG A;  5F59 A;  5KJL A;  3VUZ A;  4NVQ A;  2F69 A;  3M5A A;  4JLG A;  5JHN A;  2R3A A;  4BUP A;  3RU0 A;  1N6C A;  4J7I A;  3S7F A;  4C1Q A;  4YPU A;  5F6K C;  3M58 A;  4YNM A;  3OOI A;  1N6A A;  4YPE A;  4O6F A;  4IJD A;  3OXF A;  3M55 A;  4NJ5 A;  3OS5 A;  4QEP A;  4H12 A;  5JIN A;  4RZ0 A;  3RQ4 A;  2BQZ A;  3FPD A;  5JJ0 A;  4MI5 A;  5F5E A;  3M54 A;  1N3J A;  3QWW A;  4YNP A;  2QPW A;  3MO2 A;  3RJW A;  5LSZ A;  3DAL A;  1MUF A;  3EP0 A;  5T5G A;  5TEG A;  3RAY A;  3TG5 A;  5HI7 A;  3S7J A;  3OPE A;  3TG4 A;  3DB5 A;  3SWC A;  3BO5 A;  3IHX A;  3QWP A;  5ARF A;  3CBO A;  4E47 A;  5EX0 A;  4J83 A;  3S8P A;  3RIB A;  3F9W A;  2JV0 A;  3MEK A;  4J7F A;  1ML9 A;  3CBM A;  4I51 A;  1ZKK A;  1O9S A;  1H3I A;  4MI0 A;  5TH7 A;  5T0M A;  3M56 A;  4J8O A;  2G46 A;  4Z4P A;  5CCM A;  2RFI A;  5KJK A;  4QEN A;  2W5Y A;  1MT6 A; 
#chains in the Genus database with same CATH topology
 4LDG A;  3M53 A;  5AYF A;  1MVX A;  5T0K A;  3M57 A;  5HQ8 A;  3PDN A;  3KMA A;  4O30 A;  4JDS A;  1MVH A;  3F9X A;  3MO5 A;  5EG2 A;  2W5Z A;  5LSX A;  5KJN A;  3N71 A;  3SW9 A;  5F6L A;  3KMJ A;  5JIY A;  2IGQ A;  3KMT A;  3F9Z A;  3K5K A;  4YPA A;  3CBP A;  4QEO A;  3F9Y A;  4AU7 A;  3M59 A;  3OXL A;  5CPR B;  4IJ8 A;  3VV0 A;  5CCL A;  3S7B A;  4YND A;  2O8J A;  3OXG A;  5KJM A;  3MO0 A;  4WUY A;  4FMU A;  1XQH A;  3HNA A;  5ARG A;  5TTF A;  3S7D A;  3QWV A;  5EX3 A;  1PEG A;  5F59 A;  5KJL A;  3VUZ A;  4NVQ A;  2F69 A;  3M5A A;  4JLG A;  5JHN A;  2R3A A;  4BUP A;  3RU0 A;  1N6C A;  4J7I A;  3S7F A;  4C1Q A;  4YPU A;  5F6K C;  3M58 A;  4YNM A;  3OOI A;  1N6A A;  4YPE A;  4O6F A;  4IJD A;  3OXF A;  3M55 A;  4NJ5 A;  3OS5 A;  4QEP A;  4H12 A;  5JIN A;  4RZ0 A;  3RQ4 A;  2BQZ A;  3FPD A;  5JJ0 A;  4MI5 A;  5F5E A;  3M54 A;  1N3J A;  3QWW A;  4YNP A;  2QPW A;  3MO2 A;  3RJW A;  5LSZ A;  3DAL A;  1MUF A;  3EP0 A;  5T5G A;  5TEG A;  3RAY A;  3TG5 A;  5HI7 A;  3S7J A;  3OPE A;  3TG4 A;  3DB5 A;  3SWC A;  3BO5 A;  3IHX A;  3QWP A;  5ARF A;  3CBO A;  4E47 A;  5EX0 A;  4J83 A;  3S8P A;  3RIB A;  3F9W A;  2JV0 A;  3MEK A;  4J7F A;  1ML9 A;  3CBM A;  4I51 A;  1ZKK A;  1O9S A;  1H3I A;  4MI0 A;  5TH7 A;  5T0M A;  3M56 A;  4J8O A;  2G46 A;  4Z4P A;  5CCM A;  2RFI A;  5KJK A;  4QEN A;  2W5Y A;  1MT6 A; 
#chains in the Genus database with same CATH homology
 4LDG A;  3M53 A;  5AYF A;  1MVX A;  5T0K A;  3M57 A;  5HQ8 A;  3PDN A;  3KMA A;  4O30 A;  4JDS A;  1MVH A;  3F9X A;  3MO5 A;  5EG2 A;  2W5Z A;  5LSX A;  5KJN A;  3N71 A;  3SW9 A;  5F6L A;  3KMJ A;  5JIY A;  2IGQ A;  3KMT A;  3F9Z A;  3K5K A;  4YPA A;  3CBP A;  4QEO A;  3F9Y A;  4AU7 A;  3M59 A;  3OXL A;  5CPR B;  4IJ8 A;  3VV0 A;  5CCL A;  3S7B A;  4YND A;  2O8J A;  3OXG A;  5KJM A;  3MO0 A;  4WUY A;  4FMU A;  1XQH A;  3HNA A;  5ARG A;  5TTF A;  3S7D A;  3QWV A;  5EX3 A;  1PEG A;  5F59 A;  5KJL A;  3VUZ A;  4NVQ A;  2F69 A;  3M5A A;  4JLG A;  5JHN A;  2R3A A;  4BUP A;  3RU0 A;  1N6C A;  4J7I A;  3S7F A;  4C1Q A;  4YPU A;  5F6K C;  3M58 A;  4YNM A;  3OOI A;  1N6A A;  4YPE A;  4O6F A;  4IJD A;  3OXF A;  3M55 A;  4NJ5 A;  3OS5 A;  4QEP A;  4H12 A;  5JIN A;  4RZ0 A;  3RQ4 A;  2BQZ A;  3FPD A;  5JJ0 A;  4MI5 A;  5F5E A;  3M54 A;  1N3J A;  3QWW A;  4YNP A;  2QPW A;  3MO2 A;  3RJW A;  5LSZ A;  3DAL A;  1MUF A;  3EP0 A;  5T5G A;  5TEG A;  3RAY A;  3TG5 A;  5HI7 A;  3S7J A;  3OPE A;  3TG4 A;  3DB5 A;  3SWC A;  3BO5 A;  3IHX A;  3QWP A;  5ARF A;  3CBO A;  4E47 A;  5EX0 A;  4J83 A;  3S8P A;  3RIB A;  3F9W A;  2JV0 A;  3MEK A;  4J7F A;  1ML9 A;  3CBM A;  4I51 A;  1ZKK A;  1O9S A;  1H3I A;  4MI0 A;  5TH7 A;  5T0M A;  3M56 A;  4J8O A;  2G46 A;  4Z4P A;  5CCM A;  2RFI A;  5KJK A;  4QEN A;  2W5Y A;  1MT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...