5F5EA

The crystal structure of mll1 set domain with n3816i/q3867l mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
148
Chain Sequence
LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase 2A
total genus 40
structure length 148
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f5eA00
4E47A 5AYFA 4J83A 4NVQA 4IJ8A 3DB5A 1H3IA 3QWPA 5KJLA 2RFIA 4RZ0A 4J7IA 4YNDA 3OXFA 4AU7A 3OS5A 4YNMA 3S7FA 3HNAA 4YPEA 3TG4A 3KMJA 3S7DA 3TG5A 4QENA 2QPWA 5KJKA 1MUFA 3QWVA 1O9SA 3M53A 1MVHA 3CBOA 5F59A 3SW9A 3RU0A 1N6AA 3VV0A 5F6KC 4C1QA 5EX0A 2W5ZA 5T5GA 2F69A 1ZKKA 4BUPA 5LSXA 4LDGA 3OPEA 5KJNA 3RIBA 3OXLA 4JLGA 4NJ5A 3MEKA 3OOIA 4WUYA 3KMAA 2BQZA 4JDSA 4O6FA 3MO0A 1XQHA 4IJDA 3K5KA 3BO5A 5EX3A 4H12A 5JHNA 5HQ8A 3S8PA 4QEPA 5ARGA 3DALA 5CPRB 3M55A 5CCMA 3FPDA 4YPAA 3S7BA 3M56A 2R3AA 3CBPA 4J7FA 3RJWA 4I51A 3RAYA 3PDNA 3S7JA 5JIYA 4QEOA 3F9ZA 3M5AA 3N71A 5T0MA 4MI5A 4YPUA 3VUZA 5T0KA 3IHXA 5LSZA 1ML9A 2IGQA 3F9YA 4Z4PA 3SWCA 4J8OA 5TTFA 5EG2A 5F6LA 3CBMA 5TEGA 3M54A 5JINA 3EP0A 4YNPA 5JJ0A 2O8JA 3RQ4A 1PEGA 4MI0A 3KMTA 3M58A 3OXGA 3M59A 1MT6A 5HI7A 3MO5A 2JV0A 4O30A 2W5YA 1N3JA 2G46A 3MO2A 5CCLA 5F5EA 5TH7A 3M57A 3QWWA 5ARFA 1MVXA 3F9WA 3F9XA 1N6CA 4FMUA 5KJMA
chains in the Genus database with same CATH superfamily
4E47A 5AYFA 4J83A 4NVQA 4IJ8A 3DB5A 1H3IA 3QWPA 5KJLA 2RFIA 4RZ0A 4J7IA 4YNDA 3OXFA 4AU7A 3OS5A 4YNMA 3S7FA 3HNAA 4YPEA 3TG4A 3KMJA 3S7DA 3TG5A 4QENA 2QPWA 5KJKA 1MUFA 3QWVA 1O9SA 3M53A 1MVHA 3CBOA 5F59A 3SW9A 3RU0A 1N6AA 3VV0A 5F6KC 4C1QA 5EX0A 2W5ZA 5T5GA 2F69A 1ZKKA 4BUPA 5LSXA 4LDGA 3OPEA 5KJNA 3RIBA 3OXLA 4JLGA 4NJ5A 3MEKA 3OOIA 4WUYA 3KMAA 2BQZA 4JDSA 4O6FA 3MO0A 1XQHA 4IJDA 3K5KA 3BO5A 5EX3A 4H12A 5JHNA 5HQ8A 3S8PA 4QEPA 5ARGA 3DALA 5CPRB 3M55A 5CCMA 3FPDA 4YPAA 3S7BA 3M56A 2R3AA 3CBPA 4J7FA 3RJWA 4I51A 3RAYA 3PDNA 3S7JA 5JIYA 4QEOA 3F9ZA 3M5AA 3N71A 5T0MA 4MI5A 4YPUA 3VUZA 5T0KA 3IHXA 5LSZA 1ML9A 2IGQA 3F9YA 4Z4PA 3SWCA 4J8OA 5TTFA 5EG2A 5F6LA 3CBMA 5TEGA 3M54A 5JINA 3EP0A 4YNPA 5JJ0A 2O8JA 3RQ4A 1PEGA 4MI0A 3KMTA 3M58A 3OXGA 3M59A 1MT6A 5HI7A 3MO5A 2JV0A 4O30A 2W5YA 1N3JA 2G46A 3MO2A 5CCLA 5F5EA 5TH7A 3M57A 3QWWA 5ARFA 1MVXA 3F9WA 3F9XA 1N6CA 4FMUA 5KJMA
chains in the Genus database with same CATH topology
4E47A 5AYFA 4J83A 4NVQA 4IJ8A 3DB5A 1H3IA 3QWPA 5KJLA 2RFIA 4RZ0A 4J7IA 4YNDA 3OXFA 4AU7A 3OS5A 4YNMA 3S7FA 3HNAA 4YPEA 3TG4A 3KMJA 3S7DA 3TG5A 4QENA 2QPWA 5KJKA 1MUFA 3QWVA 1O9SA 3M53A 1MVHA 3CBOA 5F59A 3SW9A 3RU0A 1N6AA 3VV0A 5F6KC 4C1QA 5EX0A 2W5ZA 5T5GA 2F69A 1ZKKA 4BUPA 5LSXA 4LDGA 3OPEA 5KJNA 3RIBA 3OXLA 4JLGA 4NJ5A 3MEKA 3OOIA 4WUYA 3KMAA 2BQZA 4JDSA 4O6FA 3MO0A 1XQHA 4IJDA 3K5KA 3BO5A 5EX3A 4H12A 5JHNA 5HQ8A 3S8PA 4QEPA 5ARGA 3DALA 5CPRB 3M55A 5CCMA 3FPDA 4YPAA 3S7BA 3M56A 2R3AA 3CBPA 4J7FA 3RJWA 4I51A 3RAYA 3PDNA 3S7JA 5JIYA 4QEOA 3F9ZA 3M5AA 3N71A 5T0MA 4MI5A 4YPUA 3VUZA 5T0KA 3IHXA 5LSZA 1ML9A 2IGQA 3F9YA 4Z4PA 3SWCA 4J8OA 5TTFA 5EG2A 5F6LA 3CBMA 5TEGA 3M54A 5JINA 3EP0A 4YNPA 5JJ0A 2O8JA 3RQ4A 1PEGA 4MI0A 3KMTA 3M58A 3OXGA 3M59A 1MT6A 5HI7A 3MO5A 2JV0A 4O30A 2W5YA 1N3JA 2G46A 3MO2A 5CCLA 5F5EA 5TH7A 3M57A 3QWWA 5ARFA 1MVXA 3F9WA 3F9XA 1N6CA 4FMUA 5KJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E47 A;  5AYF A;  4J83 A;  4NVQ A;  4IJ8 A;  3DB5 A;  1H3I A;  3QWP A;  5KJL A;  2RFI A;  4RZ0 A;  4J7I A;  4YND A;  3OXF A;  4AU7 A;  3OS5 A;  4YNM A;  3S7F A;  3HNA A;  4YPE A;  3TG4 A;  3KMJ A;  3S7D A;  3TG5 A;  4QEN A;  2QPW A;  5KJK A;  1MUF A;  3QWV A;  1O9S A;  3M53 A;  1MVH A;  3CBO A;  5F59 A;  3SW9 A;  3RU0 A;  1N6A A;  3VV0 A;  5F6K C;  4C1Q A;  5EX0 A;  2W5Z A;  5T5G A;  2F69 A;  1ZKK A;  4BUP A;  5LSX A;  4LDG A;  3OPE A;  5KJN A;  3RIB A;  3OXL A;  4JLG A;  4NJ5 A;  3MEK A;  3OOI A;  4WUY A;  3KMA A;  2BQZ A;  4JDS A;  4O6F A;  3MO0 A;  1XQH A;  4IJD A;  3K5K A;  3BO5 A;  5EX3 A;  4H12 A;  5JHN A;  5HQ8 A;  3S8P A;  4QEP A;  5ARG A;  3DAL A;  5CPR B;  3M55 A;  5CCM A;  3FPD A;  4YPA A;  3S7B A;  3M56 A;  2R3A A;  3CBP A;  4J7F A;  3RJW A;  4I51 A;  3RAY A;  3PDN A;  3S7J A;  5JIY A;  4QEO A;  3F9Z A;  3M5A A;  3N71 A;  5T0M A;  4MI5 A;  4YPU A;  3VUZ A;  5T0K A;  3IHX A;  5LSZ A;  1ML9 A;  2IGQ A;  3F9Y A;  4Z4P A;  3SWC A;  4J8O A;  5TTF A;  5EG2 A;  5F6L A;  3CBM A;  5TEG A;  3M54 A;  5JIN A;  3EP0 A;  4YNP A;  5JJ0 A;  2O8J A;  3RQ4 A;  1PEG A;  4MI0 A;  3KMT A;  3M58 A;  3OXG A;  3M59 A;  1MT6 A;  5HI7 A;  3MO5 A;  2JV0 A;  4O30 A;  2W5Y A;  1N3J A;  2G46 A;  3MO2 A;  5CCL A;  5F5E A;  5TH7 A;  3M57 A;  3QWW A;  5ARF A;  1MVX A;  3F9W A;  3F9X A;  1N6C A;  4FMU A;  5KJM A; 
#chains in the Genus database with same CATH topology
 4E47 A;  5AYF A;  4J83 A;  4NVQ A;  4IJ8 A;  3DB5 A;  1H3I A;  3QWP A;  5KJL A;  2RFI A;  4RZ0 A;  4J7I A;  4YND A;  3OXF A;  4AU7 A;  3OS5 A;  4YNM A;  3S7F A;  3HNA A;  4YPE A;  3TG4 A;  3KMJ A;  3S7D A;  3TG5 A;  4QEN A;  2QPW A;  5KJK A;  1MUF A;  3QWV A;  1O9S A;  3M53 A;  1MVH A;  3CBO A;  5F59 A;  3SW9 A;  3RU0 A;  1N6A A;  3VV0 A;  5F6K C;  4C1Q A;  5EX0 A;  2W5Z A;  5T5G A;  2F69 A;  1ZKK A;  4BUP A;  5LSX A;  4LDG A;  3OPE A;  5KJN A;  3RIB A;  3OXL A;  4JLG A;  4NJ5 A;  3MEK A;  3OOI A;  4WUY A;  3KMA A;  2BQZ A;  4JDS A;  4O6F A;  3MO0 A;  1XQH A;  4IJD A;  3K5K A;  3BO5 A;  5EX3 A;  4H12 A;  5JHN A;  5HQ8 A;  3S8P A;  4QEP A;  5ARG A;  3DAL A;  5CPR B;  3M55 A;  5CCM A;  3FPD A;  4YPA A;  3S7B A;  3M56 A;  2R3A A;  3CBP A;  4J7F A;  3RJW A;  4I51 A;  3RAY A;  3PDN A;  3S7J A;  5JIY A;  4QEO A;  3F9Z A;  3M5A A;  3N71 A;  5T0M A;  4MI5 A;  4YPU A;  3VUZ A;  5T0K A;  3IHX A;  5LSZ A;  1ML9 A;  2IGQ A;  3F9Y A;  4Z4P A;  3SWC A;  4J8O A;  5TTF A;  5EG2 A;  5F6L A;  3CBM A;  5TEG A;  3M54 A;  5JIN A;  3EP0 A;  4YNP A;  5JJ0 A;  2O8J A;  3RQ4 A;  1PEG A;  4MI0 A;  3KMT A;  3M58 A;  3OXG A;  3M59 A;  1MT6 A;  5HI7 A;  3MO5 A;  2JV0 A;  4O30 A;  2W5Y A;  1N3J A;  2G46 A;  3MO2 A;  5CCL A;  5F5E A;  5TH7 A;  3M57 A;  3QWW A;  5ARF A;  1MVX A;  3F9W A;  3F9X A;  1N6C A;  4FMU A;  5KJM A; 
#chains in the Genus database with same CATH homology
 4E47 A;  5AYF A;  4J83 A;  4NVQ A;  4IJ8 A;  3DB5 A;  1H3I A;  3QWP A;  5KJL A;  2RFI A;  4RZ0 A;  4J7I A;  4YND A;  3OXF A;  4AU7 A;  3OS5 A;  4YNM A;  3S7F A;  3HNA A;  4YPE A;  3TG4 A;  3KMJ A;  3S7D A;  3TG5 A;  4QEN A;  2QPW A;  5KJK A;  1MUF A;  3QWV A;  1O9S A;  3M53 A;  1MVH A;  3CBO A;  5F59 A;  3SW9 A;  3RU0 A;  1N6A A;  3VV0 A;  5F6K C;  4C1Q A;  5EX0 A;  2W5Z A;  5T5G A;  2F69 A;  1ZKK A;  4BUP A;  5LSX A;  4LDG A;  3OPE A;  5KJN A;  3RIB A;  3OXL A;  4JLG A;  4NJ5 A;  3MEK A;  3OOI A;  4WUY A;  3KMA A;  2BQZ A;  4JDS A;  4O6F A;  3MO0 A;  1XQH A;  4IJD A;  3K5K A;  3BO5 A;  5EX3 A;  4H12 A;  5JHN A;  5HQ8 A;  3S8P A;  4QEP A;  5ARG A;  3DAL A;  5CPR B;  3M55 A;  5CCM A;  3FPD A;  4YPA A;  3S7B A;  3M56 A;  2R3A A;  3CBP A;  4J7F A;  3RJW A;  4I51 A;  3RAY A;  3PDN A;  3S7J A;  5JIY A;  4QEO A;  3F9Z A;  3M5A A;  3N71 A;  5T0M A;  4MI5 A;  4YPU A;  3VUZ A;  5T0K A;  3IHX A;  5LSZ A;  1ML9 A;  2IGQ A;  3F9Y A;  4Z4P A;  3SWC A;  4J8O A;  5TTF A;  5EG2 A;  5F6L A;  3CBM A;  5TEG A;  3M54 A;  5JIN A;  3EP0 A;  4YNP A;  5JJ0 A;  2O8J A;  3RQ4 A;  1PEG A;  4MI0 A;  3KMT A;  3M58 A;  3OXG A;  3M59 A;  1MT6 A;  5HI7 A;  3MO5 A;  2JV0 A;  4O30 A;  2W5Y A;  1N3J A;  2G46 A;  3MO2 A;  5CCL A;  5F5E A;  5TH7 A;  3M57 A;  3QWW A;  5ARF A;  1MVX A;  3F9W A;  3F9X A;  1N6C A;  4FMU A;  5KJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...