5F5EA

The crystal structure of mll1 set domain with n3816i/q3867l mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
148
Chain Sequence
b'LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKKLPCNCGAKKCRKFLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase 2A
molecule tags Transferase
source organism Homo sapiens
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
total genus 40
structure length 148
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f5eA00
3F9WA 5TTFA 5HI7A 2JV0A 5EX3A 5AYFA 3RIBA 4IJ8A 3F9XA 4QENA 4I51A 1N3JA 2RFIA 4MI0A 4YPAA 5T5GA 3OOIA 4NJ5A 3QWPA 3KMAA 3RJWA 4BUPA 5EX0A 3M54A 5T0MA 4J83A 3TG4A 1ZKKA 3KMJA 1O9SA 4JLGA 3EP0A 4QEOA 2O8JA 3S7DA 4YPEA 2QPWA 3M57A 2W5YA 3OS5A 4IJDA 3S7FA 3M59A 3N71A 2G46A 1PEGA 3VUZA 1XQHA 3CBPA 4H12A 3S7BA 5CCMA 5F59A 3M55A 5JJ0A 3M53A 4NVQA 5JINA 3KMTA 4C1QA 4Z4PA 4RZ0A 3RQ4A 5KJNA 3VV0A 2F69A 2R3AA 4J7FA 3DALA 3MO5A 3F9ZA 3PDNA 4QEPA 3M5AA 5T0KA 4FMUA 5KJMA 4YPUA 3BO5A 4JDSA 3M58A 3SW9A 1MUFA 4J8OA 5TH7A 3CBMA 1MVXA 5JIYA 4LDGA 3IHXA 5ARFA 3HNAA 2W5ZA 4O30A 3MEKA 5CPRB 3MO0A 2BQZA 3FPDA 3OXLA 4YNMA 5ARGA 5LSZA 3OXGA 4E47A 4YNPA 5KJKA 4MI5A 5HQ8A 3SWCA 4YNDA 5JHNA 3RAYA 5LSXA 3OPEA 3QWWA 5F5EA 1ML9A 5TEGA 5KJLA 4J7IA 3TG5A 4AU7A 2IGQA 3MO2A 3OXFA 3QWVA 5CCLA 3F9YA 4O6FA 3DB5A 5EG2A 5F6KC 3M56A 1N6CA 1MT6A 1H3IA 3K5KA 5F6LA 1MVHA 3S8PA 3CBOA 3RU0A 3S7JA 1N6AA 4WUYA
chains in the Genus database with same CATH superfamily
3F9WA 5TTFA 5HI7A 2JV0A 5EX3A 5AYFA 3RIBA 4IJ8A 3F9XA 4QENA 4I51A 1N3JA 2RFIA 4MI0A 4YPAA 5T5GA 3OOIA 4NJ5A 3QWPA 3KMAA 3RJWA 4BUPA 5EX0A 3M54A 5T0MA 4J83A 3TG4A 1ZKKA 3KMJA 1O9SA 4JLGA 3EP0A 4QEOA 2O8JA 3S7DA 4YPEA 2QPWA 3M57A 2W5YA 3OS5A 4IJDA 3S7FA 3M59A 3N71A 2G46A 1PEGA 3VUZA 1XQHA 3CBPA 4H12A 3S7BA 5CCMA 5F59A 3M55A 5JJ0A 3M53A 4NVQA 5JINA 3KMTA 4C1QA 4Z4PA 4RZ0A 3RQ4A 5KJNA 3VV0A 2F69A 2R3AA 4J7FA 3DALA 3MO5A 3F9ZA 3PDNA 4QEPA 3M5AA 5T0KA 4FMUA 5KJMA 4YPUA 3BO5A 4JDSA 3M58A 3SW9A 1MUFA 4J8OA 5TH7A 3CBMA 1MVXA 5JIYA 4LDGA 3IHXA 5ARFA 3HNAA 2W5ZA 4O30A 3MEKA 5CPRB 3MO0A 2BQZA 3FPDA 3OXLA 4YNMA 5ARGA 5LSZA 3OXGA 4E47A 4YNPA 5KJKA 4MI5A 5HQ8A 3SWCA 4YNDA 5JHNA 3RAYA 5LSXA 3OPEA 3QWWA 5F5EA 1ML9A 5TEGA 5KJLA 4J7IA 3TG5A 4AU7A 2IGQA 3MO2A 3OXFA 3QWVA 5CCLA 3F9YA 4O6FA 3DB5A 5EG2A 5F6KC 3M56A 1N6CA 1MT6A 1H3IA 3K5KA 5F6LA 1MVHA 3S8PA 3CBOA 3RU0A 3S7JA 1N6AA 4WUYA
chains in the Genus database with same CATH topology
3F9WA 5TTFA 5HI7A 2JV0A 5EX3A 5AYFA 3RIBA 4IJ8A 3F9XA 4QENA 4I51A 1N3JA 2RFIA 4MI0A 4YPAA 5T5GA 3OOIA 4NJ5A 3QWPA 3KMAA 3RJWA 4BUPA 5EX0A 3M54A 5T0MA 4J83A 3TG4A 1ZKKA 3KMJA 1O9SA 4JLGA 3EP0A 4QEOA 2O8JA 3S7DA 4YPEA 2QPWA 3M57A 2W5YA 3OS5A 4IJDA 3S7FA 3M59A 3N71A 2G46A 1PEGA 3VUZA 1XQHA 3CBPA 4H12A 3S7BA 5CCMA 5F59A 3M55A 5JJ0A 3M53A 4NVQA 5JINA 3KMTA 4C1QA 4Z4PA 4RZ0A 3RQ4A 5KJNA 3VV0A 2F69A 2R3AA 4J7FA 3DALA 3MO5A 3F9ZA 3PDNA 4QEPA 3M5AA 5T0KA 4FMUA 5KJMA 4YPUA 3BO5A 4JDSA 3M58A 3SW9A 1MUFA 4J8OA 5TH7A 3CBMA 1MVXA 5JIYA 4LDGA 3IHXA 5ARFA 3HNAA 2W5ZA 4O30A 3MEKA 5CPRB 3MO0A 2BQZA 3FPDA 3OXLA 4YNMA 5ARGA 5LSZA 3OXGA 4E47A 4YNPA 5KJKA 4MI5A 5HQ8A 3SWCA 4YNDA 5JHNA 3RAYA 5LSXA 3OPEA 3QWWA 5F5EA 1ML9A 5TEGA 5KJLA 4J7IA 3TG5A 4AU7A 2IGQA 3MO2A 3OXFA 3QWVA 5CCLA 3F9YA 4O6FA 3DB5A 5EG2A 5F6KC 3M56A 1N6CA 1MT6A 1H3IA 3K5KA 5F6LA 1MVHA 3S8PA 3CBOA 3RU0A 3S7JA 1N6AA 4WUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9W A;  5TTF A;  5HI7 A;  2JV0 A;  5EX3 A;  5AYF A;  3RIB A;  4IJ8 A;  3F9X A;  4QEN A;  4I51 A;  1N3J A;  2RFI A;  4MI0 A;  4YPA A;  5T5G A;  3OOI A;  4NJ5 A;  3QWP A;  3KMA A;  3RJW A;  4BUP A;  5EX0 A;  3M54 A;  5T0M A;  4J83 A;  3TG4 A;  1ZKK A;  3KMJ A;  1O9S A;  4JLG A;  3EP0 A;  4QEO A;  2O8J A;  3S7D A;  4YPE A;  2QPW A;  3M57 A;  2W5Y A;  3OS5 A;  4IJD A;  3S7F A;  3M59 A;  3N71 A;  2G46 A;  1PEG A;  3VUZ A;  1XQH A;  3CBP A;  4H12 A;  3S7B A;  5CCM A;  5F59 A;  3M55 A;  5JJ0 A;  3M53 A;  4NVQ A;  5JIN A;  3KMT A;  4C1Q A;  4Z4P A;  4RZ0 A;  3RQ4 A;  5KJN A;  3VV0 A;  2F69 A;  2R3A A;  4J7F A;  3DAL A;  3MO5 A;  3F9Z A;  3PDN A;  4QEP A;  3M5A A;  5T0K A;  4FMU A;  5KJM A;  4YPU A;  3BO5 A;  4JDS A;  3M58 A;  3SW9 A;  1MUF A;  4J8O A;  5TH7 A;  3CBM A;  1MVX A;  5JIY A;  4LDG A;  3IHX A;  5ARF A;  3HNA A;  2W5Z A;  4O30 A;  3MEK A;  5CPR B;  3MO0 A;  2BQZ A;  3FPD A;  3OXL A;  4YNM A;  5ARG A;  5LSZ A;  3OXG A;  4E47 A;  4YNP A;  5KJK A;  4MI5 A;  5HQ8 A;  3SWC A;  4YND A;  5JHN A;  3RAY A;  5LSX A;  3OPE A;  3QWW A;  5F5E A;  1ML9 A;  5TEG A;  5KJL A;  4J7I A;  3TG5 A;  4AU7 A;  2IGQ A;  3MO2 A;  3OXF A;  3QWV A;  5CCL A;  3F9Y A;  4O6F A;  3DB5 A;  5EG2 A;  5F6K C;  3M56 A;  1N6C A;  1MT6 A;  1H3I A;  3K5K A;  5F6L A;  1MVH A;  3S8P A;  3CBO A;  3RU0 A;  3S7J A;  1N6A A;  4WUY A; 
#chains in the Genus database with same CATH topology
 3F9W A;  5TTF A;  5HI7 A;  2JV0 A;  5EX3 A;  5AYF A;  3RIB A;  4IJ8 A;  3F9X A;  4QEN A;  4I51 A;  1N3J A;  2RFI A;  4MI0 A;  4YPA A;  5T5G A;  3OOI A;  4NJ5 A;  3QWP A;  3KMA A;  3RJW A;  4BUP A;  5EX0 A;  3M54 A;  5T0M A;  4J83 A;  3TG4 A;  1ZKK A;  3KMJ A;  1O9S A;  4JLG A;  3EP0 A;  4QEO A;  2O8J A;  3S7D A;  4YPE A;  2QPW A;  3M57 A;  2W5Y A;  3OS5 A;  4IJD A;  3S7F A;  3M59 A;  3N71 A;  2G46 A;  1PEG A;  3VUZ A;  1XQH A;  3CBP A;  4H12 A;  3S7B A;  5CCM A;  5F59 A;  3M55 A;  5JJ0 A;  3M53 A;  4NVQ A;  5JIN A;  3KMT A;  4C1Q A;  4Z4P A;  4RZ0 A;  3RQ4 A;  5KJN A;  3VV0 A;  2F69 A;  2R3A A;  4J7F A;  3DAL A;  3MO5 A;  3F9Z A;  3PDN A;  4QEP A;  3M5A A;  5T0K A;  4FMU A;  5KJM A;  4YPU A;  3BO5 A;  4JDS A;  3M58 A;  3SW9 A;  1MUF A;  4J8O A;  5TH7 A;  3CBM A;  1MVX A;  5JIY A;  4LDG A;  3IHX A;  5ARF A;  3HNA A;  2W5Z A;  4O30 A;  3MEK A;  5CPR B;  3MO0 A;  2BQZ A;  3FPD A;  3OXL A;  4YNM A;  5ARG A;  5LSZ A;  3OXG A;  4E47 A;  4YNP A;  5KJK A;  4MI5 A;  5HQ8 A;  3SWC A;  4YND A;  5JHN A;  3RAY A;  5LSX A;  3OPE A;  3QWW A;  5F5E A;  1ML9 A;  5TEG A;  5KJL A;  4J7I A;  3TG5 A;  4AU7 A;  2IGQ A;  3MO2 A;  3OXF A;  3QWV A;  5CCL A;  3F9Y A;  4O6F A;  3DB5 A;  5EG2 A;  5F6K C;  3M56 A;  1N6C A;  1MT6 A;  1H3I A;  3K5K A;  5F6L A;  1MVH A;  3S8P A;  3CBO A;  3RU0 A;  3S7J A;  1N6A A;  4WUY A; 
#chains in the Genus database with same CATH homology
 3F9W A;  5TTF A;  5HI7 A;  2JV0 A;  5EX3 A;  5AYF A;  3RIB A;  4IJ8 A;  3F9X A;  4QEN A;  4I51 A;  1N3J A;  2RFI A;  4MI0 A;  4YPA A;  5T5G A;  3OOI A;  4NJ5 A;  3QWP A;  3KMA A;  3RJW A;  4BUP A;  5EX0 A;  3M54 A;  5T0M A;  4J83 A;  3TG4 A;  1ZKK A;  3KMJ A;  1O9S A;  4JLG A;  3EP0 A;  4QEO A;  2O8J A;  3S7D A;  4YPE A;  2QPW A;  3M57 A;  2W5Y A;  3OS5 A;  4IJD A;  3S7F A;  3M59 A;  3N71 A;  2G46 A;  1PEG A;  3VUZ A;  1XQH A;  3CBP A;  4H12 A;  3S7B A;  5CCM A;  5F59 A;  3M55 A;  5JJ0 A;  3M53 A;  4NVQ A;  5JIN A;  3KMT A;  4C1Q A;  4Z4P A;  4RZ0 A;  3RQ4 A;  5KJN A;  3VV0 A;  2F69 A;  2R3A A;  4J7F A;  3DAL A;  3MO5 A;  3F9Z A;  3PDN A;  4QEP A;  3M5A A;  5T0K A;  4FMU A;  5KJM A;  4YPU A;  3BO5 A;  4JDS A;  3M58 A;  3SW9 A;  1MUF A;  4J8O A;  5TH7 A;  3CBM A;  1MVX A;  5JIY A;  4LDG A;  3IHX A;  5ARF A;  3HNA A;  2W5Z A;  4O30 A;  3MEK A;  5CPR B;  3MO0 A;  2BQZ A;  3FPD A;  3OXL A;  4YNM A;  5ARG A;  5LSZ A;  3OXG A;  4E47 A;  4YNP A;  5KJK A;  4MI5 A;  5HQ8 A;  3SWC A;  4YND A;  5JHN A;  3RAY A;  5LSX A;  3OPE A;  3QWW A;  5F5E A;  1ML9 A;  5TEG A;  5KJL A;  4J7I A;  3TG5 A;  4AU7 A;  2IGQ A;  3MO2 A;  3OXF A;  3QWV A;  5CCL A;  3F9Y A;  4O6F A;  3DB5 A;  5EG2 A;  5F6K C;  3M56 A;  1N6C A;  1MT6 A;  1H3I A;  3K5K A;  5F6L A;  1MVH A;  3S8P A;  3CBO A;  3RU0 A;  3S7J A;  1N6A A;  4WUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...