5F5EA

The crystal structure of mll1 set domain with n3816i/q3867l mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
148
Chain Sequence
b'LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKKLPCNCGAKKCRKFLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase 2A
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 148
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f5eA00
3DB5A 5KJMA 3EP0A 3F9YA 5JIYA 5LSZA 4NVQA 5KJKA 5T5GA 1MVHA 5KJNA 1ZKKA 4YNMA 3DALA 3KMAA 4Z4PA 3TG5A 3S7DA 3VUZA 3RIBA 4JDSA 4YPEA 3S7JA 3KMTA 3F9XA 5ARGA 2BQZA 3M53A 4YNDA 4AU7A 5EX0A 2W5ZA 3CBPA 5LSXA 3KMJA 4WUYA 4IJDA 2F69A 1MT6A 2RFIA 5JINA 4YPUA 3TG4A 3VV0A 3F9ZA 5F5EA 4BUPA 5F6KC 3OOIA 2R3AA 4FMUA 1ML9A 5EG2A 3QWPA 1XQHA 4J7FA 5JHNA 4YNPA 5CCLA 4MI0A 3CBOA 1O9SA 3M59A 3F9WA 5TEGA 4RZ0A 3SW9A 4QEPA 4QENA 4J83A 5ARFA 3M58A 2O8JA 5F59A 5AYFA 3SWCA 5TTFA 4IJ8A 3M5AA 5T0KA 3M54A 1N6AA 3RJWA 3S7BA 3M56A 5F6LA 4H12A 3M57A 2JV0A 1N6CA 1MUFA 4LDGA 3RU0A 4J7IA 5TH7A 3FPDA 3PDNA 4E47A 4C1QA 4MI5A 4I51A 3N71A 1N3JA 5T0MA 3QWWA 3MEKA 5HQ8A 4J8OA 3IHXA 1PEGA 3S8PA 3HNAA 4YPAA 2G46A 4O30A 3RQ4A 5CPRB 3S7FA 5KJLA 3OXLA 3MO0A 3M55A 5EX3A 4QEOA 3QWVA 3OS5A 4JLGA 3K5KA 3CBMA 3OXFA 5JJ0A 3RAYA 5HI7A 1H3IA 2QPWA 3OXGA 3BO5A 1MVXA 2IGQA 5CCMA 4O6FA 3MO2A 2W5YA 4NJ5A 3MO5A 3OPEA
chains in the Genus database with same CATH superfamily
3DB5A 5KJMA 3EP0A 3F9YA 5JIYA 5LSZA 4NVQA 5KJKA 5T5GA 1MVHA 5KJNA 1ZKKA 4YNMA 3DALA 3KMAA 4Z4PA 3TG5A 3S7DA 3VUZA 3RIBA 4JDSA 4YPEA 3S7JA 3KMTA 3F9XA 5ARGA 2BQZA 3M53A 4YNDA 4AU7A 5EX0A 2W5ZA 3CBPA 5LSXA 3KMJA 4WUYA 4IJDA 2F69A 1MT6A 2RFIA 5JINA 4YPUA 3TG4A 3VV0A 3F9ZA 5F5EA 4BUPA 5F6KC 3OOIA 2R3AA 4FMUA 1ML9A 5EG2A 3QWPA 1XQHA 4J7FA 5JHNA 4YNPA 5CCLA 4MI0A 3CBOA 1O9SA 3M59A 3F9WA 5TEGA 4RZ0A 3SW9A 4QEPA 4QENA 4J83A 5ARFA 3M58A 2O8JA 5F59A 5AYFA 3SWCA 5TTFA 4IJ8A 3M5AA 5T0KA 3M54A 1N6AA 3RJWA 3S7BA 3M56A 5F6LA 4H12A 3M57A 2JV0A 1N6CA 1MUFA 4LDGA 3RU0A 4J7IA 5TH7A 3FPDA 3PDNA 4E47A 4C1QA 4MI5A 4I51A 3N71A 1N3JA 5T0MA 3QWWA 3MEKA 5HQ8A 4J8OA 3IHXA 1PEGA 3S8PA 3HNAA 4YPAA 2G46A 4O30A 3RQ4A 5CPRB 3S7FA 5KJLA 3OXLA 3MO0A 3M55A 5EX3A 4QEOA 3QWVA 3OS5A 4JLGA 3K5KA 3CBMA 3OXFA 5JJ0A 3RAYA 5HI7A 1H3IA 2QPWA 3OXGA 3BO5A 1MVXA 2IGQA 5CCMA 4O6FA 3MO2A 2W5YA 4NJ5A 3MO5A 3OPEA
chains in the Genus database with same CATH topology
3DB5A 5KJMA 3EP0A 3F9YA 5JIYA 5LSZA 4NVQA 5KJKA 5T5GA 1MVHA 5KJNA 1ZKKA 4YNMA 3DALA 3KMAA 4Z4PA 3TG5A 3S7DA 3VUZA 3RIBA 4JDSA 4YPEA 3S7JA 3KMTA 3F9XA 5ARGA 2BQZA 3M53A 4YNDA 4AU7A 5EX0A 2W5ZA 3CBPA 5LSXA 3KMJA 4WUYA 4IJDA 2F69A 1MT6A 2RFIA 5JINA 4YPUA 3TG4A 3VV0A 3F9ZA 5F5EA 4BUPA 5F6KC 3OOIA 2R3AA 4FMUA 1ML9A 5EG2A 3QWPA 1XQHA 4J7FA 5JHNA 4YNPA 5CCLA 4MI0A 3CBOA 1O9SA 3M59A 3F9WA 5TEGA 4RZ0A 3SW9A 4QEPA 4QENA 4J83A 5ARFA 3M58A 2O8JA 5F59A 5AYFA 3SWCA 5TTFA 4IJ8A 3M5AA 5T0KA 3M54A 1N6AA 3RJWA 3S7BA 3M56A 5F6LA 4H12A 3M57A 2JV0A 1N6CA 1MUFA 4LDGA 3RU0A 4J7IA 5TH7A 3FPDA 3PDNA 4E47A 4C1QA 4MI5A 4I51A 3N71A 1N3JA 5T0MA 3QWWA 3MEKA 5HQ8A 4J8OA 3IHXA 1PEGA 3S8PA 3HNAA 4YPAA 2G46A 4O30A 3RQ4A 5CPRB 3S7FA 5KJLA 3OXLA 3MO0A 3M55A 5EX3A 4QEOA 3QWVA 3OS5A 4JLGA 3K5KA 3CBMA 3OXFA 5JJ0A 3RAYA 5HI7A 1H3IA 2QPWA 3OXGA 3BO5A 1MVXA 2IGQA 5CCMA 4O6FA 3MO2A 2W5YA 4NJ5A 3MO5A 3OPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB5 A;  5KJM A;  3EP0 A;  3F9Y A;  5JIY A;  5LSZ A;  4NVQ A;  5KJK A;  5T5G A;  1MVH A;  5KJN A;  1ZKK A;  4YNM A;  3DAL A;  3KMA A;  4Z4P A;  3TG5 A;  3S7D A;  3VUZ A;  3RIB A;  4JDS A;  4YPE A;  3S7J A;  3KMT A;  3F9X A;  5ARG A;  2BQZ A;  3M53 A;  4YND A;  4AU7 A;  5EX0 A;  2W5Z A;  3CBP A;  5LSX A;  3KMJ A;  4WUY A;  4IJD A;  2F69 A;  1MT6 A;  2RFI A;  5JIN A;  4YPU A;  3TG4 A;  3VV0 A;  3F9Z A;  5F5E A;  4BUP A;  5F6K C;  3OOI A;  2R3A A;  4FMU A;  1ML9 A;  5EG2 A;  3QWP A;  1XQH A;  4J7F A;  5JHN A;  4YNP A;  5CCL A;  4MI0 A;  3CBO A;  1O9S A;  3M59 A;  3F9W A;  5TEG A;  4RZ0 A;  3SW9 A;  4QEP A;  4QEN A;  4J83 A;  5ARF A;  3M58 A;  2O8J A;  5F59 A;  5AYF A;  3SWC A;  5TTF A;  4IJ8 A;  3M5A A;  5T0K A;  3M54 A;  1N6A A;  3RJW A;  3S7B A;  3M56 A;  5F6L A;  4H12 A;  3M57 A;  2JV0 A;  1N6C A;  1MUF A;  4LDG A;  3RU0 A;  4J7I A;  5TH7 A;  3FPD A;  3PDN A;  4E47 A;  4C1Q A;  4MI5 A;  4I51 A;  3N71 A;  1N3J A;  5T0M A;  3QWW A;  3MEK A;  5HQ8 A;  4J8O A;  3IHX A;  1PEG A;  3S8P A;  3HNA A;  4YPA A;  2G46 A;  4O30 A;  3RQ4 A;  5CPR B;  3S7F A;  5KJL A;  3OXL A;  3MO0 A;  3M55 A;  5EX3 A;  4QEO A;  3QWV A;  3OS5 A;  4JLG A;  3K5K A;  3CBM A;  3OXF A;  5JJ0 A;  3RAY A;  5HI7 A;  1H3I A;  2QPW A;  3OXG A;  3BO5 A;  1MVX A;  2IGQ A;  5CCM A;  4O6F A;  3MO2 A;  2W5Y A;  4NJ5 A;  3MO5 A;  3OPE A; 
#chains in the Genus database with same CATH topology
 3DB5 A;  5KJM A;  3EP0 A;  3F9Y A;  5JIY A;  5LSZ A;  4NVQ A;  5KJK A;  5T5G A;  1MVH A;  5KJN A;  1ZKK A;  4YNM A;  3DAL A;  3KMA A;  4Z4P A;  3TG5 A;  3S7D A;  3VUZ A;  3RIB A;  4JDS A;  4YPE A;  3S7J A;  3KMT A;  3F9X A;  5ARG A;  2BQZ A;  3M53 A;  4YND A;  4AU7 A;  5EX0 A;  2W5Z A;  3CBP A;  5LSX A;  3KMJ A;  4WUY A;  4IJD A;  2F69 A;  1MT6 A;  2RFI A;  5JIN A;  4YPU A;  3TG4 A;  3VV0 A;  3F9Z A;  5F5E A;  4BUP A;  5F6K C;  3OOI A;  2R3A A;  4FMU A;  1ML9 A;  5EG2 A;  3QWP A;  1XQH A;  4J7F A;  5JHN A;  4YNP A;  5CCL A;  4MI0 A;  3CBO A;  1O9S A;  3M59 A;  3F9W A;  5TEG A;  4RZ0 A;  3SW9 A;  4QEP A;  4QEN A;  4J83 A;  5ARF A;  3M58 A;  2O8J A;  5F59 A;  5AYF A;  3SWC A;  5TTF A;  4IJ8 A;  3M5A A;  5T0K A;  3M54 A;  1N6A A;  3RJW A;  3S7B A;  3M56 A;  5F6L A;  4H12 A;  3M57 A;  2JV0 A;  1N6C A;  1MUF A;  4LDG A;  3RU0 A;  4J7I A;  5TH7 A;  3FPD A;  3PDN A;  4E47 A;  4C1Q A;  4MI5 A;  4I51 A;  3N71 A;  1N3J A;  5T0M A;  3QWW A;  3MEK A;  5HQ8 A;  4J8O A;  3IHX A;  1PEG A;  3S8P A;  3HNA A;  4YPA A;  2G46 A;  4O30 A;  3RQ4 A;  5CPR B;  3S7F A;  5KJL A;  3OXL A;  3MO0 A;  3M55 A;  5EX3 A;  4QEO A;  3QWV A;  3OS5 A;  4JLG A;  3K5K A;  3CBM A;  3OXF A;  5JJ0 A;  3RAY A;  5HI7 A;  1H3I A;  2QPW A;  3OXG A;  3BO5 A;  1MVX A;  2IGQ A;  5CCM A;  4O6F A;  3MO2 A;  2W5Y A;  4NJ5 A;  3MO5 A;  3OPE A; 
#chains in the Genus database with same CATH homology
 3DB5 A;  5KJM A;  3EP0 A;  3F9Y A;  5JIY A;  5LSZ A;  4NVQ A;  5KJK A;  5T5G A;  1MVH A;  5KJN A;  1ZKK A;  4YNM A;  3DAL A;  3KMA A;  4Z4P A;  3TG5 A;  3S7D A;  3VUZ A;  3RIB A;  4JDS A;  4YPE A;  3S7J A;  3KMT A;  3F9X A;  5ARG A;  2BQZ A;  3M53 A;  4YND A;  4AU7 A;  5EX0 A;  2W5Z A;  3CBP A;  5LSX A;  3KMJ A;  4WUY A;  4IJD A;  2F69 A;  1MT6 A;  2RFI A;  5JIN A;  4YPU A;  3TG4 A;  3VV0 A;  3F9Z A;  5F5E A;  4BUP A;  5F6K C;  3OOI A;  2R3A A;  4FMU A;  1ML9 A;  5EG2 A;  3QWP A;  1XQH A;  4J7F A;  5JHN A;  4YNP A;  5CCL A;  4MI0 A;  3CBO A;  1O9S A;  3M59 A;  3F9W A;  5TEG A;  4RZ0 A;  3SW9 A;  4QEP A;  4QEN A;  4J83 A;  5ARF A;  3M58 A;  2O8J A;  5F59 A;  5AYF A;  3SWC A;  5TTF A;  4IJ8 A;  3M5A A;  5T0K A;  3M54 A;  1N6A A;  3RJW A;  3S7B A;  3M56 A;  5F6L A;  4H12 A;  3M57 A;  2JV0 A;  1N6C A;  1MUF A;  4LDG A;  3RU0 A;  4J7I A;  5TH7 A;  3FPD A;  3PDN A;  4E47 A;  4C1Q A;  4MI5 A;  4I51 A;  3N71 A;  1N3J A;  5T0M A;  3QWW A;  3MEK A;  5HQ8 A;  4J8O A;  3IHX A;  1PEG A;  3S8P A;  3HNA A;  4YPA A;  2G46 A;  4O30 A;  3RQ4 A;  5CPR B;  3S7F A;  5KJL A;  3OXL A;  3MO0 A;  3M55 A;  5EX3 A;  4QEO A;  3QWV A;  3OS5 A;  4JLG A;  3K5K A;  3CBM A;  3OXF A;  5JJ0 A;  3RAY A;  5HI7 A;  1H3I A;  2QPW A;  3OXG A;  3BO5 A;  1MVX A;  2IGQ A;  5CCM A;  4O6F A;  3MO2 A;  2W5Y A;  4NJ5 A;  3MO5 A;  3OPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...