5F5YA

Wt drosophila melanogaster cycle pas-b with bound ethylene glycol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title WT Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
molecule keywords Protein cycle
total genus 30
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f5yA00
4F3LA 2J80A 2R78A 3MFXA 4KUKA 1OTAA 2YKFA 3VE3A 1LSVA 4L9EA 1S4SA 2KX6A 1LSXA 5HWVA 1UGUA 2PYPA 3MJQA 5DKLA 3ULFA 1G28A 2L0WA 3CWFA 1XJ3A 2B02A 1XFNA 5J7EA 4PKYG 2K7SA 3EWKA 5AVEA 4L9GA 1MZUA 2QJ7A 2H28A 4I38A 3H82B 3BWLA 1S1YA 3MQOA 4WN5A 1N9NA 4GS9B 3E4QA 4L9FA 3BY9A 1OTDA 5J4EA 5HSQA 3K3DA 1T18A 1X0OA 2P7JA 4GW9A 4H6JB 4HP4A 4K08A 3HJIA 2QHKA 3P7NA 4NXFA 4YWZA 2ZOIA 2PDRA 2Z6DA 4I3JA 4R38A 2WKRA 5I5LA 4H6JA 4EEPA 5HDDA 2Z6CA 1LT0A 2L4RA 1UWPX 2W27A 3H7WB 3F1NB 1P0ZA 5J3WA 4E04A 1V9ZA 3KX0X 2BASA 4GHIA 3F1PB 2PHYA 1DP9A 1OT9A 3VE4A 2PR5A 3RH8B 3UB9A 5IS1A 2V0UA 1T1AA 5HDSA 3K3CA 2OWJA 5HWWA 2PD8A 1LL8A 4EEUA 3LIDA 3UB6A 3F1PA 4HH3A 4KQDA 1S1ZA 1BYWA 3ICYA 4I3IA 2INWA 3G6OA 4NXGA 1OT6A 3RTYA 2A24B 1T1CA 3GDIA 3PYPA 5G4ZA 3H7WA 4B9OA 5A8BA 3LIEA 2OWHA 1JNUA 3BY8A 1XJ2A 3IS2B 2WKPA 2OOLA 3H9WA 4EQ1A 2M1CA 1D06A 1OJ5A 1P97A 3CLOA 2D01A 3EEHA 1GSVA 3IS2A 4WLAA 5F5YA 4LRXC 3D72A 4DJ2A 4EETB 3A0VA 3LIBA 3NOPC 4NXBA 4JGQA 5AVFA 3LI8A 3UB8A 1XFQA 3UMDA 4EXOA 3A0SA 2QKPA 4HHDA 4HIAA 3A0RA 4NXEA 1XJ4A 2YKHA 4HI4A 4BBVA 4DJ3A 3SW1A 3T50A 1N9LA 5HD3A 3UMEA 5HD5A 3F1OA 1DP8A 1T1BA 2D02A 3LIAA 3MQQA 1F98A 4HJ3A 1S67L 4M4XA 3LICA 3NOTC 4I3AA 5DJTA 3UB7A 2KDKA 4R6LA 2EA9A 2JN7A 2V9AA 2WKQA 1GSWA 1F9IA 4MN5A 4HH2A 4JGPA 2V1BA 4PKYA 5G4YA 4HNBA 2PR6A 3C2WA 5EFWA 5TBMA 3GECA 1NWZA 3LYXA 3FG8A 4WL9A 1OTIA 3NJAA 1S66L 1OTBA 5TBMB 4HY8A 4R3AA 3FC7A 4I5SA 2VV6A 3HJKA 3F1NA 1OJGA 1N9OA 2JHEA 1TS0A 4JGRA 4XT2A 1VB6A 2HV1A 3H82A 5HWTA 4I39A 5IU1A 3E4PA 4LRZE 3UE6A 1DP6A 3F1OB 4R70A 1D7EA 2QJ5A 4GCZA 4WF0A 3C8CA 4JGOA 3MXQA 1EW0A 1T19A 2A24A 5HZHA 4GS9A 2VLGA 3ZQ5A 4XT2B 4F3LB 2ZBBA 4HP9A 5DKKA 4KUOA 3NHQA 3B33A 2VEAA 5KIZA 4LRYC 1S4RA 3CAXA 3MR0A 4HJ4A 2PYRA 2W0NA 1KOUA 2VV8A 5F69A 4EERA 2V1AA 5HDCA 4HOIA 1GSXA 1V9YA 3E4OA 4MN6A 4WUJA 4LPZA 4GHIB 3LIFA 1WA9A 5DJUA 3PHYA 4BBTA 4LLOB 3VOLA 4EESA 4EW7A 2L1MA 2I9VA 4HQAA 3NOUC 2GJ3A 5F6AA 1DRMA 2VV7A 1LSWA 1TS6A 2ZOHA 1TS8A 4HJ6A 3LI9A 2PD7A 1Y28A 5F68A 1ODVA 1UWNX 4RQ9A 2CMNA 2QWSA 3IBRA 4BBUA 3OLOA 1XJ6A 1OTEA 3LUQA 2V0WA 1TS7A
chains in the Genus database with same CATH superfamily
1L2SA 2Y55A 2KX6A 1G5UA 2PYPA 1LLBA 5GHZA 5FSRA 1YT4A 4B88A 2K7SA 2VZWA 4QB8A 1F2KA 3NY4A 3E4QA 3Q81A 3EEAA 4KZ3A 2GDNA 4XXRA 4X6TA 2GZAA 2Z6CA 1YM1A 4B4XA 2EX9A 5KSCA 2EWVA 3B47A 4PM8A 1OT9A 2WKIA 3V50A 5FI6A 2EX8A 1WYCA 1WE4A 3G6OA 4WM9A 4B9OA 1KE3A 1SDNA 2LB9A 4EETB 1Z6FA 3LY4A 3G34A 3ZNYA 1YLZA 1EI5A 3FV7A 4FH2A 4Z9QA 1ERQA 1BULA 3NDEA 5F83A 4HJ3A 4M4XA 4JF4A 4P0MA 5DJTA 3VV4A 3OPRA 4PKYA 4ARZA 1GSWA 3R7WA 1ES4A 3T1XA 3C2WA 5FQKA 2ZC7A 5FI2A 3NJAA 1S66L 2XGNA 2VKSA 2XH9A 4S2PA 1BLHA 2KOIA 3UE3A 1YLWA 4QJGA 1XX2A 1T19A 2WGIA 4NKPA 3CUEC 5FQIA 3HLBA 4EV4A 3CAXA 4KG2A 5E2FA 4EERA 1PIOA 1ZG4A 4JXSA 5FASA 3BFFA 2ZQ9A 1IKIA 2JKRI 3HLDA 1PRQA 1K55A 1H8MA 1LSWA 1TS8A 2VGJA 3M2JA 3IBRA 4CLCC 1YSPA 3MFXA 4WZ5A 4FSFA 2J9OA 1H3QA 3BLSA 5EVID 3SS3A 4S2IA 3A3EA 1G6AA 1L0GA 4NK3A 4GB7A 1S0WA 2XD1A 5L10A 5DF8A 4DRTA 1CQAA 3F1PB 4E3NA 2PHYA 2Q0OA 2PR5A 5IS1A 4WMCD 1ES3A 3IT9A 1FSWA 3SH8A 4OPRA 1IYOA 3H9WA 1GA0A 1XA1A 3WRZA 1MBLA 3A3JA 3BW6A 4E3KA 3LI8A 1PNEA 2B18A 1AXBA 5DTTA 2WAFA 3EGDC 4O0PA 4JF6A 2QPNA 3LR4A 4X55A 3RTYA 5EOOA 3UE0A 2R9WA 1JWPA 5GHYA 5I94A 4LFUA 3DTMA 1YAXA 1PZOA 5DVAA 1N9OA 1VB6A 3E4PA 4OLDA 2O9BA 3ZFZA 3GRJA 2ZM8A 1ALQA 3NHQA 5DTKA 1S4RA 3MR0A 5HL6A 4KENB 4Y17A 4MN6A 2Y2HA 3B42A 3QHYA 4Y3IA 2XDMA 3MMHA 2UV0E 2ZOHA 1TF1A 2YKFA 3QNBA 1ONGA 3C5AA 5GLCA 4UA9A 2HGVA 1ES5A 2XRNA 2H5SA 3BJNA 4A5RA 2XK1A 2ZOIA 4I3JA 2Y91A 4QY6A 4EEPA 2ZQCA 1LL5A 1LT0A 3VP3A 3T1QB 3BECA 2NUPC 1PFLA 4S2OA 4BL3A 1J9MA 4E6WA 4OQIA 3F1PA 3TE8A 1OT6A 1PI4A 4O7DA 2G2UA 2B95A 1JNUA 4MNRA 3DWKA 4BWIA 2D01A 4OOMA 4WLAA 1YPRA 3D72A 3HLEA 1XFQA 3C4OA 3F1OA 1DP8A 1L3LA 4KZ7A 3IXDA 3M6BA 3IHAA 4K0WA 4R6LA 1CF0A 4X1MA 1FCOA 1OTIA 3FWLA 1CEFA 2HDQA 3JYIA 4GKUA 1SCWA 2W3EA 3F1NA 4EUVA 1YMXA 2QYBA 3V3SA 3C8CA 3VP2A 4WELA 3CUEA 2Y2NA 3SS5A 3ZQ5A 3MQ0A 4FD8A 2FZ0A 2XEPA 4N1HA 2XROA 5HW3A 2VV7A 5EE8A 3S7QA 3GMWA 4FH4A 5CTMA 5EUAA 4BMWA 4RQ9A 4RX2A 1U60A 3HVFA 1GHPA 4BL2A 1XFNA 3JVUA 3UO9A 2H28A 2ZM0A 2OLUA 1K6SA 3LR5A 3MBZA 4GW9A 3RFBA 1QMFA 1UWPX 4UQIS 3N6IA 1NYMA 4OPZA 1Q2PA 2W3FA 1G68A 4G3KA 4LGWA 3S7OA 3OCNA 2ZJ9A 4YNRA 1DJAA 1S1ZA 1K57C 2A24B 1VQQA 2W1RA 4ESPA 3IS2B 3SH7A 1YLYA 2JKFA 3ITBA 1K56A 3S7NA 4DJ2A 3VMAA 4JGQA 3OPPA 2WADA 3T12B 3T4SA 4KQOA 3UMEA 2I72A 4I3AA 4ZJ3A 3BFEA 3G32A 1W7FA 3GECA 3S7PA 2V20A 1BLSA 5BOHA 4UA7A 4KG6A 4C6YA 1KVLA 1OJGA 1XP4A 1GHMA 1NRFA 5CHUA 4DDYA 1ONHA 3ZG7B 3A3FA 4BD0A 4XT2B 1ESUA 3C30A 4EUZA 3B33A 5FATA 5G18A 1YMSA 5CGWA 4EWFA 4Y0UA 4LLOB 3LI9A 2HZ5A 3LUQA 2J80A 1IOUA 1H5XA 5HPIA 3SOIA 4HBTA 4DN0A 5C5KA 3KO6A 1FIKA 2HP9A 1MWRA 1RGYA 3HLFA 3BWLA 4GDBA 4WN5A 2WKHA 4DKIA 1HZOA 3BFGA 4NXFA 1W8QA 4GNUA 4Y2FA 3S22A 4QHCA 3VOYA 3VFFA 3R7WB 3L7HA 1K57A 4N1XA 3N8RA 3RH8B 3VE4A 2PU2A 2V0UA 3V39A 2WGWB 3LIDA 2BTFP 2JKGA 4S2NC 1PYYA 3HUNA 1K4FA 4KQRA 2ZL1B 3NIAA 2O9AA 4DMZA 5FI7A 3T4OA 3DW0A 3SW1A 2ACGA 3ZG8B 1N9LA 1W79A 4BQMA 2J3WA 3T4LA 4MMNA 4OOLA 2EA9A 2V9AA 2OV5A 2EFXA 2X01A 4C3QA 3N8SA 1E25A 3U2AA 1BT5A 4I5SA 3W2ZA 5GLBA 5F1GA 2Y2KA 1GCEA 1TS0A 4JGRA 1K54A 2A3UA 3WS2A 3UDFA 1SKFA 3IF6A 3V67A 1NY0A 2BG1A 4Q0HA 2B5RA 1MY8A 2QMIA 4WMCA 3OPLA 3UB5P 2VEAA 1KE4A 5LBRA 1KOUA 2Q9NA 4XUXA 4HOIA 4MEZA 3PHYA 2L1MA 3KSIA 3NDGA 1Y28A 2W1TA 2EWWA 2CMNA 4GDNA 2ZMAA 1KGEA 4KUKA 1OTAA 4ZJ2A 1G28A 1LI9A 1XJ3A 4FCFA 3IF6B 3IWIA 5AVEA 5CHMA 5FQ9A 1ZC2A 1X0OA 1L0EA 1S6RA 3KYZA 5HDDA 3G30A 1XKZA 3F1NB 3GR2A 5J3WA 4S2KA 4PM9A 3QP4A 4EEUA 2PBDP 3IWOA 4YFMA 5L07A 3T1RA 2OWHA 1D06A 2PU4A 3EQUA 4ZJ1A 1K56D 3MKFA 3P01A 5HX9A 5MC7A 4X56A 2EXAA 5HD3A 1FSYA 3NOTC 2Y4AA 4QY5A 3Q07A 5TBMB 2V8CA 5HWTA 3IX8A 1IEMA 3QP5A 3HUOA 4O8GA 1L0FA 1TDLA 1BUEA 4IHQA 4CPKA 3HREA 3VFHA 5KIZA 4Y0TA 4HJ4A 2P08A 3DBAA 3JPUA 3D4FA 1CJFA 4KG5A 4WUJA 3UNWA 3T4QA 1LI0A 5EM0A 3IBJA 4NEED 4IUKA 4B4ZA 4OH0A 1BZAA 3EGXC 3PXPA 4KZ8A 3I7JA 4OLGA 5A93A 1JTDA 3AGDA 2ZQAA 1XJ6A 4E3MA 4EQIA 4L9EA 3NC8A 4Y0OA 3SZTA 3CWFA 1ERMA 4P85A 5F82A 1S1YA 2IWDA 2V2FF 4JXGA 3O3VA 4DXCA 1P9WA 3VP0A 3H7WB 5EM1A 1TVFA 2J3TC 4GHIA 4LV1A 4ETZA 2KLIA 4YINA 5HDSA 3TRCA 4LCMA 1Y54A 1BYWA 1K4EA 3GDIA 2Y2LA 2WKPA 4EQ1A 1BTLA 1NYYA 2E8IA 2PAVP 2EX2A 4MBFA 3CHWP 3QP8A 3MQQA 1O7EA 1FOFA 1N4OA 3E98A 5EVEA 4H8RA 4D60A 2WKQA 4CLCA 5TBMA 2XA7M 5E2EA 4EBPA 5E2HA 1ES2A 3WS1A 3PAGA 3CZDA 4BJPA 4BENA 2RL3A 1NZOA 4ME4A 3WS0A 1KVMA 3SS4A 5E43A 4II7A 5L2FA 4U3TA 4KUOA 4JKTA 2J8YA 2WUQA 2VV8A 1VEUB 5HFOA 1STZA 4ID4A 1DRMA 2A49A 4HJ6A 2WGVA 3O86A 4F3LA 5HWVA 2HP6A 4QWOA 3UPPA 2H10A 1I2WA 2BLSA 3UN7A 4L9FA 4ETXA 2ZL1A 4Y13A 2PDRA 3ZHHA 4H6JA 1CK3A 3A3IA 3LR3A 2BASA 5FAOA 5TJJA 2XFSA 4HH3A 3TG9A 2INWA 4NXGA 4LCLA 4JF5A 4LV3A 1T1CA 4DE0A 2WAEA 4E3OA 4GZBA 3A0VA 5CX7A 3KSGA 3O87A 4RX3A 2PRFA 2Y2OA 5L09A 3BRMA 3SH9A 5EOEA 3PBTA 1MKIA 4KZ9A 1H8ZA 1NZUA 3WWXA 2M7VA 5KSHA 2FFFB 3VSKA 2G2WA 2HV1A 2UWXA 3MS6A 2FFYA 2ZC6B 5F1FA 3DTKA 4GD8A 4WYYA 1FCNA 2VLGA 1NXYA 4HP9A 5DKKA 4R3JA 1W8YA 4IBRA 5CGSA 2W0NA 1BLCA 1PW8A 4OKPA 2H0TA 1PWGA 3CITA 5FL3A 2A2LA 3MXRA 3Q7VB 1YSQA 4UQIM 1UWNX 4WBGA 4OQGA 2QWSA 3ISGA 2G7UA 3O88A 2HP5A 2OLVA 2HJEA 2PT7A 1P9RA 5FQQA 5AQAA 5FQJA 4E3LA 3OZHA 2Z2MB 5J7EA 1I5QA 2JCHA 5CGXA 2VGKA 3QP1A 4Y7PA 3R4KA 4H6JB 4YWZA 1TD5A 3U4LP 3IF6C 2ZLYA 3KX0X 3MZFA 3VP1A 2J9PA 2O0YA 2HJ9C 4KQDA 3V5MA 2V1ZA 2XR0A 3LIEA 3JVVA 3OOVA 4KZBA 1NRJA 3IHBA 5F5YA 1JWZA 3N4IA 4P6ZS 5HARA 2QKPA 3Q1FA 2WGWA 3NECA 2YKHA 4DE3A 3T50A 2ZQ8A 3IXHA 3MKEA 3IX3A 4HNBA 3ZG9B 2P04A 2WKEA 2X02A 3FG8A 1MWSA 3VOZA 3TSGA 4N9LA 2JHEA 3HCYA 2VX8A 2ZM2A 1YLTA 3GTCA 5AQ9A 4WF0A 1A0KA 1EW0A 1PZPA 3P98A 2GNXA 1E4DA 3BFCA 2XD5A 4JLFA 4N9KA 5FEGA 5F6AA 4ZAMA 1VHMA 2WZXA 2P74A 5F68A 4IJGA 2Y8HA 3VE3A 1SZVA 1UGUA 3MJQA 2L0WA 1VM1A 2QZ6A 4JXWA 2X71A 3LR0A 3BY9A 5E2GA 4HP4A 3HJIA 3IXBA 4KZ5A 1KGGA 3Q7VA 1IFQA 4MDZA 4Q8IA 4WEKA 1YQSA 5HPFA 3K3CA 3UB6A 4I3IA 3OC2A 4GOGA 3IS2A 1MPLA 3E2LA 4S2LA 2W3GA 5DTSA 4EBLA 4R0QA 2JN7A 4IBXA 4F94A 3QNCA 4X25A 2V1BA 5DF7A 4LENA 2DRWA 3OPHA 2PBYA 4I39A 5IU1A 4LRZE 3F1OB 4OP5A 4JGOA 5EVIB 4GN2A 4ZBEA 2XLNA 2ZBBA 1O07A 4LRYC 1HD8A 2M7UA 5F69A 4GLQA 3LIFA 3FKVA 1Q2QA 2I9VA 3BEBA 3IQAA 3L9KA 4DF6A 1K38A 2W3HA 4NG2A 4XUZA 5CXWA 4OOYA 1XPBA 1S4SA 2DMWA 3MQOA 5DFYA 4GS9B 1FILA 3NCKA 5HSQA 5EV0A 4WZ5C 3IF5A 3G31A 5I5LA 2IWCA 5FAQA 3WRTA 3FKWA 1ZTUA 3MZEA 1ESIA 1T1AA 3CI6A 3S1YA 1H0MA 3H7WA 2Y2MA 4M3KA 5JYPA 5U47A 4MN7A 2HDRA 3FPVA 3OBFA 1XA7A 5TR7A 3CLOA 1GSVA 4NXBA 1N9BA 3LO7A 3PBQA 3AGFA 4KZ6A 4HHDA 4OPQA 5TGFA 4HI4A 3VP4A 4ZRRA 4HEFA 2D02A 5CTNA 4HH2A 4JGPA 3IX4A 5A91A 3PAEA 4S2JA 3NI9A 2OSUA 5FQMA 1OTBA 4KZ4A 1FQGA 3ZVTA 2A24A 4JXVA 4DDSA 4F3LB 4E6XA 5EVLA 5KMWA 1BLPA 4IUHA 4C75A 5AQ7A 2V1AA 4LV2A 3W8KA 1WA9A 3N8LA 4BBTA 3OCLA 1W63Q 3QP6A 2ZQDA 3Q82A 1SDEA 5CECA 1G6OA 4L0LA 1OMEA 3ZG5A 3MXQA 3OLOA 3GQZA 3AGEA 1LSVA 4E3JA 3T4TA 1C3BA 1ZKJA 3ULFA 2R9XA 2B02A 2GX5A 4PKYG 2QJ7A 3P09A 1KDWA 4QD4A 2C6WB 1LL9A 2WK0A 3P7NA 3GV9A 2Z6DA 1P0ZA 5GLDA 3MF0A 4S2NA 1KE0A 5EVIC 3E0YA 3UE1A 3EQVA 3KSFA 4Q0JA 1PW1A 1PI5A 1TEMA 5CEDA 5A92A 4IVKA 1YKDA 5G4ZA 4CLCD 2MJ6A 4YOFA 1MXOA 4Y5FA 1KDSA 4U0TA 2NUTC 4PM6A 5AVFA 1CI8A 4GJ4A 2JKTI 3ITAA 3K2NA 2HF6A 3G4PA 3UB7A 3Q7ZA 3UDIA 3D9YA 2O99A 2J7VA 4BD1A 4R1GA 1BSGA 3KYEA 1Z09A 4ZTKA 4PM5A 1FR1A 3O5YA 4HY8A 3FC7A 3HJKA 1GHIA 3ZGAB 4R4RA 4OPYA 3BFDA 3M2KA 4X53A 4R70A 1D7EA 2QJ5A 3BQ8A 5HAIA 1XXMA 1DJBA 3UDXA 3IWQA 4UHUA 5FA7A 4MCWA 3PTEA 1JTGA 1GSXA 2V8FA 3E4OA 4EESA 3G35A 1TS6A 4NETA 3LGOA 3PBNA 3PBOA 1OTEA 3MFDA 2R78A 4N92A 3MXSA 4G3WA 4QPRA 3QP2A 4P6BA 3H82B 3UPNA 2Y2PA 1OTDA 1K6RA 3VSLA 1RGZA 3IXGA 5GLAA 1SHVA 3TOIA 4E04A 1NJ4A 2HDUA 2W27A 5M18A 1IKGA 1VETB 1DP9A 1MWUA 4X1LA 1EROA 2OWJA 5FEFA 4X69A 3NBLA 1XGIA 4IVIA 3PYPA 4P6ZM 5EVIA 1FCMA 2XF3A 2W3DA 4OP8A 2M1CA 2Y79A 4WZ4A 1OJ5A 3KYQA 1P97A 2EXBA 1IELA 4EXOA 5FAPA 4G3VA 3BQAA 5EECA 4BBVA 4DJ3A 4R3BA 3LY3A 1M6KA 1T1BA 2OAQ1 3LICA 1GA9A 4MN5A 5M1AA 4WEJA 3LYXA 4WL9A 4OVDA 4ZDXA 1QMEA 4XT2A 1VEUA 4UAAA 1DP6A 4AFIA 5DFXA 3HLGA 4DE1A 5IT5A 3W4PA 1L0DA 1HTZA 1V9YA 5DJUA 2WZZA 1AWIA 4ARZB 3NOUC 3T1SA 2GJ3A 4X68A 4Y15A 2VJWA 1TS7A 2XQZA 1IYQA 2RCXA 1LSXA 2JKRM 4CLCE 2Y2JA 4JBFA 5KZHA 4L9GA 1K54C 2VK3A 1N9NA 5J4EA 3K3DA 1T18A 4EBNA 3DWZA 4K08A 2QHKA 3IH8A 3ZVWA 2JKTM 2L4RA 4RA7A 4CJNA 1ACFA 5AJGA 1E3UA 3BLMA 3HLCA 2K31A 3M6HA 5A90A 2HDSA 5HWWA 2LB5A 1LL8A 1Y4OA 4DXBA 3B3XA 3CG5A 5JYOA 5A8BA 2HPBA 3ZCZA 3BM6A 3BY8A 2OOLA 3EEHA 3T4KA 4OQ0A 3LIBA 3RJUA 3UB8A 4RVAA 1MKMA 3W4QA 4R4SA 1NLZA 4UEYA 2K2NA 3LIAA 5CHJA 3LEZA 5M19A 2Y59A 1F9IA 1NWZA 4KZAA 3G2ZA 2VV6A 3H82A 1WYBA 3CPTA 2H0YA 4UA6A 3C4PA 2EX6A 5DF9A 4U0XA 4K0XA 3ZG0A 3WS5A 5HAPA 4GS9A 3LFVA 1I2SA 5CERA 4Q0IA 2ZMVA 2XA7S 1DY6A 4FTXA 5AQBA 2ZQ7A 1W5DA 2DNSA 5GL9A 3CPTB 3ZNTA 3DAVA 1ZG6A 3G2YA 3V3RA 3EOIA 3MZDA 3DTEA 2CC1A 4PHTA 1LHYA 4DE2A 5L8MA 4BBUA 4FOFA 4GD6A 3C38A 4K91A 5DKLA 3HL9A 3FZCA 3EWKA 4I38A 3FPWA 1IYPA 1HVBA 4O01A 3GVBA 5J8XA 4Z1WA 2Y2IA 3T4JA 2C5WB 2OAP1 2WKRA 2ZMFA 4P87A 5D3OA 1MWTA 3HBRA 3PBSA 5HL1A 2PD8A 2EFUA 2VA0A 2JE5A 1PWCA 1RCJA 3ICYA 3KSHA 2P9VA 3ZDJA 2VGLS 3IH9A 1XJ2A 1K55C 4IEDA 5EPHA 3NOPC 1MC0A 4E3IA 3E2KA 3CJMA 4JPMA 3A0SA 3A0RA 4NXEA 1XJ4A 2ZC3B 1SKOB 3C7UA 3NULA 4B93A 4D2OA 1F98A 1S67L 5CRFA 1F5MA 5G4YA 3TW8A 2PR6A 4PPRA 2W1TB 4OQHA 2IA2A 4CQHA 2DCFA 3WS4A 2ZC4B 3N7WA 1DJCA 1K0KA 2IWBA 1ZHHB 3D3OA 2FH5A 3CMZA 4GCZA 2XFTA 1JWVA 5IHVA 1KGFA 4OONA 4QU3A 2Q9MA 2PYRA 5TFQA 2J3TD 1CI9A 4LPZA 3PBRA 3VOLA 2AVXA 3ZYTA 4HQAA 1W63M 4MBHA 1K25A 1PWDA 4R23A 3W4OA 4EW7A 4EU0A 1EWZA 4BLMA 2JC7A 3GSGA 3FYZA 3S4XA 1IYSA 1YLPA 5K5BA 2JBFA 1MZUA 1RP5A 2Y2GA 2P7JA 3PR6A 5HAQA 3BYDA 3TJZC 4R38A 4HESA 1TDGA 1YLJA 1V9ZA 5CEBA 1XGJA 1E3UD 1JVJA 4KQQA 4PAUA 4HBUA 1VETA 3UY6A 1FR6A 4MBKA 2VGLM 4PM7A 4RYEA 4FUWA 1NLYA 1J3WA 4LRXC 1CEGA 5FDSA 2E8JA 3DTIA 3UMDA 3HLWA 4HIAA 2O9CA 1OPXA 1D1JA 5HD5A 4CLCB 1H8YA 1M40A 1SKOA 3LEQA 4LV0A 2KDKA 5HZHA 3UB9A 2ZD8A 5EFWA 4PMAA 1HLUP 3LCEA 3RXXA 2WYXA 4MLLA 3RXWA 4R3AA 2Y2QA 2P9VB 3MSHA 3UPOA 3C7VA 3UE6A 3A3DA 4S2MA 2XSSA 5GHXA 5HDCA 2Z2LB 4GHIB 2ZC5B 3HUMA 1ODVA 5FDHA 2PD7A 2V0WA
chains in the Genus database with same CATH topology
2J80A 2HJEA 2PT7A 1P9RA 2R78A 1IOUA 5HPIA 4DN0A 5C5KA 2KX6A 2PYPA 3KO6A 4G3WA 4QPRA 5J7EA 2K7SA 2VZWA 3H82B 3BWLA 4WN5A 3E4QA 1OTDA 4NXFA 3EEAA 3R4KA 4H6JB 4YWZA 1TD5A 4Y2FA 2GZAA 2Z6CA 4E04A 2W27A 3R7WB 3KX0X 2EWVA 3B47A 1DP9A 1OT9A 3VE4A 3RH8B 2O0YA 2V0UA 2OWJA 3LIDA 2HJ9C 4KQDA 3G6OA 3PYPA 4P6ZM 4B9OA 2W3DA 3LIEA 3JVVA 2M1CA 2Y79A 1OJ5A 3KYQA 1P97A 3OOVA 2LB9A 1NRJA 5F5YA 2O9AA 4EETB 4DMZA 3T4OA 4EXOA 4P6ZS 4G3VA 3BQAA 2QKPA 2YKHA 4BBVA 3SW1A 4DJ3A 3T50A 1N9LA 1T1BA 4HJ3A 2J3WA 2OAQ1 4M4XA 3LICA 5DJTA 3T4LA 4MMNA 4OOLA 3VV4A 2EA9A 4PKYA 2V9AA 4MN5A 1GSWA 4ARZA 3R7WA 4HNBA 3C2WA 4WEJA 2P04A 3LYXA 3FG8A 4WL9A 3U2AA 3NJAA 1S66L 4I5SA 2VKSA 3W2ZA 2KOIA 2JHEA 1TS0A 3HCYA 4JGRA 4XT2A 3UE3A 2VX8A 3V67A 1DP6A 4Q0HA 4WF0A 1EW0A 1T19A 4AFIA 5DFXA 4NKPA 2GNXA 3CUEC 2VEAA 5IT5A 3CAXA 5LBRA 1KOUA 4EERA 4HOIA 1V9YA 5DJUA 3PHYA 2JKRI 2L1MA 3KSIA 4ARZB 3NOUC 1H8MA 2GJ3A 5F6AA 1VHMA 1LSWA 1TS8A 2VJWA 5F68A 1Y28A 2W1TA 2EWWA 4IJGA 2CMNA 2Y8HA 3IBRA 4CLCC 1TS7A 1YSPA 4KUKA 3MFXA 3VE3A 1OTAA 1LSXA 1UGUA 3MJQA 1G28A 2JKRM 2L0WA 1XJ3A 4FSFA 4CLCE 5AVEA 4L9GA 1H3QA 3LR0A 1N9NA 3BY9A 5J4EA 3K3DA 1T18A 1X0OA 4HP4A 4K08A 3HJIA 2QHKA 1IFQA 3KYZA 4MDZA 2JKTM 5HDDA 2L4RA 4WEKA 3F1NB 5J3WA 5HPFA 5AJGA 3F1PB 2PHYA 2K31A 2PR5A 5IS1A 3K3CA 5HWWA 2LB5A 1LL8A 4EEUA 3UB6A 4I3IA 3OC2A 5A8BA 2OWHA 3BY8A 3H9WA 2OOLA 1D06A 3EEHA 3IS2A 3T4KA 3EQUA 3LIBA 3BW6A 3P01A 3UB8A 3LI8A 2B18A 1MKMA 5MC7A 1NLZA 5HD3A 4UEYA 2K2NA 3LIAA 3EGDC 4O0PA 2W3GA 3NOTC 3LR4A 2JN7A 3RTYA 1F9IA 2V1BA 1NWZA 5TBMB 2VV6A 1YAXA 1N9OA 1VB6A 3H82A 5HWTA 4I39A 5IU1A 3E4PA 4LRZE 5DF9A 3F1OB 2O9BA 4JGOA 4O8GA 4GS9A 3LFVA 4IHQA 2ZBBA 4Q0IA 2ZMVA 2XA7S 3NHQA 5KIZA 4LRYC 1S4RA 3MR0A 4HJ4A 2P08A 3DBAA 5HL6A 2M7UA 5F69A 4GLQA 4MN6A 4WUJA 3LIFA 3B42A 3T4QA 2I9VA 3IBJA 4NEED 4IUKA 3EOIA 4Y3IA 3MMHA 2ZOHA 3EGXC 3PXPA 2W3HA 4PHTA 1TF1A 5L8MA 4BBUA 2YKFA 1XJ6A 4FOFA 3C38A 4L9EA 1S4SA 5DKLA 2DMWA 3CWFA 3EWKA 4I38A 3FPWA 1S1YA 3MQOA 2HGVA 2XRNA 5DFYA 4GS9B 4O01A 4Z1WA 5HSQA 3T4JA 3BJNA 2ZOIA 1P9WA 4I3JA 2OAP1 2WKRA 5I5LA 4EEPA 1LT0A 3H7WB 2ZMFA 2J3TC 4GHIA 4ETZA 1ZTUA 2NUPC 2KLIA 3PBSA 1T1AA 5HDSA 3TRCA 3CI6A 2PD8A 2VA0A 3F1PA 3KSHA 3ICYA 1BYWA 3TE8A 2VGLS 1OT6A 3GDIA 3H7WA 4MN7A 1JNUA 1XJ2A 3FPVA 2WKPA 3OBFA 4EQ1A 4BWIA 3CLOA 2D01A 4OOMA 1GSVA 4WLAA 3D72A 3NOPC 4NXBA 1MC0A 1XFQA 3PBQA 3A0SA 4HHDA 3A0RA 4NXEA 1XJ4A 4HI4A 4B93A 4ZRRA 3F1OA 1DP8A 3MQQA 2D02A 1F98A 1S67L 3E98A 1F5MA 4R6LA 2WKQA 5G4YA 4HH2A 4JGPA 3TW8A 2PR6A 4CLCA 5TBMA 2W1TB 2XA7M 1OTIA 1OTBA 2IA2A 2W3EA 4CQHA 3F1NA 4EUVA 4BJPA 1ZHHB 2QYBA 3D3OA 2FH5A 4GCZA 3C8CA 4ME4A 2A24A 4WELA 3CUEA 3ZQ5A 4II7A 4F3LB 4KUOA 3MQ0A 4IUHA 2PYRA 2FZ0A 2VV8A 2V1AA 2J3TD 4LPZA 1STZA 1WA9A 4BBTA 3PBRA 3OCLA 3VOLA 1W63Q 2XROA 3ZYTA 4HQAA 1W63M 1DRMA 2VV7A 3S7QA 1G6OA 4L0LA 4HJ6A 4BMWA 4RQ9A 3MXQA 4EW7A 4EU0A 3OLOA 4F3LA 1LSVA 3T4TA 5HWVA 3ULFA 2B02A 1XFNA 2GX5A 4PKYG 5K5BA 3JVUA 1MZUA 2QJ7A 2H28A 3LR5A 4L9FA 4ETXA 2P7JA 3PR6A 4GW9A 3P7NA 3RFBA 3TJZC 2PDRA 2Z6DA 4R38A 4H6JA 1UWPX 3LR3A 4UQIS 1P0ZA 1V9ZA 3MF0A 2BASA 3E0YA 3EQVA 3KSFA 2W3FA 5TJJA 4Q0JA 4G3KA 3S7OA 3OCNA 4YNRA 4PAUA 4HH3A 1S1ZA 2INWA 4NXGA 1YKDA 2A24B 1T1CA 2VGLM 5G4ZA 4CLCD 2MJ6A 2W1RA 4YOFA 3IS2B 1NLYA 4Y5FA 3S7NA 4LRXC 4DJ2A 3A0VA 2NUTC 5AVFA 4JGQA 3UMDA 4GJ4A 4HIAA 3T4SA 5CX7A 2O9CA 1OPXA 2JKTI 3KSGA 4KQOA 3UMEA 5HD5A 3K2NA 4CLCB 2HF6A 4I3AA 3UB7A 2KDKA 5HZHA 3UB9A 2O99A 5EFWA 3PBTA 3GECA 3S7PA 3O5YA 4HY8A 4R3AA 2M7VA 3FC7A 5KSHA 3HJKA 1OJGA 2HV1A 3UE6A 4R70A 1D7EA 2QJ5A 3BQ8A 2VLGA 4XT2B 3C30A 4HP9A 5DKKA 3B33A 2XSSA 2W0NA 4MCWA 5HDCA 1GSXA 3E4OA 3CITA 4GHIB 5FL3A 4EESA 4LLOB 2A2LA 1TS6A 1YSQA 3LI9A 4UQIM 1ODVA 1UWNX 3PBNA 2QWSA 2G7UA 3PBOA 2PD7A 1OTEA 3LUQA 2V0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3L A;  2J80 A;  2R78 A;  3MFX A;  4KUK A;  1OTA A;  2YKF A;  3VE3 A;  1LSV A;  4L9E A;  1S4S A;  2KX6 A;  1LSX A;  5HWV A;  1UGU A;  2PYP A;  3MJQ A;  5DKL A;  3ULF A;  1G28 A;  2L0W A;  3CWF A;  1XJ3 A;  2B02 A;  1XFN A;  5J7E A;  4PKY G;  2K7S A;  3EWK A;  5AVE A;  4L9G A;  1MZU A;  2QJ7 A;  2H28 A;  4I38 A;  3H82 B;  3BWL A;  1S1Y A;  3MQO A;  4WN5 A;  1N9N A;  4GS9 B;  3E4Q A;  4L9F A;  3BY9 A;  1OTD A;  5J4E A;  5HSQ A;  3K3D A;  1T18 A;  1X0O A;  2P7J A;  4GW9 A;  4H6J B;  4HP4 A;  4K08 A;  3HJI A;  2QHK A;  3P7N A;  4NXF A;  4YWZ A;  2ZOI A;  2PDR A;  2Z6D A;  4I3J A;  4R38 A;  2WKR A;  5I5L A;  4H6J A;  4EEP A;  5HDD A;  2Z6C A;  1LT0 A;  2L4R A;  1UWP X;  2W27 A;  3H7W B;  3F1N B;  1P0Z A;  5J3W A;  4E04 A;  1V9Z A;  3KX0 X;  2BAS A;  4GHI A;  3F1P B;  2PHY A;  1DP9 A;  1OT9 A;  3VE4 A;  2PR5 A;  3RH8 B;  3UB9 A;  5IS1 A;  2V0U A;  1T1A A;  5HDS A;  3K3C A;  2OWJ A;  5HWW A;  2PD8 A;  1LL8 A;  4EEU A;  3LID A;  3UB6 A;  3F1P A;  4HH3 A;  4KQD A;  1S1Z A;  1BYW A;  3ICY A;  4I3I A;  2INW A;  3G6O A;  4NXG A;  1OT6 A;  3RTY A;  2A24 B;  1T1C A;  3GDI A;  3PYP A;  5G4Z A;  3H7W A;  4B9O A;  5A8B A;  3LIE A;  2OWH A;  1JNU A;  3BY8 A;  1XJ2 A;  3IS2 B;  2WKP A;  2OOL A;  3H9W A;  4EQ1 A;  2M1C A;  1D06 A;  1OJ5 A;  1P97 A;  3CLO A;  2D01 A;  3EEH A;  1GSV A;  3IS2 A;  4WLA A;  5F5Y A;  4LRX C;  3D72 A;  4DJ2 A;  4EET B;  3A0V A;  3LIB A;  3NOP C;  4NXB A;  4JGQ A;  5AVF A;  3LI8 A;  3UB8 A;  1XFQ A;  3UMD A;  4EXO A;  3A0S A;  2QKP A;  4HHD A;  4HIA A;  3A0R A;  4NXE A;  1XJ4 A;  2YKH A;  4HI4 A;  4BBV A;  4DJ3 A;  3SW1 A;  3T50 A;  1N9L A;  5HD3 A;  3UME A;  5HD5 A;  3F1O A;  1DP8 A;  1T1B A;  2D02 A;  3LIA A;  3MQQ A;  1F98 A;  4HJ3 A;  1S67 L;  4M4X A;  3LIC A;  3NOT C;  4I3A A;  5DJT A;  3UB7 A;  2KDK A;  4R6L A;  2EA9 A;  2JN7 A;  2V9A A;  2WKQ A;  1GSW A;  1F9I A;  4MN5 A;  4HH2 A;  4JGP A;  2V1B A;  4PKY A;  5G4Y A;  4HNB A;  2PR6 A;  3C2W A;  5EFW A;  5TBM A;  3GEC A;  1NWZ A;  3LYX A;  3FG8 A;  4WL9 A;  1OTI A;  3NJA A;  1S66 L;  1OTB A;  5TBM B;  4HY8 A;  4R3A A;  3FC7 A;  4I5S A;  2VV6 A;  3HJK A;  3F1N A;  1OJG A;  1N9O A;  2JHE A;  1TS0 A;  4JGR A;  4XT2 A;  1VB6 A;  2HV1 A;  3H82 A;  5HWT A;  4I39 A;  5IU1 A;  3E4P A;  4LRZ E;  3UE6 A;  1DP6 A;  3F1O B;  4R70 A;  1D7E A;  2QJ5 A;  4GCZ A;  4WF0 A;  3C8C A;  4JGO A;  3MXQ A;  1EW0 A;  1T19 A;  2A24 A;  5HZH A;  4GS9 A;  2VLG A;  3ZQ5 A;  4XT2 B;  4F3L B;  2ZBB A;  4HP9 A;  5DKK A;  4KUO A;  3NHQ A;  3B33 A;  2VEA A;  5KIZ A;  4LRY C;  1S4R A;  3CAX A;  3MR0 A;  4HJ4 A;  2PYR A;  2W0N A;  1KOU A;  2VV8 A;  5F69 A;  4EER A;  2V1A A;  5HDC A;  4HOI A;  1GSX A;  1V9Y A;  3E4O A;  4MN6 A;  4WUJ A;  4LPZ A;  4GHI B;  3LIF A;  1WA9 A;  5DJU A;  3PHY A;  4BBT A;  4LLO B;  3VOL A;  4EES A;  4EW7 A;  2L1M A;  2I9V A;  4HQA A;  3NOU C;  2GJ3 A;  5F6A A;  1DRM A;  2VV7 A;  1LSW A;  1TS6 A;  2ZOH A;  1TS8 A;  4HJ6 A;  3LI9 A;  2PD7 A;  1Y28 A;  5F68 A;  1ODV A;  1UWN X;  4RQ9 A;  2CMN A;  2QWS A;  3IBR A;  4BBU A;  3OLO A;  1XJ6 A;  1OTE A;  3LUQ A;  2V0W A;  1TS7 A; 
#chains in the Genus database with same CATH topology
 1L2S A;  2Y55 A;  2KX6 A;  1G5U A;  2PYP A;  1LLB A;  5GHZ A;  5FSR A;  1YT4 A;  4B88 A;  2K7S A;  2VZW A;  4QB8 A;  1F2K A;  3NY4 A;  3E4Q A;  3Q81 A;  3EEA A;  4KZ3 A;  2GDN A;  4XXR A;  4X6T A;  2GZA A;  2Z6C A;  1YM1 A;  4B4X A;  2EX9 A;  5KSC A;  2EWV A;  3B47 A;  4PM8 A;  1OT9 A;  2WKI A;  3V50 A;  5FI6 A;  2EX8 A;  1WYC A;  1WE4 A;  3G6O A;  4WM9 A;  4B9O A;  1KE3 A;  1SDN A;  2LB9 A;  4EET B;  1Z6F A;  3LY4 A;  3G34 A;  3ZNY A;  1YLZ A;  1EI5 A;  3FV7 A;  4FH2 A;  4Z9Q A;  1ERQ A;  1BUL A;  3NDE A;  5F83 A;  4HJ3 A;  4M4X A;  4JF4 A;  4P0M A;  5DJT A;  3VV4 A;  3OPR A;  4PKY A;  4ARZ A;  1GSW A;  3R7W A;  1ES4 A;  3T1X A;  3C2W A;  5FQK A;  2ZC7 A;  5FI2 A;  3NJA A;  1S66 L;  2XGN A;  2VKS A;  2XH9 A;  4S2P A;  1BLH A;  2KOI A;  3UE3 A;  1YLW A;  4QJG A;  1XX2 A;  1T19 A;  2WGI A;  4NKP A;  3CUE C;  5FQI A;  3HLB A;  4EV4 A;  3CAX A;  4KG2 A;  5E2F A;  4EER A;  1PIO A;  1ZG4 A;  4JXS A;  5FAS A;  3BFF A;  2ZQ9 A;  1IKI A;  2JKR I;  3HLD A;  1PRQ A;  1K55 A;  1H8M A;  1LSW A;  1TS8 A;  2VGJ A;  3M2J A;  3IBR A;  4CLC C;  1YSP A;  3MFX A;  4WZ5 A;  4FSF A;  2J9O A;  1H3Q A;  3BLS A;  5EVI D;  3SS3 A;  4S2I A;  3A3E A;  1G6A A;  1L0G A;  4NK3 A;  4GB7 A;  1S0W A;  2XD1 A;  5L10 A;  5DF8 A;  4DRT A;  1CQA A;  3F1P B;  4E3N A;  2PHY A;  2Q0O A;  2PR5 A;  5IS1 A;  4WMC D;  1ES3 A;  3IT9 A;  1FSW A;  3SH8 A;  4OPR A;  1IYO A;  3H9W A;  1GA0 A;  1XA1 A;  3WRZ A;  1MBL A;  3A3J A;  3BW6 A;  4E3K A;  3LI8 A;  1PNE A;  2B18 A;  1AXB A;  5DTT A;  2WAF A;  3EGD C;  4O0P A;  4JF6 A;  2QPN A;  3LR4 A;  4X55 A;  3RTY A;  5EOO A;  3UE0 A;  2R9W A;  1JWP A;  5GHY A;  5I94 A;  4LFU A;  3DTM A;  1YAX A;  1PZO A;  5DVA A;  1N9O A;  1VB6 A;  3E4P A;  4OLD A;  2O9B A;  3ZFZ A;  3GRJ A;  2ZM8 A;  1ALQ A;  3NHQ A;  5DTK A;  1S4R A;  3MR0 A;  5HL6 A;  4KEN B;  4Y17 A;  4MN6 A;  2Y2H A;  3B42 A;  3QHY A;  4Y3I A;  2XDM A;  3MMH A;  2UV0 E;  2ZOH A;  1TF1 A;  2YKF A;  3QNB A;  1ONG A;  3C5A A;  5GLC A;  4UA9 A;  2HGV A;  1ES5 A;  2XRN A;  2H5S A;  3BJN A;  4A5R A;  2XK1 A;  2ZOI A;  4I3J A;  2Y91 A;  4QY6 A;  4EEP A;  2ZQC A;  1LL5 A;  1LT0 A;  3VP3 A;  3T1Q B;  3BEC A;  2NUP C;  1PFL A;  4S2O A;  4BL3 A;  1J9M A;  4E6W A;  4OQI A;  3F1P A;  3TE8 A;  1OT6 A;  1PI4 A;  4O7D A;  2G2U A;  2B95 A;  1JNU A;  4MNR A;  3DWK A;  4BWI A;  2D01 A;  4OOM A;  4WLA A;  1YPR A;  3D72 A;  3HLE A;  1XFQ A;  3C4O A;  3F1O A;  1DP8 A;  1L3L A;  4KZ7 A;  3IXD A;  3M6B A;  3IHA A;  4K0W A;  4R6L A;  1CF0 A;  4X1M A;  1FCO A;  1OTI A;  3FWL A;  1CEF A;  2HDQ A;  3JYI A;  4GKU A;  1SCW A;  2W3E A;  3F1N A;  4EUV A;  1YMX A;  2QYB A;  3V3S A;  3C8C A;  3VP2 A;  4WEL A;  3CUE A;  2Y2N A;  3SS5 A;  3ZQ5 A;  3MQ0 A;  4FD8 A;  2FZ0 A;  2XEP A;  4N1H A;  2XRO A;  5HW3 A;  2VV7 A;  5EE8 A;  3S7Q A;  3GMW A;  4FH4 A;  5CTM A;  5EUA A;  4BMW A;  4RQ9 A;  4RX2 A;  1U60 A;  3HVF A;  1GHP A;  4BL2 A;  1XFN A;  3JVU A;  3UO9 A;  2H28 A;  2ZM0 A;  2OLU A;  1K6S A;  3LR5 A;  3MBZ A;  4GW9 A;  3RFB A;  1QMF A;  1UWP X;  4UQI S;  3N6I A;  1NYM A;  4OPZ A;  1Q2P A;  2W3F A;  1G68 A;  4G3K A;  4LGW A;  3S7O A;  3OCN A;  2ZJ9 A;  4YNR A;  1DJA A;  1S1Z A;  1K57 C;  2A24 B;  1VQQ A;  2W1R A;  4ESP A;  3IS2 B;  3SH7 A;  1YLY A;  2JKF A;  3ITB A;  1K56 A;  3S7N A;  4DJ2 A;  3VMA A;  4JGQ A;  3OPP A;  2WAD A;  3T12 B;  3T4S A;  4KQO A;  3UME A;  2I72 A;  4I3A A;  4ZJ3 A;  3BFE A;  3G32 A;  1W7F A;  3GEC A;  3S7P A;  2V20 A;  1BLS A;  5BOH A;  4UA7 A;  4KG6 A;  4C6Y A;  1KVL A;  1OJG A;  1XP4 A;  1GHM A;  1NRF A;  5CHU A;  4DDY A;  1ONH A;  3ZG7 B;  3A3F A;  4BD0 A;  4XT2 B;  1ESU A;  3C30 A;  4EUZ A;  3B33 A;  5FAT A;  5G18 A;  1YMS A;  5CGW A;  4EWF A;  4Y0U A;  4LLO B;  3LI9 A;  2HZ5 A;  3LUQ A;  2J80 A;  1IOU A;  1H5X A;  5HPI A;  3SOI A;  4HBT A;  4DN0 A;  5C5K A;  3KO6 A;  1FIK A;  2HP9 A;  1MWR A;  1RGY A;  3HLF A;  3BWL A;  4GDB A;  4WN5 A;  2WKH A;  4DKI A;  1HZO A;  3BFG A;  4NXF A;  1W8Q A;  4GNU A;  4Y2F A;  3S22 A;  4QHC A;  3VOY A;  3VFF A;  3R7W B;  3L7H A;  1K57 A;  4N1X A;  3N8R A;  3RH8 B;  3VE4 A;  2PU2 A;  2V0U A;  3V39 A;  2WGW B;  3LID A;  2BTF P;  2JKG A;  4S2N C;  1PYY A;  3HUN A;  1K4F A;  4KQR A;  2ZL1 B;  3NIA A;  2O9A A;  4DMZ A;  5FI7 A;  3T4O A;  3DW0 A;  3SW1 A;  2ACG A;  3ZG8 B;  1N9L A;  1W79 A;  4BQM A;  2J3W A;  3T4L A;  4MMN A;  4OOL A;  2EA9 A;  2V9A A;  2OV5 A;  2EFX A;  2X01 A;  4C3Q A;  3N8S A;  1E25 A;  3U2A A;  1BT5 A;  4I5S A;  3W2Z A;  5GLB A;  5F1G A;  2Y2K A;  1GCE A;  1TS0 A;  4JGR A;  1K54 A;  2A3U A;  3WS2 A;  3UDF A;  1SKF A;  3IF6 A;  3V67 A;  1NY0 A;  2BG1 A;  4Q0H A;  2B5R A;  1MY8 A;  2QMI A;  4WMC A;  3OPL A;  3UB5 P;  2VEA A;  1KE4 A;  5LBR A;  1KOU A;  2Q9N A;  4XUX A;  4HOI A;  4MEZ A;  3PHY A;  2L1M A;  3KSI A;  3NDG A;  1Y28 A;  2W1T A;  2EWW A;  2CMN A;  4GDN A;  2ZMA A;  1KGE A;  4KUK A;  1OTA A;  4ZJ2 A;  1G28 A;  1LI9 A;  1XJ3 A;  4FCF A;  3IF6 B;  3IWI A;  5AVE A;  5CHM A;  5FQ9 A;  1ZC2 A;  1X0O A;  1L0E A;  1S6R A;  3KYZ A;  5HDD A;  3G30 A;  1XKZ A;  3F1N B;  3GR2 A;  5J3W A;  4S2K A;  4PM9 A;  3QP4 A;  4EEU A;  2PBD P;  3IWO A;  4YFM A;  5L07 A;  3T1R A;  2OWH A;  1D06 A;  2PU4 A;  3EQU A;  4ZJ1 A;  1K56 D;  3MKF A;  3P01 A;  5HX9 A;  5MC7 A;  4X56 A;  2EXA A;  5HD3 A;  1FSY A;  3NOT C;  2Y4A A;  4QY5 A;  3Q07 A;  5TBM B;  2V8C A;  5HWT A;  3IX8 A;  1IEM A;  3QP5 A;  3HUO A;  4O8G A;  1L0F A;  1TDL A;  1BUE A;  4IHQ A;  4CPK A;  3HRE A;  3VFH A;  5KIZ A;  4Y0T A;  4HJ4 A;  2P08 A;  3DBA A;  3JPU A;  3D4F A;  1CJF A;  4KG5 A;  4WUJ A;  3UNW A;  3T4Q A;  1LI0 A;  5EM0 A;  3IBJ A;  4NEE D;  4IUK A;  4B4Z A;  4OH0 A;  1BZA A;  3EGX C;  3PXP A;  4KZ8 A;  3I7J A;  4OLG A;  5A93 A;  1JTD A;  3AGD A;  2ZQA A;  1XJ6 A;  4E3M A;  4EQI A;  4L9E A;  3NC8 A;  4Y0O A;  3SZT A;  3CWF A;  1ERM A;  4P85 A;  5F82 A;  1S1Y A;  2IWD A;  2V2F F;  4JXG A;  3O3V A;  4DXC A;  1P9W A;  3VP0 A;  3H7W B;  5EM1 A;  1TVF A;  2J3T C;  4GHI A;  4LV1 A;  4ETZ A;  2KLI A;  4YIN A;  5HDS A;  3TRC A;  4LCM A;  1Y54 A;  1BYW A;  1K4E A;  3GDI A;  2Y2L A;  2WKP A;  4EQ1 A;  1BTL A;  1NYY A;  2E8I A;  2PAV P;  2EX2 A;  4MBF A;  3CHW P;  3QP8 A;  3MQQ A;  1O7E A;  1FOF A;  1N4O A;  3E98 A;  5EVE A;  4H8R A;  4D60 A;  2WKQ A;  4CLC A;  5TBM A;  2XA7 M;  5E2E A;  4EBP A;  5E2H A;  1ES2 A;  3WS1 A;  3PAG A;  3CZD A;  4BJP A;  4BEN A;  2RL3 A;  1NZO A;  4ME4 A;  3WS0 A;  1KVM A;  3SS4 A;  5E43 A;  4II7 A;  5L2F A;  4U3T A;  4KUO A;  4JKT A;  2J8Y A;  2WUQ A;  2VV8 A;  1VEU B;  5HFO A;  1STZ A;  4ID4 A;  1DRM A;  2A49 A;  4HJ6 A;  2WGV A;  3O86 A;  4F3L A;  5HWV A;  2HP6 A;  4QWO A;  3UPP A;  2H10 A;  1I2W A;  2BLS A;  3UN7 A;  4L9F A;  4ETX A;  2ZL1 A;  4Y13 A;  2PDR A;  3ZHH A;  4H6J A;  1CK3 A;  3A3I A;  3LR3 A;  2BAS A;  5FAO A;  5TJJ A;  2XFS A;  4HH3 A;  3TG9 A;  2INW A;  4NXG A;  4LCL A;  4JF5 A;  4LV3 A;  1T1C A;  4DE0 A;  2WAE A;  4E3O A;  4GZB A;  3A0V A;  5CX7 A;  3KSG A;  3O87 A;  4RX3 A;  2PRF A;  2Y2O A;  5L09 A;  3BRM A;  3SH9 A;  5EOE A;  3PBT A;  1MKI A;  4KZ9 A;  1H8Z A;  1NZU A;  3WWX A;  2M7V A;  5KSH A;  2FFF B;  3VSK A;  2G2W A;  2HV1 A;  2UWX A;  3MS6 A;  2FFY A;  2ZC6 B;  5F1F A;  3DTK A;  4GD8 A;  4WYY A;  1FCN A;  2VLG A;  1NXY A;  4HP9 A;  5DKK A;  4R3J A;  1W8Y A;  4IBR A;  5CGS A;  2W0N A;  1BLC A;  1PW8 A;  4OKP A;  2H0T A;  1PWG A;  3CIT A;  5FL3 A;  2A2L A;  3MXR A;  3Q7V B;  1YSQ A;  4UQI M;  1UWN X;  4WBG A;  4OQG A;  2QWS A;  3ISG A;  2G7U A;  3O88 A;  2HP5 A;  2OLV A;  2HJE A;  2PT7 A;  1P9R A;  5FQQ A;  5AQA A;  5FQJ A;  4E3L A;  3OZH A;  2Z2M B;  5J7E A;  1I5Q A;  2JCH A;  5CGX A;  2VGK A;  3QP1 A;  4Y7P A;  3R4K A;  4H6J B;  4YWZ A;  1TD5 A;  3U4L P;  3IF6 C;  2ZLY A;  3KX0 X;  3MZF A;  3VP1 A;  2J9P A;  2O0Y A;  2HJ9 C;  4KQD A;  3V5M A;  2V1Z A;  2XR0 A;  3LIE A;  3JVV A;  3OOV A;  4KZB A;  1NRJ A;  3IHB A;  5F5Y A;  1JWZ A;  3N4I A;  4P6Z S;  5HAR A;  2QKP A;  3Q1F A;  2WGW A;  3NEC A;  2YKH A;  4DE3 A;  3T50 A;  2ZQ8 A;  3IXH A;  3MKE A;  3IX3 A;  4HNB A;  3ZG9 B;  2P04 A;  2WKE A;  2X02 A;  3FG8 A;  1MWS A;  3VOZ A;  3TSG A;  4N9L A;  2JHE A;  3HCY A;  2VX8 A;  2ZM2 A;  1YLT A;  3GTC A;  5AQ9 A;  4WF0 A;  1A0K A;  1EW0 A;  1PZP A;  3P98 A;  2GNX A;  1E4D A;  3BFC A;  2XD5 A;  4JLF A;  4N9K A;  5FEG A;  5F6A A;  4ZAM A;  1VHM A;  2WZX A;  2P74 A;  5F68 A;  4IJG A;  2Y8H A;  3VE3 A;  1SZV A;  1UGU A;  3MJQ A;  2L0W A;  1VM1 A;  2QZ6 A;  4JXW A;  2X71 A;  3LR0 A;  3BY9 A;  5E2G A;  4HP4 A;  3HJI A;  3IXB A;  4KZ5 A;  1KGG A;  3Q7V A;  1IFQ A;  4MDZ A;  4Q8I A;  4WEK A;  1YQS A;  5HPF A;  3K3C A;  3UB6 A;  4I3I A;  3OC2 A;  4GOG A;  3IS2 A;  1MPL A;  3E2L A;  4S2L A;  2W3G A;  5DTS A;  4EBL A;  4R0Q A;  2JN7 A;  4IBX A;  4F94 A;  3QNC A;  4X25 A;  2V1B A;  5DF7 A;  4LEN A;  2DRW A;  3OPH A;  2PBY A;  4I39 A;  5IU1 A;  4LRZ E;  3F1O B;  4OP5 A;  4JGO A;  5EVI B;  4GN2 A;  4ZBE A;  2XLN A;  2ZBB A;  1O07 A;  4LRY C;  1HD8 A;  2M7U A;  5F69 A;  4GLQ A;  3LIF A;  3FKV A;  1Q2Q A;  2I9V A;  3BEB A;  3IQA A;  3L9K A;  4DF6 A;  1K38 A;  2W3H A;  4NG2 A;  4XUZ A;  5CXW A;  4OOY A;  1XPB A;  1S4S A;  2DMW A;  3MQO A;  5DFY A;  4GS9 B;  1FIL A;  3NCK A;  5HSQ A;  5EV0 A;  4WZ5 C;  3IF5 A;  3G31 A;  5I5L A;  2IWC A;  5FAQ A;  3WRT A;  3FKW A;  1ZTU A;  3MZE A;  1ESI A;  1T1A A;  3CI6 A;  3S1Y A;  1H0M A;  3H7W A;  2Y2M A;  4M3K A;  5JYP A;  5U47 A;  4MN7 A;  2HDR A;  3FPV A;  3OBF A;  1XA7 A;  5TR7 A;  3CLO A;  1GSV A;  4NXB A;  1N9B A;  3LO7 A;  3PBQ A;  3AGF A;  4KZ6 A;  4HHD A;  4OPQ A;  5TGF A;  4HI4 A;  3VP4 A;  4ZRR A;  4HEF A;  2D02 A;  5CTN A;  4HH2 A;  4JGP A;  3IX4 A;  5A91 A;  3PAE A;  4S2J A;  3NI9 A;  2OSU A;  5FQM A;  1OTB A;  4KZ4 A;  1FQG A;  3ZVT A;  2A24 A;  4JXV A;  4DDS A;  4F3L B;  4E6X A;  5EVL A;  5KMW A;  1BLP A;  4IUH A;  4C75 A;  5AQ7 A;  2V1A A;  4LV2 A;  3W8K A;  1WA9 A;  3N8L A;  4BBT A;  3OCL A;  1W63 Q;  3QP6 A;  2ZQD A;  3Q82 A;  1SDE A;  5CEC A;  1G6O A;  4L0L A;  1OME A;  3ZG5 A;  3MXQ A;  3OLO A;  3GQZ A;  3AGE A;  1LSV A;  4E3J A;  3T4T A;  1C3B A;  1ZKJ A;  3ULF A;  2R9X A;  2B02 A;  2GX5 A;  4PKY G;  2QJ7 A;  3P09 A;  1KDW A;  4QD4 A;  2C6W B;  1LL9 A;  2WK0 A;  3P7N A;  3GV9 A;  2Z6D A;  1P0Z A;  5GLD A;  3MF0 A;  4S2N A;  1KE0 A;  5EVI C;  3E0Y A;  3UE1 A;  3EQV A;  3KSF A;  4Q0J A;  1PW1 A;  1PI5 A;  1TEM A;  5CED A;  5A92 A;  4IVK A;  1YKD A;  5G4Z A;  4CLC D;  2MJ6 A;  4YOF A;  1MXO A;  4Y5F A;  1KDS A;  4U0T A;  2NUT C;  4PM6 A;  5AVF A;  1CI8 A;  4GJ4 A;  2JKT I;  3ITA A;  3K2N A;  2HF6 A;  3G4P A;  3UB7 A;  3Q7Z A;  3UDI A;  3D9Y A;  2O99 A;  2J7V A;  4BD1 A;  4R1G A;  1BSG A;  3KYE A;  1Z09 A;  4ZTK A;  4PM5 A;  1FR1 A;  3O5Y A;  4HY8 A;  3FC7 A;  3HJK A;  1GHI A;  3ZGA B;  4R4R A;  4OPY A;  3BFD A;  3M2K A;  4X53 A;  4R70 A;  1D7E A;  2QJ5 A;  3BQ8 A;  5HAI A;  1XXM A;  1DJB A;  3UDX A;  3IWQ A;  4UHU A;  5FA7 A;  4MCW A;  3PTE A;  1JTG A;  1GSX A;  2V8F A;  3E4O A;  4EES A;  3G35 A;  1TS6 A;  4NET A;  3LGO A;  3PBN A;  3PBO A;  1OTE A;  3MFD A;  2R78 A;  4N92 A;  3MXS A;  4G3W A;  4QPR A;  3QP2 A;  4P6B A;  3H82 B;  3UPN A;  2Y2P A;  1OTD A;  1K6R A;  3VSL A;  1RGZ A;  3IXG A;  5GLA A;  1SHV A;  3TOI A;  4E04 A;  1NJ4 A;  2HDU A;  2W27 A;  5M18 A;  1IKG A;  1VET B;  1DP9 A;  1MWU A;  4X1L A;  1ERO A;  2OWJ A;  5FEF A;  4X69 A;  3NBL A;  1XGI A;  4IVI A;  3PYP A;  4P6Z M;  5EVI A;  1FCM A;  2XF3 A;  2W3D A;  4OP8 A;  2M1C A;  2Y79 A;  4WZ4 A;  1OJ5 A;  3KYQ A;  1P97 A;  2EXB A;  1IEL A;  4EXO A;  5FAP A;  4G3V A;  3BQA A;  5EEC A;  4BBV A;  4DJ3 A;  4R3B A;  3LY3 A;  1M6K A;  1T1B A;  2OAQ 1;  3LIC A;  1GA9 A;  4MN5 A;  5M1A A;  4WEJ A;  3LYX A;  4WL9 A;  4OVD A;  4ZDX A;  1QME A;  4XT2 A;  1VEU A;  4UAA A;  1DP6 A;  4AFI A;  5DFX A;  3HLG A;  4DE1 A;  5IT5 A;  3W4P A;  1L0D A;  1HTZ A;  1V9Y A;  5DJU A;  2WZZ A;  1AWI A;  4ARZ B;  3NOU C;  3T1S A;  2GJ3 A;  4X68 A;  4Y15 A;  2VJW A;  1TS7 A;  2XQZ A;  1IYQ A;  2RCX A;  1LSX A;  2JKR M;  4CLC E;  2Y2J A;  4JBF A;  5KZH A;  4L9G A;  1K54 C;  2VK3 A;  1N9N A;  5J4E A;  3K3D A;  1T18 A;  4EBN A;  3DWZ A;  4K08 A;  2QHK A;  3IH8 A;  3ZVW A;  2JKT M;  2L4R A;  4RA7 A;  4CJN A;  1ACF A;  5AJG A;  1E3U A;  3BLM A;  3HLC A;  2K31 A;  3M6H A;  5A90 A;  2HDS A;  5HWW A;  2LB5 A;  1LL8 A;  1Y4O A;  4DXB A;  3B3X A;  3CG5 A;  5JYO A;  5A8B A;  2HPB A;  3ZCZ A;  3BM6 A;  3BY8 A;  2OOL A;  3EEH A;  3T4K A;  4OQ0 A;  3LIB A;  3RJU A;  3UB8 A;  4RVA A;  1MKM A;  3W4Q A;  4R4S A;  1NLZ A;  4UEY A;  2K2N A;  3LIA A;  5CHJ A;  3LEZ A;  5M19 A;  2Y59 A;  1F9I A;  1NWZ A;  4KZA A;  3G2Z A;  2VV6 A;  3H82 A;  1WYB A;  3CPT A;  2H0Y A;  4UA6 A;  3C4P A;  2EX6 A;  5DF9 A;  4U0X A;  4K0X A;  3ZG0 A;  3WS5 A;  5HAP A;  4GS9 A;  3LFV A;  1I2S A;  5CER A;  4Q0I A;  2ZMV A;  2XA7 S;  1DY6 A;  4FTX A;  5AQB A;  2ZQ7 A;  1W5D A;  2DNS A;  5GL9 A;  3CPT B;  3ZNT A;  3DAV A;  1ZG6 A;  3G2Y A;  3V3R A;  3EOI A;  3MZD A;  3DTE A;  2CC1 A;  4PHT A;  1LHY A;  4DE2 A;  5L8M A;  4BBU A;  4FOF A;  4GD6 A;  3C38 A;  4K91 A;  5DKL A;  3HL9 A;  3FZC A;  3EWK A;  4I38 A;  3FPW A;  1IYP A;  1HVB A;  4O01 A;  3GVB A;  5J8X A;  4Z1W A;  2Y2I A;  3T4J A;  2C5W B;  2OAP 1;  2WKR A;  2ZMF A;  4P87 A;  5D3O A;  1MWT A;  3HBR A;  3PBS A;  5HL1 A;  2PD8 A;  2EFU A;  2VA0 A;  2JE5 A;  1PWC A;  1RCJ A;  3ICY A;  3KSH A;  2P9V A;  3ZDJ A;  2VGL S;  3IH9 A;  1XJ2 A;  1K55 C;  4IED A;  5EPH A;  3NOP C;  1MC0 A;  4E3I A;  3E2K A;  3CJM A;  4JPM A;  3A0S A;  3A0R A;  4NXE A;  1XJ4 A;  2ZC3 B;  1SKO B;  3C7U A;  3NUL A;  4B93 A;  4D2O A;  1F98 A;  1S67 L;  5CRF A;  1F5M A;  5G4Y A;  3TW8 A;  2PR6 A;  4PPR A;  2W1T B;  4OQH A;  2IA2 A;  4CQH A;  2DCF A;  3WS4 A;  2ZC4 B;  3N7W A;  1DJC A;  1K0K A;  2IWB A;  1ZHH B;  3D3O A;  2FH5 A;  3CMZ A;  4GCZ A;  2XFT A;  1JWV A;  5IHV A;  1KGF A;  4OON A;  4QU3 A;  2Q9M A;  2PYR A;  5TFQ A;  2J3T D;  1CI9 A;  4LPZ A;  3PBR A;  3VOL A;  2AVX A;  3ZYT A;  4HQA A;  1W63 M;  4MBH A;  1K25 A;  1PWD A;  4R23 A;  3W4O A;  4EW7 A;  4EU0 A;  1EWZ A;  4BLM A;  2JC7 A;  3GSG A;  3FYZ A;  3S4X A;  1IYS A;  1YLP A;  5K5B A;  2JBF A;  1MZU A;  1RP5 A;  2Y2G A;  2P7J A;  3PR6 A;  5HAQ A;  3BYD A;  3TJZ C;  4R38 A;  4HES A;  1TDG A;  1YLJ A;  1V9Z A;  5CEB A;  1XGJ A;  1E3U D;  1JVJ A;  4KQQ A;  4PAU A;  4HBU A;  1VET A;  3UY6 A;  1FR6 A;  4MBK A;  2VGL M;  4PM7 A;  4RYE A;  4FUW A;  1NLY A;  1J3W A;  4LRX C;  1CEG A;  5FDS A;  2E8J A;  3DTI A;  3UMD A;  3HLW A;  4HIA A;  2O9C A;  1OPX A;  1D1J A;  5HD5 A;  4CLC B;  1H8Y A;  1M40 A;  1SKO A;  3LEQ A;  4LV0 A;  2KDK A;  5HZH A;  3UB9 A;  2ZD8 A;  5EFW A;  4PMA A;  1HLU P;  3LCE A;  3RXX A;  2WYX A;  4MLL A;  3RXW A;  4R3A A;  2Y2Q A;  2P9V B;  3MSH A;  3UPO A;  3C7V A;  3UE6 A;  3A3D A;  4S2M A;  2XSS A;  5GHX A;  5HDC A;  2Z2L B;  4GHI B;  2ZC5 B;  3HUM A;  1ODV A;  5FDH A;  2PD7 A;  2V0W A; 
#chains in the Genus database with same CATH homology
 2J80 A;  2HJE A;  2PT7 A;  1P9R A;  2R78 A;  1IOU A;  5HPI A;  4DN0 A;  5C5K A;  2KX6 A;  2PYP A;  3KO6 A;  4G3W A;  4QPR A;  5J7E A;  2K7S A;  2VZW A;  3H82 B;  3BWL A;  4WN5 A;  3E4Q A;  1OTD A;  4NXF A;  3EEA A;  3R4K A;  4H6J B;  4YWZ A;  1TD5 A;  4Y2F A;  2GZA A;  2Z6C A;  4E04 A;  2W27 A;  3R7W B;  3KX0 X;  2EWV A;  3B47 A;  1DP9 A;  1OT9 A;  3VE4 A;  3RH8 B;  2O0Y A;  2V0U A;  2OWJ A;  3LID A;  2HJ9 C;  4KQD A;  3G6O A;  3PYP A;  4P6Z M;  4B9O A;  2W3D A;  3LIE A;  3JVV A;  2M1C A;  2Y79 A;  1OJ5 A;  3KYQ A;  1P97 A;  3OOV A;  2LB9 A;  1NRJ A;  5F5Y A;  2O9A A;  4EET B;  4DMZ A;  3T4O A;  4EXO A;  4P6Z S;  4G3V A;  3BQA A;  2QKP A;  2YKH A;  4BBV A;  3SW1 A;  4DJ3 A;  3T50 A;  1N9L A;  1T1B A;  4HJ3 A;  2J3W A;  2OAQ 1;  4M4X A;  3LIC A;  5DJT A;  3T4L A;  4MMN A;  4OOL A;  3VV4 A;  2EA9 A;  4PKY A;  2V9A A;  4MN5 A;  1GSW A;  4ARZ A;  3R7W A;  4HNB A;  3C2W A;  4WEJ A;  2P04 A;  3LYX A;  3FG8 A;  4WL9 A;  3U2A A;  3NJA A;  1S66 L;  4I5S A;  2VKS A;  3W2Z A;  2KOI A;  2JHE A;  1TS0 A;  3HCY A;  4JGR A;  4XT2 A;  3UE3 A;  2VX8 A;  3V67 A;  1DP6 A;  4Q0H A;  4WF0 A;  1EW0 A;  1T19 A;  4AFI A;  5DFX A;  4NKP A;  2GNX A;  3CUE C;  2VEA A;  5IT5 A;  3CAX A;  5LBR A;  1KOU A;  4EER A;  4HOI A;  1V9Y A;  5DJU A;  3PHY A;  2JKR I;  2L1M A;  3KSI A;  4ARZ B;  3NOU C;  1H8M A;  2GJ3 A;  5F6A A;  1VHM A;  1LSW A;  1TS8 A;  2VJW A;  5F68 A;  1Y28 A;  2W1T A;  2EWW A;  4IJG A;  2CMN A;  2Y8H A;  3IBR A;  4CLC C;  1TS7 A;  1YSP A;  4KUK A;  3MFX A;  3VE3 A;  1OTA A;  1LSX A;  1UGU A;  3MJQ A;  1G28 A;  2JKR M;  2L0W A;  1XJ3 A;  4FSF A;  4CLC E;  5AVE A;  4L9G A;  1H3Q A;  3LR0 A;  1N9N A;  3BY9 A;  5J4E A;  3K3D A;  1T18 A;  1X0O A;  4HP4 A;  4K08 A;  3HJI A;  2QHK A;  1IFQ A;  3KYZ A;  4MDZ A;  2JKT M;  5HDD A;  2L4R A;  4WEK A;  3F1N B;  5J3W A;  5HPF A;  5AJG A;  3F1P B;  2PHY A;  2K31 A;  2PR5 A;  5IS1 A;  3K3C A;  5HWW A;  2LB5 A;  1LL8 A;  4EEU A;  3UB6 A;  4I3I A;  3OC2 A;  5A8B A;  2OWH A;  3BY8 A;  3H9W A;  2OOL A;  1D06 A;  3EEH A;  3IS2 A;  3T4K A;  3EQU A;  3LIB A;  3BW6 A;  3P01 A;  3UB8 A;  3LI8 A;  2B18 A;  1MKM A;  5MC7 A;  1NLZ A;  5HD3 A;  4UEY A;  2K2N A;  3LIA A;  3EGD C;  4O0P A;  2W3G A;  3NOT C;  3LR4 A;  2JN7 A;  3RTY A;  1F9I A;  2V1B A;  1NWZ A;  5TBM B;  2VV6 A;  1YAX A;  1N9O A;  1VB6 A;  3H82 A;  5HWT A;  4I39 A;  5IU1 A;  3E4P A;  4LRZ E;  5DF9 A;  3F1O B;  2O9B A;  4JGO A;  4O8G A;  4GS9 A;  3LFV A;  4IHQ A;  2ZBB A;  4Q0I A;  2ZMV A;  2XA7 S;  3NHQ A;  5KIZ A;  4LRY C;  1S4R A;  3MR0 A;  4HJ4 A;  2P08 A;  3DBA A;  5HL6 A;  2M7U A;  5F69 A;  4GLQ A;  4MN6 A;  4WUJ A;  3LIF A;  3B42 A;  3T4Q A;  2I9V A;  3IBJ A;  4NEE D;  4IUK A;  3EOI A;  4Y3I A;  3MMH A;  2ZOH A;  3EGX C;  3PXP A;  2W3H A;  4PHT A;  1TF1 A;  5L8M A;  4BBU A;  2YKF A;  1XJ6 A;  4FOF A;  3C38 A;  4L9E A;  1S4S A;  5DKL A;  2DMW A;  3CWF A;  3EWK A;  4I38 A;  3FPW A;  1S1Y A;  3MQO A;  2HGV A;  2XRN A;  5DFY A;  4GS9 B;  4O01 A;  4Z1W A;  5HSQ A;  3T4J A;  3BJN A;  2ZOI A;  1P9W A;  4I3J A;  2OAP 1;  2WKR A;  5I5L A;  4EEP A;  1LT0 A;  3H7W B;  2ZMF A;  2J3T C;  4GHI A;  4ETZ A;  1ZTU A;  2NUP C;  2KLI A;  3PBS A;  1T1A A;  5HDS A;  3TRC A;  3CI6 A;  2PD8 A;  2VA0 A;  3F1P A;  3KSH A;  3ICY A;  1BYW A;  3TE8 A;  2VGL S;  1OT6 A;  3GDI A;  3H7W A;  4MN7 A;  1JNU A;  1XJ2 A;  3FPV A;  2WKP A;  3OBF A;  4EQ1 A;  4BWI A;  3CLO A;  2D01 A;  4OOM A;  1GSV A;  4WLA A;  3D72 A;  3NOP C;  4NXB A;  1MC0 A;  1XFQ A;  3PBQ A;  3A0S A;  4HHD A;  3A0R A;  4NXE A;  1XJ4 A;  4HI4 A;  4B93 A;  4ZRR A;  3F1O A;  1DP8 A;  3MQQ A;  2D02 A;  1F98 A;  1S67 L;  3E98 A;  1F5M A;  4R6L A;  2WKQ A;  5G4Y A;  4HH2 A;  4JGP A;  3TW8 A;  2PR6 A;  4CLC A;  5TBM A;  2W1T B;  2XA7 M;  1OTI A;  1OTB A;  2IA2 A;  2W3E A;  4CQH A;  3F1N A;  4EUV A;  4BJP A;  1ZHH B;  2QYB A;  3D3O A;  2FH5 A;  4GCZ A;  3C8C A;  4ME4 A;  2A24 A;  4WEL A;  3CUE A;  3ZQ5 A;  4II7 A;  4F3L B;  4KUO A;  3MQ0 A;  4IUH A;  2PYR A;  2FZ0 A;  2VV8 A;  2V1A A;  2J3T D;  4LPZ A;  1STZ A;  1WA9 A;  4BBT A;  3PBR A;  3OCL A;  3VOL A;  1W63 Q;  2XRO A;  3ZYT A;  4HQA A;  1W63 M;  1DRM A;  2VV7 A;  3S7Q A;  1G6O A;  4L0L A;  4HJ6 A;  4BMW A;  4RQ9 A;  3MXQ A;  4EW7 A;  4EU0 A;  3OLO A;  4F3L A;  1LSV A;  3T4T A;  5HWV A;  3ULF A;  2B02 A;  1XFN A;  2GX5 A;  4PKY G;  5K5B A;  3JVU A;  1MZU A;  2QJ7 A;  2H28 A;  3LR5 A;  4L9F A;  4ETX A;  2P7J A;  3PR6 A;  4GW9 A;  3P7N A;  3RFB A;  3TJZ C;  2PDR A;  2Z6D A;  4R38 A;  4H6J A;  1UWP X;  3LR3 A;  4UQI S;  1P0Z A;  1V9Z A;  3MF0 A;  2BAS A;  3E0Y A;  3EQV A;  3KSF A;  2W3F A;  5TJJ A;  4Q0J A;  4G3K A;  3S7O A;  3OCN A;  4YNR A;  4PAU A;  4HH3 A;  1S1Z A;  2INW A;  4NXG A;  1YKD A;  2A24 B;  1T1C A;  2VGL M;  5G4Z A;  4CLC D;  2MJ6 A;  2W1R A;  4YOF A;  3IS2 B;  1NLY A;  4Y5F A;  3S7N A;  4LRX C;  4DJ2 A;  3A0V A;  2NUT C;  5AVF A;  4JGQ A;  3UMD A;  4GJ4 A;  4HIA A;  3T4S A;  5CX7 A;  2O9C A;  1OPX A;  2JKT I;  3KSG A;  4KQO A;  3UME A;  5HD5 A;  3K2N A;  4CLC B;  2HF6 A;  4I3A A;  3UB7 A;  2KDK A;  5HZH A;  3UB9 A;  2O99 A;  5EFW A;  3PBT A;  3GEC A;  3S7P A;  3O5Y A;  4HY8 A;  4R3A A;  2M7V A;  3FC7 A;  5KSH A;  3HJK A;  1OJG A;  2HV1 A;  3UE6 A;  4R70 A;  1D7E A;  2QJ5 A;  3BQ8 A;  2VLG A;  4XT2 B;  3C30 A;  4HP9 A;  5DKK A;  3B33 A;  2XSS A;  2W0N A;  4MCW A;  5HDC A;  1GSX A;  3E4O A;  3CIT A;  4GHI B;  5FL3 A;  4EES A;  4LLO B;  2A2L A;  1TS6 A;  1YSQ A;  3LI9 A;  4UQI M;  1ODV A;  1UWN X;  3PBN A;  2QWS A;  2G7U A;  3PBO A;  2PD7 A;  1OTE A;  3LUQ A;  2V0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...