5F5YA

Wt drosophila melanogaster cycle pas-b with bound ethylene glycol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
b'MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cycle
molecule tags Circadian clock protein
source organism Drosophila melanogaster
publication title WT Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
total genus 30
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f5yA00
2OOLA 3EEHA 3NOUC 2WKPA 2W0NA 3MQQA 1F98A 4HP9A 2WKQA 1S66L 3IBRA 1V9ZA 2VV6A 3LYXA 4EQ1A 4EESA 5J4EA 4PKYA 4HQAA 3LIDA 2GJ3A 3T50A 4GCZA 4DJ3A 2PYPA 4JGOA 4E04A 1OJ5A 4NXGA 2INWA 3MJQA 4BBVA 2H28A 2PYRA 3LIFA 4NXEA 4XT2B 3UB9A 3E4PA 4JGPA 4R3AA 1T19A 1V9YA 2D01A 1N9LA 4I38A 3RH8B 2PD8A 1OTEA 4WLAA 5DKLA 4EEPA 1T18A 2ZBBA 4H6JB 5A8BA 4I3AA 3C2WA 3MQOA 3VE3A 1OTIA 4R70A 4I3IA 2L0WA 4HP4A 1T1CA 3F1PA 1VB6A 5HDDA 2QJ5A 1WA9A 3D72A 3HJKA 4R6LA 1S67L 5DJUA 1OT6A 4WL9A 2ZOIA 3NOPC 1OT9A 4JGRA 2A24B 2CMNA 3NJAA 3H7WB 1TS0A 1UWNX 2PR6A 3A0SA 1D06A 4HOIA 4L9EA 2Z6CA 4R38A 4B9OA 4EERA 1EW0A 4KQDA 1D7EA 1P0ZA 1UWPX 3OLOA 4DJ2A 3IS2B 3GECA 4EXOA 4K08A 2B02A 4HNBA 5G4ZA 4EW7A 3K3DA 2V1BA 3K3CA 1DP8A 1XJ6A 5EFWA 3H7WA 2OWJA 3CAXA 3LI9A 2L1MA 3UB8A 3ZQ5A 2ZOHA 5HSQA 2V1AA 1DRMA 2W27A 4NXFA 4WUJA 2EA9A 5HZHA 2VV8A 5HDCA 1JNUA 1N9OA 3P7NA 4HJ4A 3FG8A 4KUKA 3E4OA 1ODVA 3SW1A 5IS1A 3ICYA 2YKFA 1OTBA 3F1NA 4YWZA 4M4XA 4XT2A 3VE4A 2JHEA 1TS7A 4LRYC 3LICA 4MN5A 4JGQA 3E4QA 4WN5A 5F6AA 2J80A 4HI4A 4EETB 1T1AA 2VEAA 3A0RA 1G28A 3NHQA 5DKKA 5I5LA 1OTDA 2R78A 5HWTA 3LIBA 5HD5A 3VOLA 2OWHA 3A0VA 4LRXC 4BBUA 3B33A 5HDSA 3GDIA 3BY9A 1UGUA 5KIZA 4F3LA 3LUQA 3H82A 2JN7A 3F1NB 3LIAA 3MR0A 5HWWA 2YKHA 1X0OA 3F1OB 3KX0X 1TS6A 4MN6A 1LSVA 4RQ9A 3BY8A 3PYPA 4EEUA 1OTAA 2KDKA 3EWKA 4HY8A 5J7EA 4HHDA 1TS8A 3MFXA 3H82B 1XFNA 3NOTC 4GS9A 4NXBA 3UE6A 2QJ7A 4BBTA 1T1BA 2PDRA 2Z6DA 1F9IA 1DP9A 4LRZE 1KOUA 2A24A 3F1OA 2VLGA 4HH2A 4WF0A 3UB7A 2HV1A 3C8CA 4L9GA 4GHIA 1DP6A 4GHIB 2D02A 4HJ6A 4I3JA 3UB6A 3BWLA 3CWFA 2V9AA 3FC7A 4PKYG 4HJ3A 5TBMA 2PHYA 5J3WA 3F1PB 1GSXA 1XJ3A 1XFQA 1S1ZA 2VV7A 1S4RA 5DJTA 3G6OA 5F69A 3UMDA 3ULFA 3MXQA 1NWZA 4HH3A 4KUOA 4L9FA 2M1CA 4F3LB 1N9NA 1BYWA 2KX6A 2V0UA 2V0WA 2I9VA 4GW9A 5AVEA 5AVFA 3CLOA 4LLOB 5F5YA 5IU1A 5HWVA 1GSVA 5TBMB 1LSXA 2WKRA 5G4YA 1MZUA 2BASA 4H6JA 4LPZA 1LT0A 3LI8A 4I5SA 3PHYA 2P7JA 3UMEA 3H9WA 3HJIA 1OJGA 1P97A 1LSWA 1XJ2A 2QWSA 3LIEA 4I39A 5HD3A 1GSWA 2K7SA 1LL8A 4HIAA 5F68A 4GS9B 1Y28A 2PR5A 3IS2A 3RTYA 1S4SA 2QHKA 2QKPA 1XJ4A 1S1YA 2PD7A 2L4RA
chains in the Genus database with same CATH superfamily
2NUTC 3WWXA 3MQQA 4HP9A 4WEKA 4OOMA 4EQ1A 3BQAA 4RX2A 4DJ3A 1WYCA 4GD6A 3MJQA 5CERA 2Y59A 4NXEA 4QY5A 1BUEA 4KZ9A 3MS6A 4S2KA 2RCXA 2P74A 1SZVA 1L3LA 2CMNA 3H7WB 5CGXA 2EFUA 5TR7A 4NG2A 5E43A 2XSSA 2HDQA 5L2FA 3TOIA 4BWIA 3K3CA 2L1MA 4GNUA 2W27A 4RX3A 5FEGA 5HAQA 5GLAA 3E4OA 3G32A 2YKFA 1WE4A 4F3LA 3VP2A 4CQHA 2XEPA 3VOLA 3N8LA 4FCFA 4KG5A 1ERQA 4IVIA 3MR0A 3BLMA 4QB8A 3F1OB 1SKOA 5FDSA 1LSVA 3BY8A 2Z2LB 1FR6A 5FQQA 1M6KA 1ZKJA 4GB7A 2A24A 1H8YA 4PPRA 3C8CA 1KGEA 3QP5A 3AGEA 3CWFA 4HJ3A 2PU2A 3SH7A 5HFOA 3ZG8B 4KZAA 5FQMA 4K91A 2ZL1B 3IXBA 5KSCA 3LCEA 5FAPA 1JWZA 3VP0A 5JYPA 4EBLA 1YSQA 2Q9MA 3NOUC 5J8XA 1V9ZA 1SKFA 4GCZA 3UNWA 4QU3A 3LIFA 1LLBA 2ZL1A 1TD5A 1XA1A 4S2OA 2WGWA 1VB6A 1G6OA 1PZPA 2ZOIA 3NOPC 4QY6A 3P09A 1UWNX 1A0KA 3IH8A 4BD0A 3IS2B 3T4SA 1Z6FA 2IWCA 4EW7A 2W3FA 3MBZA 2VX8A 1ZG4A 1L0GA 5HDCA 1JNUA 1KE3A 1TS7A 1BLSA 3DBAA 4EETB 1IYOA 1TEMA 3EGDC 3SS3A 3A0VA 1XXMA 3GDIA 3EOIA 5EM0A 4WBGA 1PNEA 5J7EA 4HY8A 1VEUA 1NYMA 5DFXA 3BWLA 2PHYA 4D2OA 4P6ZM 2W1TA 5CX7A 1IOUA 4YINA 5EUAA 3NI9A 3K2NA 1P9RA 3PTEA 1YLTA 3LI8A 3S7PA 4B93A 4I5SA 4KG2A 4X1LA 2QWSA 3MZEA 3MZDA 4OONA 3SH8A 2ZD8A 4UA6A 3IS2A 1STZA 3UDIA 1SCWA 4LRYC 2W3DA 4R3BA 5CHJA 2X01A 4DE2A 5CTNA 5GHYA 3V3SA 5HX9A 3P98A 5FDHA 4KZ8A 3Q1FA 3BLSA 4X56A 5EVIB 2QPNA 4CPKA 2XFTA 1GHPA 2XD1A 4H8RA 1HZOA 1KVMA 5EVIA 3C4PA 4OP8A 4A5RA 1ESIA 1MKIA 1ZHHB 1TDLA 4R38A 4FH2A 1EW0A 4WZ5A 1BULA 4JF5A 1ES5A 1YM1A 4Q0IA 5L07A 3OZHA 1XKZA 5EVEA 1GHIA 3CPTB 2J9PA 2EA9A 2Y2JA 3BW6A 1AWIA 3CG5A 3QP6A 3HLGA 3T4JA 2HP6A 4XT2A 3IXHA 4PM9A 3O87A 1PI4A 2VEAA 4BBUA 2R9WA 4CLCB 4JLFA 2OAQ1 4FUWA 5KMWA 3CUEC 4CJNA 4DE1A 2W1TB 3NOTC 4GS9A 3DTEA 2WADA 1SKOB 3F1OA 4WF0A 3V39A 3F1PB 1S1ZA 4Z9QA 1O7EA 4KUOA 4F3LB 2KX6A 2I9VA 1NJ4A 5CXWA 2Y55A 3DAVA 2XF3A 4KQQA 1TVFA 5CEBA 1P9WA 2Q0OA 3EEAA 3A3FA 4ETXA 3NBLA 3S7NA 2FFFB 4M3KA 3IX3A 1F5MA 1YKDA 4UEYA 3CJMA 3KSHA 2OOLA 3G34A 3EEHA 3NY4A 5AQAA 5HAIA 1C3BA 4PAUA 3JVUA 4PKYA 2A2LA 3S7OA 4RYEA 4LCLA 4U0TA 1W8YA 4ME4A 3KO6A 5GHZA 3IXGA 3HCYA 4Y15A 3ISGA 2Y91A 4I3AA 2H0YA 2ZMFA 3MQ0A 2WK0A 1GA9A 3DWKA 5GLCA 2XR0A 1IKIA 4D60A 4WZ4A 1FCOA 1FIKA 4E3LA 2QYBA 3ZHHA 2E8JA 2Y8HA 4E6WA 3CAXA 2G2WA 1JWVA 2HDSA 4IUHA 4GD8A 3T1SA 4WUJA 3HUNA 2VGJA 1K0KA 4R1GA 3UPNA 4JXSA 3PXPA 1JVJA 5I5LA 4LGWA 2C5WB 5HWTA 4LRXC 1YLJA 4IUKA 1MWRA 4E3IA 3IF6C 4MN6A 4WZ5C 3T1XA 1CJFA 3S22A 4E3KA 3BFDA 2DNSA 4DE3A 2VLGA 4XXRA 1DP6A 3IF6A 4I3JA 2O99A 1XFQA 3GMWA 3OPRA 4L9FA 5AVEA 1BLHA 1ESUA 3OCLA 4LLOB 2I72A 2QZ6A 4H6JA 4KZ5A 2P7JA 3UMEA 5U47A 1YPRA 3ZDJA 4RVAA 3Q07A 2DRWA 1FSWA 4LV0A 5KSHA 3VP3A 1DJCA 4S2MA 4C3QA 3DTMA 3C7UA 4ZTKA 3MKEA 2WAEA 2Y2IA 5J4EA 4CLCA 3LIDA 1W63Q 2E8IA 2PYPA 3PBOA 5M1AA 4GJ4A 1QMFA 4UA7A 4WLAA 3LR0A 1DY6A 5A91A 2OLVA 2XFSA 5I94A 1I2SA 2B5RA 4QWOA 4X68A 2A24B 5FAQA 4HOIA 4EERA 3O88A 2VZWA 3MXRA 1UWPX 3PR6A 4QJGA 2O9BA 5DF7A 4KQOA 4X69A 3CMZA 3LR4A 1K54C 1L0EA 1Q2PA 2K31A 4DXCA 2XD5A 4O01A 1UGUA 5DF9A 3LUQA 1NRJA 2WKIA 2GDNA 2YKHA 4MCWA 2WGIA 4RQ9A 3T4TA 2FZ0A 1H8ZA 2XA7M 2Y2MA 5AQ9A 1G5UA 4R23A 4HJ6A 2EXAA 3DWZA 1PWGA 3ZFZA 4OLGA 3ULFA 4OPYA 1L0DA 4HH3A 4RA7A 5HWVA 1GSVA 3JPUA 1KE0A 1MZUA 4YNRA 2WAFA 1LSWA 3UE0A 4I39A 1PFLA 1W8QA 4CLCE 2PD7A 4BENA 5L10A 1W5DA 5CECA 5FQKA 4B4XA 4S2JA 4R3JA 3MZFA 3C4OA 2KLIA 2PYRA 3HUMA 3GVBA 4JGPA 4JXGA 2D01A 4ARZB 2C6WB 4PM5A 1IYQA 4R70A 4I3IA 3ZYTA 1FSYA 4X53A 1EI5A 3T4OA 1MKMA 1K56A 4GLQA 2JKRM 3NJAA 2ZMAA 1D7EA 5D3OA 5FEFA 4DJ2A 5G4ZA 4GN2A 1ES3A 5CGWA 4Y0TA 1XJ6A 3SOIA 1ONHA 1N9OA 4EUVA 4ESPA 3C7VA 3V3RA 3ZVTA 2OWHA 5DVAA 5HDSA 5KIZA 3DTKA 3KYQA 1ACFA 3KX0X 1TS6A 4ZRRA 1SDEA 3SH9A 3BFFA 1OTAA 1WYBA 3NECA 1ES2A 3W4QA 3MFXA 2H10A 4MLLA 1DJBA 4OQGA 4E6XA 4JKTA 1QMEA 5DFYA 4FD8A 4WMCA 1MPLA 1XJ3A 5HL1A 1FOFA 1K25A 1BZAA 1U60A 5GLBA 4P6ZS 1OJGA 1GSWA 2HJ9C 4LV3A 1S4SA 3C5AA 3D3OA 3FV7A 5GHXA 3IWOA 2ZM0A 3FYZA 4MBKA 5EOOA 2INWA 3IHBA 3QHYA 4YOFA 3N4IA 4WM9A 4KG6A 3V50A 2HGVA 3RJUA 5A8BA 3VE3A 1S6RA 2JKFA 2ZQDA 2L0WA 3UN7A 4DE0A 1T1CA 5HDDA 4R6LA 2P9VB 3A0SA 4OH0A 1D06A 4YFMA 5FASA 1IYPA 3IWQA 2XROA 2ZM2A 4JF6A 3UY6A 2M7UA 2O0YA 3LI9A 3MKFA 2V1AA 3KSIA 1FR1A 5HZHA 4KQRA 1FCNA 3FWLA 2Y2KA 1OTBA 4IBRA 4C75A 3A0RA 1L0FA 4DF6A 1CK3A 3SS4A 3LIAA 5HWWA 2XQZA 1H3QA 5DF8A 3CPTA 4HHDA 3QNCA 2W1RA 1KOUA 1PZOA 1MWTA 3UB7A 5CHUA 4GHIB 2D02A 3OCNA 1K6SA 1MWUA 3LGOA 1GSXA 3JYIA 3MXQA 2VGLS 5G18A 3HLWA 2BASA 4LPZA 3RXWA 1YLPA 3TRCA 3H9WA 3PBQA 4GS9B 3HUOA 3GTCA 1BT5A 4OOLA 4X25A 4Y0UA 5AJGA 5LBRA 2ACGA 1I5QA 3CI6A 5EOEA 5TJJA 3BECA 1CEGA 1OJ5A 4XT2B 3UB9A 3IF5A 2V8FA 3NCKA 3WRZA 4JF4A 4UQIS 2VGKA 5DKLA 2Y2PA 3B3XA 4LCMA 3U4LP 3QP8A 1PYYA 2QJ5A 5GLDA 3PAEA 1K4FA 3IHAA 4DN0A 2GX5A 2Y79A 1TS0A 2EX9A 3Q7ZA 2ZQAA 3HLEA 3HBRA 3TJZC 4HNBA 5CEDA 3ZQ5A 4NXFA 4HEFA 2G7UA 1EWZA 3LY4A 3BRMA 1ODVA 3ICYA 3MMHA 3IT9A 5HSQA 4KZ6A 3B33A 3TE8A 1VEUB 2G2UA 2JKTM 4EU0A 3PBNA 5BOHA 1XGJA 4FTXA 3TG9A 3CHWP 3UE6A 2QJ7A 4QPRA 4HH2A 5TFQA 4OPRA 2GNXA 2HZ5A 5DJTA 4OPZA 4WYYA 3W4PA 2HPBA 4ZBEA 5F5YA 3M2KA 4E3NA 1LSXA 3ITBA 1YT4A 3PHYA 1HVBA 4QHCA 4K0WA 3ITAA 4PMAA 3S1YA 3LEQA 3WS1A 2ZQ8A 4MMNA 3CUEA 2HP9A 3IH9A 3A3EA 1F98A 2WGWB 2IWDA 2BG1A 3GV9A 4LV1A 4DDYA 2XH9A 4NXGA 2GZAA 4I38A 5L09A 4H6JB 2DCFA 1E4DA 2J3TD 5M19A 4PM6A 4X6TA 1L2SA 1WA9A 3HJKA 4OLDA 5C5KA 1S67L 1OT6A 2VA0A 3O3VA 3IQAA 2ZC5B 4R0QA 2OSUA 5GL9A 5HAPA 1J3WA 3FG8A 3L9KA 3G4PA 1FCMA 2JHEA 4EBNA 4MN5A 4WN5A 2J80A 1XA7A 1G28A 3NHQA 1OTDA 2J3TC 1CQAA 2AVXA 3E2KA 4IJGA 3PBTA 5HPFA 2J8YA 4E3MA 1KDWA 2W3HA 1N4OA 1I2WA 3W2ZA 1G6AA 1TS8A 1YQSA 2EFXA 1MWSA 5CGSA 1F9IA 4ARZA 4BJPA 4OP5A 4LFUA 4HBUA 4L9GA 3EGXC 3EQUA 2JCHA 1BSGA 3G2ZA 4O0PA 5F69A 1S4RA 2ZC7A 3L7HA 1VHMA 4XUZA 1PW8A 5FAOA 2ZC4B 2W3EA 3HJIA 5F82A 4HIAA 3KYZA 4FOFA 3RTYA 1KDSA 2JC7A 3UO9A 3JVVA 4GDBA 2WKQA 3IBRA 2EWVA 4MDZA 2EX6A 1SDNA 3AGDA 2Y4AA 2JKGA 5DTKA 3TSGA 2PD8A 1OTEA 3C2WA 1K55A 4FH4A 1IKGA 3OPPA 4JXWA 1K4EA 1AXBA 3BEBA 4EQIA 3FPVA 4OOYA 3UE3A 3R7WA 4JGRA 4DDSA 2JE5A 4OKPA 1K54A 1P0ZA 2FH5A 4MN7A 4S2PA 4HJ4A 4PM7A 4Y3IA 3LICA 4OVDA 4P0MA 2KOIA 5F6AA 2A3UA 1K38A 4FSFA 3Q7VB 1HD8A 4OPQA 3EQVA 4JPMA 1FQGA 1X0OA 4K0XA 3VMAA 5K5BA 2V1ZA 1CEFA 4GKUA 3G35A 4CLCD 2Z6DA 4LRZE 2PT7A 3GQZA 3G30A 2Q9NA 3FC7A 2V9AA 3O5YA 4PKYG 5J3WA 3W8KA 3UMDA 4KZ3A 4DRTA 3VFFA 5TBMB 4AFIA 2WKRA 1FILA 5F1FA 1H5XA 1P97A 2IA2A 4DMZA 2EWWA 2K7SA 4MBFA 1LL8A 3D72A 3IX4A 3A3JA 1S66L 2VV6A 3ZG5A 3LYXA 1XP4A 4E04A 4HQAA 3VV4A 3ZG9B 2CC1A 4UQIM 4JGOA 3KYEA 4XUXA 2EXBA 3BFGA 4BBVA 3G31A 3IF6B 1ALQA 4UAAA 1T19A 3RH8B 2H5SA 4UA9A 1OTIA 4II7A 4Y7PA 3PBRA 3N7WA 1OPXA 2PBYA 1K55C 3MFDA 3KSFA 2XK1A 1ZTUA 2Z6CA 4KQDA 3O86A 1K6RA 3UB5P 2B02A 3PAGA 3WRTA 4IHQA 3K3DA 2QMIA 3GSGA 4WELA 2O9AA 4Q8IA 1YAXA 2ZC3B 3C30A 4YWZA 3C38A 2JKTI 1JWPA 3BY9A 1XGIA 2P9VA 1CI8A 4JXVA 4EEUA 1ZG6A 3NIAA 1LHYA 3VP4A 4P87A 4N92A 2HV1A 2V8CA 2Y2NA 1MC0A 3G2YA 2MJ6A 1D1JA 4DKIA 2Y2GA 1NWZA 2M1CA 2ZM8A 1G68A 4ZDXA 3D9YA 3HVFA 3N8SA 3SZTA 1XJ4A 1S1YA 2W0NA 1YMXA 2GJ3A 4G3KA 4R4RA 2H28A 4IVKA 4Y17A 2RL3A 1V9YA 1RGYA 4EEPA 5EM1A 3RFBA 4U0XA 1RP5A 4KENB 2XRNA 5TGFA 5E2FA 2V2FF 1NLYA 1SHVA 4JBFA 4X55A 1XX2A 2ZQCA 2V20A 3DTIA 5EVLA 4K08A 2HDUA 1DP8A 1NYYA 1MY8A 1ZC2A 2OWJA 4KZ7A 2WZXA 5DTSA 1DRMA 2FFYA 3HLBA 3M6BA 2BTFP 3B47A 1LL9A 4Y0OA 5IS1A 3W4OA 4ZJ3A 2Y2LA 5HD5A 4P85A 2HF6A 3LY3A 3H82A 2VJWA 3I7JA 4Z1WA 1IEMA 5EPHA 2J3WA 3KSGA 3A3DA 2J7VA 1E3UA 3R4KA 1HLUP 3V5MA 2UV0E 3G6OA 5FATA 5JYOA 3T1QB 2V0WA 1EROA 2EX8A 3N6IA 5FA7A 5EV0A 2OV5A 1HTZA 5EVID 3LIEA 3N8RA 1CI9A 3WS2A 1Y28A 2Z2MB 2QHKA 2EX2A 4B9OA 4PM8A 2A49A 2ZLYA 3M6HA 2OLUA 1BTLA 4EV4A 3WS5A 3OBFA 3LO7A 4NKPA 5AQBA 3OOVA 1K57C 4L0LA 3LR5A 3E98A 4HP4A 2WKEA 4Q0JA 2PBDP 4WL9A 2PRFA 3Q81A 2P04A 2PR6A 4L9EA 1OMEA 3OLOA 2P08A 2O9CA 3LFVA 2XGNA 3CITA 3QNBA 2JBFA 3Q82A 3UB8A 5IHVA 1S0WA 3UDFA 4BD1A 2VV8A 4ZJ1A 4KUKA 4HBTA 1Y4OA 3AGFA 3F1NA 1VETA 1Y54A 1JTDA 3LIBA 4ETZA 3UE1A 2XA7S 1VETB 4BLMA 2JN7A 3F1NB 5IT5A 3WS0A 2VK3A 4N1HA 1KGGA 5CTMA 3PBSA 3TW8A 5MC7A 3VSKA 3UB6A 3ZCZA 3GRJA 3E0YA 3VOYA 1RGZA 3UPOA 3QP1A 1XPBA 1N9NA 2V0UA 4GW9A 5AVFA 1JTGA 4IEDA 4EBPA 5HD3A 3VP1A 1MBLA 1PWCA 2L4RA 2NUPC 2PU4A 4S2LA 2ZQ7A 4MEZA 1YLWA 3IWIA 4EESA 3T50A 1NRFA 4EWFA 4BL3A 3QP2A 4LENA 3ZGAB 2J9OA 2ZQ9A 1T18A 3MSHA 1TF1A 1LI9A 4NK3A 5DJUA 4G3VA 2ZC6B 4S2IA 5HW3A 3FKVA 2M7VA 4E3JA 5HARA 4WMCD 3R7WB 3GECA 3T4LA 2BLSA 3GR2A 2LB9A 3BM6A 4HESA 3BFEA 3A3IA 4JGQA 4HI4A 1T1AA 2K2NA 2HJEA 1O07A 3NDGA 5FL3A 3S4XA 3ZG7B 4NXBA 3H82B 3HLCA 2UWXA 1T1BA 1DP9A 4Q0HA 1H0MA 4GHIA 4E3OA 3OPLA 4ID4A 3ZVWA 4IBXA 1IELA 5FQ9A 1KE4A 3T12B 3CLOA 5F83A 5KZHA 4Y13A 3CZDA 5F1GA 2X02A 3M2JA 3VFHA 5AQ7A 2WYXA 1CF0A 2DMWA 3T4QA 1E3UD 4OQIA 5F68A 4OQHA 3UPPA 4QD4A 1W7FA 2QKPA 3BJNA 3T4KA 2V1BA 2B18A 2WKHA 1Q2QA 3WS4A 1ERMA 1IYSA 3VSLA 1DJAA 4GDNA 2ZJ9A 2VKSA 5HL6A 1YSPA 1N9LA 5E2HA 4ZJ2A 1NLZA 4LV2A 2ZBBA 3FZCA 4C6YA 1LI0A 3IBJA 4KZ4A 1M40A 3LR3A 4U3TA 1OT9A 3IX8A 4WEJA 3UDXA 4EUZA 3LEZA 4EXOA 1NXYA 1YLYA 3H7WA 5CRFA 3RXXA 3FKWA 5A90A 5CHMA 1ES4A 3SW1A 5A92A 4R4SA 4M4XA 2ZMVA 1F2KA 3E4QA 3U2AA 5DKKA 4CLCC 2R78A 5E2GA 5FI2A 3P01A 3D4FA 5E2EA 1ONGA 2HDRA 2IWBA 4Y2FA 3MF0A 3BFCA 3SS5A 3PYPA 4OQ0A 3NDEA 1W63M 4NETA 2OAP1 2PDRA 4N1XA 2VGLM 1E25A 4MNRA 5FQJA 3HREA 3VOZA 5FQIA 4MBHA 5HPIA 2VV7A 4ZAMA 3ZNTA 2Y2HA 1BYWA 4NEED 4PHTA 5FI6A 5G4YA 1LT0A 1W79A 1XJ2A 3HLDA 5A93A 4O8GA 2JKRI 5M18A 3QP4A 1KVLA 2WKPA 4F94A 3OC2A 3ZNYA 2WGVA 4X1MA 4G3WA 1IFQA 4S2NC 4Y5FA 2Y2OA 1VM1A 4O7DA 1MXOA 3E4PA 4R3AA 1PWDA 4KZBA 1J9MA 2H0TA 2XLNA 2XDMA 3MQOA 5EECA 3BQ8A 2WUQA 3F1PA 2HP5A 1VQQA 3S7QA 1H8MA 3MXSA 2LB5A 1K57A 3HLFA 1BLCA 3DW0A 3HL9A 4DXBA 5EFWA 1BLPA 1NZUA 2ZOHA 4B4ZA 3E2LA 1LL5A 1Z09A 4BL2A 3P7NA 4N9LA 3BYDA 1K56D 4UHUA 3VE4A 2PAVP 3NULA 3ZG0A 3OPHA 4B88A 2WZZA 1GCEA 4BMWA 4BQMA 5DTTA 5FI7A 1PIOA 4S2NA 1KGFA 2KDKA 3EWKA 1XFNA 3Q7VA 4BBTA 2Y2QA 5EVIC 1PRQA 2B95A 1GA0A 3FPWA 4GZBA 5TBMA 3V67A 2X71A 2W3GA 3B42A 1GHMA 1PW1A 3T1RA 5FSRA 4N9KA 1TDGA 3NC8A 5IU1A 1YMSA 2R9XA 1NZOA 1PI5A 3IXDA 1N9BA 5EE8A 5L8MA 1NY0A 1RCJA 2PR5A 1YLZA 4GOGA 4P6BA
chains in the Genus database with same CATH topology
2NUTC 3MQQA 1F98A 4HP9A 4WEKA 4OOMA 4EQ1A 5J4EA 4CLCA 3BQAA 4DJ3A 3LIDA 1W63Q 2PYPA 3PBOA 4GJ4A 4NXGA 3MJQA 3OBFA 4NKPA 4NXEA 3OOVA 2GZAA 4I38A 4WLAA 4H6JB 3LR0A 4L0LA 2J3TD 3LR5A 3E98A 4HP4A 4Q0JA 1WA9A 3HJKA 5C5KA 1S67L 1OT6A 4WL9A 2A24B 2CMNA 2P04A 3H7WB 4HOIA 2PR6A 4L9EA 2VA0A 4EERA 2VZWA 1UWPX 2XSSA 3OLOA 3PR6A 2P08A 2O9BA 4BWIA 2O9CA 3LFVA 3CITA 3K3CA 3UB8A 2L1MA 2W27A 4KQOA 2VV8A 4KUKA 3FG8A 3E4OA 2YKFA 3LR4A 3F1NA 2JHEA 4MN5A 4WN5A 4F3LA 4CQHA 2J80A 1G28A 3NHQA 3VOLA 1OTDA 3LIBA 2J3TC 2K31A 4ETZA 4O01A 1UGUA 4IJGA 5DF9A 3PBTA 3LUQA 1NRJA 2XA7S 2JN7A 3F1NB 3MR0A 5HPFA 5IT5A 2YKHA 4MCWA 3F1OB 2W3HA 1LSVA 4RQ9A 3W2ZA 3BY8A 3PBSA 3T4TA 2FZ0A 1TS8A 3TW8A 5MC7A 2XA7M 1F9IA 4ARZA 4BJPA 2A24A 3C8CA 4L9GA 3EGXC 3EQUA 3UB6A 4HJ6A 3E0YA 3CWFA 4HJ3A 4O0PA 5F69A 1S4RA 3ULFA 4HH3A 1N9NA 2V0UA 4GW9A 5AVFA 1VHMA 5HWVA 1GSVA 1MZUA 4YNRA 2W3EA 3HJIA 5HD3A 1LSWA 4I39A 4HIAA 3KYZA 1YSQA 4FOFA 3RTYA 4CLCE 2PD7A 2L4RA 3NOUC 3JVVA 2NUPC 2WKQA 3IBRA 1V9ZA 4EESA 3T50A 2EWVA 4MDZA 4GCZA 2KLIA 2PYRA 3LIFA 4JGPA 2D01A 4ARZB 2PD8A 1OTEA 1T18A 1TD5A 3C2WA 4R70A 4I3IA 1TF1A 3ZYTA 3FPVA 1VB6A 3T4OA 1MKMA 4GLQA 3UE3A 3R7WA 2JKRM 5DJUA 4G3VA 1G6OA 2ZOIA 3NOPC 4JGRA 3NJAA 1UWNX 2M7VA 1D7EA 1P0ZA 4DJ2A 3R7WB 2FH5A 3IS2B 3GECA 3T4SA 3T4LA 5G4ZA 4EW7A 2W3FA 1XJ6A 4MN7A 2VX8A 2LB9A 5HDCA 1JNUA 1N9OA 4HJ4A 4Y3IA 4EUVA 1TS7A 3LICA 3DBAA 2KOIA 4JGQA 5F6AA 4EETB 4HI4A 1T1AA 3EGDC 2OWHA 3A0VA 5HDSA 3GDIA 2K2NA 4FSFA 5KIZA 2HJEA 3KYQA 3EOIA 3EQVA 1X0OA 3KX0X 1TS6A 4ZRRA 5FL3A 5J7EA 1OTAA 4HY8A 5K5BA 4NXBA 3MFXA 3H82B 4CLCD 1T1BA 2Z6DA 1DP9A 4LRZE 4Q0HA 2PT7A 4GHIA 5DFYA 5DFXA 3BWLA 3FC7A 2V9AA 3O5YA 4PKYG 2PHYA 5J3WA 1XJ3A 4P6ZM 3UMDA 2W1TA 5CX7A 1IOUA 3CLOA 3K2NA 1P9RA 5TBMB 4AFIA 2WKRA 3LI8A 3S7PA 4B93A 4I5SA 4P6ZS 1OJGA 1P97A 2IA2A 2QWSA 4DMZA 2DMWA 2EWWA 1GSWA 2K7SA 3T4QA 1LL8A 5F68A 2HJ9C 3IS2A 1S4SA 1STZA 3T4KA 2QKPA 3BJNA 4LRYC 3D72A 2V1BA 3D3OA 2W3DA 2B18A 1S66L 2VV6A 3LYXA 4E04A 4HQAA 3VV4A 4UQIM 4JGOA 2INWA 2VKSA 4BBVA 5HL6A 4YOFA 1YSPA 1T19A 1N9LA 3RH8B 1NLZA 2HGVA 2ZBBA 5A8BA 3VE3A 1OTIA 4II7A 2L0WA 1T1CA 3PBRA 3IBJA 1OPXA 5HDDA 4R6LA 3KSFA 3LR3A 1OT9A 4WEJA 1ZHHB 3A0SA 1D06A 4R38A 1ZTUA 2Z6CA 1EW0A 4KQDA 2XROA 4EXOA 2B02A 4IHQA 4Q0IA 3K3DA 2M7UA 2O0YA 3H7WA 3LI9A 4WELA 2V1AA 2O9AA 3KSIA 2EA9A 5HZHA 3BW6A 1YAXA 3SW1A 3C30A 1OTBA 4YWZA 3T4JA 4M4XA 4XT2A 2ZMVA 3E4QA 3C38A 2JKTI 3U2AA 2VEAA 3A0RA 5DKKA 4CLCC 2R78A 4BBUA 3P01A 4CLCB 3BY9A 4Y2FA 2OAQ1 3LIAA 3MF0A 5HWWA 3CUEC 1H3QA 3PYPA 4EEUA 4HHDA 2W1TB 1W63M 3NOTC 4GS9A 2OAP1 2PDRA 2W1RA 2VGLM 1KOUA 3F1OA 4WF0A 3UB7A 2HV1A 4GHIB 2D02A 1MC0A 3OCNA 2MJ6A 3F1PB 1GSXA 5HPIA 1S1ZA 2VV7A 3MXQA 1NWZA 2VGLS 4KUOA 2M1CA 4F3LB 2KX6A 1BYWA 4NEED 2I9VA 4PHTA 5G4YA 2BASA 4LPZA 1LT0A 3TRCA 3H9WA 1XJ2A 3PBQA 1P9WA 3EEAA 4ETXA 4O8GA 3S7NA 4GS9B 2JKRI 1F5MA 1YKDA 4UEYA 1XJ4A 1S1YA 4OOLA 3KSHA 2OOLA 3EEHA 2WKPA 2W0NA 5AJGA 5LBRA 4PAUA 3JVUA 3CI6A 3OC2A 4PKYA 2GJ3A 4G3KA 5TJJA 2A2LA 1OJ5A 4G3WA 1IFQA 3S7OA 4Y5FA 2H28A 4XT2B 3UB9A 3E4PA 3KO6A 4ME4A 4R3AA 1V9YA 3HCYA 4UQIS 4EEPA 5DKLA 4I3AA 3MQOA 3RFBA 3BQ8A 2ZMFA 2XRNA 3MQ0A 3F1PA 2QJ5A 3S7QA 4DN0A 1NLYA 2GX5A 2Y79A 1H8MA 1TS0A 4B9OA 2LB5A 2QYBA 4K08A 3TJZC 4HNBA 2Y8HA 5EFWA 1DP8A 2OWJA 3CAXA 3ZQ5A 2ZOHA 4IUHA 1DRMA 4NXFA 4WUJA 2G7UA 3P7NA 1ODVA 3ICYA 3B47A 3MMHA 3VE4A 3PXPA 5IS1A 5I5LA 5HSQA 5HWTA 5HD5A 4BMWA 4LRXC 3B33A 4IUKA 3TE8A 2HF6A 2JKTM 3H82A 2VJWA 4Z1WA 4EU0A 3PBNA 4MN6A 2J3WA 2KDKA 3EWKA 1XFNA 3UE6A 2QJ7A 4BBTA 4QPRA 3KSGA 3R4KA 4HH2A 2VLGA 1DP6A 4I3JA 3FPWA 2O99A 5TBMA 2GNXA 5DJTA 1XFQA 3V67A 2W3GA 3G6OA 3B42A 4L9FA 2V0WA 5AVEA 3OCLA 5F5YA 4LLOB 5IU1A 1LSXA 4H6JA 3PHYA 2P7JA 3UMEA 5L8MA 3LIEA 1Y28A 2PR5A 5KSHA 2QHKA 4MMNA 3CUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOL A;  3EEH A;  3NOU C;  2WKP A;  2W0N A;  3MQQ A;  1F98 A;  4HP9 A;  2WKQ A;  1S66 L;  3IBR A;  1V9Z A;  2VV6 A;  3LYX A;  4EQ1 A;  4EES A;  5J4E A;  4PKY A;  4HQA A;  3LID A;  2GJ3 A;  3T50 A;  4GCZ A;  4DJ3 A;  2PYP A;  4JGO A;  4E04 A;  1OJ5 A;  4NXG A;  2INW A;  3MJQ A;  4BBV A;  2H28 A;  2PYR A;  3LIF A;  4NXE A;  4XT2 B;  3UB9 A;  3E4P A;  4JGP A;  4R3A A;  1T19 A;  1V9Y A;  2D01 A;  1N9L A;  4I38 A;  3RH8 B;  2PD8 A;  1OTE A;  4WLA A;  5DKL A;  4EEP A;  1T18 A;  2ZBB A;  4H6J B;  5A8B A;  4I3A A;  3C2W A;  3MQO A;  3VE3 A;  1OTI A;  4R70 A;  4I3I A;  2L0W A;  4HP4 A;  1T1C A;  3F1P A;  1VB6 A;  5HDD A;  2QJ5 A;  1WA9 A;  3D72 A;  3HJK A;  4R6L A;  1S67 L;  5DJU A;  1OT6 A;  4WL9 A;  2ZOI A;  3NOP C;  1OT9 A;  4JGR A;  2A24 B;  2CMN A;  3NJA A;  3H7W B;  1TS0 A;  1UWN X;  2PR6 A;  3A0S A;  1D06 A;  4HOI A;  4L9E A;  2Z6C A;  4R38 A;  4B9O A;  4EER A;  1EW0 A;  4KQD A;  1D7E A;  1P0Z A;  1UWP X;  3OLO A;  4DJ2 A;  3IS2 B;  3GEC A;  4EXO A;  4K08 A;  2B02 A;  4HNB A;  5G4Z A;  4EW7 A;  3K3D A;  2V1B A;  3K3C A;  1DP8 A;  1XJ6 A;  5EFW A;  3H7W A;  2OWJ A;  3CAX A;  3LI9 A;  2L1M A;  3UB8 A;  3ZQ5 A;  2ZOH A;  5HSQ A;  2V1A A;  1DRM A;  2W27 A;  4NXF A;  4WUJ A;  2EA9 A;  5HZH A;  2VV8 A;  5HDC A;  1JNU A;  1N9O A;  3P7N A;  4HJ4 A;  3FG8 A;  4KUK A;  3E4O A;  1ODV A;  3SW1 A;  5IS1 A;  3ICY A;  2YKF A;  1OTB A;  3F1N A;  4YWZ A;  4M4X A;  4XT2 A;  3VE4 A;  2JHE A;  1TS7 A;  4LRY C;  3LIC A;  4MN5 A;  4JGQ A;  3E4Q A;  4WN5 A;  5F6A A;  2J80 A;  4HI4 A;  4EET B;  1T1A A;  2VEA A;  3A0R A;  1G28 A;  3NHQ A;  5DKK A;  5I5L A;  1OTD A;  2R78 A;  5HWT A;  3LIB A;  5HD5 A;  3VOL A;  2OWH A;  3A0V A;  4LRX C;  4BBU A;  3B33 A;  5HDS A;  3GDI A;  3BY9 A;  1UGU A;  5KIZ A;  4F3L A;  3LUQ A;  3H82 A;  2JN7 A;  3F1N B;  3LIA A;  3MR0 A;  5HWW A;  2YKH A;  1X0O A;  3F1O B;  3KX0 X;  1TS6 A;  4MN6 A;  1LSV A;  4RQ9 A;  3BY8 A;  3PYP A;  4EEU A;  1OTA A;  2KDK A;  3EWK A;  4HY8 A;  5J7E A;  4HHD A;  1TS8 A;  3MFX A;  3H82 B;  1XFN A;  3NOT C;  4GS9 A;  4NXB A;  3UE6 A;  2QJ7 A;  4BBT A;  1T1B A;  2PDR A;  2Z6D A;  1F9I A;  1DP9 A;  4LRZ E;  1KOU A;  2A24 A;  3F1O A;  2VLG A;  4HH2 A;  4WF0 A;  3UB7 A;  2HV1 A;  3C8C A;  4L9G A;  4GHI A;  1DP6 A;  4GHI B;  2D02 A;  4HJ6 A;  4I3J A;  3UB6 A;  3BWL A;  3CWF A;  2V9A A;  3FC7 A;  4PKY G;  4HJ3 A;  5TBM A;  2PHY A;  5J3W A;  3F1P B;  1GSX A;  1XJ3 A;  1XFQ A;  1S1Z A;  2VV7 A;  1S4R A;  5DJT A;  3G6O A;  5F69 A;  3UMD A;  3ULF A;  3MXQ A;  1NWZ A;  4HH3 A;  4KUO A;  4L9F A;  2M1C A;  4F3L B;  1N9N A;  1BYW A;  2KX6 A;  2V0U A;  2V0W A;  2I9V A;  4GW9 A;  5AVE A;  5AVF A;  3CLO A;  4LLO B;  5F5Y A;  5IU1 A;  5HWV A;  1GSV A;  5TBM B;  1LSX A;  2WKR A;  5G4Y A;  1MZU A;  2BAS A;  4H6J A;  4LPZ A;  1LT0 A;  3LI8 A;  4I5S A;  3PHY A;  2P7J A;  3UME A;  3H9W A;  3HJI A;  1OJG A;  1P97 A;  1LSW A;  1XJ2 A;  2QWS A;  3LIE A;  4I39 A;  5HD3 A;  1GSW A;  2K7S A;  1LL8 A;  4HIA A;  5F68 A;  4GS9 B;  1Y28 A;  2PR5 A;  3IS2 A;  3RTY A;  1S4S A;  2QHK A;  2QKP A;  1XJ4 A;  1S1Y A;  2PD7 A;  2L4R A; 
#chains in the Genus database with same CATH topology
 2NUT C;  3WWX A;  3MQQ A;  4HP9 A;  4WEK A;  4OOM A;  4EQ1 A;  3BQA A;  4RX2 A;  4DJ3 A;  1WYC A;  4GD6 A;  3MJQ A;  5CER A;  2Y59 A;  4NXE A;  4QY5 A;  1BUE A;  4KZ9 A;  3MS6 A;  4S2K A;  2RCX A;  2P74 A;  1SZV A;  1L3L A;  2CMN A;  3H7W B;  5CGX A;  2EFU A;  5TR7 A;  4NG2 A;  5E43 A;  2XSS A;  2HDQ A;  5L2F A;  3TOI A;  4BWI A;  3K3C A;  2L1M A;  4GNU A;  2W27 A;  4RX3 A;  5FEG A;  5HAQ A;  5GLA A;  3E4O A;  3G32 A;  2YKF A;  1WE4 A;  4F3L A;  3VP2 A;  4CQH A;  2XEP A;  3VOL A;  3N8L A;  4FCF A;  4KG5 A;  1ERQ A;  4IVI A;  3MR0 A;  3BLM A;  4QB8 A;  3F1O B;  1SKO A;  5FDS A;  1LSV A;  3BY8 A;  2Z2L B;  1FR6 A;  5FQQ A;  1M6K A;  1ZKJ A;  4GB7 A;  2A24 A;  1H8Y A;  4PPR A;  3C8C A;  1KGE A;  3QP5 A;  3AGE A;  3CWF A;  4HJ3 A;  2PU2 A;  3SH7 A;  5HFO A;  3ZG8 B;  4KZA A;  5FQM A;  4K91 A;  2ZL1 B;  3IXB A;  5KSC A;  3LCE A;  5FAP A;  1JWZ A;  3VP0 A;  5JYP A;  4EBL A;  1YSQ A;  2Q9M A;  3NOU C;  5J8X A;  1V9Z A;  1SKF A;  4GCZ A;  3UNW A;  4QU3 A;  3LIF A;  1LLB A;  2ZL1 A;  1TD5 A;  1XA1 A;  4S2O A;  2WGW A;  1VB6 A;  1G6O A;  1PZP A;  2ZOI A;  3NOP C;  4QY6 A;  3P09 A;  1UWN X;  1A0K A;  3IH8 A;  4BD0 A;  3IS2 B;  3T4S A;  1Z6F A;  2IWC A;  4EW7 A;  2W3F A;  3MBZ A;  2VX8 A;  1ZG4 A;  1L0G A;  5HDC A;  1JNU A;  1KE3 A;  1TS7 A;  1BLS A;  3DBA A;  4EET B;  1IYO A;  1TEM A;  3EGD C;  3SS3 A;  3A0V A;  1XXM A;  3GDI A;  3EOI A;  5EM0 A;  4WBG A;  1PNE A;  5J7E A;  4HY8 A;  1VEU A;  1NYM A;  5DFX A;  3BWL A;  2PHY A;  4D2O A;  4P6Z M;  2W1T A;  5CX7 A;  1IOU A;  4YIN A;  5EUA A;  3NI9 A;  3K2N A;  1P9R A;  3PTE A;  1YLT A;  3LI8 A;  3S7P A;  4B93 A;  4I5S A;  4KG2 A;  4X1L A;  2QWS A;  3MZE A;  3MZD A;  4OON A;  3SH8 A;  2ZD8 A;  4UA6 A;  3IS2 A;  1STZ A;  3UDI A;  1SCW A;  4LRY C;  2W3D A;  4R3B A;  5CHJ A;  2X01 A;  4DE2 A;  5CTN A;  5GHY A;  3V3S A;  5HX9 A;  3P98 A;  5FDH A;  4KZ8 A;  3Q1F A;  3BLS A;  4X56 A;  5EVI B;  2QPN A;  4CPK A;  2XFT A;  1GHP A;  2XD1 A;  4H8R A;  1HZO A;  1KVM A;  5EVI A;  3C4P A;  4OP8 A;  4A5R A;  1ESI A;  1MKI A;  1ZHH B;  1TDL A;  4R38 A;  4FH2 A;  1EW0 A;  4WZ5 A;  1BUL A;  4JF5 A;  1ES5 A;  1YM1 A;  4Q0I A;  5L07 A;  3OZH A;  1XKZ A;  5EVE A;  1GHI A;  3CPT B;  2J9P A;  2EA9 A;  2Y2J A;  3BW6 A;  1AWI A;  3CG5 A;  3QP6 A;  3HLG A;  3T4J A;  2HP6 A;  4XT2 A;  3IXH A;  4PM9 A;  3O87 A;  1PI4 A;  2VEA A;  4BBU A;  2R9W A;  4CLC B;  4JLF A;  2OAQ 1;  4FUW A;  5KMW A;  3CUE C;  4CJN A;  4DE1 A;  2W1T B;  3NOT C;  4GS9 A;  3DTE A;  2WAD A;  1SKO B;  3F1O A;  4WF0 A;  3V39 A;  3F1P B;  1S1Z A;  4Z9Q A;  1O7E A;  4KUO A;  4F3L B;  2KX6 A;  2I9V A;  1NJ4 A;  5CXW A;  2Y55 A;  3DAV A;  2XF3 A;  4KQQ A;  1TVF A;  5CEB A;  1P9W A;  2Q0O A;  3EEA A;  3A3F A;  4ETX A;  3NBL A;  3S7N A;  2FFF B;  4M3K A;  3IX3 A;  1F5M A;  1YKD A;  4UEY A;  3CJM A;  3KSH A;  2OOL A;  3G34 A;  3EEH A;  3NY4 A;  5AQA A;  5HAI A;  1C3B A;  4PAU A;  3JVU A;  4PKY A;  2A2L A;  3S7O A;  4RYE A;  4LCL A;  4U0T A;  1W8Y A;  4ME4 A;  3KO6 A;  5GHZ A;  3IXG A;  3HCY A;  4Y15 A;  3ISG A;  2Y91 A;  4I3A A;  2H0Y A;  2ZMF A;  3MQ0 A;  2WK0 A;  1GA9 A;  3DWK A;  5GLC A;  2XR0 A;  1IKI A;  4D60 A;  4WZ4 A;  1FCO A;  1FIK A;  4E3L A;  2QYB A;  3ZHH A;  2E8J A;  2Y8H A;  4E6W A;  3CAX A;  2G2W A;  1JWV A;  2HDS A;  4IUH A;  4GD8 A;  3T1S A;  4WUJ A;  3HUN A;  2VGJ A;  1K0K A;  4R1G A;  3UPN A;  4JXS A;  3PXP A;  1JVJ A;  5I5L A;  4LGW A;  2C5W B;  5HWT A;  4LRX C;  1YLJ A;  4IUK A;  1MWR A;  4E3I A;  3IF6 C;  4MN6 A;  4WZ5 C;  3T1X A;  1CJF A;  3S22 A;  4E3K A;  3BFD A;  2DNS A;  4DE3 A;  2VLG A;  4XXR A;  1DP6 A;  3IF6 A;  4I3J A;  2O99 A;  1XFQ A;  3GMW A;  3OPR A;  4L9F A;  5AVE A;  1BLH A;  1ESU A;  3OCL A;  4LLO B;  2I72 A;  2QZ6 A;  4H6J A;  4KZ5 A;  2P7J A;  3UME A;  5U47 A;  1YPR A;  3ZDJ A;  4RVA A;  3Q07 A;  2DRW A;  1FSW A;  4LV0 A;  5KSH A;  3VP3 A;  1DJC A;  4S2M A;  4C3Q A;  3DTM A;  3C7U A;  4ZTK A;  3MKE A;  2WAE A;  2Y2I A;  5J4E A;  4CLC A;  3LID A;  1W63 Q;  2E8I A;  2PYP A;  3PBO A;  5M1A A;  4GJ4 A;  1QMF A;  4UA7 A;  4WLA A;  3LR0 A;  1DY6 A;  5A91 A;  2OLV A;  2XFS A;  5I94 A;  1I2S A;  2B5R A;  4QWO A;  4X68 A;  2A24 B;  5FAQ A;  4HOI A;  4EER A;  3O88 A;  2VZW A;  3MXR A;  1UWP X;  3PR6 A;  4QJG A;  2O9B A;  5DF7 A;  4KQO A;  4X69 A;  3CMZ A;  3LR4 A;  1K54 C;  1L0E A;  1Q2P A;  2K31 A;  4DXC A;  2XD5 A;  4O01 A;  1UGU A;  5DF9 A;  3LUQ A;  1NRJ A;  2WKI A;  2GDN A;  2YKH A;  4MCW A;  2WGI A;  4RQ9 A;  3T4T A;  2FZ0 A;  1H8Z A;  2XA7 M;  2Y2M A;  5AQ9 A;  1G5U A;  4R23 A;  4HJ6 A;  2EXA A;  3DWZ A;  1PWG A;  3ZFZ A;  4OLG A;  3ULF A;  4OPY A;  1L0D A;  4HH3 A;  4RA7 A;  5HWV A;  1GSV A;  3JPU A;  1KE0 A;  1MZU A;  4YNR A;  2WAF A;  1LSW A;  3UE0 A;  4I39 A;  1PFL A;  1W8Q A;  4CLC E;  2PD7 A;  4BEN A;  5L10 A;  1W5D A;  5CEC A;  5FQK A;  4B4X A;  4S2J A;  4R3J A;  3MZF A;  3C4O A;  2KLI A;  2PYR A;  3HUM A;  3GVB A;  4JGP A;  4JXG A;  2D01 A;  4ARZ B;  2C6W B;  4PM5 A;  1IYQ A;  4R70 A;  4I3I A;  3ZYT A;  1FSY A;  4X53 A;  1EI5 A;  3T4O A;  1MKM A;  1K56 A;  4GLQ A;  2JKR M;  3NJA A;  2ZMA A;  1D7E A;  5D3O A;  5FEF A;  4DJ2 A;  5G4Z A;  4GN2 A;  1ES3 A;  5CGW A;  4Y0T A;  1XJ6 A;  3SOI A;  1ONH A;  1N9O A;  4EUV A;  4ESP A;  3C7V A;  3V3R A;  3ZVT A;  2OWH A;  5DVA A;  5HDS A;  5KIZ A;  3DTK A;  3KYQ A;  1ACF A;  3KX0 X;  1TS6 A;  4ZRR A;  1SDE A;  3SH9 A;  3BFF A;  1OTA A;  1WYB A;  3NEC A;  1ES2 A;  3W4Q A;  3MFX A;  2H10 A;  4MLL A;  1DJB A;  4OQG A;  4E6X A;  4JKT A;  1QME A;  5DFY A;  4FD8 A;  4WMC A;  1MPL A;  1XJ3 A;  5HL1 A;  1FOF A;  1K25 A;  1BZA A;  1U60 A;  5GLB A;  4P6Z S;  1OJG A;  1GSW A;  2HJ9 C;  4LV3 A;  1S4S A;  3C5A A;  3D3O A;  3FV7 A;  5GHX A;  3IWO A;  2ZM0 A;  3FYZ A;  4MBK A;  5EOO A;  2INW A;  3IHB A;  3QHY A;  4YOF A;  3N4I A;  4WM9 A;  4KG6 A;  3V50 A;  2HGV A;  3RJU A;  5A8B A;  3VE3 A;  1S6R A;  2JKF A;  2ZQD A;  2L0W A;  3UN7 A;  4DE0 A;  1T1C A;  5HDD A;  4R6L A;  2P9V B;  3A0S A;  4OH0 A;  1D06 A;  4YFM A;  5FAS A;  1IYP A;  3IWQ A;  2XRO A;  2ZM2 A;  4JF6 A;  3UY6 A;  2M7U A;  2O0Y A;  3LI9 A;  3MKF A;  2V1A A;  3KSI A;  1FR1 A;  5HZH A;  4KQR A;  1FCN A;  3FWL A;  2Y2K A;  1OTB A;  4IBR A;  4C75 A;  3A0R A;  1L0F A;  4DF6 A;  1CK3 A;  3SS4 A;  3LIA A;  5HWW A;  2XQZ A;  1H3Q A;  5DF8 A;  3CPT A;  4HHD A;  3QNC A;  2W1R A;  1KOU A;  1PZO A;  1MWT A;  3UB7 A;  5CHU A;  4GHI B;  2D02 A;  3OCN A;  1K6S A;  1MWU A;  3LGO A;  1GSX A;  3JYI A;  3MXQ A;  2VGL S;  5G18 A;  3HLW A;  2BAS A;  4LPZ A;  3RXW A;  1YLP A;  3TRC A;  3H9W A;  3PBQ A;  4GS9 B;  3HUO A;  3GTC A;  1BT5 A;  4OOL A;  4X25 A;  4Y0U A;  5AJG A;  5LBR A;  2ACG A;  1I5Q A;  3CI6 A;  5EOE A;  5TJJ A;  3BEC A;  1CEG A;  1OJ5 A;  4XT2 B;  3UB9 A;  3IF5 A;  2V8F A;  3NCK A;  3WRZ A;  4JF4 A;  4UQI S;  2VGK A;  5DKL A;  2Y2P A;  3B3X A;  4LCM A;  3U4L P;  3QP8 A;  1PYY A;  2QJ5 A;  5GLD A;  3PAE A;  1K4F A;  3IHA A;  4DN0 A;  2GX5 A;  2Y79 A;  1TS0 A;  2EX9 A;  3Q7Z A;  2ZQA A;  3HLE A;  3HBR A;  3TJZ C;  4HNB A;  5CED A;  3ZQ5 A;  4NXF A;  4HEF A;  2G7U A;  1EWZ A;  3LY4 A;  3BRM A;  1ODV A;  3ICY A;  3MMH A;  3IT9 A;  5HSQ A;  4KZ6 A;  3B33 A;  3TE8 A;  1VEU B;  2G2U A;  2JKT M;  4EU0 A;  3PBN A;  5BOH A;  1XGJ A;  4FTX A;  3TG9 A;  3CHW P;  3UE6 A;  2QJ7 A;  4QPR A;  4HH2 A;  5TFQ A;  4OPR A;  2GNX A;  2HZ5 A;  5DJT A;  4OPZ A;  4WYY A;  3W4P A;  2HPB A;  4ZBE A;  5F5Y A;  3M2K A;  4E3N A;  1LSX A;  3ITB A;  1YT4 A;  3PHY A;  1HVB A;  4QHC A;  4K0W A;  3ITA A;  4PMA A;  3S1Y A;  3LEQ A;  3WS1 A;  2ZQ8 A;  4MMN A;  3CUE A;  2HP9 A;  3IH9 A;  3A3E A;  1F98 A;  2WGW B;  2IWD A;  2BG1 A;  3GV9 A;  4LV1 A;  4DDY A;  2XH9 A;  4NXG A;  2GZA A;  4I38 A;  5L09 A;  4H6J B;  2DCF A;  1E4D A;  2J3T D;  5M19 A;  4PM6 A;  4X6T A;  1L2S A;  1WA9 A;  3HJK A;  4OLD A;  5C5K A;  1S67 L;  1OT6 A;  2VA0 A;  3O3V A;  3IQA A;  2ZC5 B;  4R0Q A;  2OSU A;  5GL9 A;  5HAP A;  1J3W A;  3FG8 A;  3L9K A;  3G4P A;  1FCM A;  2JHE A;  4EBN A;  4MN5 A;  4WN5 A;  2J80 A;  1XA7 A;  1G28 A;  3NHQ A;  1OTD A;  2J3T C;  1CQA A;  2AVX A;  3E2K A;  4IJG A;  3PBT A;  5HPF A;  2J8Y A;  4E3M A;  1KDW A;  2W3H A;  1N4O A;  1I2W A;  3W2Z A;  1G6A A;  1TS8 A;  1YQS A;  2EFX A;  1MWS A;  5CGS A;  1F9I A;  4ARZ A;  4BJP A;  4OP5 A;  4LFU A;  4HBU A;  4L9G A;  3EGX C;  3EQU A;  2JCH A;  1BSG A;  3G2Z A;  4O0P A;  5F69 A;  1S4R A;  2ZC7 A;  3L7H A;  1VHM A;  4XUZ A;  1PW8 A;  5FAO A;  2ZC4 B;  2W3E A;  3HJI A;  5F82 A;  4HIA A;  3KYZ A;  4FOF A;  3RTY A;  1KDS A;  2JC7 A;  3UO9 A;  3JVV A;  4GDB A;  2WKQ A;  3IBR A;  2EWV A;  4MDZ A;  2EX6 A;  1SDN A;  3AGD A;  2Y4A A;  2JKG A;  5DTK A;  3TSG A;  2PD8 A;  1OTE A;  3C2W A;  1K55 A;  4FH4 A;  1IKG A;  3OPP A;  4JXW A;  1K4E A;  1AXB A;  3BEB A;  4EQI A;  3FPV A;  4OOY A;  3UE3 A;  3R7W A;  4JGR A;  4DDS A;  2JE5 A;  4OKP A;  1K54 A;  1P0Z A;  2FH5 A;  4MN7 A;  4S2P A;  4HJ4 A;  4PM7 A;  4Y3I A;  3LIC A;  4OVD A;  4P0M A;  2KOI A;  5F6A A;  2A3U A;  1K38 A;  4FSF A;  3Q7V B;  1HD8 A;  4OPQ A;  3EQV A;  4JPM A;  1FQG A;  1X0O A;  4K0X A;  3VMA A;  5K5B A;  2V1Z A;  1CEF A;  4GKU A;  3G35 A;  4CLC D;  2Z6D A;  4LRZ E;  2PT7 A;  3GQZ A;  3G30 A;  2Q9N A;  3FC7 A;  2V9A A;  3O5Y A;  4PKY G;  5J3W A;  3W8K A;  3UMD A;  4KZ3 A;  4DRT A;  3VFF A;  5TBM B;  4AFI A;  2WKR A;  1FIL A;  5F1F A;  1H5X A;  1P97 A;  2IA2 A;  4DMZ A;  2EWW A;  2K7S A;  4MBF A;  1LL8 A;  3D72 A;  3IX4 A;  3A3J A;  1S66 L;  2VV6 A;  3ZG5 A;  3LYX A;  1XP4 A;  4E04 A;  4HQA A;  3VV4 A;  3ZG9 B;  2CC1 A;  4UQI M;  4JGO A;  3KYE A;  4XUX A;  2EXB A;  3BFG A;  4BBV A;  3G31 A;  3IF6 B;  1ALQ A;  4UAA A;  1T19 A;  3RH8 B;  2H5S A;  4UA9 A;  1OTI A;  4II7 A;  4Y7P A;  3PBR A;  3N7W A;  1OPX A;  2PBY A;  1K55 C;  3MFD A;  3KSF A;  2XK1 A;  1ZTU A;  2Z6C A;  4KQD A;  3O86 A;  1K6R A;  3UB5 P;  2B02 A;  3PAG A;  3WRT A;  4IHQ A;  3K3D A;  2QMI A;  3GSG A;  4WEL A;  2O9A A;  4Q8I A;  1YAX A;  2ZC3 B;  3C30 A;  4YWZ A;  3C38 A;  2JKT I;  1JWP A;  3BY9 A;  1XGI A;  2P9V A;  1CI8 A;  4JXV A;  4EEU A;  1ZG6 A;  3NIA A;  1LHY A;  3VP4 A;  4P87 A;  4N92 A;  2HV1 A;  2V8C A;  2Y2N A;  1MC0 A;  3G2Y A;  2MJ6 A;  1D1J A;  4DKI A;  2Y2G A;  1NWZ A;  2M1C A;  2ZM8 A;  1G68 A;  4ZDX A;  3D9Y A;  3HVF A;  3N8S A;  3SZT A;  1XJ4 A;  1S1Y A;  2W0N A;  1YMX A;  2GJ3 A;  4G3K A;  4R4R A;  2H28 A;  4IVK A;  4Y17 A;  2RL3 A;  1V9Y A;  1RGY A;  4EEP A;  5EM1 A;  3RFB A;  4U0X A;  1RP5 A;  4KEN B;  2XRN A;  5TGF A;  5E2F A;  2V2F F;  1NLY A;  1SHV A;  4JBF A;  4X55 A;  1XX2 A;  2ZQC A;  2V20 A;  3DTI A;  5EVL A;  4K08 A;  2HDU A;  1DP8 A;  1NYY A;  1MY8 A;  1ZC2 A;  2OWJ A;  4KZ7 A;  2WZX A;  5DTS A;  1DRM A;  2FFY A;  3HLB A;  3M6B A;  2BTF P;  3B47 A;  1LL9 A;  4Y0O A;  5IS1 A;  3W4O A;  4ZJ3 A;  2Y2L A;  5HD5 A;  4P85 A;  2HF6 A;  3LY3 A;  3H82 A;  2VJW A;  3I7J A;  4Z1W A;  1IEM A;  5EPH A;  2J3W A;  3KSG A;  3A3D A;  2J7V A;  1E3U A;  3R4K A;  1HLU P;  3V5M A;  2UV0 E;  3G6O A;  5FAT A;  5JYO A;  3T1Q B;  2V0W A;  1ERO A;  2EX8 A;  3N6I A;  5FA7 A;  5EV0 A;  2OV5 A;  1HTZ A;  5EVI D;  3LIE A;  3N8R A;  1CI9 A;  3WS2 A;  1Y28 A;  2Z2M B;  2QHK A;  2EX2 A;  4B9O A;  4PM8 A;  2A49 A;  2ZLY A;  3M6H A;  2OLU A;  1BTL A;  4EV4 A;  3WS5 A;  3OBF A;  3LO7 A;  4NKP A;  5AQB A;  3OOV A;  1K57 C;  4L0L A;  3LR5 A;  3E98 A;  4HP4 A;  2WKE A;  4Q0J A;  2PBD P;  4WL9 A;  2PRF A;  3Q81 A;  2P04 A;  2PR6 A;  4L9E A;  1OME A;  3OLO A;  2P08 A;  2O9C A;  3LFV A;  2XGN A;  3CIT A;  3QNB A;  2JBF A;  3Q82 A;  3UB8 A;  5IHV A;  1S0W A;  3UDF A;  4BD1 A;  2VV8 A;  4ZJ1 A;  4KUK A;  4HBT A;  1Y4O A;  3AGF A;  3F1N A;  1VET A;  1Y54 A;  1JTD A;  3LIB A;  4ETZ A;  3UE1 A;  2XA7 S;  1VET B;  4BLM A;  2JN7 A;  3F1N B;  5IT5 A;  3WS0 A;  2VK3 A;  4N1H A;  1KGG A;  5CTM A;  3PBS A;  3TW8 A;  5MC7 A;  3VSK A;  3UB6 A;  3ZCZ A;  3GRJ A;  3E0Y A;  3VOY A;  1RGZ A;  3UPO A;  3QP1 A;  1XPB A;  1N9N A;  2V0U A;  4GW9 A;  5AVF A;  1JTG A;  4IED A;  4EBP A;  5HD3 A;  3VP1 A;  1MBL A;  1PWC A;  2L4R A;  2NUP C;  2PU4 A;  4S2L A;  2ZQ7 A;  4MEZ A;  1YLW A;  3IWI A;  4EES A;  3T50 A;  1NRF A;  4EWF A;  4BL3 A;  3QP2 A;  4LEN A;  3ZGA B;  2J9O A;  2ZQ9 A;  1T18 A;  3MSH A;  1TF1 A;  1LI9 A;  4NK3 A;  5DJU A;  4G3V A;  2ZC6 B;  4S2I A;  5HW3 A;  3FKV A;  2M7V A;  4E3J A;  5HAR A;  4WMC D;  3R7W B;  3GEC A;  3T4L A;  2BLS A;  3GR2 A;  2LB9 A;  3BM6 A;  4HES A;  3BFE A;  3A3I A;  4JGQ A;  4HI4 A;  1T1A A;  2K2N A;  2HJE A;  1O07 A;  3NDG A;  5FL3 A;  3S4X A;  3ZG7 B;  4NXB A;  3H82 B;  3HLC A;  2UWX A;  1T1B A;  1DP9 A;  4Q0H A;  1H0M A;  4GHI A;  4E3O A;  3OPL A;  4ID4 A;  3ZVW A;  4IBX A;  1IEL A;  5FQ9 A;  1KE4 A;  3T12 B;  3CLO A;  5F83 A;  5KZH A;  4Y13 A;  3CZD A;  5F1G A;  2X02 A;  3M2J A;  3VFH A;  5AQ7 A;  2WYX A;  1CF0 A;  2DMW A;  3T4Q A;  1E3U D;  4OQI A;  5F68 A;  4OQH A;  3UPP A;  4QD4 A;  1W7F A;  2QKP A;  3BJN A;  3T4K A;  2V1B A;  2B18 A;  2WKH A;  1Q2Q A;  3WS4 A;  1ERM A;  1IYS A;  3VSL A;  1DJA A;  4GDN A;  2ZJ9 A;  2VKS A;  5HL6 A;  1YSP A;  1N9L A;  5E2H A;  4ZJ2 A;  1NLZ A;  4LV2 A;  2ZBB A;  3FZC A;  4C6Y A;  1LI0 A;  3IBJ A;  4KZ4 A;  1M40 A;  3LR3 A;  4U3T A;  1OT9 A;  3IX8 A;  4WEJ A;  3UDX A;  4EUZ A;  3LEZ A;  4EXO A;  1NXY A;  1YLY A;  3H7W A;  5CRF A;  3RXX A;  3FKW A;  5A90 A;  5CHM A;  1ES4 A;  3SW1 A;  5A92 A;  4R4S A;  4M4X A;  2ZMV A;  1F2K A;  3E4Q A;  3U2A A;  5DKK A;  4CLC C;  2R78 A;  5E2G A;  5FI2 A;  3P01 A;  3D4F A;  5E2E A;  1ONG A;  2HDR A;  2IWB A;  4Y2F A;  3MF0 A;  3BFC A;  3SS5 A;  3PYP A;  4OQ0 A;  3NDE A;  1W63 M;  4NET A;  2OAP 1;  2PDR A;  4N1X A;  2VGL M;  1E25 A;  4MNR A;  5FQJ A;  3HRE A;  3VOZ A;  5FQI A;  4MBH A;  5HPI A;  2VV7 A;  4ZAM A;  3ZNT A;  2Y2H A;  1BYW A;  4NEE D;  4PHT A;  5FI6 A;  5G4Y A;  1LT0 A;  1W79 A;  1XJ2 A;  3HLD A;  5A93 A;  4O8G A;  2JKR I;  5M18 A;  3QP4 A;  1KVL A;  2WKP A;  4F94 A;  3OC2 A;  3ZNY A;  2WGV A;  4X1M A;  4G3W A;  1IFQ A;  4S2N C;  4Y5F A;  2Y2O A;  1VM1 A;  4O7D A;  1MXO A;  3E4P A;  4R3A A;  1PWD A;  4KZB A;  1J9M A;  2H0T A;  2XLN A;  2XDM A;  3MQO A;  5EEC A;  3BQ8 A;  2WUQ A;  3F1P A;  2HP5 A;  1VQQ A;  3S7Q A;  1H8M A;  3MXS A;  2LB5 A;  1K57 A;  3HLF A;  1BLC A;  3DW0 A;  3HL9 A;  4DXB A;  5EFW A;  1BLP A;  1NZU A;  2ZOH A;  4B4Z A;  3E2L A;  1LL5 A;  1Z09 A;  4BL2 A;  3P7N A;  4N9L A;  3BYD A;  1K56 D;  4UHU A;  3VE4 A;  2PAV P;  3NUL A;  3ZG0 A;  3OPH A;  4B88 A;  2WZZ A;  1GCE A;  4BMW A;  4BQM A;  5DTT A;  5FI7 A;  1PIO A;  4S2N A;  1KGF A;  2KDK A;  3EWK A;  1XFN A;  3Q7V A;  4BBT A;  2Y2Q A;  5EVI C;  1PRQ A;  2B95 A;  1GA0 A;  3FPW A;  4GZB A;  5TBM A;  3V67 A;  2X71 A;  2W3G A;  3B42 A;  1GHM A;  1PW1 A;  3T1R A;  5FSR A;  4N9K A;  1TDG A;  3NC8 A;  5IU1 A;  1YMS A;  2R9X A;  1NZO A;  1PI5 A;  3IXD A;  1N9B A;  5EE8 A;  5L8M A;  1NY0 A;  1RCJ A;  2PR5 A;  1YLZ A;  4GOG A;  4P6B A; 
#chains in the Genus database with same CATH homology
 2NUT C;  3MQQ A;  1F98 A;  4HP9 A;  4WEK A;  4OOM A;  4EQ1 A;  5J4E A;  4CLC A;  3BQA A;  4DJ3 A;  3LID A;  1W63 Q;  2PYP A;  3PBO A;  4GJ4 A;  4NXG A;  3MJQ A;  3OBF A;  4NKP A;  4NXE A;  3OOV A;  2GZA A;  4I38 A;  4WLA A;  4H6J B;  3LR0 A;  4L0L A;  2J3T D;  3LR5 A;  3E98 A;  4HP4 A;  4Q0J A;  1WA9 A;  3HJK A;  5C5K A;  1S67 L;  1OT6 A;  4WL9 A;  2A24 B;  2CMN A;  2P04 A;  3H7W B;  4HOI A;  2PR6 A;  4L9E A;  2VA0 A;  4EER A;  2VZW A;  1UWP X;  2XSS A;  3OLO A;  3PR6 A;  2P08 A;  2O9B A;  4BWI A;  2O9C A;  3LFV A;  3CIT A;  3K3C A;  3UB8 A;  2L1M A;  2W27 A;  4KQO A;  2VV8 A;  4KUK A;  3FG8 A;  3E4O A;  2YKF A;  3LR4 A;  3F1N A;  2JHE A;  4MN5 A;  4WN5 A;  4F3L A;  4CQH A;  2J80 A;  1G28 A;  3NHQ A;  3VOL A;  1OTD A;  3LIB A;  2J3T C;  2K31 A;  4ETZ A;  4O01 A;  1UGU A;  4IJG A;  5DF9 A;  3PBT A;  3LUQ A;  1NRJ A;  2XA7 S;  2JN7 A;  3F1N B;  3MR0 A;  5HPF A;  5IT5 A;  2YKH A;  4MCW A;  3F1O B;  2W3H A;  1LSV A;  4RQ9 A;  3W2Z A;  3BY8 A;  3PBS A;  3T4T A;  2FZ0 A;  1TS8 A;  3TW8 A;  5MC7 A;  2XA7 M;  1F9I A;  4ARZ A;  4BJP A;  2A24 A;  3C8C A;  4L9G A;  3EGX C;  3EQU A;  3UB6 A;  4HJ6 A;  3E0Y A;  3CWF A;  4HJ3 A;  4O0P A;  5F69 A;  1S4R A;  3ULF A;  4HH3 A;  1N9N A;  2V0U A;  4GW9 A;  5AVF A;  1VHM A;  5HWV A;  1GSV A;  1MZU A;  4YNR A;  2W3E A;  3HJI A;  5HD3 A;  1LSW A;  4I39 A;  4HIA A;  3KYZ A;  1YSQ A;  4FOF A;  3RTY A;  4CLC E;  2PD7 A;  2L4R A;  3NOU C;  3JVV A;  2NUP C;  2WKQ A;  3IBR A;  1V9Z A;  4EES A;  3T50 A;  2EWV A;  4MDZ A;  4GCZ A;  2KLI A;  2PYR A;  3LIF A;  4JGP A;  2D01 A;  4ARZ B;  2PD8 A;  1OTE A;  1T18 A;  1TD5 A;  3C2W A;  4R70 A;  4I3I A;  1TF1 A;  3ZYT A;  3FPV A;  1VB6 A;  3T4O A;  1MKM A;  4GLQ A;  3UE3 A;  3R7W A;  2JKR M;  5DJU A;  4G3V A;  1G6O A;  2ZOI A;  3NOP C;  4JGR A;  3NJA A;  1UWN X;  2M7V A;  1D7E A;  1P0Z A;  4DJ2 A;  3R7W B;  2FH5 A;  3IS2 B;  3GEC A;  3T4S A;  3T4L A;  5G4Z A;  4EW7 A;  2W3F A;  1XJ6 A;  4MN7 A;  2VX8 A;  2LB9 A;  5HDC A;  1JNU A;  1N9O A;  4HJ4 A;  4Y3I A;  4EUV A;  1TS7 A;  3LIC A;  3DBA A;  2KOI A;  4JGQ A;  5F6A A;  4EET B;  4HI4 A;  1T1A A;  3EGD C;  2OWH A;  3A0V A;  5HDS A;  3GDI A;  2K2N A;  4FSF A;  5KIZ A;  2HJE A;  3KYQ A;  3EOI A;  3EQV A;  1X0O A;  3KX0 X;  1TS6 A;  4ZRR A;  5FL3 A;  5J7E A;  1OTA A;  4HY8 A;  5K5B A;  4NXB A;  3MFX A;  3H82 B;  4CLC D;  1T1B A;  2Z6D A;  1DP9 A;  4LRZ E;  4Q0H A;  2PT7 A;  4GHI A;  5DFY A;  5DFX A;  3BWL A;  3FC7 A;  2V9A A;  3O5Y A;  4PKY G;  2PHY A;  5J3W A;  1XJ3 A;  4P6Z M;  3UMD A;  2W1T A;  5CX7 A;  1IOU A;  3CLO A;  3K2N A;  1P9R A;  5TBM B;  4AFI A;  2WKR A;  3LI8 A;  3S7P A;  4B93 A;  4I5S A;  4P6Z S;  1OJG A;  1P97 A;  2IA2 A;  2QWS A;  4DMZ A;  2DMW A;  2EWW A;  1GSW A;  2K7S A;  3T4Q A;  1LL8 A;  5F68 A;  2HJ9 C;  3IS2 A;  1S4S A;  1STZ A;  3T4K A;  2QKP A;  3BJN A;  4LRY C;  3D72 A;  2V1B A;  3D3O A;  2W3D A;  2B18 A;  1S66 L;  2VV6 A;  3LYX A;  4E04 A;  4HQA A;  3VV4 A;  4UQI M;  4JGO A;  2INW A;  2VKS A;  4BBV A;  5HL6 A;  4YOF A;  1YSP A;  1T19 A;  1N9L A;  3RH8 B;  1NLZ A;  2HGV A;  2ZBB A;  5A8B A;  3VE3 A;  1OTI A;  4II7 A;  2L0W A;  1T1C A;  3PBR A;  3IBJ A;  1OPX A;  5HDD A;  4R6L A;  3KSF A;  3LR3 A;  1OT9 A;  4WEJ A;  1ZHH B;  3A0S A;  1D06 A;  4R38 A;  1ZTU A;  2Z6C A;  1EW0 A;  4KQD A;  2XRO A;  4EXO A;  2B02 A;  4IHQ A;  4Q0I A;  3K3D A;  2M7U A;  2O0Y A;  3H7W A;  3LI9 A;  4WEL A;  2V1A A;  2O9A A;  3KSI A;  2EA9 A;  5HZH A;  3BW6 A;  1YAX A;  3SW1 A;  3C30 A;  1OTB A;  4YWZ A;  3T4J A;  4M4X A;  4XT2 A;  2ZMV A;  3E4Q A;  3C38 A;  2JKT I;  3U2A A;  2VEA A;  3A0R A;  5DKK A;  4CLC C;  2R78 A;  4BBU A;  3P01 A;  4CLC B;  3BY9 A;  4Y2F A;  2OAQ 1;  3LIA A;  3MF0 A;  5HWW A;  3CUE C;  1H3Q A;  3PYP A;  4EEU A;  4HHD A;  2W1T B;  1W63 M;  3NOT C;  4GS9 A;  2OAP 1;  2PDR A;  2W1R A;  2VGL M;  1KOU A;  3F1O A;  4WF0 A;  3UB7 A;  2HV1 A;  4GHI B;  2D02 A;  1MC0 A;  3OCN A;  2MJ6 A;  3F1P B;  1GSX A;  5HPI A;  1S1Z A;  2VV7 A;  3MXQ A;  1NWZ A;  2VGL S;  4KUO A;  2M1C A;  4F3L B;  2KX6 A;  1BYW A;  4NEE D;  2I9V A;  4PHT A;  5G4Y A;  2BAS A;  4LPZ A;  1LT0 A;  3TRC A;  3H9W A;  1XJ2 A;  3PBQ A;  1P9W A;  3EEA A;  4ETX A;  4O8G A;  3S7N A;  4GS9 B;  2JKR I;  1F5M A;  1YKD A;  4UEY A;  1XJ4 A;  1S1Y A;  4OOL A;  3KSH A;  2OOL A;  3EEH A;  2WKP A;  2W0N A;  5AJG A;  5LBR A;  4PAU A;  3JVU A;  3CI6 A;  3OC2 A;  4PKY A;  2GJ3 A;  4G3K A;  5TJJ A;  2A2L A;  1OJ5 A;  4G3W A;  1IFQ A;  3S7O A;  4Y5F A;  2H28 A;  4XT2 B;  3UB9 A;  3E4P A;  3KO6 A;  4ME4 A;  4R3A A;  1V9Y A;  3HCY A;  4UQI S;  4EEP A;  5DKL A;  4I3A A;  3MQO A;  3RFB A;  3BQ8 A;  2ZMF A;  2XRN A;  3MQ0 A;  3F1P A;  2QJ5 A;  3S7Q A;  4DN0 A;  1NLY A;  2GX5 A;  2Y79 A;  1H8M A;  1TS0 A;  4B9O A;  2LB5 A;  2QYB A;  4K08 A;  3TJZ C;  4HNB A;  2Y8H A;  5EFW A;  1DP8 A;  2OWJ A;  3CAX A;  3ZQ5 A;  2ZOH A;  4IUH A;  1DRM A;  4NXF A;  4WUJ A;  2G7U A;  3P7N A;  1ODV A;  3ICY A;  3B47 A;  3MMH A;  3VE4 A;  3PXP A;  5IS1 A;  5I5L A;  5HSQ A;  5HWT A;  5HD5 A;  4BMW A;  4LRX C;  3B33 A;  4IUK A;  3TE8 A;  2HF6 A;  2JKT M;  3H82 A;  2VJW A;  4Z1W A;  4EU0 A;  3PBN A;  4MN6 A;  2J3W A;  2KDK A;  3EWK A;  1XFN A;  3UE6 A;  2QJ7 A;  4BBT A;  4QPR A;  3KSG A;  3R4K A;  4HH2 A;  2VLG A;  1DP6 A;  4I3J A;  3FPW A;  2O99 A;  5TBM A;  2GNX A;  5DJT A;  1XFQ A;  3V67 A;  2W3G A;  3G6O A;  3B42 A;  4L9F A;  2V0W A;  5AVE A;  3OCL A;  5F5Y A;  4LLO B;  5IU1 A;  1LSX A;  4H6J A;  3PHY A;  2P7J A;  3UME A;  5L8M A;  3LIE A;  1Y28 A;  2PR5 A;  5KSH A;  2QHK A;  4MMN A;  3CUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...