5F5YA

Wt drosophila melanogaster cycle pas-b with bound ethylene glycol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cycle
publication title WT Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 30
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f5yA00
2VLGA 3UB7A 3MJQA 4KQDA 2A24A 3MXQA 3C8CA 3IS2A 4I39A 1NWZA 1F9IA 2L1MA 1T1AA 2KDKA 4I3IA 2PYPA 2VV7A 3LIFA 4KUOA 4F3LA 1OTAA 4LLOB 2V9AA 1T1CA 4GS9A 4K08A 1DRMA 4HJ4A 2OWJA 5IU1A 3G6OA 4BBTA 3A0SA 4LPZA 3UB6A 3C2WA 3IS2B 2PD8A 1LSVA 3LUQA 2JHEA 3GDIA 4JGRA 4PKYG 1XFQA 4F3LB 1BYWA 5A8BA 1V9ZA 5F6AA 3NOPC 4GS9B 4HH2A 3FG8A 4R6LA 2QKPA 1KOUA 3MR0A 1OTBA 3LI9A 5J3WA 3BY9A 5J7EA 1S67L 2M1CA 2W27A 5G4YA 2PDRA 4B9OA 1EW0A 1S1YA 1S1ZA 3P7NA 4I5SA 3LIBA 4NXEA 3RH8B 4JGQA 1DP6A 5HWWA 5IS1A 4H6JB 2D01A 4EETB 5HWVA 5KIZA 4WUJA 4R3AA 3EEHA 2PR6A 1TS6A 2L0WA 4WL9A 3LI8A 2VEAA 1XJ3A 1S4SA 2JN7A 3MQQA 2L4RA 1LSXA 4HIAA 1UGUA 5I5LA 4EW7A 4HNBA 4R38A 3VOLA 2QWSA 4WLAA 4HI4A 4WN5A 4GHIA 3F1PB 3HJKA 1Y28A 1T19A 1MZUA 4DJ2A 1TS8A 1D06A 4DJ3A 2PHYA 4HOIA 3ICYA 3E4QA 3HJIA 3H82A 2WKPA 1GSWA 4LRZE 1DP8A 3UB9A 3K3DA 2Z6CA 4HH3A 4LRXC 5G4ZA 1GSVA 1V9YA 3F1NA 4WF0A 3EWKA 4GHIB 5AVFA 5HSQA 4JGPA 4M4XA 3KX0X 3VE4A 2ZBBA 5F68A 3LIDA 1P0ZA 3UE6A 3H82B 5TBMA 3K3CA 1OTEA 1OTDA 2ZOHA 4H6JA 4PKYA 1ODVA 3ZQ5A 3H7WA 1OTIA 1S4RA 2V0WA 1P97A 2PYRA 1VB6A 3F1NB 5HDDA 2QJ7A 3BY8A 4NXFA 1N9NA 4HP4A 1UWNX 1XFNA 2R78A 4EESA 5HWTA 1OT6A 3NJAA 5TBMB 3UMDA 5DJTA 5HD3A 2CMNA 5EFWA 1OJGA 4HHDA 3H7WB 3ULFA 1DP9A 4HJ3A 2B02A 5HZHA 3F1PA 3H9WA 4BBUA 3NHQA 3A0VA 2J80A 2INWA 1N9LA 3PHYA 2V1BA 4GW9A 4L9EA 3OLOA 3UB8A 1S66L 4KUKA 4BBVA 3T50A 5DKKA 3LYXA 3E4PA 4I3AA 1JNUA 1OT9A 4I38A 4NXGA 2P7JA 2V0UA 1X0OA 3MQOA 4MN6A 3F1OA 2I9VA 3LIEA 2PR5A 2V1AA 4EXOA 3IBRA 1LL8A 2Z6DA 3LIAA 4XT2A 2ZOIA 5F69A 1XJ4A 1LT0A 1OJ5A 3PYPA 2QHKA 2HV1A 3F1OB 4JGOA 2KX6A 4HY8A 3CAXA 2OWHA 4L9GA 3SW1A 4I3JA 4HQAA 2A24B 3BWLA 3B33A 4XT2B 1XJ2A 2W0NA 3MFXA 4RQ9A 3UMEA 1LSWA 5HDSA 1T18A 4GCZA 2WKRA 4EEUA 3RTYA 5DKLA 4R70A 5DJUA 4EQ1A 4MN5A 4EERA 1F98A 4LRYC 2D02A 3LICA 3CWFA 2QJ5A 5AVEA 1TS7A 3GECA 2GJ3A 1N9OA 2H28A 1XJ6A 1T1BA 3NOTC 3FC7A 1TS0A 2OOLA 2VV8A 2YKHA 2EA9A 2YKFA 2PD7A 4YWZA 1UWPX 4HP9A 4HJ6A 4E04A 3D72A 3E4OA 5HDCA 2VV6A 3CLOA 1G28A 1GSXA 5HD5A 2BASA 3VE3A 5F5YA 4L9FA 4NXBA 5J4EA 1D7EA 3NOUC 2K7SA 3A0RA 2WKQA 4EEPA 1WA9A
chains in the Genus database with same CATH superfamily
2A24A 5F1FA 2WADA 3TE8A 4I39A 4KG2A 5E2FA 2Y55A 4S2NC 3WWXA 5FQMA 1GHIA 4IEDA 4X68A 4KZ3A 4C6YA 3DW0A 3HLWA 4LLOB 3LEZA 1IYQA 1T1CA 1SDNA 5DF7A 2Y2GA 2AVXA 4U3TA 1MXOA 2WAFA 3T4JA 3IS2B 1YSPA 2Y2QA 3CUEA 3IWOA 3IWIA 4E6WA 2PU2A 1GA0A 4JF6A 1FIKA 1L2SA 3JPUA 5F6AA 3NOPC 3FG8A 3MR0A 4NG2A 4C75A 1ZKJA 3LI9A 1IYPA 2ZL1A 4GZBA 5J3WA 3BY9A 3GTCA 4GD6A 3SOIA 3BYDA 4JXWA 4EBNA 2W27A 4X6TA 4GNUA 3M6BA 4BD1A 5J8XA 2J7VA 1S1YA 1S1ZA 2XSSA 4JF4A 3B3XA 2V8CA 2WYXA 2XQZA 1BLSA 3RH8B 1K55C 1J3WA 5HWWA 2O9AA 1WE4A 5GLDA 3UE0A 4GOGA 4M3KA 4XUZA 4R3AA 2OLUA 3EEHA 4ZDXA 3DBAA 4WZ5C 3VP4A 2JN7A 4MBKA 5AQAA 3V3RA 4HIAA 5DTSA 4X56A 4QB8A 2QWSA 3EGXC 4E6XA 1MWRA 2VKSA 4HI4A 2M7VA 1I2SA 3F1PB 3HJKA 3NBLA 3CITA 1N9BA 1TS8A 5EM1A 3N8LA 4Y0TA 4O0PA 5HPFA 3OBFA 2DNSA 3HJIA 1PW8A 1CI9A 3M2JA 5AQ9A 1YM1A 4R1GA 3MZDA 1DP8A 2Z6CA 4OQGA 2FH5A 5KMWA 2W3EA 5KSHA 3C30A 4GHIB 5HSQA 2E8JA 4JGPA 4M4XA 2DMWA 2ZBBA 1XGIA 3QNBA 3LCEA 5F68A 3LIDA 4GDNA 1P0ZA 2PAVP 2LB9A 2Q9NA 3UE6A 2XRNA 4KZAA 1OTEA 1TD5A 1LI9A 2EXBA 3WS0A 3ZQ5A 3A3FA 1S4RA 2V0WA 3ITAA 5F82A 2PYRA 5EVEA 3L9KA 1BTLA 3F1NB 2VGJA 3PTEA 4OLGA 3ZVTA 2WK0A 3KYQA 4S2JA 1PI5A 2DCFA 4LGWA 3KSIA 1K56D 3WRTA 3T1SA 1HZOA 2XK1A 3S1YA 2GZAA 2HP5A 2FZ0A 4BD0A 4HJ3A 1RGZA 1K4FA 1YLJA 5HZHA 3F1PA 4GD8A 4ETZA 5L07A 4ZTKA 3NHQA 3BQ8A 1KDWA 3HL9A 5GLAA 3LGOA 3SS3A 1LL5A 1PNEA 4KUKA 4N92A 3LYXA 3E4PA 5FEGA 5FI2A 3W2ZA 4KZ6A 1SCWA 3NDGA 4OVDA 4NK3A 3ZNTA 4Y0UA 2R9XA 4KZ9A 1M40A 3T12B 1X0OA 2RCXA 4MN6A 2G2WA 4Y5FA 2XA7M 1JWZA 2ZQ8A 3BM6A 2ZLYA 4XUXA 1FCOA 4EXOA 1TDLA 3MQ0A 5FAQA 2BLSA 5FDHA 2ZOIA 2UV0E 2EWVA 2HP6A 4ZRRA 4IBRA 2XH9A 3DTKA 2EWWA 3QP2A 2QHKA 3FPVA 4KQOA 1BUEA 4MBFA 5HARA 4OLDA 3CAXA 1FR6A 4E3OA 4ZAMA 4MNRA 3VP3A 4I3JA 3IX4A 4DF6A 4KZ5A 4OP8A 2Y2OA 3B33A 4XT2B 4PM9A 3LY4A 4RQ9A 5GHYA 2QZ6A 1KGEA 4K0WA 4EEUA 2H0YA 1ZG4A 2JKTI 2O9BA 5KZHA 4WM9A 4YFMA 3GQZA 3A3IA 1ES3A 4MN5A 1CK3A 3KSFA 1XPBA 5FA7A 2V8FA 1XA7A 4RVAA 4EU0A 4GJ4A 4QY6A 2QJ5A 1TS7A 4DDYA 4X55A 3CJMA 5FSRA 5HL6A 3GECA 2GJ3A 1G5UA 3IXBA 1N9OA 1PRQA 2H28A 2WZXA 2XD1A 4GLQA 4CLCB 1VQQA 3NOTC 3ZFZA 2Y8HA 2VV8A 4P85A 2EA9A 2PD7A 4Q0HA 5EVLA 1KDSA 1K25A 1ZG6A 4E04A 3E4OA 5HDCA 4E3KA 2VV6A 1OPXA 3Q82A 5TJJA 3LO7A 2WKEA 2ZC4B 5HD5A 1CI8A 5GLBA 4L9FA 4UA6A 1VETB 1OMEA 4E3NA 3G2YA 1J9MA 2JCHA 1BULA 3IF6A 5EPHA 4EEPA 4WZ4A 4QD4A 3T4TA 1FCMA 2PRFA 4KQDA 3SH7A 1DJAA 5EUAA 1CF0A 3UO9A 1M6KA 3IWQA 4X69A 1K38A 1NWZA 2JKRI 2PT7A 5GHZA 1IOUA 5CGWA 2KDKA 4UA9A 1G68A 4KUOA 2P9VB 2V9AA 3MFDA 3I7JA 3PAEA 1CEFA 3VP0A 4Q8IA 2Y2PA 4GS9A 1HLUP 5CTNA 4FSFA 3PXPA 2Q9MA 1ZTUA 3G6OA 1YLPA 5E2EA 4LPZA 1MKMA 3UB5P 3C2WA 1W8QA 1L0FA 4BJPA 3S4XA 2JHEA 4CPKA 2X02A 4KZ7A 5CGXA 1FQGA 3T1XA 4PM7A 4CLCA 5FL3A 4AFIA 2HDQA 1NLYA 2A49A 4R6LA 3OOVA 4X53A 5AQ7A 1XX2A 2J3TC 1W8YA 4EUVA 2IA2A 2VGKA 2CC1A 1E3UA 1EWZA 3HREA 1S67L 4OH0A 3C7UA 2W3DA 1NJ4A 2IWDA 3O87A 2PDRA 3A3EA 4B9OA 1H8YA 1EW0A 1AXBA 1TF1A 5CX7A 3VSLA 4I5SA 2HDUA 4KQQA 2ZM8A 4DDSA 1Q2PA 4FOFA 1L3LA 3S7OA 3B47A 1DP6A 4H6JB 3T4OA 1U60A 2ZL1B 3LEQA 4LV1A 3PBQA 3CUEC 4FTXA 4DE1A 4B4XA 3C7VA 2Y2MA 4YINA 2O0YA 3MSHA 1YMXA 4ID4A 5KIZA 3OPRA 4WUJA 3UNWA 2OV5A 3AGFA 3QP1A 2PR6A 4U0TA 3L7HA 5TFQA 1DY6A 5DF8A 1S6RA 4E3IA 3V50A 2L4RA 4S2MA 3PBNA 3SH9A 2ZQAA 1STZA 4EW7A 3NECA 3VOLA 4S2IA 3BQAA 3KYEA 1XP4A 1Y28A 2PHYA 3E4QA 5FAPA 1SKFA 4MCWA 2VGLS 2W3GA 3WS5A 2VK3A 3T1RA 4LRZE 4PM6A 3EEAA 5EM0A 3A3JA 3DWZA 3K3DA 4HH3A 3HLBA 1JVJA 1MY8A 4P87A 4OP5A 1AWIA 4LCLA 3QP6A 5EECA 3IF5A 4MBHA 4WF0A 5FATA 3JVVA 3S22A 2Y2JA 1ONGA 3UE1A 1QMFA 4ZJ1A 4ME4A 2DRWA 3ZYTA 5HAQA 3TRCA 1PWCA 2KOIA 2Y59A 2HJ9C 1CEGA 1NZUA 2XD5A 3BFCA 2ZOHA 4H6JA 4PKYA 1ODVA 5A92A 4QWOA 3G35A 4DRTA 5CRFA 2O9CA 1P9WA 4ETXA 1HVBA 4KZBA 1VB6A 3G34A 4XXRA 1H5XA 1W7FA 3HCYA 3W4QA 1GHPA 5LBRA 1KVLA 1N9NA 1UWNX 1MKIA 4X1MA 1BSGA 3P01A 3ZNYA 5HWTA 4PAUA 1SKOA 5DJTA 2LB5A 2G7UA 2J8YA 4H8RA 5CGSA 5EFWA 1OJGA 4UAAA 1K57A 1NRFA 4O7DA 1L0EA 2B02A 3B42A 4N9KA 1IELA 4X1LA 3MS6A 5GL9A 4PM8A 4UQIS 1N9LA 2EX9A 2WGWA 3MF0A 3UB8A 4OOLA 2Y91A 4CJNA 1TVFA 4I3AA 2JKTM 1NLZA 1ES5A 1LL9A 5JYOA 1OT9A 4I38A 3S7PA 2RL3A 3AGDA 1Z6FA 3UPOA 3IXDA 4WEKA 5EV0A 3IH9A 3C4PA 3LIEA 3IHAA 3V3SA 2QMIA 1E4DA 4DXCA 1MPLA 2V1AA 4RX3A 2NUTC 1GA9A 3QP5A 4P0MA 1P9RA 3HUMA 3RXXA 5DTKA 1K6RA 4GB7A 1XJ4A 3PYPA 3G2ZA 5L2FA 3WS4A 4II7A 4NEED 4FUWA 2KX6A 1A0KA 3GVBA 1L0GA 3CI6A 3NC8A 3SZTA 2OWHA 4S2PA 1KGGA 4RYEA 2E8IA 2J9OA 3HLDA 3VSKA 5F1GA 4A5RA 4GDBA 1XJ2A 2ZQ7A 2C6WB 1IKGA 1GHMA 3UMEA 5HDSA 4R3JA 1MBLA 4GCZA 3ZGAB 4JXGA 1Q2QA 3DTIA 2JKRM 4EERA 4BL3A 3MMHA 3OC2A 2D02A 3IBJA 2B5RA 2ZM2A 3HLGA 3CWFA 3LY3A 5AVEA 3HLEA 2EFXA 3UDIA 1W63M 3OPLA 4Q0JA 3BECA 4MLLA 1T1BA 3T4KA 3IHBA 5DTTA 3FC7A 3N8RA 5FQ9A 2OOLA 1JTGA 1KE0A 2FFYA 1Z09A 4YWZA 4RX2A 2WUQA 4O8GA 3T4LA 4HBTA 1W63Q 4KZ4A 3D9YA 3T4QA 2ZC7A 4WMCA 3OZHA 4YOFA 3C38A 4ZJ3A 3FKWA 1ZC2A 2BASA 2WGIA 4BQMA 3UY6A 5F5YA 4NXBA 2ZMFA 3U4LP 3SS5A 3NOUC 4PHTA 2K7SA 1GCEA 5F83A 1YLZA 5KSCA 2HPBA 4LV3A 2J3WA 1JTDA 5G18A 3UB7A 2GX5A 5U47A 3C8CA 5CEDA 1F9IA 4D60A 2L1MA 1T1AA 4I3IA 2PYPA 2VV7A 3D3OA 3NCKA 1RCJA 4F3LA 1OTAA 3EOIA 4DN0A 3DTEA 4WEJA 2QPNA 3IF6B 3N7WA 4HJ4A 2OWJA 5IU1A 2ZMVA 4BBTA 3A0SA 5AJGA 3TSGA 2VX8A 3IX3A 3FV7A 3UB6A 4DE0A 4EWFA 5A93A 2PD8A 1LSVA 3ISGA 3GDIA 4CLCD 3P09A 4N1XA 4UHUA 2OLVA 5M18A 4OPZA 3Q7ZA 5C5KA 4PMAA 5EOOA 2XF3A 5A8BA 3IF6C 1QMEA 5GLCA 4LCMA 3EQVA 1DJBA 1SHVA 4GS9B 4HH2A 1E3UD 2G2UA 1ALQA 2QKPA 3V5MA 3TW8A 5E2HA 1YLWA 4OKPA 2M1CA 3ZVWA 5GHXA 4NETA 5G4YA 1ONHA 1TDGA 2W3HA 4P6ZS 3VFHA 4FD8A 4PM5A 5CEBA 4HBUA 3BJNA 2MJ6A 3LIBA 1BLCA 4Y13A 3CG5A 3E0YA 4NXEA 4E3LA 4JGQA 3G31A 2W1TA 5IS1A 3ZG9B 3PBRA 5EVIA 4EQIA 4EETB 3VP1A 3BEBA 1K0KA 3BLMA 3W4OA 1D1JA 3FPWA 4CLCC 5A91A 1NZOA 2EFUA 5E43A 5FQJA 2Y2LA 2J3TD 2L0WA 4WL9A 2PBYA 3P98A 1EROA 2VEAA 1S4SA 4JXSA 3W4PA 3LR4A 1H0MA 1UGUA 5I5LA 2VGLM 4OOYA 4HNBA 4U0XA 4LFUA 4WLAA 3Q07A 4WN5A 4S2LA 3WS1A 1IEMA 3MXRA 5FDSA 1MZUA 4QY5A 3ICYA 4DMZA 2NUPC 2ZQCA 1FR1A 2ZM0A 3H82A 2VZWA 2WKPA 2PBDP 3QP4A 1GSWA 2IWCA 4NKPA 5G4ZA 1GSVA 1VM1A 2W1RA 5AVFA 3SS4A 3SH8A 1YLYA 3VE4A 4YNRA 3VFFA 4R3BA 1KGFA 2HZ5A 2XLNA 3UE3A 5TBMA 4LV2A 2A3UA 5K5BA 3LFVA 5HPIA 3H7WA 2W3FA 4ARZB 1OTIA 5L10A 1P97A 5DFXA 4WYYA 1K54A 4JXVA 4UA7A 3IXHA 1H8ZA 3BW6A 2V1ZA 3RFBA 2QJ7A 3BFDA 1XFNA 2R78A 1OT6A 4UQIM 3NJAA 4Z9QA 4GN2A 4OPQA 1FOFA 2X01A 3Q7VA 3RJUA 1NXYA 5HD3A 2CMNA 1MC0A 1JWPA 2HJEA 5FQKA 3ULFA 5EOEA 1CQAA 1RGYA 3UPNA 2VA0A 1BT5A 3A0VA 5TGFA 2OSUA 2INWA 5HAPA 2V1BA 4GW9A 3OLOA 3CZDA 3OCNA 4MEZA 1JNUA 2Y2KA 2JBFA 1SKOB 5DVAA 2Y79A 4NXGA 2P7JA 3O5YA 4JLFA 3F1OA 3R7WB 3M2KA 1G6OA 2I9VA 2JKGA 2WKHA 5AQBA 5DF9A 1IYOA 1O7EA 1LLBA 2FFFB 1PFLA 4G3VA 3BLSA 4HEFA 2PR5A 2WGWB 2O99A 4QU3A 1YAXA 1W79A 1NY0A 4Y15A 5CERA 1LL8A 3HLCA 3E2LA 3C4OA 4L0LA 2Z6DA 1W5DA 4N1HA 5HW3A 1VHMA 1K57C 4ARZA 1LT0A 3BFFA 4K0XA 2XEPA 5HAIA 3FZCA 2EX2A 3LR3A 1JWVA 4BMWA 2H0TA 3CPTA 1L0DA 2KLIA 1K4EA 1IFQA 1YSQA 2V2FF 4HQAA 3KSHA 1MWTA 3BWLA 4FCFA 1PI4A 5JYPA 5TR7A 4IUHA 3TOIA 4CLCE 3OPPA 5CHJA 3UDFA 1LSWA 1PWDA 1VEUB 2K31A 2VJWA 2XGNA 1T18A 1XA1A 5DKLA 3RTYA 4WBGA 3MZFA 4DKIA 1F98A 2QYBA 4IVIA 4DE3A 4LRYC 3MKFA 2EXAA 2EX8A 3T1QB 5A90A 3T4SA 3R4KA 5FEFA 2I72A 4S2NA 4KG6A 4UEYA 3VP2A 2XROA 2WGVA 3ITBA 3R7WA 3BFEA 1XJ6A 3NULA 4G3WA 2H10A 3N8SA 3HLFA 1HTZA 4WMCD 2YKFA 3N6IA 3VOYA 2M7UA 1YMSA 1SZVA 3KSGA 3CMZA 3CLOA 1H8MA 1YLTA 1E25A 3GR2A 2ZC5B 1Y54A 3S7NA 3ZG8B 3VE3A 3U2AA 4BENA 1KE3A 3MKEA 5DFYA 1D7EA 4P6BA 2ZC3B 1ES2A 3A0RA 3UPPA 2VLGA 3GSGA 3MJQA 3MXQA 3ZG0A 3IS2A 4B4ZA 1ERQA 1PIOA 1F5MA 5BOHA 1VEUA 2ACGA 4IBXA 3LIFA 3IH8A 2XDMA 3FKVA 2GDNA 4K08A 2HF6A 1DRMA 3Q81A 5M19A 1IYSA 1FSYA 1K55A 4Q0IA 4E3MA 3D4FA 1PZPA 3WRZA 2P74A 3LUQA 3CHWP 5CHUA 3JYIA 4JGRA 4PKYG 4QJGA 2WAEA 3GRJA 4BLMA 1XFQA 4F3LB 1BYWA 4F94A 3ZDJA 1V9ZA 5I94A 4KZ8A 3QHYA 4HESA 1KOUA 4WZ5A 4P6ZM 1OTBA 2GNXA 1FSWA 3BRMA 5J7EA 2K2NA 2J9PA 5HFOA 3UN7A 4GKUA 3S7QA 5FAOA 3IXGA 3PR6A 1BZAA 4LENA 5CXWA 5FASA 3O88A 3P7NA 5CECA 5MC7A 4O01A 3Q1FA 5HL1A 3NY4A 5EVID 5L09A 1WYCA 3HVFA 3PBSA 3EGDC 1PYYA 4LV0A 2JC7A 2D01A 4R0QA 2HDRA 2HGVA 3NDEA 4D2OA 1I5QA 4CQHA 4S2KA 2Q0OA 1H3QA 4IHQA 5L8MA 5HWVA 3BFGA 3N4IA 4BL2A 4K91A 1MWSA 1TS6A 1F2KA 5IHVA 2Y2IA 3LI8A 3QP8A 1XJ3A 4Y0OA 3IT9A 3AGEA 2X71A 2P04A 3MQQA 3DAVA 3OCLA 1LSXA 3FWLA 2W1TB 3HUNA 4R38A 3M6HA 3UDXA 4QPRA 3K2NA 5EVIB 4B88A 3FYZA 4GHIA 3O3VA 1T19A 1NYYA 4DJ2A 3HUOA 2JE5A 1D06A 2B18A 4DJ3A 2JKFA 4HOIA 1IKIA 1O07A 4B93A 3E98A 1K6SA 2ZQDA 5E2GA 3UB9A 1KE4A 2ZJ9A 2BG1A 4LRXC 3PBTA 1C3BA 4DE2A 3HBRA 5EVIC 2XFSA 3C5AA 4S2OA 1N4OA 1G6AA 1V9YA 1TEMA 3F1NA 3EWKA 3KO6A 1BLPA 3MZEA 5FQIA 1NYMA 4ZJ2A 3KX0X 4FH4A 3JVUA 5D3OA 3G4PA 3H82B 1S0WA 3K3CA 1OTDA 1ESIA 4OOMA 3IQAA 2Y2NA 2BTFP 2B95A 4FH2A 2V20A 1MWUA 5HDDA 2OAP1 4G3KA 3VV4A 3MBZA 3BY8A 4NXFA 3A3DA 1YPRA 4HP4A 2Y2HA 1PWGA 4EESA 5TBMB 3UMDA 4Y3IA 4N9LA 2H5SA 3PAGA 2ZD8A 4HHDA 1K56A 3H7WB 2Y4AA 1DP9A 1FILA 1FCNA 1SDEA 3H9WA 1PZOA 4X25A 3PBOA 4BBUA 2HDSA 3VOZA 4R23A 2J80A 3PHYA 4RA7A 4L9EA 1S66L 4BBVA 3T50A 5DKKA 1YQSA 5HX9A 1XGJA 3Q7VB 2OAQ1 4EUZA 3GV9A 4E3JA 2V0UA 2UWXA 5EE8A 4OPRA 4MDZA 1ES4A 1K54C 2ZC6B 3MQOA 2Z2LB 3V39A 5CTMA 1EI5A 1PW1A 4OQIA 4MMNA 3RXWA 1I2WA 4Y17A 5M1AA 3GMWA 3ZG7B 3IBRA 2WKIA 3E2KA 3LR5A 3QNCA 3LIAA 4XT2A 3VMAA 1ACFA 3W8KA 5F69A 2XA7S 4EBLA 4ZBEA 1WYBA 2HP9A 1OJ5A 1XKZA 5FI6A 3MXSA 4ESPA 4OQHA 2HV1A 3F1OB 4JGOA 1LI0A 4BWIA 4IJGA 4HY8A 4R4SA 4EV4A 4Z1WA 3WS2A 4JKTA 2Z2MB 4IUKA 3G32A 4L9GA 3SW1A 3EQUA 4OPYA 4WELA 3ZCZA 4Y2FA 2XFTA 2A24B 1XXMA 2W0NA 3MFXA 3V67A 5IT5A 2WKRA 1LHYA 2P08A 2R9WA 4R70A 5DJUA 1RP5A 2WZZA 4EQ1A 3DWKA 3OPHA 1NRJA 3CPTB 3NI9A 5FI7A 4JPMA 3IX8A 1ERMA 3LICA 3TG9A 3TJZC 4R4RA 4JF5A 1YKDA 4OONA 2ZMAA 4Y7PA 1VETA 1HD8A 1BLHA 5FQQA 3ZG5A 3DTMA 2ZQ9A 1TS0A 1CJFA 1ESUA 2XR0A 2YKHA 1YT4A 2C5WB 3G30A 4IVKA 1Y4OA 4QHCA 1UWPX 3ZHHA 4HP9A 4PPRA 4HJ6A 4EBPA 4JBFA 4KG5A 3D72A 3LR0A 3O86A 2A2LA 4C3QA 1KVMA 4KENB 4OQ0A 1G28A 2IWBA 1GSXA 2PU4A 3NIAA 1DJCA 3KYZA 2P9VA 2EX6A 5CHMA 4KQRA 5J4EA 4MN7A 4DXBA 2WKQA 1WA9A 1ZHHB
chains in the Genus database with same CATH topology
2VLGA 2J3WA 3UB7A 3MJQA 4KQDA 2GX5A 2A24A 3MXQA 3TE8A 3C8CA 3IS2A 4I39A 1NWZA 2JKRI 2PT7A 1F5MA 1F9IA 2L1MA 1IOUA 1T1AA 2KDKA 4I3IA 2PYPA 2VV7A 3LIFA 3D3OA 4KUOA 4F3LA 1OTAA 3EOIA 4LLOB 4DN0A 2V9AA 1T1CA 4GS9A 4K08A 4WEJA 2HF6A 1DRMA 4FSFA 3PXPA 4HJ4A 2OWJA 5IU1A 2ZMVA 1ZTUA 3G6OA 4BBTA 3A0SA 5AJGA 2VX8A 4Q0IA 4LPZA 3UB6A 1MKMA 3C2WA 3T4JA 4BJPA 3IS2B 1YSPA 2PD8A 1LSVA 3CUEA 3LUQA 2JHEA 3GDIA 4CLCD 4JGRA 4PKYG 1XFQA 4F3LB 5C5KA 1BYWA 4CLCA 5FL3A 5A8BA 4AFIA 1V9ZA 3EQVA 5F6AA 3NOPC 4GS9B 4HH2A 1NLYA 3FG8A 4R6LA 3OOVA 2QKPA 1KOUA 3MR0A 4P6ZM 1OTBA 2GNXA 2J3TC 3LI9A 4EUVA 2IA2A 5J3WA 3BY9A 3TW8A 5J7EA 1S67L 2K2NA 2M1CA 2W27A 2W3DA 3S7QA 5G4YA 2PDRA 3PR6A 4B9OA 1EW0A 2W3HA 4P6ZS 1TF1A 1S1YA 1S1ZA 2XSSA 5CX7A 3P7NA 4I5SA 3BJNA 2MJ6A 3LIBA 5MC7A 4O01A 3E0YA 4NXEA 3RH8B 4FOFA 3S7OA 4JGQA 3B47A 1DP6A 5HWWA 2W1TA 5IS1A 4H6JB 3PBSA 3T4OA 3EGDC 3PBRA 2O9AA 3PBQA 2D01A 3CUEC 2HGVA 4EETB 4CQHA 1H3QA 2O0YA 4IHQA 5L8MA 5HWVA 5KIZA 3FPWA 4CLCC 4WUJA 4R3AA 3EEHA 2PR6A 1TS6A 3DBAA 2J3TD 2L0WA 4WL9A 3LI8A 2VEAA 1XJ3A 1S4SA 2JN7A 2P04A 3MQQA 2L4RA 3LR4A 3OCLA 1LSXA 3PBNA 4HIAA 1UGUA 2W1TB 5I5LA 2VGLM 1STZA 4EW7A 4HNBA 4R38A 3VOLA 2QWSA 3EGXC 4QPRA 2VKSA 4WLAA 3K2NA 4HI4A 3BQAA 4WN5A 2M7VA 4GHIA 3F1PB 3HJKA 1Y28A 1T19A 1MZUA 3CITA 4DJ2A 1TS8A 1D06A 2B18A 4DJ3A 2PHYA 4HOIA 3ICYA 3E4QA 4O0PA 4DMZA 5HPFA 3OBFA 2NUPC 3HJIA 3H82A 4MCWA 2VZWA 2VGLS 2W3GA 2WKPA 4B93A 3E98A 1GSWA 4LRZE 1DP8A 3UB9A 3EEAA 3K3DA 2Z6CA 4HH3A 4LRXC 4NKPA 3PBTA 5G4ZA 1GSVA 2FH5A 1V9YA 2W3EA 3F1NA 4WF0A 3EWKA 5KSHA 3C30A 3KO6A 2W1RA 4GHIB 5AVFA 5HSQA 3JVVA 4JGPA 4M4XA 3KX0X 2DMWA 3VE4A 2ZBBA 4YNRA 5F68A 3LIDA 4ME4A 3ZYTA 1P0ZA 3JVUA 2LB9A 3UE3A 3UE6A 3H82B 5TBMA 2XRNA 3TRCA 3K3CA 2KOIA 1OTEA 5K5BA 1OTDA 1TD5A 2HJ9C 3LFVA 2ZOHA 4H6JA 4OOMA 4PKYA 1ODVA 3ZQ5A 5HPIA 3H7WA 2W3FA 4ARZB 1OTIA 1S4RA 2V0WA 2O9CA 1P9WA 4ETXA 1P97A 2PYRA 5DFXA 1VB6A 3F1NB 3HCYA 5LBRA 3KYQA 5HDDA 2OAP1 3BW6A 4G3KA 3VV4A 3RFBA 2QJ7A 3BY8A 3KSIA 4NXFA 1N9NA 4HP4A 1UWNX 1XFNA 2R78A 4EESA 3P01A 5HWTA 1OT6A 4UQIM 3NJAA 5TBMB 3UMDA 4PAUA 5DJTA 4Y3IA 2LB5A 2G7UA 2GZAA 5HD3A 2CMNA 1MC0A 5EFWA 1OJGA 4HHDA 2FZ0A 3H7WB 2HJEA 3ULFA 1DP9A 4HJ3A 2B02A 3B42A 5HZHA 3F1PA 4ETZA 3H9WA 2VA0A 3PBOA 4BBUA 3NHQA 3BQ8A 3A0VA 2J80A 2INWA 4UQIS 1N9LA 3PHYA 2V1BA 4GW9A 4L9EA 3MF0A 3OLOA 3UB8A 1S66L 4KUKA 4BBVA 4OOLA 5DKKA 3T50A 3LYXA 3OCNA 3E4PA 4I3AA 1JNUA 2JKTM 1NLZA 3W2ZA 1OT9A 4I38A 2Y79A 3S7PA 4NXGA 2OAQ1 2P7JA 3O5YA 2V0UA 4MDZA 1X0OA 3MQOA 4WEKA 4MN6A 3F1OA 3R7WB 4Y5FA 2XA7M 1G6OA 2I9VA 3LIEA 5DF9A 4G3VA 4MMNA 2PR5A 2V1AA 4EXOA 2O99A 3MQ0A 3IBRA 1YAXA 2NUTC 1LL8A 3LR5A 4L0LA 1P9RA 2Z6DA 3LIAA 4XT2A 2ZOIA 2EWVA 4ZRRA 5F69A 1VHMA 2XA7S 1XJ4A 4ARZA 1LT0A 1OJ5A 3PYPA 2EWWA 2QHKA 3FPVA 4II7A 4KQOA 4NEED 2HV1A 3F1OB 4JGOA 4BWIA 3LR3A 2KX6A 4IJGA 4BMWA 4HY8A 4Z1WA 3CAXA 3CI6A 2OWHA 2KLIA 4IUKA 4L9GA 1IFQA 3SW1A 3EQUA 4I3JA 1YSQA 4WELA 4Y2FA 4HQAA 3KSHA 2A24B 3BWLA 3B33A 4XT2B 1XJ2A 4IUHA 4CLCE 2W0NA 3MFXA 3V67A 4RQ9A 3UMEA 5IT5A 1LSWA 5HDSA 2K31A 2VJWA 1T18A 4GCZA 2WKRA 4EEUA 3RTYA 2P08A 5DKLA 4R70A 5DJUA 2JKTI 2O9BA 4EQ1A 2JKRM 4MN5A 4EERA 1F98A 2QYBA 1NRJA 3KSFA 3MMHA 3OC2A 4LRYC 2D02A 3IBJA 4EU0A 3LICA 3CWFA 3T4SA 4GJ4A 2QJ5A 3TJZC 5AVEA 1TS7A 3R4KA 1W63M 1YKDA 4UEYA 5HL6A 3GECA 2XROA 2GJ3A 4Q0JA 3R7WA 1N9OA 2H28A 1XJ6A 4GLQA 4G3WA 1T1BA 3T4KA 4CLCB 3NOTC 3FC7A 1TS0A 2OOLA 2Y8HA 2VV8A 2YKHA 2EA9A 2YKFA 2PD7A 4Q0HA 4YWZA 4O8GA 3T4LA 1UWPX 1W63Q 3T4QA 4HP9A 4HJ6A 2M7UA 4E04A 3D72A 3E4OA 5HDCA 2VV6A 1OPXA 4YOFA 3LR0A 3KSGA 5TJJA 3CLOA 1H8MA 2A2LA 3C38A 1G28A 1GSXA 5HD5A 3KYZA 2BASA 3S7NA 3VE3A 3U2AA 5F5YA 4L9FA 4NXBA 5DFYA 2ZMFA 5J4EA 1D7EA 3NOUC 4PHTA 2K7SA 4MN7A 3A0RA 2WKQA 4EEPA 1WA9A 3T4TA 1ZHHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLG A;  3UB7 A;  3MJQ A;  4KQD A;  2A24 A;  3MXQ A;  3C8C A;  3IS2 A;  4I39 A;  1NWZ A;  1F9I A;  2L1M A;  1T1A A;  2KDK A;  4I3I A;  2PYP A;  2VV7 A;  3LIF A;  4KUO A;  4F3L A;  1OTA A;  4LLO B;  2V9A A;  1T1C A;  4GS9 A;  4K08 A;  1DRM A;  4HJ4 A;  2OWJ A;  5IU1 A;  3G6O A;  4BBT A;  3A0S A;  4LPZ A;  3UB6 A;  3C2W A;  3IS2 B;  2PD8 A;  1LSV A;  3LUQ A;  2JHE A;  3GDI A;  4JGR A;  4PKY G;  1XFQ A;  4F3L B;  1BYW A;  5A8B A;  1V9Z A;  5F6A A;  3NOP C;  4GS9 B;  4HH2 A;  3FG8 A;  4R6L A;  2QKP A;  1KOU A;  3MR0 A;  1OTB A;  3LI9 A;  5J3W A;  3BY9 A;  5J7E A;  1S67 L;  2M1C A;  2W27 A;  5G4Y A;  2PDR A;  4B9O A;  1EW0 A;  1S1Y A;  1S1Z A;  3P7N A;  4I5S A;  3LIB A;  4NXE A;  3RH8 B;  4JGQ A;  1DP6 A;  5HWW A;  5IS1 A;  4H6J B;  2D01 A;  4EET B;  5HWV A;  5KIZ A;  4WUJ A;  4R3A A;  3EEH A;  2PR6 A;  1TS6 A;  2L0W A;  4WL9 A;  3LI8 A;  2VEA A;  1XJ3 A;  1S4S A;  2JN7 A;  3MQQ A;  2L4R A;  1LSX A;  4HIA A;  1UGU A;  5I5L A;  4EW7 A;  4HNB A;  4R38 A;  3VOL A;  2QWS A;  4WLA A;  4HI4 A;  4WN5 A;  4GHI A;  3F1P B;  3HJK A;  1Y28 A;  1T19 A;  1MZU A;  4DJ2 A;  1TS8 A;  1D06 A;  4DJ3 A;  2PHY A;  4HOI A;  3ICY A;  3E4Q A;  3HJI A;  3H82 A;  2WKP A;  1GSW A;  4LRZ E;  1DP8 A;  3UB9 A;  3K3D A;  2Z6C A;  4HH3 A;  4LRX C;  5G4Z A;  1GSV A;  1V9Y A;  3F1N A;  4WF0 A;  3EWK A;  4GHI B;  5AVF A;  5HSQ A;  4JGP A;  4M4X A;  3KX0 X;  3VE4 A;  2ZBB A;  5F68 A;  3LID A;  1P0Z A;  3UE6 A;  3H82 B;  5TBM A;  3K3C A;  1OTE A;  1OTD A;  2ZOH A;  4H6J A;  4PKY A;  1ODV A;  3ZQ5 A;  3H7W A;  1OTI A;  1S4R A;  2V0W A;  1P97 A;  2PYR A;  1VB6 A;  3F1N B;  5HDD A;  2QJ7 A;  3BY8 A;  4NXF A;  1N9N A;  4HP4 A;  1UWN X;  1XFN A;  2R78 A;  4EES A;  5HWT A;  1OT6 A;  3NJA A;  5TBM B;  3UMD A;  5DJT A;  5HD3 A;  2CMN A;  5EFW A;  1OJG A;  4HHD A;  3H7W B;  3ULF A;  1DP9 A;  4HJ3 A;  2B02 A;  5HZH A;  3F1P A;  3H9W A;  4BBU A;  3NHQ A;  3A0V A;  2J80 A;  2INW A;  1N9L A;  3PHY A;  2V1B A;  4GW9 A;  4L9E A;  3OLO A;  3UB8 A;  1S66 L;  4KUK A;  4BBV A;  3T50 A;  5DKK A;  3LYX A;  3E4P A;  4I3A A;  1JNU A;  1OT9 A;  4I38 A;  4NXG A;  2P7J A;  2V0U A;  1X0O A;  3MQO A;  4MN6 A;  3F1O A;  2I9V A;  3LIE A;  2PR5 A;  2V1A A;  4EXO A;  3IBR A;  1LL8 A;  2Z6D A;  3LIA A;  4XT2 A;  2ZOI A;  5F69 A;  1XJ4 A;  1LT0 A;  1OJ5 A;  3PYP A;  2QHK A;  2HV1 A;  3F1O B;  4JGO A;  2KX6 A;  4HY8 A;  3CAX A;  2OWH A;  4L9G A;  3SW1 A;  4I3J A;  4HQA A;  2A24 B;  3BWL A;  3B33 A;  4XT2 B;  1XJ2 A;  2W0N A;  3MFX A;  4RQ9 A;  3UME A;  1LSW A;  5HDS A;  1T18 A;  4GCZ A;  2WKR A;  4EEU A;  3RTY A;  5DKL A;  4R70 A;  5DJU A;  4EQ1 A;  4MN5 A;  4EER A;  1F98 A;  4LRY C;  2D02 A;  3LIC A;  3CWF A;  2QJ5 A;  5AVE A;  1TS7 A;  3GEC A;  2GJ3 A;  1N9O A;  2H28 A;  1XJ6 A;  1T1B A;  3NOT C;  3FC7 A;  1TS0 A;  2OOL A;  2VV8 A;  2YKH A;  2EA9 A;  2YKF A;  2PD7 A;  4YWZ A;  1UWP X;  4HP9 A;  4HJ6 A;  4E04 A;  3D72 A;  3E4O A;  5HDC A;  2VV6 A;  3CLO A;  1G28 A;  1GSX A;  5HD5 A;  2BAS A;  3VE3 A;  5F5Y A;  4L9F A;  4NXB A;  5J4E A;  1D7E A;  3NOU C;  2K7S A;  3A0R A;  2WKQ A;  4EEP A;  1WA9 A; 
#chains in the Genus database with same CATH topology
 2A24 A;  5F1F A;  2WAD A;  3TE8 A;  4I39 A;  4KG2 A;  5E2F A;  2Y55 A;  4S2N C;  3WWX A;  5FQM A;  1GHI A;  4IED A;  4X68 A;  4KZ3 A;  4C6Y A;  3DW0 A;  3HLW A;  4LLO B;  3LEZ A;  1IYQ A;  1T1C A;  1SDN A;  5DF7 A;  2Y2G A;  2AVX A;  4U3T A;  1MXO A;  2WAF A;  3T4J A;  3IS2 B;  1YSP A;  2Y2Q A;  3CUE A;  3IWO A;  3IWI A;  4E6W A;  2PU2 A;  1GA0 A;  4JF6 A;  1FIK A;  1L2S A;  3JPU A;  5F6A A;  3NOP C;  3FG8 A;  3MR0 A;  4NG2 A;  4C75 A;  1ZKJ A;  3LI9 A;  1IYP A;  2ZL1 A;  4GZB A;  5J3W A;  3BY9 A;  3GTC A;  4GD6 A;  3SOI A;  3BYD A;  4JXW A;  4EBN A;  2W27 A;  4X6T A;  4GNU A;  3M6B A;  4BD1 A;  5J8X A;  2J7V A;  1S1Y A;  1S1Z A;  2XSS A;  4JF4 A;  3B3X A;  2V8C A;  2WYX A;  2XQZ A;  1BLS A;  3RH8 B;  1K55 C;  1J3W A;  5HWW A;  2O9A A;  1WE4 A;  5GLD A;  3UE0 A;  4GOG A;  4M3K A;  4XUZ A;  4R3A A;  2OLU A;  3EEH A;  4ZDX A;  3DBA A;  4WZ5 C;  3VP4 A;  2JN7 A;  4MBK A;  5AQA A;  3V3R A;  4HIA A;  5DTS A;  4X56 A;  4QB8 A;  2QWS A;  3EGX C;  4E6X A;  1MWR A;  2VKS A;  4HI4 A;  2M7V A;  1I2S A;  3F1P B;  3HJK A;  3NBL A;  3CIT A;  1N9B A;  1TS8 A;  5EM1 A;  3N8L A;  4Y0T A;  4O0P A;  5HPF A;  3OBF A;  2DNS A;  3HJI A;  1PW8 A;  1CI9 A;  3M2J A;  5AQ9 A;  1YM1 A;  4R1G A;  3MZD A;  1DP8 A;  2Z6C A;  4OQG A;  2FH5 A;  5KMW A;  2W3E A;  5KSH A;  3C30 A;  4GHI B;  5HSQ A;  2E8J A;  4JGP A;  4M4X A;  2DMW A;  2ZBB A;  1XGI A;  3QNB A;  3LCE A;  5F68 A;  3LID A;  4GDN A;  1P0Z A;  2PAV P;  2LB9 A;  2Q9N A;  3UE6 A;  2XRN A;  4KZA A;  1OTE A;  1TD5 A;  1LI9 A;  2EXB A;  3WS0 A;  3ZQ5 A;  3A3F A;  1S4R A;  2V0W A;  3ITA A;  5F82 A;  2PYR A;  5EVE A;  3L9K A;  1BTL A;  3F1N B;  2VGJ A;  3PTE A;  4OLG A;  3ZVT A;  2WK0 A;  3KYQ A;  4S2J A;  1PI5 A;  2DCF A;  4LGW A;  3KSI A;  1K56 D;  3WRT A;  3T1S A;  1HZO A;  2XK1 A;  3S1Y A;  2GZA A;  2HP5 A;  2FZ0 A;  4BD0 A;  4HJ3 A;  1RGZ A;  1K4F A;  1YLJ A;  5HZH A;  3F1P A;  4GD8 A;  4ETZ A;  5L07 A;  4ZTK A;  3NHQ A;  3BQ8 A;  1KDW A;  3HL9 A;  5GLA A;  3LGO A;  3SS3 A;  1LL5 A;  1PNE A;  4KUK A;  4N92 A;  3LYX A;  3E4P A;  5FEG A;  5FI2 A;  3W2Z A;  4KZ6 A;  1SCW A;  3NDG A;  4OVD A;  4NK3 A;  3ZNT A;  4Y0U A;  2R9X A;  4KZ9 A;  1M40 A;  3T12 B;  1X0O A;  2RCX A;  4MN6 A;  2G2W A;  4Y5F A;  2XA7 M;  1JWZ A;  2ZQ8 A;  3BM6 A;  2ZLY A;  4XUX A;  1FCO A;  4EXO A;  1TDL A;  3MQ0 A;  5FAQ A;  2BLS A;  5FDH A;  2ZOI A;  2UV0 E;  2EWV A;  2HP6 A;  4ZRR A;  4IBR A;  2XH9 A;  3DTK A;  2EWW A;  3QP2 A;  2QHK A;  3FPV A;  4KQO A;  1BUE A;  4MBF A;  5HAR A;  4OLD A;  3CAX A;  1FR6 A;  4E3O A;  4ZAM A;  4MNR A;  3VP3 A;  4I3J A;  3IX4 A;  4DF6 A;  4KZ5 A;  4OP8 A;  2Y2O A;  3B33 A;  4XT2 B;  4PM9 A;  3LY4 A;  4RQ9 A;  5GHY A;  2QZ6 A;  1KGE A;  4K0W A;  4EEU A;  2H0Y A;  1ZG4 A;  2JKT I;  2O9B A;  5KZH A;  4WM9 A;  4YFM A;  3GQZ A;  3A3I A;  1ES3 A;  4MN5 A;  1CK3 A;  3KSF A;  1XPB A;  5FA7 A;  2V8F A;  1XA7 A;  4RVA A;  4EU0 A;  4GJ4 A;  4QY6 A;  2QJ5 A;  1TS7 A;  4DDY A;  4X55 A;  3CJM A;  5FSR A;  5HL6 A;  3GEC A;  2GJ3 A;  1G5U A;  3IXB A;  1N9O A;  1PRQ A;  2H28 A;  2WZX A;  2XD1 A;  4GLQ A;  4CLC B;  1VQQ A;  3NOT C;  3ZFZ A;  2Y8H A;  2VV8 A;  4P85 A;  2EA9 A;  2PD7 A;  4Q0H A;  5EVL A;  1KDS A;  1K25 A;  1ZG6 A;  4E04 A;  3E4O A;  5HDC A;  4E3K A;  2VV6 A;  1OPX A;  3Q82 A;  5TJJ A;  3LO7 A;  2WKE A;  2ZC4 B;  5HD5 A;  1CI8 A;  5GLB A;  4L9F A;  4UA6 A;  1VET B;  1OME A;  4E3N A;  3G2Y A;  1J9M A;  2JCH A;  1BUL A;  3IF6 A;  5EPH A;  4EEP A;  4WZ4 A;  4QD4 A;  3T4T A;  1FCM A;  2PRF A;  4KQD A;  3SH7 A;  1DJA A;  5EUA A;  1CF0 A;  3UO9 A;  1M6K A;  3IWQ A;  4X69 A;  1K38 A;  1NWZ A;  2JKR I;  2PT7 A;  5GHZ A;  1IOU A;  5CGW A;  2KDK A;  4UA9 A;  1G68 A;  4KUO A;  2P9V B;  2V9A A;  3MFD A;  3I7J A;  3PAE A;  1CEF A;  3VP0 A;  4Q8I A;  2Y2P A;  4GS9 A;  1HLU P;  5CTN A;  4FSF A;  3PXP A;  2Q9M A;  1ZTU A;  3G6O A;  1YLP A;  5E2E A;  4LPZ A;  1MKM A;  3UB5 P;  3C2W A;  1W8Q A;  1L0F A;  4BJP A;  3S4X A;  2JHE A;  4CPK A;  2X02 A;  4KZ7 A;  5CGX A;  1FQG A;  3T1X A;  4PM7 A;  4CLC A;  5FL3 A;  4AFI A;  2HDQ A;  1NLY A;  2A49 A;  4R6L A;  3OOV A;  4X53 A;  5AQ7 A;  1XX2 A;  2J3T C;  1W8Y A;  4EUV A;  2IA2 A;  2VGK A;  2CC1 A;  1E3U A;  1EWZ A;  3HRE A;  1S67 L;  4OH0 A;  3C7U A;  2W3D A;  1NJ4 A;  2IWD A;  3O87 A;  2PDR A;  3A3E A;  4B9O A;  1H8Y A;  1EW0 A;  1AXB A;  1TF1 A;  5CX7 A;  3VSL A;  4I5S A;  2HDU A;  4KQQ A;  2ZM8 A;  4DDS A;  1Q2P A;  4FOF A;  1L3L A;  3S7O A;  3B47 A;  1DP6 A;  4H6J B;  3T4O A;  1U60 A;  2ZL1 B;  3LEQ A;  4LV1 A;  3PBQ A;  3CUE C;  4FTX A;  4DE1 A;  4B4X A;  3C7V A;  2Y2M A;  4YIN A;  2O0Y A;  3MSH A;  1YMX A;  4ID4 A;  5KIZ A;  3OPR A;  4WUJ A;  3UNW A;  2OV5 A;  3AGF A;  3QP1 A;  2PR6 A;  4U0T A;  3L7H A;  5TFQ A;  1DY6 A;  5DF8 A;  1S6R A;  4E3I A;  3V50 A;  2L4R A;  4S2M A;  3PBN A;  3SH9 A;  2ZQA A;  1STZ A;  4EW7 A;  3NEC A;  3VOL A;  4S2I A;  3BQA A;  3KYE A;  1XP4 A;  1Y28 A;  2PHY A;  3E4Q A;  5FAP A;  1SKF A;  4MCW A;  2VGL S;  2W3G A;  3WS5 A;  2VK3 A;  3T1R A;  4LRZ E;  4PM6 A;  3EEA A;  5EM0 A;  3A3J A;  3DWZ A;  3K3D A;  4HH3 A;  3HLB A;  1JVJ A;  1MY8 A;  4P87 A;  4OP5 A;  1AWI A;  4LCL A;  3QP6 A;  5EEC A;  3IF5 A;  4MBH A;  4WF0 A;  5FAT A;  3JVV A;  3S22 A;  2Y2J A;  1ONG A;  3UE1 A;  1QMF A;  4ZJ1 A;  4ME4 A;  2DRW A;  3ZYT A;  5HAQ A;  3TRC A;  1PWC A;  2KOI A;  2Y59 A;  2HJ9 C;  1CEG A;  1NZU A;  2XD5 A;  3BFC A;  2ZOH A;  4H6J A;  4PKY A;  1ODV A;  5A92 A;  4QWO A;  3G35 A;  4DRT A;  5CRF A;  2O9C A;  1P9W A;  4ETX A;  1HVB A;  4KZB A;  1VB6 A;  3G34 A;  4XXR A;  1H5X A;  1W7F A;  3HCY A;  3W4Q A;  1GHP A;  5LBR A;  1KVL A;  1N9N A;  1UWN X;  1MKI A;  4X1M A;  1BSG A;  3P01 A;  3ZNY A;  5HWT A;  4PAU A;  1SKO A;  5DJT A;  2LB5 A;  2G7U A;  2J8Y A;  4H8R A;  5CGS A;  5EFW A;  1OJG A;  4UAA A;  1K57 A;  1NRF A;  4O7D A;  1L0E A;  2B02 A;  3B42 A;  4N9K A;  1IEL A;  4X1L A;  3MS6 A;  5GL9 A;  4PM8 A;  4UQI S;  1N9L A;  2EX9 A;  2WGW A;  3MF0 A;  3UB8 A;  4OOL A;  2Y91 A;  4CJN A;  1TVF A;  4I3A A;  2JKT M;  1NLZ A;  1ES5 A;  1LL9 A;  5JYO A;  1OT9 A;  4I38 A;  3S7P A;  2RL3 A;  3AGD A;  1Z6F A;  3UPO A;  3IXD A;  4WEK A;  5EV0 A;  3IH9 A;  3C4P A;  3LIE A;  3IHA A;  3V3S A;  2QMI A;  1E4D A;  4DXC A;  1MPL A;  2V1A A;  4RX3 A;  2NUT C;  1GA9 A;  3QP5 A;  4P0M A;  1P9R A;  3HUM A;  3RXX A;  5DTK A;  1K6R A;  4GB7 A;  1XJ4 A;  3PYP A;  3G2Z A;  5L2F A;  3WS4 A;  4II7 A;  4NEE D;  4FUW A;  2KX6 A;  1A0K A;  3GVB A;  1L0G A;  3CI6 A;  3NC8 A;  3SZT A;  2OWH A;  4S2P A;  1KGG A;  4RYE A;  2E8I A;  2J9O A;  3HLD A;  3VSK A;  5F1G A;  4A5R A;  4GDB A;  1XJ2 A;  2ZQ7 A;  2C6W B;  1IKG A;  1GHM A;  3UME A;  5HDS A;  4R3J A;  1MBL A;  4GCZ A;  3ZGA B;  4JXG A;  1Q2Q A;  3DTI A;  2JKR M;  4EER A;  4BL3 A;  3MMH A;  3OC2 A;  2D02 A;  3IBJ A;  2B5R A;  2ZM2 A;  3HLG A;  3CWF A;  3LY3 A;  5AVE A;  3HLE A;  2EFX A;  3UDI A;  1W63 M;  3OPL A;  4Q0J A;  3BEC A;  4MLL A;  1T1B A;  3T4K A;  3IHB A;  5DTT A;  3FC7 A;  3N8R A;  5FQ9 A;  2OOL A;  1JTG A;  1KE0 A;  2FFY A;  1Z09 A;  4YWZ A;  4RX2 A;  2WUQ A;  4O8G A;  3T4L A;  4HBT A;  1W63 Q;  4KZ4 A;  3D9Y A;  3T4Q A;  2ZC7 A;  4WMC A;  3OZH A;  4YOF A;  3C38 A;  4ZJ3 A;  3FKW A;  1ZC2 A;  2BAS A;  2WGI A;  4BQM A;  3UY6 A;  5F5Y A;  4NXB A;  2ZMF A;  3U4L P;  3SS5 A;  3NOU C;  4PHT A;  2K7S A;  1GCE A;  5F83 A;  1YLZ A;  5KSC A;  2HPB A;  4LV3 A;  2J3W A;  1JTD A;  5G18 A;  3UB7 A;  2GX5 A;  5U47 A;  3C8C A;  5CED A;  1F9I A;  4D60 A;  2L1M A;  1T1A A;  4I3I A;  2PYP A;  2VV7 A;  3D3O A;  3NCK A;  1RCJ A;  4F3L A;  1OTA A;  3EOI A;  4DN0 A;  3DTE A;  4WEJ A;  2QPN A;  3IF6 B;  3N7W A;  4HJ4 A;  2OWJ A;  5IU1 A;  2ZMV A;  4BBT A;  3A0S A;  5AJG A;  3TSG A;  2VX8 A;  3IX3 A;  3FV7 A;  3UB6 A;  4DE0 A;  4EWF A;  5A93 A;  2PD8 A;  1LSV A;  3ISG A;  3GDI A;  4CLC D;  3P09 A;  4N1X A;  4UHU A;  2OLV A;  5M18 A;  4OPZ A;  3Q7Z A;  5C5K A;  4PMA A;  5EOO A;  2XF3 A;  5A8B A;  3IF6 C;  1QME A;  5GLC A;  4LCM A;  3EQV A;  1DJB A;  1SHV A;  4GS9 B;  4HH2 A;  1E3U D;  2G2U A;  1ALQ A;  2QKP A;  3V5M A;  3TW8 A;  5E2H A;  1YLW A;  4OKP A;  2M1C A;  3ZVW A;  5GHX A;  4NET A;  5G4Y A;  1ONH A;  1TDG A;  2W3H A;  4P6Z S;  3VFH A;  4FD8 A;  4PM5 A;  5CEB A;  4HBU A;  3BJN A;  2MJ6 A;  3LIB A;  1BLC A;  4Y13 A;  3CG5 A;  3E0Y A;  4NXE A;  4E3L A;  4JGQ A;  3G31 A;  2W1T A;  5IS1 A;  3ZG9 B;  3PBR A;  5EVI A;  4EQI A;  4EET B;  3VP1 A;  3BEB A;  1K0K A;  3BLM A;  3W4O A;  1D1J A;  3FPW A;  4CLC C;  5A91 A;  1NZO A;  2EFU A;  5E43 A;  5FQJ A;  2Y2L A;  2J3T D;  2L0W A;  4WL9 A;  2PBY A;  3P98 A;  1ERO A;  2VEA A;  1S4S A;  4JXS A;  3W4P A;  3LR4 A;  1H0M A;  1UGU A;  5I5L A;  2VGL M;  4OOY A;  4HNB A;  4U0X A;  4LFU A;  4WLA A;  3Q07 A;  4WN5 A;  4S2L A;  3WS1 A;  1IEM A;  3MXR A;  5FDS A;  1MZU A;  4QY5 A;  3ICY A;  4DMZ A;  2NUP C;  2ZQC A;  1FR1 A;  2ZM0 A;  3H82 A;  2VZW A;  2WKP A;  2PBD P;  3QP4 A;  1GSW A;  2IWC A;  4NKP A;  5G4Z A;  1GSV A;  1VM1 A;  2W1R A;  5AVF A;  3SS4 A;  3SH8 A;  1YLY A;  3VE4 A;  4YNR A;  3VFF A;  4R3B A;  1KGF A;  2HZ5 A;  2XLN A;  3UE3 A;  5TBM A;  4LV2 A;  2A3U A;  5K5B A;  3LFV A;  5HPI A;  3H7W A;  2W3F A;  4ARZ B;  1OTI A;  5L10 A;  1P97 A;  5DFX A;  4WYY A;  1K54 A;  4JXV A;  4UA7 A;  3IXH A;  1H8Z A;  3BW6 A;  2V1Z A;  3RFB A;  2QJ7 A;  3BFD A;  1XFN A;  2R78 A;  1OT6 A;  4UQI M;  3NJA A;  4Z9Q A;  4GN2 A;  4OPQ A;  1FOF A;  2X01 A;  3Q7V A;  3RJU A;  1NXY A;  5HD3 A;  2CMN A;  1MC0 A;  1JWP A;  2HJE A;  5FQK A;  3ULF A;  5EOE A;  1CQA A;  1RGY A;  3UPN A;  2VA0 A;  1BT5 A;  3A0V A;  5TGF A;  2OSU A;  2INW A;  5HAP A;  2V1B A;  4GW9 A;  3OLO A;  3CZD A;  3OCN A;  4MEZ A;  1JNU A;  2Y2K A;  2JBF A;  1SKO B;  5DVA A;  2Y79 A;  4NXG A;  2P7J A;  3O5Y A;  4JLF A;  3F1O A;  3R7W B;  3M2K A;  1G6O A;  2I9V A;  2JKG A;  2WKH A;  5AQB A;  5DF9 A;  1IYO A;  1O7E A;  1LLB A;  2FFF B;  1PFL A;  4G3V A;  3BLS A;  4HEF A;  2PR5 A;  2WGW B;  2O99 A;  4QU3 A;  1YAX A;  1W79 A;  1NY0 A;  4Y15 A;  5CER A;  1LL8 A;  3HLC A;  3E2L A;  3C4O A;  4L0L A;  2Z6D A;  1W5D A;  4N1H A;  5HW3 A;  1VHM A;  1K57 C;  4ARZ A;  1LT0 A;  3BFF A;  4K0X A;  2XEP A;  5HAI A;  3FZC A;  2EX2 A;  3LR3 A;  1JWV A;  4BMW A;  2H0T A;  3CPT A;  1L0D A;  2KLI A;  1K4E A;  1IFQ A;  1YSQ A;  2V2F F;  4HQA A;  3KSH A;  1MWT A;  3BWL A;  4FCF A;  1PI4 A;  5JYP A;  5TR7 A;  4IUH A;  3TOI A;  4CLC E;  3OPP A;  5CHJ A;  3UDF A;  1LSW A;  1PWD A;  1VEU B;  2K31 A;  2VJW A;  2XGN A;  1T18 A;  1XA1 A;  5DKL A;  3RTY A;  4WBG A;  3MZF A;  4DKI A;  1F98 A;  2QYB A;  4IVI A;  4DE3 A;  4LRY C;  3MKF A;  2EXA A;  2EX8 A;  3T1Q B;  5A90 A;  3T4S A;  3R4K A;  5FEF A;  2I72 A;  4S2N A;  4KG6 A;  4UEY A;  3VP2 A;  2XRO A;  2WGV A;  3ITB A;  3R7W A;  3BFE A;  1XJ6 A;  3NUL A;  4G3W A;  2H10 A;  3N8S A;  3HLF A;  1HTZ A;  4WMC D;  2YKF A;  3N6I A;  3VOY A;  2M7U A;  1YMS A;  1SZV A;  3KSG A;  3CMZ A;  3CLO A;  1H8M A;  1YLT A;  1E25 A;  3GR2 A;  2ZC5 B;  1Y54 A;  3S7N A;  3ZG8 B;  3VE3 A;  3U2A A;  4BEN A;  1KE3 A;  3MKE A;  5DFY A;  1D7E A;  4P6B A;  2ZC3 B;  1ES2 A;  3A0R A;  3UPP A;  2VLG A;  3GSG A;  3MJQ A;  3MXQ A;  3ZG0 A;  3IS2 A;  4B4Z A;  1ERQ A;  1PIO A;  1F5M A;  5BOH A;  1VEU A;  2ACG A;  4IBX A;  3LIF A;  3IH8 A;  2XDM A;  3FKV A;  2GDN A;  4K08 A;  2HF6 A;  1DRM A;  3Q81 A;  5M19 A;  1IYS A;  1FSY A;  1K55 A;  4Q0I A;  4E3M A;  3D4F A;  1PZP A;  3WRZ A;  2P74 A;  3LUQ A;  3CHW P;  5CHU A;  3JYI A;  4JGR A;  4PKY G;  4QJG A;  2WAE A;  3GRJ A;  4BLM A;  1XFQ A;  4F3L B;  1BYW A;  4F94 A;  3ZDJ A;  1V9Z A;  5I94 A;  4KZ8 A;  3QHY A;  4HES A;  1KOU A;  4WZ5 A;  4P6Z M;  1OTB A;  2GNX A;  1FSW A;  3BRM A;  5J7E A;  2K2N A;  2J9P A;  5HFO A;  3UN7 A;  4GKU A;  3S7Q A;  5FAO A;  3IXG A;  3PR6 A;  1BZA A;  4LEN A;  5CXW A;  5FAS A;  3O88 A;  3P7N A;  5CEC A;  5MC7 A;  4O01 A;  3Q1F A;  5HL1 A;  3NY4 A;  5EVI D;  5L09 A;  1WYC A;  3HVF A;  3PBS A;  3EGD C;  1PYY A;  4LV0 A;  2JC7 A;  2D01 A;  4R0Q A;  2HDR A;  2HGV A;  3NDE A;  4D2O A;  1I5Q A;  4CQH A;  4S2K A;  2Q0O A;  1H3Q A;  4IHQ A;  5L8M A;  5HWV A;  3BFG A;  3N4I A;  4BL2 A;  4K91 A;  1MWS A;  1TS6 A;  1F2K A;  5IHV A;  2Y2I A;  3LI8 A;  3QP8 A;  1XJ3 A;  4Y0O A;  3IT9 A;  3AGE A;  2X71 A;  2P04 A;  3MQQ A;  3DAV A;  3OCL A;  1LSX A;  3FWL A;  2W1T B;  3HUN A;  4R38 A;  3M6H A;  3UDX A;  4QPR A;  3K2N A;  5EVI B;  4B88 A;  3FYZ A;  4GHI A;  3O3V A;  1T19 A;  1NYY A;  4DJ2 A;  3HUO A;  2JE5 A;  1D06 A;  2B18 A;  4DJ3 A;  2JKF A;  4HOI A;  1IKI A;  1O07 A;  4B93 A;  3E98 A;  1K6S A;  2ZQD A;  5E2G A;  3UB9 A;  1KE4 A;  2ZJ9 A;  2BG1 A;  4LRX C;  3PBT A;  1C3B A;  4DE2 A;  3HBR A;  5EVI C;  2XFS A;  3C5A A;  4S2O A;  1N4O A;  1G6A A;  1V9Y A;  1TEM A;  3F1N A;  3EWK A;  3KO6 A;  1BLP A;  3MZE A;  5FQI A;  1NYM A;  4ZJ2 A;  3KX0 X;  4FH4 A;  3JVU A;  5D3O A;  3G4P A;  3H82 B;  1S0W A;  3K3C A;  1OTD A;  1ESI A;  4OOM A;  3IQA A;  2Y2N A;  2BTF P;  2B95 A;  4FH2 A;  2V20 A;  1MWU A;  5HDD A;  2OAP 1;  4G3K A;  3VV4 A;  3MBZ A;  3BY8 A;  4NXF A;  3A3D A;  1YPR A;  4HP4 A;  2Y2H A;  1PWG A;  4EES A;  5TBM B;  3UMD A;  4Y3I A;  4N9L A;  2H5S A;  3PAG A;  2ZD8 A;  4HHD A;  1K56 A;  3H7W B;  2Y4A A;  1DP9 A;  1FIL A;  1FCN A;  1SDE A;  3H9W A;  1PZO A;  4X25 A;  3PBO A;  4BBU A;  2HDS A;  3VOZ A;  4R23 A;  2J80 A;  3PHY A;  4RA7 A;  4L9E A;  1S66 L;  4BBV A;  3T50 A;  5DKK A;  1YQS A;  5HX9 A;  1XGJ A;  3Q7V B;  2OAQ 1;  4EUZ A;  3GV9 A;  4E3J A;  2V0U A;  2UWX A;  5EE8 A;  4OPR A;  4MDZ A;  1ES4 A;  1K54 C;  2ZC6 B;  3MQO A;  2Z2L B;  3V39 A;  5CTM A;  1EI5 A;  1PW1 A;  4OQI A;  4MMN A;  3RXW A;  1I2W A;  4Y17 A;  5M1A A;  3GMW A;  3ZG7 B;  3IBR A;  2WKI A;  3E2K A;  3LR5 A;  3QNC A;  3LIA A;  4XT2 A;  3VMA A;  1ACF A;  3W8K A;  5F69 A;  2XA7 S;  4EBL A;  4ZBE A;  1WYB A;  2HP9 A;  1OJ5 A;  1XKZ A;  5FI6 A;  3MXS A;  4ESP A;  4OQH A;  2HV1 A;  3F1O B;  4JGO A;  1LI0 A;  4BWI A;  4IJG A;  4HY8 A;  4R4S A;  4EV4 A;  4Z1W A;  3WS2 A;  4JKT A;  2Z2M B;  4IUK A;  3G32 A;  4L9G A;  3SW1 A;  3EQU A;  4OPY A;  4WEL A;  3ZCZ A;  4Y2F A;  2XFT A;  2A24 B;  1XXM A;  2W0N A;  3MFX A;  3V67 A;  5IT5 A;  2WKR A;  1LHY A;  2P08 A;  2R9W A;  4R70 A;  5DJU A;  1RP5 A;  2WZZ A;  4EQ1 A;  3DWK A;  3OPH A;  1NRJ A;  3CPT B;  3NI9 A;  5FI7 A;  4JPM A;  3IX8 A;  1ERM A;  3LIC A;  3TG9 A;  3TJZ C;  4R4R A;  4JF5 A;  1YKD A;  4OON A;  2ZMA A;  4Y7P A;  1VET A;  1HD8 A;  1BLH A;  5FQQ A;  3ZG5 A;  3DTM A;  2ZQ9 A;  1TS0 A;  1CJF A;  1ESU A;  2XR0 A;  2YKH A;  1YT4 A;  2C5W B;  3G30 A;  4IVK A;  1Y4O A;  4QHC A;  1UWP X;  3ZHH A;  4HP9 A;  4PPR A;  4HJ6 A;  4EBP A;  4JBF A;  4KG5 A;  3D72 A;  3LR0 A;  3O86 A;  2A2L A;  4C3Q A;  1KVM A;  4KEN B;  4OQ0 A;  1G28 A;  2IWB A;  1GSX A;  2PU4 A;  3NIA A;  1DJC A;  3KYZ A;  2P9V A;  2EX6 A;  5CHM A;  4KQR A;  5J4E A;  4MN7 A;  4DXB A;  2WKQ A;  1WA9 A;  1ZHH B; 
#chains in the Genus database with same CATH homology
 2VLG A;  2J3W A;  3UB7 A;  3MJQ A;  4KQD A;  2GX5 A;  2A24 A;  3MXQ A;  3TE8 A;  3C8C A;  3IS2 A;  4I39 A;  1NWZ A;  2JKR I;  2PT7 A;  1F5M A;  1F9I A;  2L1M A;  1IOU A;  1T1A A;  2KDK A;  4I3I A;  2PYP A;  2VV7 A;  3LIF A;  3D3O A;  4KUO A;  4F3L A;  1OTA A;  3EOI A;  4LLO B;  4DN0 A;  2V9A A;  1T1C A;  4GS9 A;  4K08 A;  4WEJ A;  2HF6 A;  1DRM A;  4FSF A;  3PXP A;  4HJ4 A;  2OWJ A;  5IU1 A;  2ZMV A;  1ZTU A;  3G6O A;  4BBT A;  3A0S A;  5AJG A;  2VX8 A;  4Q0I A;  4LPZ A;  3UB6 A;  1MKM A;  3C2W A;  3T4J A;  4BJP A;  3IS2 B;  1YSP A;  2PD8 A;  1LSV A;  3CUE A;  3LUQ A;  2JHE A;  3GDI A;  4CLC D;  4JGR A;  4PKY G;  1XFQ A;  4F3L B;  5C5K A;  1BYW A;  4CLC A;  5FL3 A;  5A8B A;  4AFI A;  1V9Z A;  3EQV A;  5F6A A;  3NOP C;  4GS9 B;  4HH2 A;  1NLY A;  3FG8 A;  4R6L A;  3OOV A;  2QKP A;  1KOU A;  3MR0 A;  4P6Z M;  1OTB A;  2GNX A;  2J3T C;  3LI9 A;  4EUV A;  2IA2 A;  5J3W A;  3BY9 A;  3TW8 A;  5J7E A;  1S67 L;  2K2N A;  2M1C A;  2W27 A;  2W3D A;  3S7Q A;  5G4Y A;  2PDR A;  3PR6 A;  4B9O A;  1EW0 A;  2W3H A;  4P6Z S;  1TF1 A;  1S1Y A;  1S1Z A;  2XSS A;  5CX7 A;  3P7N A;  4I5S A;  3BJN A;  2MJ6 A;  3LIB A;  5MC7 A;  4O01 A;  3E0Y A;  4NXE A;  3RH8 B;  4FOF A;  3S7O A;  4JGQ A;  3B47 A;  1DP6 A;  5HWW A;  2W1T A;  5IS1 A;  4H6J B;  3PBS A;  3T4O A;  3EGD C;  3PBR A;  2O9A A;  3PBQ A;  2D01 A;  3CUE C;  2HGV A;  4EET B;  4CQH A;  1H3Q A;  2O0Y A;  4IHQ A;  5L8M A;  5HWV A;  5KIZ A;  3FPW A;  4CLC C;  4WUJ A;  4R3A A;  3EEH A;  2PR6 A;  1TS6 A;  3DBA A;  2J3T D;  2L0W A;  4WL9 A;  3LI8 A;  2VEA A;  1XJ3 A;  1S4S A;  2JN7 A;  2P04 A;  3MQQ A;  2L4R A;  3LR4 A;  3OCL A;  1LSX A;  3PBN A;  4HIA A;  1UGU A;  2W1T B;  5I5L A;  2VGL M;  1STZ A;  4EW7 A;  4HNB A;  4R38 A;  3VOL A;  2QWS A;  3EGX C;  4QPR A;  2VKS A;  4WLA A;  3K2N A;  4HI4 A;  3BQA A;  4WN5 A;  2M7V A;  4GHI A;  3F1P B;  3HJK A;  1Y28 A;  1T19 A;  1MZU A;  3CIT A;  4DJ2 A;  1TS8 A;  1D06 A;  2B18 A;  4DJ3 A;  2PHY A;  4HOI A;  3ICY A;  3E4Q A;  4O0P A;  4DMZ A;  5HPF A;  3OBF A;  2NUP C;  3HJI A;  3H82 A;  4MCW A;  2VZW A;  2VGL S;  2W3G A;  2WKP A;  4B93 A;  3E98 A;  1GSW A;  4LRZ E;  1DP8 A;  3UB9 A;  3EEA A;  3K3D A;  2Z6C A;  4HH3 A;  4LRX C;  4NKP A;  3PBT A;  5G4Z A;  1GSV A;  2FH5 A;  1V9Y A;  2W3E A;  3F1N A;  4WF0 A;  3EWK A;  5KSH A;  3C30 A;  3KO6 A;  2W1R A;  4GHI B;  5AVF A;  5HSQ A;  3JVV A;  4JGP A;  4M4X A;  3KX0 X;  2DMW A;  3VE4 A;  2ZBB A;  4YNR A;  5F68 A;  3LID A;  4ME4 A;  3ZYT A;  1P0Z A;  3JVU A;  2LB9 A;  3UE3 A;  3UE6 A;  3H82 B;  5TBM A;  2XRN A;  3TRC A;  3K3C A;  2KOI A;  1OTE A;  5K5B A;  1OTD A;  1TD5 A;  2HJ9 C;  3LFV A;  2ZOH A;  4H6J A;  4OOM A;  4PKY A;  1ODV A;  3ZQ5 A;  5HPI A;  3H7W A;  2W3F A;  4ARZ B;  1OTI A;  1S4R A;  2V0W A;  2O9C A;  1P9W A;  4ETX A;  1P97 A;  2PYR A;  5DFX A;  1VB6 A;  3F1N B;  3HCY A;  5LBR A;  3KYQ A;  5HDD A;  2OAP 1;  3BW6 A;  4G3K A;  3VV4 A;  3RFB A;  2QJ7 A;  3BY8 A;  3KSI A;  4NXF A;  1N9N A;  4HP4 A;  1UWN X;  1XFN A;  2R78 A;  4EES A;  3P01 A;  5HWT A;  1OT6 A;  4UQI M;  3NJA A;  5TBM B;  3UMD A;  4PAU A;  5DJT A;  4Y3I A;  2LB5 A;  2G7U A;  2GZA A;  5HD3 A;  2CMN A;  1MC0 A;  5EFW A;  1OJG A;  4HHD A;  2FZ0 A;  3H7W B;  2HJE A;  3ULF A;  1DP9 A;  4HJ3 A;  2B02 A;  3B42 A;  5HZH A;  3F1P A;  4ETZ A;  3H9W A;  2VA0 A;  3PBO A;  4BBU A;  3NHQ A;  3BQ8 A;  3A0V A;  2J80 A;  2INW A;  4UQI S;  1N9L A;  3PHY A;  2V1B A;  4GW9 A;  4L9E A;  3MF0 A;  3OLO A;  3UB8 A;  1S66 L;  4KUK A;  4BBV A;  4OOL A;  5DKK A;  3T50 A;  3LYX A;  3OCN A;  3E4P A;  4I3A A;  1JNU A;  2JKT M;  1NLZ A;  3W2Z A;  1OT9 A;  4I38 A;  2Y79 A;  3S7P A;  4NXG A;  2OAQ 1;  2P7J A;  3O5Y A;  2V0U A;  4MDZ A;  1X0O A;  3MQO A;  4WEK A;  4MN6 A;  3F1O A;  3R7W B;  4Y5F A;  2XA7 M;  1G6O A;  2I9V A;  3LIE A;  5DF9 A;  4G3V A;  4MMN A;  2PR5 A;  2V1A A;  4EXO A;  2O99 A;  3MQ0 A;  3IBR A;  1YAX A;  2NUT C;  1LL8 A;  3LR5 A;  4L0L A;  1P9R A;  2Z6D A;  3LIA A;  4XT2 A;  2ZOI A;  2EWV A;  4ZRR A;  5F69 A;  1VHM A;  2XA7 S;  1XJ4 A;  4ARZ A;  1LT0 A;  1OJ5 A;  3PYP A;  2EWW A;  2QHK A;  3FPV A;  4II7 A;  4KQO A;  4NEE D;  2HV1 A;  3F1O B;  4JGO A;  4BWI A;  3LR3 A;  2KX6 A;  4IJG A;  4BMW A;  4HY8 A;  4Z1W A;  3CAX A;  3CI6 A;  2OWH A;  2KLI A;  4IUK A;  4L9G A;  1IFQ A;  3SW1 A;  3EQU A;  4I3J A;  1YSQ A;  4WEL A;  4Y2F A;  4HQA A;  3KSH A;  2A24 B;  3BWL A;  3B33 A;  4XT2 B;  1XJ2 A;  4IUH A;  4CLC E;  2W0N A;  3MFX A;  3V67 A;  4RQ9 A;  3UME A;  5IT5 A;  1LSW A;  5HDS A;  2K31 A;  2VJW A;  1T18 A;  4GCZ A;  2WKR A;  4EEU A;  3RTY A;  2P08 A;  5DKL A;  4R70 A;  5DJU A;  2JKT I;  2O9B A;  4EQ1 A;  2JKR M;  4MN5 A;  4EER A;  1F98 A;  2QYB A;  1NRJ A;  3KSF A;  3MMH A;  3OC2 A;  4LRY C;  2D02 A;  3IBJ A;  4EU0 A;  3LIC A;  3CWF A;  3T4S A;  4GJ4 A;  2QJ5 A;  3TJZ C;  5AVE A;  1TS7 A;  3R4K A;  1W63 M;  1YKD A;  4UEY A;  5HL6 A;  3GEC A;  2XRO A;  2GJ3 A;  4Q0J A;  3R7W A;  1N9O A;  2H28 A;  1XJ6 A;  4GLQ A;  4G3W A;  1T1B A;  3T4K A;  4CLC B;  3NOT C;  3FC7 A;  1TS0 A;  2OOL A;  2Y8H A;  2VV8 A;  2YKH A;  2EA9 A;  2YKF A;  2PD7 A;  4Q0H A;  4YWZ A;  4O8G A;  3T4L A;  1UWP X;  1W63 Q;  3T4Q A;  4HP9 A;  4HJ6 A;  2M7U A;  4E04 A;  3D72 A;  3E4O A;  5HDC A;  2VV6 A;  1OPX A;  4YOF A;  3LR0 A;  3KSG A;  5TJJ A;  3CLO A;  1H8M A;  2A2L A;  3C38 A;  1G28 A;  1GSX A;  5HD5 A;  3KYZ A;  2BAS A;  3S7N A;  3VE3 A;  3U2A A;  5F5Y A;  4L9F A;  4NXB A;  5DFY A;  2ZMF A;  5J4E A;  1D7E A;  3NOU C;  4PHT A;  2K7S A;  4MN7 A;  3A0R A;  2WKQ A;  4EEP A;  1WA9 A;  3T4T A;  1ZHH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...