5F5YA

Wt drosophila melanogaster cycle pas-b with bound ethylene glycol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title WT Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
molecule keywords Protein cycle
total genus 30
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f5yA00
2V1BA 3ICYA 1XJ4A 3MXQA 3F1NB 3K3CA 1X0OA 3F1NA 3LICA 3T50A 1TS8A 3LIEA 4L9EA 4NXBA 2V0WA 4R3AA 1DP6A 2OOLA 3F1PA 1WA9A 3FC7A 2PYRA 3F1PB 4EERA 3E4PA 2PR5A 1XFQA 4F3LA 3F1OA 5F5YA 4I3IA 1BYWA 2Z6CA 5EFWA 2Z6DA 2KX6A 1OTEA 1G28A 3OLOA 2W27A 4NXGA 4E04A 2I9VA 1GSWA 3C8CA 1XFNA 4HJ4A 4HNBA 5DJUA 3EEHA 4HP9A 1S4RA 4WLAA 4KQDA 1P97A 3B33A 2L1MA 2QWSA 3MJQA 4I3AA 1KOUA 5TBMB 5TBMA 3RTYA 3VE4A 5HDSA 4LLOB 3LIFA 1DP8A 2M1CA 4KUKA 4NXFA 1LT0A 1S1ZA 3IS2A 4M4XA 2VEAA 4R70A 3BY8A 3EWKA 4HH2A 3UB8A 4GCZA 5DKLA 1D06A 1S67L 2PHYA 4R38A 5J3WA 2PD7A 3H7WB 4HQAA 4L9FA 5I5LA 1DP9A 2D02A 3MQQA 1DRMA 5KIZA 1D7EA 2A24B 4HY8A 3LIDA 4MN5A 5HDCA 3SW1A 1GSXA 1LSXA 1EW0A 2YKHA 3D72A 4DJ3A 2K7SA 1TS6A 2OWJA 4GHIB 4EEUA 4GHIA 1UWNX 2ZOIA 3GECA 5A8BA 1Y28A 1T1BA 2L4RA 1LL8A 2PD8A 3NHQA 4XT2A 5IU1A 1UWPX 2QKPA 4JGPA 3K3DA 3NOUC 1LSWA 4PKYA 1XJ3A 2VLGA 5G4YA 2R78A 3BY9A 4LRXC 2A24A 1T1CA 1XJ6A 3P7NA 3LIAA 4DJ2A 2KDKA 3UB7A 1OTDA 5HD3A 1OTBA 2JHEA 2L0WA 2OWHA 5AVFA 2J80A 4GS9B 4MN6A 2QJ7A 1OJ5A 4B9OA 4BBVA 2GJ3A 2WKQA 4I5SA 2ZBBA 3NOPC 4HOIA 2H28A 3UB9A 5HWVA 3A0VA 4PKYG 2BASA 3LI8A 3E4QA 2V0UA 3A0RA 3PYPA 2CMNA 2D01A 5IS1A 1MZUA 1N9LA 1S66L 2PYPA 2WKPA 4GS9A 4GW9A 5G4ZA 4HIAA 4H6JA 1XJ2A 2VV8A 4JGQA 5DJTA 4F3LB 2QHKA 3F1OB 2EA9A 1TS7A 4I3JA 3PHYA 4RQ9A 3CWFA 1VB6A 1OT9A 3H82B 5HWTA 1TS0A 4K08A 4WL9A 2INWA 1V9YA 3A0SA 3MQOA 3NJAA 2QJ5A 4H6JB 4L9GA 4LRYC 4EQ1A 4EXOA 3CLOA 3GDIA 3UE6A 5HWWA 4EESA 1V9ZA 4NXEA 2PR6A 2B02A 3ULFA 1LSVA 1OT6A 4LRZE 1S4SA 3G6OA 3UMEA 3IS2B 2W0NA 4R6LA 4HJ6A 4WN5A 3H82A 5HSQA 1OJGA 1ODVA 2V1AA 3C2WA 4HJ3A 4I38A 2V9AA 3HJKA 1OTAA 4HHDA 3BWLA 4EETB 4WUJA 2ZOHA 4EEPA 1F9IA 3KX0X 3RH8B 3NOTC 5HD5A 3VOLA 3E4OA 1N9OA 1GSVA 2P7JA 3LI9A 1UGUA 4HI4A 5AVEA 5DKKA 3MR0A 4JGOA 4KUOA 3MFXA 5HDDA 3ZQ5A 4WF0A 5J4EA 2HV1A 3LYXA 4HP4A 1JNUA 3H7WA 3UMDA 3FG8A 4XT2B 2VV6A 4BBUA 2JN7A 2PDRA 2YKFA 4LPZA 1T1AA 4JGRA 4YWZA 3VE3A 5J7EA 4BBTA 4HH3A 1F98A 1S1YA 1N9NA 3LIBA 2VV7A 4I39A 1NWZA 5F68A 3CAXA 1P0ZA 2WKRA 4EW7A 1T18A 5F6AA 5HZHA 1T19A 3IBRA 5F69A 3UB6A 3H9WA 3LUQA 1OTIA 3HJIA
chains in the Genus database with same CATH superfamily
3FV7A 4WBGA 3MFDA 3PTEA 1MC0A 1TS8A 5FQKA 4IBXA 4AFIA 4PM6A 5DFYA 1BYWA 4KENB 1G28A 4LV0A 1RCJA 1HZOA 4BD0A 3DWKA 4WEJA 3IF6A 3AGFA 1CEFA 3A3EA 3V3SA 2V20A 1XX2A 2PT7A 2K7SA 1TVFA 3LO7A 4LCMA 2K2NA 4EEUA 1JVJA 3RJUA 5HAIA 4Q0HA 1LSWA 4D60A 4DMZA 3OCLA 1JTGA 1K55A 1TDGA 1YKDA 3OPLA 5IHVA 2WAEA 3TG9A 5IS1A 3DAVA 3KSGA 3T1QB 2JKRI 5HPFA 1A0KA 3O5YA 1VB6A 5A93A 2QJ5A 5CGWA 4QHCA 3PBSA 1V9ZA 5D3OA 1HTZA 3GV9A 1YT4A 1MPLA 5CEBA 2O9BA 1GSVA 1IYQA 5AVEA 4DN0A 3V5MA 1XPBA 3EGDC 1MWRA 3C38A 2P9VA 2WYXA 4GZBA 5CX7A 5HAQA 5FAOA 3IBRA 4C75A 1IYSA 3T50A 3BLMA 3T4LA 1I5QA 4K0WA 3F1OA 3G4PA 3HUOA 5L07A 4X53A 2A49A 5AQ9A 3C30A 1QMEA 2GX5A 3ITAA 3ZYTA 5L2FA 4WLAA 1SHVA 3DTIA 1P97A 3VE4A 4MBKA 4FUWA 4LLOB 1Z6FA 4FH2A 4X69A 4E3OA 3SW1A 1KVMA 2HF6A 3PBOA 3GECA 4ZBEA 2W3HA 4LV2A 4WMCD 4QWOA 1BT5A 5HD3A 4O7DA 3Q7ZA 4Q0IA 3UB9A 1BLHA 4N1HA 4DDSA 1K25A 2XRNA 5G18A 1YAXA 4GB7A 2BLSA 3LGOA 4WL9A 4YINA 3WS2A 3A0SA 5GLCA 2XF3A 4OP8A 2M7VA 4KG5A 1VETA 3H82A 1DJCA 4ZDXA 4HEFA 4JLFA 4WUJA 1ERMA 3UO9A 5HAPA 5GHXA 3UDIA 4MMNA 3KYQA 5HL6A 3CHWP 3HLBA 4S2JA 2JN7A 2H0YA 1ONHA 3VP4A 4HH3A 4P6ZM 1S1YA 1N9NA 2J7VA 3L9KA 3NC8A 5FI2A 1MWTA 2PRFA 4Z9QA 3KO6A 3P09A 1ZC2A 3M6BA 3N8SA 3GSGA 2QZ6A 1DY6A 3C8CA 1PW8A 2ZQ9A 5TBMB 4KQDA 1KVLA 3IX3A 3GVBA 2Y2OA 3EWKA 2WAFA 3C7UA 1S67L 1PWCA 4L9FA 5FDSA 5CGSA 1DRMA 1O7EA 1D7EA 2A24B 2JKTI 4E04A 3OCNA 1BULA 3PAGA 5IU1A 2EFUA 4LRXC 2A24A 1XJ6A 3MXSA 1OTDA 3KYZA 4Y0UA 1H3QA 4OVDA 2Z2MB 3BFGA 4B88A 1TD5A 5E2HA 2JKTM 3E4QA 2WKPA 4GS9A 3PBTA 4CLCC 1MWUA 1BZAA 3JPUA 5HWTA 4H6JB 3NJAA 3G30A 2HJ9C 5KSHA 3TRCA 2ZQAA 4CLCE 1Z09A 5FL3A 1PWDA 1K56A 1YLYA 3W4PA 1GHPA 4OP5A 3ZG9B 3MFXA 4HP4A 1YSPA 3HVFA 4DRTA 4Y2FA 4OOLA 4UAAA 2GZAA 4BLMA 2BG1A 2EX6A 3HJIA 3MXQA 4N92A 3F1NB 3K3CA 4WZ4A 2EX8A 4EERA 5CHMA 2Z6CA 4MEZA 4FOFA 2KX6A 4O8GA 2ZMAA 4Q0JA 1ES4A 4MBHA 4I3AA 1CEGA 5DTTA 5MC7A 1FCMA 4Z1WA 2M1CA 3KSIA 2OV5A 2IWBA 2Q9NA 1XA1A 4Y0OA 3ISGA 3QNCA 2HDQA 2Y8HA 2HJEA 1EW0A 3M2JA 4E6WA 3D9YA 1E4DA 1Y28A 3LY4A 3R7WA 1XJ3A 2VLGA 1ZG4A 1L0DA 5GL9A 3P98A 2HP5A 1OTBA 4FCFA 1K55C 2WKQA 4E3JA 2KLIA 5CTMA 3DW0A 2JKFA 3PYPA 2ACGA 2VGJA 3N4IA 1TDLA 2ZL1B 2O0YA 3UB5P 2Q9MA 1TS0A 4ARZB 4FSFA 4IHQA 1CI8A 2WZZA 3TSGA 2ZL1A 1EROA 1BSGA 4DE1A 1KGFA 2JCHA 2HP9A 3OPHA 2JKGA 2ZOHA 1E3UA 2G2WA 3UE0A 3LI9A 3DTMA 5EPHA 4OLGA 3E2KA 1PWGA 1NZUA 4BJPA 4DXCA 1O07A 4S2NC 4BWIA 4JXSA 3VOZA 3LUQA 3E4PA 2V8CA 3BFDA 3BFEA 3ZHHA 4ARZA 2R9WA 3FC7A 1XFQA 3CI6A 2O9AA 5EFWA 4KZ9A 4KZAA 4WM9A 1W63M 4HP9A 3MJQA 2XA7S 3LIFA 5CTNA 1YLPA 5EVID 2WUQA 4KZ8A 4DDYA 4DKIA 3HLCA 3MQQA 5KIZA 2XSSA 5HDCA 1JWZA 4GOGA 5EVIC 3NHQA 4NEED 2QKPA 1DJAA 1YQSA 3ZNTA 2V1ZA 1SZVA 3LR0A 2J80A 4GS9B 3T4TA 4OH0A 4IVIA 4P6ZS 5HWVA 1K54C 1FIKA 2CMNA 2XD1A 2GNXA 3LR4A 4H6JA 4JGQA 5A90A 3F1OB 1FSWA 5DTKA 5CECA 1RP5A 1YLZA 4EBPA 1V9YA 4X1MA 2A3UA 3UPNA 2Y2HA 3LR3A 3BYDA 3NDEA 1K38A 1OMEA 3ZG7B 3BW6A 1K57A 1OPXA 2WGWA 4R3JA 2OAP1 2PU2A 1SKOB 1UGUA 5FQIA 5DF9A 2C5WB 3RXWA 5J4EA 5FI6A 3HUMA 4CQHA 3GTCA 3E0YA 1T19A 1OTIA 2ZMFA 3UNWA 1ACFA 4WMCA 4NKPA 2EXAA 5TR7A 3OPPA 4Y0TA 5GLAA 3IH8A 4Y17A 3FYZA 1U60A 1LI0A 3AGEA 2Q0OA 5TBMA 3CUEA 3VP3A 4CLCD 3B3XA 3T1SA 3UB8A 3ZCZA 3A3DA 4JKTA 4ETXA 3W4QA 3BFFA 1K6RA 1LSXA 2ZD8A 1G6AA 3SS4A 1CK3A 1LL8A 2OSUA 2R78A 2P9VB 3BLSA 2GJ3A 3D4FA 3IQAA 3HLWA 4DE2A 2G2UA 2H28A 5E2GA 1JTDA 3A0RA 4ZJ2A 1KE0A 3PBQA 5CGXA 3QP1A 5FASA 5EECA 3OBFA 3WS5A 4QJGA 4LRZE 4NETA 2XFSA 5I94A 3FKWA 5DF7A 1ES3A 2PBDP 2HGVA 1PZOA 1FOFA 3N8LA 1IKIA 3EQVA 2XDMA 2MJ6A 1K4FA 2A2LA 4QD4A 2RCXA 1F98A 2XGNA 4KZ6A 1P0ZA 5F82A 1IFQA 3IHAA 4PPRA 5F69A 1XJ4A 4R3BA 3VP2A 2ZJ9A 3G34A 4CLCB 5F5YA 1STZA 2ZC3B 4OQIA 4P6BA 4IUHA 4N9KA 3RTYA 3VFHA 2WGIA 4DXBA 1IELA 2VEAA 3BY8A 2Y4AA 1D06A 3A3FA 1VQQA 4R4RA 5I5LA 2G7UA 1TF1A 2XQZA 4EBLA 4FD8A 1G68A 3W8KA 5FEFA 1KDWA 2YKHA 4GHIA 3A3IA 4PM8A 3MBZA 4WELA 1LLBA 3UB7A 3IT9A 4E3IA 3VSKA 3Q07A 1M6KA 4EWFA 1L0FA 2BASA 3B47A 2V0UA 3CJMA 2D01A 1NRFA 5G4ZA 4N1XA 1J9MA 5DJTA 5FDHA 4F3LB 2VX8A 4F94A 2B95A 1RGYA 3MZFA 3O86A 3WWXA 4DF6A 4LV1A 1ES2A 4EXOA 3IWIA 1LSVA 3I7JA 1BUEA 1VM1A 2B18A 2Y2GA 3CITA 3CZDA 1OTAA 3HREA 3VP0A 3RH8B 4IEDA 3MZDA 1H0MA 3ZQ5A 1ZHHB 1G6OA 3T1RA 1EWZA 1H8MA 3G32A 2EFXA 2QMIA 4G3WA 3H9WA 3UDFA 1IYOA 2EWWA 3MQ0A 5TJJA 1S6RA 2J3TC 1K6SA 4R3AA 3C7VA 1FILA 4P85A 3VSLA 1PW1A 3AGDA 2IA2A 4WZ5A 1XFNA 2L1MA 2P74A 4R1GA 4NXFA 2Y2MA 5L09A 3B42A 3FPVA 3D72A 4A5RA 4WEKA 2L4RA 2EXBA 1PNEA 1XP4A 2HPBA 1MWSA 2NUPC 2W3FA 5DF8A 4DJ2A 1JWPA 4JXVA 2L0WA 3EEAA 4MN6A 1YLJA 1CF0A 3SS5A 3O87A 1CQAA 3UPPA 1S66L 2X71A 2VA0A 4JF6A 2NUTC 1NY0A 4GD8A 1FCOA 3CWFA 4OQGA 3M6HA 2VJWA 5AQAA 1VHMA 4MN7A 3ZG0A 1PRQA 3NI9A 5HW3A 3IS2B 4R6LA 4HJ6A 4U3TA 1ODVA 2HP6A 4HHDA 5DTSA 1W5DA 3TJZC 1N9OA 3S4XA 3C5AA 4X6TA 3U2AA 5A92A 3T4QA 4ZRRA 4I39A 5HX9A 3ZG5A 4H8RA 2Y2NA 5EE8A 3ZFZA 3CMZA 3IF6B 3UE3A 4QU3A 3LCEA 4OQ0A 2WKHA 3HUNA 3O3VA 1LT0A 1VETB 4HH2A 4U0TA 3UDXA 4X68A 2WGWB 1H8YA 3H7WB 4HQAA 3JVVA 2VKSA 2DNSA 2OWJA 2WGVA 3HLFA 3BRMA 3LEZA 3EQUA 1I2WA 2QYBA 1UWPX 5EM1A 4QY5A 5CERA 3EGXC 1P9RA 3W2ZA 1YM1A 2JHEA 2OWHA 5AVFA 1OJ5A 2H10A 1FCNA 4KZ3A 4Y13A 1KGGA 5BOHA 5CHJA 4D2OA 3VMAA 1XJ2A 2QHKA 3QHYA 1MBLA 2XK1A 4ZAMA 4S2LA 3CLOA 4OQHA 3DBAA 1XKZA 4X55A 2C6WB 4S2IA 4EETB 3BQ8A 4IBRA 1W7FA 5IT5A 1IEMA 4KG2A 2Y2PA 5HL1A 5FQJA 5EM0A 5HDDA 2HV1A 1TEMA 3BQAA 2P08A 4O0PA 1LHYA 5J7EA 2XH9A 4X1LA 2WKRA 5HARA 5HZHA 4GKUA 1NRJA 3NBLA 3ICYA 3N7WA 2W3EA 2J3TD 1PIOA 5EUAA 4UEYA 1ES5A 3KSHA 1S4RA 2Y55A 1E3UD 1LL9A 2VGLM 3IS2A 3ITBA 5E2FA 2X01A 1HD8A 1FR6A 4R38A 1IOUA 2ZQDA 2D02A 2Y2JA 1K57C 1YPRA 2V2FF 2Y59A 3QP6A 5FI7A 4YNRA 2PD8A 3QP2A 5G4YA 2HZ5A 3BY9A 5C5KA 1ALQA 1K0KA 4IJGA 3BJNA 1BLSA 3BECA 2QJ7A 3ZVWA 1LL5A 3E98A 4C3QA 4BL3A 3A0VA 3DTKA 3LI8A 2ZC4B 4EQIA 5GHYA 4GNUA 3P01A 1D1JA 3HLGA 3PHYA 4ETZA 3E2LA 1BLPA 3H82B 4MCWA 4XUXA 1S0WA 5HWWA 4NXEA 3CUEC 2B02A 1L0GA 1Q2PA 5J8XA 2JC7A 3DTEA 4BD1A 2VGKA 3IH9A 1BLCA 3UPOA 3E4OA 4XUZA 2I72A 2E8IA 3GR2A 4ME4A 2RL3A 3H7WA 3MKFA 2M7UA 3FG8A 4XT2B 2YKFA 3FWLA 2XROA 1WYCA 2ZC6B 1ONGA 4FTXA 1SCWA 3JYIA 4ZJ3A 4HJ3A 1MXOA 3RXXA 5CEDA 3IXHA 5F1GA 4X25A 3BM6A 3DWZA 3F1PB 2Y2KA 5M19A 4GJ4A 3LFVA 4E6XA 1GHMA 2EWVA 4HJ4A 4JF4A 3EEHA 3B33A 1KOUA 3S7QA 4KUKA 4QPRA 4PM5A 1W8YA 4GCZA 5DKLA 4DE0A 2KOIA 3IF5A 1DP9A 2R9XA 3LIDA 1KE3A 3D3OA 4KQRA 4E3KA 2Z2LB 3NOUC 1SDNA 3MZEA 3TE8A 4O01A 2FZ0A 1CJFA 4BBVA 4I5SA 1YLTA 4OKPA 5LBRA 4ZJ1A 2PYPA 3GRJA 3S22A 3NY4A 1OT9A 5U47A 3T4OA 3PR6A 4MBFA 5EVLA 4L9GA 4EESA 3IXBA 2P04A 2PAVP 1IKGA 3WS1A 2V1AA 3WS4A 3M2KA 5EVEA 1MKIA 1RGZA 3OPRA 3KX0X 3T12B 4KZ4A 3VOLA 3T4JA 4OOMA 4KUOA 5F83A 3UMDA 5TGFA 3ZG8B 4ESPA 1N9BA 1T1AA 4JGRA 2ZLYA 3HCYA 3CG5A 3GMWA 3IX4A 1NWZA 1I2SA 3BFCA 2Y2IA 4ID4A 3LICA 4GDBA 2IWDA 3BEBA 2PYRA 4UA9A 4CLCA 2WKEA 3VFFA 4X56A 4F3LA 2ZC5B 3V67A 4KZ7A 2Z6DA 1OTEA 4II7A 1GSWA 4HNBA 4OOYA 3SZTA 1XXMA 2LB9A 3W4OA 4G3VA 4M4XA 4R70A 1VEUB 4RVAA 2W3DA 4JXGA 5J3WA 4HY8A 2XD5A 1GSXA 4GHIB 1TS6A 1HLUP 5EVIA 4XT2A 3ULFA 3TOIA 3LIAA 1Y54A 1WE4A 1PI5A 3CPTA 2PU4A 3G2ZA 1KE4A 2J3WA 4MDZA 2XA7M 3CPTB 5CHUA 2J9PA 1C3BA 4OPYA 1PI4A 3V39A 1GHIA 1H5XA 2X02A 3S7OA 3NULA 4MLLA 3MQOA 3UE6A 2PR6A 3PBNA 1OT6A 4JF5A 3G35A 2XR0A 1W63Q 5FAPA 4OPRA 2FFFB 4EEPA 3NOTC 2P7JA 5DVAA 3MR0A 4JGOA 4C6YA 5JYOA 4LENA 2EX2A 3MKEA 4G3KA 4BBTA 3HBRA 5AQBA 1T18A 2ZM8A 2VZWA 5FEGA 5AJGA 1ZKJA 2V1BA 1X0OA 3LIEA 3Q7VA 3NECA 2OOLA 3SH8A 1WA9A 3OZHA 4HBUA 1XA7A 4EU0A 4ZTKA 5KMWA 2W27A 1NXYA 2CC1A 2O9CA 5HDSA 2OAQ1 1DP8A 1M40A 2VK3A 2H0TA 4M3KA 3IF6C 2PHYA 4RA7A 5FSRA 4EUVA 4GD6A 4MN5A 1NZOA 1PYYA 4JXWA 4JGPA 3IXDA 3K3DA 2ZMVA 3PBRA 1T1CA 4GN2A 4EUZA 1WYBA 3P7NA 3O88A 1SKOA 1G5UA 2Y2QA 4GLQA 5HPIA 5EV0A 2ZQCA 3NOPC 3IHBA 3QP4A 4MNRA 3VP1A 2XFTA 1ESIA 1ESUA 2UWXA 5FQQA 4GW9A 4JBFA 1LI9A 1F5MA 3WRZA 1W79A 3IXGA 1H8ZA 4BENA 3T4SA 3TW8A 1GA0A 4PM9A 4QB8A 2JE5A 1KGEA 2ZQ8A 2WK0A 4WN5A 3U4LP 1OJGA 1FSYA 4KZBA 3R4KA 3BWLA 4E3LA 4JPMA 5FQ9A 1YLWA 5M1AA 4HESA 1KDSA 4KQOA 3R7WB 2IWCA 5DFXA 4YWZA 1K4EA 3FPWA 1PZPA 3S1YA 3LIBA 5F68A 3OOVA 4YOFA 3UY6A 4S2OA 1J3WA 3F1PA 2OLUA 3GQZA 3V50A 2H5SA 5HFOA 4OPQA 1F2KA 5L10A 4KQQA 4K91A 4R23A 3MXRA 5DJUA 3EOIA 2W1TB 4WZ5C 4LFUA 4QY6A 1MY8A 3N8RA 3Q81A 2WKIA 1MKMA 2J8YA 2FH5A 3NIAA 2AVXA 5EOEA 5GHZA 4UA7A 4NK3A 3UN7A 3ZNYA 4BL2A 2W1RA 1YMSA 4E3MA 4FH4A 2ZC7A 3ZVTA 3C4OA 1K54A 4B4XA 1N9LA 2V8FA 4RX3A 3KYEA 4HIAA 3NDGA 1K56D 4UQIS 2EA9A 2JBFA 4I3JA 1JWVA 2HDSA 2ZM0A 3Q7VB 3VOYA 5F1FA 4K0XA 4LRYC 4EQ1A 2BTFP 2LB5A 4GDNA 5KZHA 3SS3A 3IBJA 2DCFA 1S4SA 3G6OA 2W0NA 3FKVA 1P9WA 4I38A 1L0EA 2XLNA 1QMFA 1F9IA 2DMWA 4IVKA 3ZDJA 5DKKA 5JYPA 4LGWA 3LYXA 2VV6A 2PDRA 2E8JA 3PAEA 3MF0A 3IWQA 1N4OA 2XEPA 4WYYA 3IX8A 3UB6A 4UHUA 4RX2A 2GDNA 1NLZA 3SOIA 3F1NA 4BMWA 5CRFA 4L9EA 4NXBA 2V0WA 1DP6A 1XGJA 5FATA 4I3IA 1DJBA 5E2EA 2I9VA 3QP5A 3N6IA 1Y4OA 2QWSA 3G2YA 2ZM2A 3QP8A 2Y2LA 2UV0E 1S1ZA 4P87A 1PFLA 4LV3A 1XGIA 3RFBA 3C4PA 4UQIM 4E3NA 1HVBA 4S2PA 4Y5FA 4R0QA 3S7NA 1BTLA 1Q2QA 5EVIB 3LEQA 5A8BA 1T1BA 2Y91A 4Y3IA 4L0LA 2KDKA 3ZGAB 2K31A 4XXRA 3NCKA 3KSFA 4HOIA 5FQMA 4PKYG 4S2NA 3VV4A 5A91A 1W8QA 4N9LA 3V3RA 4IUKA 3G31A 3LY3A 4OONA 4NG2A 4BQMA 5CXWA 3T1XA 5TFQA 4Y15A 3Q1FA 2INWA 3LR5A 4EV4A 4S2KA 3GDIA 1VEUA 5HSQA 3MSHA 2VGLS 2W1TA 3C2WA 2V9AA 2PBYA 4R4SA 2WZXA 3L7HA 4OPZA 4LCLA 4Q8IA 5HD5A 2EX9A 1NYYA 4HI4A 1E25A 3WRTA 1AWIA 5L8MA 1NYMA 1YMXA 1ZTUA 3HL9A 4BBUA 3SH9A 2ZQ7A 2HDRA 1IYPA 5FA7A 1AXBA 4CJNA 3CAXA 4EW7A 2DRWA 4CPKA 4EBNA 4KZ5A 4U0XA 4B93A 5AQ7A 2WADA 2PR5A 2QPNA 1CI9A 3OLOA 4NXGA 3SH7A 5M18A 3MS6A 5FAQA 3A3JA 2J9OA 4Y7PA 4HBTA 4S2MA 5GLDA 1EI5A 2PD7A 1YSQA 2OLVA 4DJ3A 3K2NA 1UWNX 2HDUA 2ZOIA 1FR1A 1L2SA 1L3LA 4PKYA 3JVUA 4PHTA 2FFYA 4B9OA 4RYEA 2ZBBA 5GLBA 1MZUA 4DE3A 4OLDA 2VV8A 2W3GA 2B5RA 1TS7A 3OC2A 4YFMA 4RQ9A 2Y79A 4K08A 5E43A 2O99A 3T4KA 3HLDA 3PXPA 3UMEA 3FZCA 4UA6A 3QNBA 3HJKA 5EOOA 1GCEA 3IWOA 1SDEA 1SKFA 1NLYA 4WF0A 1NJ4A 4KG6A 1JNUA 1ERQA 3S7PA 4PMAA 4LPZA 1GA9A 3Q82A 4P0MA 3VE3A 3WS0A 1FQGA 5K5BA 4PAUA 5KSCA 3UE1A 4B4ZA 2VV7A 4PM7A 3MMHA 1ZG6A 5F6AA 3HLEA 2JKRM
chains in the Genus database with same CATH topology
2V1BA 1X0OA 1MC0A 1TS8A 3LIEA 4ARZA 2OOLA 3FC7A 1WA9A 4AFIA 1XFQA 3CI6A 4EU0A 2O9AA 1BYWA 5DFYA 5EFWA 3UE3A 1G28A 2W27A 1W63M 4HP9A 3MJQA 2O9CA 2XA7S 5HDSA 2OAQ1 1DP8A 3LIFA 1LT0A 4WEJA 4HH2A 2PHYA 4EUVA 3H7WB 4HQAA 3JVVA 3MQQA 5KIZA 2XSSA 4MN5A 5HDCA 2VKSA 2PT7A 2K7SA 2OWJA 3EQUA 2K2NA 4EEUA 3NHQA 4NEED 2QYBA 1UWPX 2QKPA 4JGPA 3K3DA 4Q0HA 1LSWA 4DMZA 3OCLA 2ZMVA 3PBRA 1T1CA 3P7NA 3EGXC 1P9RA 3W2ZA 2JHEA 2OWHA 3LR0A 5AVFA 2J80A 4GS9B 1OJ5A 3T4TA 1YKDA 4GLQA 5HPIA 3NOPC 4P6ZS 5HWVA 2CMNA 5IS1A 2GNXA 3LR4A 3KSGA 2JKRI 4GW9A 1F5MA 1XJ2A 4H6JA 4JGQA 5HPFA 2QHKA 3F1OB 3O5YA 1VB6A 3T4SA 1V9YA 2QJ5A 3TW8A 3CLOA 3PBSA 3DBAA 1V9ZA 3LR3A 4WN5A 1OJGA 4EETB 3BQ8A 3BW6A 3R4KA 3BWLA 1OPXA 2OAP1 5IT5A 2O9BA 1GSVA 1UGUA 5AVEA 5DF9A 4DN0A 5HDDA 4KQOA 5J4EA 3R7WB 2HV1A 3BQAA 3EGDC 2P08A 5DFXA 3C38A 4O0PA 4YWZA 5J7EA 3FPWA 4CQHA 3LIBA 5CX7A 5F68A 3E0YA 2WKRA 5HZHA 1T19A 3IBRA 1NRJA 3OOVA 4YOFA 1OTIA 2ZMFA 3ICYA 3T50A 2W3EA 3T4LA 4NKPA 2J3TD 3F1PA 3F1OA 4UEYA 3C30A 3KSHA 2GX5A 3ZYTA 5DJUA 3EOIA 4WLAA 2W1TB 1S4RA 1P97A 5TBMA 3VE4A 3CUEA 4LLOB 4CLCD 2VGLM 3IS2A 1MKMA 3UB8A 4R38A 1IOUA 2FH5A 4ETXA 2D02A 3SW1A 1LSXA 2HF6A 3PBOA 4YNRA 3GECA 1LL8A 2PD8A 2W3HA 5G4YA 2R78A 3BY9A 5C5KA 4IJGA 3BJNA 5HD3A 2QJ7A 2GJ3A 2W1RA 4Q0IA 3E98A 2H28A 3UB9A 3A0VA 3LI8A 3A0RA 1N9LA 2XRNA 4HIAA 1YAXA 2EA9A 3P01A 3PBQA 4UQIS 4I3JA 4ETZA 3PHYA 3H82B 4MCWA 4WL9A 3A0SA 4LRYC 3OBFA 4EQ1A 2LB5A 5HWWA 2M7VA 4NXEA 3CUEC 2B02A 3IBJA 4LRZE 1S4SA 3G6OA 2W0NA 3H82A 1P9WA 4I38A 2HGVA 4WUJA 1F9IA 2DMWA 3E4OA 5DKKA 3EQVA 4MMNA 4ME4A 3LYXA 3KYQA 5HL6A 2MJ6A 3H7WA 2M7UA 3FG8A 4XT2B 2VV6A 2JN7A 2PDRA 2YKFA 2A2LA 4HH3A 2XROA 1F98A 4P6ZM 1S1YA 1N9NA 3MF0A 1P0ZA 3UB6A 1IFQA 5F69A 4HJ3A 1XJ4A 1NLZA 3F1NA 4BMWA 4L9EA 4NXBA 3KO6A 2V0WA 1DP6A 3F1PB 4CLCB 4GJ4A 5F5YA 4I3IA 3LFVA 1STZA 2I9VA 2EWVA 3C8CA 4HJ4A 4IUHA 3EEHA 5TBMB 4KQDA 3B33A 2QWSA 3RTYA 1KOUA 3S7QA 4KUKA 4QPRA 1S1ZA 2VEAA 3BY8A 3EWKA 4GCZA 5DKLA 1D06A 3RFBA 4UQIM 1S67L 2KOIA 2G7UA 5I5LA 4L9FA 1DP9A 1TF1A 4Y5FA 1DRMA 1D7EA 2A24B 3LIDA 2JKTI 4E04A 2YKHA 3D3OA 5AJGA 3OCNA 3S7NA 4GHIA 5A8BA 1T1BA 5IU1A 4Y3IA 3NOUC 4LRXC 4WELA 2A24A 4L0LA 1XJ6A 3TE8A 4O01A 2KDKA 2K31A 1OTDA 3UB7A 2FZ0A 3KYZA 1H3QA 2JKRM 3KSFA 4BBVA 1TD5A 4I5SA 4HOIA 4PKYG 2BASA 2JKTM 3B47A 3E4QA 3VV4A 2V0UA 2D01A 5LBRA 4IUKA 2PYPA 2WKPA 4GS9A 5G4ZA 3PBTA 5DJTA 4F3LB 4CLCC 2VX8A 1OT9A 3T4OA 5HWTA 3PR6A 2INWA 4EXOA 3LR5A 3NJAA 4H6JB 4L9GA 3GDIA 4EESA 2P04A 2HJ9C 1LSVA 5KSHA 3TRCA 5HSQA 2B18A 4CLCE 2V1AA 2VGLS 2W1TA 3C2WA 2V9AA 3CITA 1OTAA 5FL3A 3RH8B 3KX0X 5HD5A 3VOLA 3T4JA 4HI4A 4OOMA 4KUOA 3MFXA 3ZQ5A 5L8MA 4HP4A 1YSPA 1ZHHB 1G6OA 3UMDA 4Y2FA 1ZTUA 4BBUA 1T1AA 4JGRA 1H8MA 4OOLA 3HCYA 1NWZA 3CAXA 4EW7A 2GZAA 4G3WA 3H9WA 3HJIA 2EWWA 3MXQA 3MQ0A 3F1NB 3K3CA 3LICA 5TJJA 2J3TC 4R3AA 4B93A 2PYRA 4CLCA 4EERA 2PR5A 4F3LA 2IA2A 3V67A 2Z6CA 2Z6DA 4FOFA 2KX6A 1OTEA 3OLOA 4II7A 4NXGA 1GSWA 1XFNA 4HNBA 4O8GA 4Q0JA 4I3AA 2L1MA 2LB9A 5MC7A 4G3VA 4Z1WA 2M1CA 4NXFA 4M4XA 3KSIA 4R70A 2W3DA 5J3WA 2PD7A 3B42A 1YSQA 2Y8HA 4HY8A 3FPVA 1GSXA 2HJEA 1EW0A 4DJ3A 3K2NA 3D72A 4GHIB 1TS6A 1UWNX 2ZOIA 4WEKA 1Y28A 2L4RA 3R7WA 4XT2A 3ULFA 4PKYA 1XJ3A 2VLGA 2NUPC 3LIAA 2W3FA 3JVUA 4PHTA 4DJ2A 1OTBA 2L0WA 3EEAA 4MN6A 4B9OA 2WKQA 2ZBBA 2KLIA 2J3WA 4MDZA 3PYPA 1MZUA 1S66L 2XA7M 2VV8A 2VA0A 2W3GA 2NUTC 1TS7A 3OC2A 4RQ9A 3CWFA 2O0YA 2VJWA 1VHMA 3S7OA 2Y79A 1TS0A 4K08A 4MN7A 4ARZB 3MQOA 4FSFA 2O99A 3UE6A 4IHQA 2PR6A 3T4KA 3PBNA 1OT6A 3PXPA 3IS2B 3UMEA 4R6LA 4HJ6A 1ODVA 3HJKA 4HHDA 1W63Q 2ZOHA 4EEPA 3NOTC 3TJZC 1N9OA 2P7JA 3LI9A 3MR0A 4JGOA 3U2AA 1NLYA 4WF0A 1JNUA 3T4QA 3S7PA 4LPZA 3VE3A 4BJPA 4G3KA 4BBTA 5K5BA 4PAUA 4ZRRA 2VV7A 4I39A 3MMHA 1T18A 5F6AA 2VZWA 4BWIA 3LUQA 3E4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1B A;  3ICY A;  1XJ4 A;  3MXQ A;  3F1N B;  3K3C A;  1X0O A;  3F1N A;  3LIC A;  3T50 A;  1TS8 A;  3LIE A;  4L9E A;  4NXB A;  2V0W A;  4R3A A;  1DP6 A;  2OOL A;  3F1P A;  1WA9 A;  3FC7 A;  2PYR A;  3F1P B;  4EER A;  3E4P A;  2PR5 A;  1XFQ A;  4F3L A;  3F1O A;  5F5Y A;  4I3I A;  1BYW A;  2Z6C A;  5EFW A;  2Z6D A;  2KX6 A;  1OTE A;  1G28 A;  3OLO A;  2W27 A;  4NXG A;  4E04 A;  2I9V A;  1GSW A;  3C8C A;  1XFN A;  4HJ4 A;  4HNB A;  5DJU A;  3EEH A;  4HP9 A;  1S4R A;  4WLA A;  4KQD A;  1P97 A;  3B33 A;  2L1M A;  2QWS A;  3MJQ A;  4I3A A;  1KOU A;  5TBM B;  5TBM A;  3RTY A;  3VE4 A;  5HDS A;  4LLO B;  3LIF A;  1DP8 A;  2M1C A;  4KUK A;  4NXF A;  1LT0 A;  1S1Z A;  3IS2 A;  4M4X A;  2VEA A;  4R70 A;  3BY8 A;  3EWK A;  4HH2 A;  3UB8 A;  4GCZ A;  5DKL A;  1D06 A;  1S67 L;  2PHY A;  4R38 A;  5J3W A;  2PD7 A;  3H7W B;  4HQA A;  4L9F A;  5I5L A;  1DP9 A;  2D02 A;  3MQQ A;  1DRM A;  5KIZ A;  1D7E A;  2A24 B;  4HY8 A;  3LID A;  4MN5 A;  5HDC A;  3SW1 A;  1GSX A;  1LSX A;  1EW0 A;  2YKH A;  3D72 A;  4DJ3 A;  2K7S A;  1TS6 A;  2OWJ A;  4GHI B;  4EEU A;  4GHI A;  1UWN X;  2ZOI A;  3GEC A;  5A8B A;  1Y28 A;  1T1B A;  2L4R A;  1LL8 A;  2PD8 A;  3NHQ A;  4XT2 A;  5IU1 A;  1UWP X;  2QKP A;  4JGP A;  3K3D A;  3NOU C;  1LSW A;  4PKY A;  1XJ3 A;  2VLG A;  5G4Y A;  2R78 A;  3BY9 A;  4LRX C;  2A24 A;  1T1C A;  1XJ6 A;  3P7N A;  3LIA A;  4DJ2 A;  2KDK A;  3UB7 A;  1OTD A;  5HD3 A;  1OTB A;  2JHE A;  2L0W A;  2OWH A;  5AVF A;  2J80 A;  4GS9 B;  4MN6 A;  2QJ7 A;  1OJ5 A;  4B9O A;  4BBV A;  2GJ3 A;  2WKQ A;  4I5S A;  2ZBB A;  3NOP C;  4HOI A;  2H28 A;  3UB9 A;  5HWV A;  3A0V A;  4PKY G;  2BAS A;  3LI8 A;  3E4Q A;  2V0U A;  3A0R A;  3PYP A;  2CMN A;  2D01 A;  5IS1 A;  1MZU A;  1N9L A;  1S66 L;  2PYP A;  2WKP A;  4GS9 A;  4GW9 A;  5G4Z A;  4HIA A;  4H6J A;  1XJ2 A;  2VV8 A;  4JGQ A;  5DJT A;  4F3L B;  2QHK A;  3F1O B;  2EA9 A;  1TS7 A;  4I3J A;  3PHY A;  4RQ9 A;  3CWF A;  1VB6 A;  1OT9 A;  3H82 B;  5HWT A;  1TS0 A;  4K08 A;  4WL9 A;  2INW A;  1V9Y A;  3A0S A;  3MQO A;  3NJA A;  2QJ5 A;  4H6J B;  4L9G A;  4LRY C;  4EQ1 A;  4EXO A;  3CLO A;  3GDI A;  3UE6 A;  5HWW A;  4EES A;  1V9Z A;  4NXE A;  2PR6 A;  2B02 A;  3ULF A;  1LSV A;  1OT6 A;  4LRZ E;  1S4S A;  3G6O A;  3UME A;  3IS2 B;  2W0N A;  4R6L A;  4HJ6 A;  4WN5 A;  3H82 A;  5HSQ A;  1OJG A;  1ODV A;  2V1A A;  3C2W A;  4HJ3 A;  4I38 A;  2V9A A;  3HJK A;  1OTA A;  4HHD A;  3BWL A;  4EET B;  4WUJ A;  2ZOH A;  4EEP A;  1F9I A;  3KX0 X;  3RH8 B;  3NOT C;  5HD5 A;  3VOL A;  3E4O A;  1N9O A;  1GSV A;  2P7J A;  3LI9 A;  1UGU A;  4HI4 A;  5AVE A;  5DKK A;  3MR0 A;  4JGO A;  4KUO A;  3MFX A;  5HDD A;  3ZQ5 A;  4WF0 A;  5J4E A;  2HV1 A;  3LYX A;  4HP4 A;  1JNU A;  3H7W A;  3UMD A;  3FG8 A;  4XT2 B;  2VV6 A;  4BBU A;  2JN7 A;  2PDR A;  2YKF A;  4LPZ A;  1T1A A;  4JGR A;  4YWZ A;  3VE3 A;  5J7E A;  4BBT A;  4HH3 A;  1F98 A;  1S1Y A;  1N9N A;  3LIB A;  2VV7 A;  4I39 A;  1NWZ A;  5F68 A;  3CAX A;  1P0Z A;  2WKR A;  4EW7 A;  1T18 A;  5F6A A;  5HZH A;  1T19 A;  3IBR A;  5F69 A;  3UB6 A;  3H9W A;  3LUQ A;  1OTI A;  3HJI A; 
#chains in the Genus database with same CATH topology
 3FV7 A;  4WBG A;  3MFD A;  3PTE A;  1MC0 A;  1TS8 A;  5FQK A;  4IBX A;  4AFI A;  4PM6 A;  5DFY A;  1BYW A;  4KEN B;  1G28 A;  4LV0 A;  1RCJ A;  1HZO A;  4BD0 A;  3DWK A;  4WEJ A;  3IF6 A;  3AGF A;  1CEF A;  3A3E A;  3V3S A;  2V20 A;  1XX2 A;  2PT7 A;  2K7S A;  1TVF A;  3LO7 A;  4LCM A;  2K2N A;  4EEU A;  1JVJ A;  3RJU A;  5HAI A;  4Q0H A;  1LSW A;  4D60 A;  4DMZ A;  3OCL A;  1JTG A;  1K55 A;  1TDG A;  1YKD A;  3OPL A;  5IHV A;  2WAE A;  3TG9 A;  5IS1 A;  3DAV A;  3KSG A;  3T1Q B;  2JKR I;  5HPF A;  1A0K A;  3O5Y A;  1VB6 A;  5A93 A;  2QJ5 A;  5CGW A;  4QHC A;  3PBS A;  1V9Z A;  5D3O A;  1HTZ A;  3GV9 A;  1YT4 A;  1MPL A;  5CEB A;  2O9B A;  1GSV A;  1IYQ A;  5AVE A;  4DN0 A;  3V5M A;  1XPB A;  3EGD C;  1MWR A;  3C38 A;  2P9V A;  2WYX A;  4GZB A;  5CX7 A;  5HAQ A;  5FAO A;  3IBR A;  4C75 A;  1IYS A;  3T50 A;  3BLM A;  3T4L A;  1I5Q A;  4K0W A;  3F1O A;  3G4P A;  3HUO A;  5L07 A;  4X53 A;  2A49 A;  5AQ9 A;  3C30 A;  1QME A;  2GX5 A;  3ITA A;  3ZYT A;  5L2F A;  4WLA A;  1SHV A;  3DTI A;  1P97 A;  3VE4 A;  4MBK A;  4FUW A;  4LLO B;  1Z6F A;  4FH2 A;  4X69 A;  4E3O A;  3SW1 A;  1KVM A;  2HF6 A;  3PBO A;  3GEC A;  4ZBE A;  2W3H A;  4LV2 A;  4WMC D;  4QWO A;  1BT5 A;  5HD3 A;  4O7D A;  3Q7Z A;  4Q0I A;  3UB9 A;  1BLH A;  4N1H A;  4DDS A;  1K25 A;  2XRN A;  5G18 A;  1YAX A;  4GB7 A;  2BLS A;  3LGO A;  4WL9 A;  4YIN A;  3WS2 A;  3A0S A;  5GLC A;  2XF3 A;  4OP8 A;  2M7V A;  4KG5 A;  1VET A;  3H82 A;  1DJC A;  4ZDX A;  4HEF A;  4JLF A;  4WUJ A;  1ERM A;  3UO9 A;  5HAP A;  5GHX A;  3UDI A;  4MMN A;  3KYQ A;  5HL6 A;  3CHW P;  3HLB A;  4S2J A;  2JN7 A;  2H0Y A;  1ONH A;  3VP4 A;  4HH3 A;  4P6Z M;  1S1Y A;  1N9N A;  2J7V A;  3L9K A;  3NC8 A;  5FI2 A;  1MWT A;  2PRF A;  4Z9Q A;  3KO6 A;  3P09 A;  1ZC2 A;  3M6B A;  3N8S A;  3GSG A;  2QZ6 A;  1DY6 A;  3C8C A;  1PW8 A;  2ZQ9 A;  5TBM B;  4KQD A;  1KVL A;  3IX3 A;  3GVB A;  2Y2O A;  3EWK A;  2WAF A;  3C7U A;  1S67 L;  1PWC A;  4L9F A;  5FDS A;  5CGS A;  1DRM A;  1O7E A;  1D7E A;  2A24 B;  2JKT I;  4E04 A;  3OCN A;  1BUL A;  3PAG A;  5IU1 A;  2EFU A;  4LRX C;  2A24 A;  1XJ6 A;  3MXS A;  1OTD A;  3KYZ A;  4Y0U A;  1H3Q A;  4OVD A;  2Z2M B;  3BFG A;  4B88 A;  1TD5 A;  5E2H A;  2JKT M;  3E4Q A;  2WKP A;  4GS9 A;  3PBT A;  4CLC C;  1MWU A;  1BZA A;  3JPU A;  5HWT A;  4H6J B;  3NJA A;  3G30 A;  2HJ9 C;  5KSH A;  3TRC A;  2ZQA A;  4CLC E;  1Z09 A;  5FL3 A;  1PWD A;  1K56 A;  1YLY A;  3W4P A;  1GHP A;  4OP5 A;  3ZG9 B;  3MFX A;  4HP4 A;  1YSP A;  3HVF A;  4DRT A;  4Y2F A;  4OOL A;  4UAA A;  2GZA A;  4BLM A;  2BG1 A;  2EX6 A;  3HJI A;  3MXQ A;  4N92 A;  3F1N B;  3K3C A;  4WZ4 A;  2EX8 A;  4EER A;  5CHM A;  2Z6C A;  4MEZ A;  4FOF A;  2KX6 A;  4O8G A;  2ZMA A;  4Q0J A;  1ES4 A;  4MBH A;  4I3A A;  1CEG A;  5DTT A;  5MC7 A;  1FCM A;  4Z1W A;  2M1C A;  3KSI A;  2OV5 A;  2IWB A;  2Q9N A;  1XA1 A;  4Y0O A;  3ISG A;  3QNC A;  2HDQ A;  2Y8H A;  2HJE A;  1EW0 A;  3M2J A;  4E6W A;  3D9Y A;  1E4D A;  1Y28 A;  3LY4 A;  3R7W A;  1XJ3 A;  2VLG A;  1ZG4 A;  1L0D A;  5GL9 A;  3P98 A;  2HP5 A;  1OTB A;  4FCF A;  1K55 C;  2WKQ A;  4E3J A;  2KLI A;  5CTM A;  3DW0 A;  2JKF A;  3PYP A;  2ACG A;  2VGJ A;  3N4I A;  1TDL A;  2ZL1 B;  2O0Y A;  3UB5 P;  2Q9M A;  1TS0 A;  4ARZ B;  4FSF A;  4IHQ A;  1CI8 A;  2WZZ A;  3TSG A;  2ZL1 A;  1ERO A;  1BSG A;  4DE1 A;  1KGF A;  2JCH A;  2HP9 A;  3OPH A;  2JKG A;  2ZOH A;  1E3U A;  2G2W A;  3UE0 A;  3LI9 A;  3DTM A;  5EPH A;  4OLG A;  3E2K A;  1PWG A;  1NZU A;  4BJP A;  4DXC A;  1O07 A;  4S2N C;  4BWI A;  4JXS A;  3VOZ A;  3LUQ A;  3E4P A;  2V8C A;  3BFD A;  3BFE A;  3ZHH A;  4ARZ A;  2R9W A;  3FC7 A;  1XFQ A;  3CI6 A;  2O9A A;  5EFW A;  4KZ9 A;  4KZA A;  4WM9 A;  1W63 M;  4HP9 A;  3MJQ A;  2XA7 S;  3LIF A;  5CTN A;  1YLP A;  5EVI D;  2WUQ A;  4KZ8 A;  4DDY A;  4DKI A;  3HLC A;  3MQQ A;  5KIZ A;  2XSS A;  5HDC A;  1JWZ A;  4GOG A;  5EVI C;  3NHQ A;  4NEE D;  2QKP A;  1DJA A;  1YQS A;  3ZNT A;  2V1Z A;  1SZV A;  3LR0 A;  2J80 A;  4GS9 B;  3T4T A;  4OH0 A;  4IVI A;  4P6Z S;  5HWV A;  1K54 C;  1FIK A;  2CMN A;  2XD1 A;  2GNX A;  3LR4 A;  4H6J A;  4JGQ A;  5A90 A;  3F1O B;  1FSW A;  5DTK A;  5CEC A;  1RP5 A;  1YLZ A;  4EBP A;  1V9Y A;  4X1M A;  2A3U A;  3UPN A;  2Y2H A;  3LR3 A;  3BYD A;  3NDE A;  1K38 A;  1OME A;  3ZG7 B;  3BW6 A;  1K57 A;  1OPX A;  2WGW A;  4R3J A;  2OAP 1;  2PU2 A;  1SKO B;  1UGU A;  5FQI A;  5DF9 A;  2C5W B;  3RXW A;  5J4E A;  5FI6 A;  3HUM A;  4CQH A;  3GTC A;  3E0Y A;  1T19 A;  1OTI A;  2ZMF A;  3UNW A;  1ACF A;  4WMC A;  4NKP A;  2EXA A;  5TR7 A;  3OPP A;  4Y0T A;  5GLA A;  3IH8 A;  4Y17 A;  3FYZ A;  1U60 A;  1LI0 A;  3AGE A;  2Q0O A;  5TBM A;  3CUE A;  3VP3 A;  4CLC D;  3B3X A;  3T1S A;  3UB8 A;  3ZCZ A;  3A3D A;  4JKT A;  4ETX A;  3W4Q A;  3BFF A;  1K6R A;  1LSX A;  2ZD8 A;  1G6A A;  3SS4 A;  1CK3 A;  1LL8 A;  2OSU A;  2R78 A;  2P9V B;  3BLS A;  2GJ3 A;  3D4F A;  3IQA A;  3HLW A;  4DE2 A;  2G2U A;  2H28 A;  5E2G A;  1JTD A;  3A0R A;  4ZJ2 A;  1KE0 A;  3PBQ A;  5CGX A;  3QP1 A;  5FAS A;  5EEC A;  3OBF A;  3WS5 A;  4QJG A;  4LRZ E;  4NET A;  2XFS A;  5I94 A;  3FKW A;  5DF7 A;  1ES3 A;  2PBD P;  2HGV A;  1PZO A;  1FOF A;  3N8L A;  1IKI A;  3EQV A;  2XDM A;  2MJ6 A;  1K4F A;  2A2L A;  4QD4 A;  2RCX A;  1F98 A;  2XGN A;  4KZ6 A;  1P0Z A;  5F82 A;  1IFQ A;  3IHA A;  4PPR A;  5F69 A;  1XJ4 A;  4R3B A;  3VP2 A;  2ZJ9 A;  3G34 A;  4CLC B;  5F5Y A;  1STZ A;  2ZC3 B;  4OQI A;  4P6B A;  4IUH A;  4N9K A;  3RTY A;  3VFH A;  2WGI A;  4DXB A;  1IEL A;  2VEA A;  3BY8 A;  2Y4A A;  1D06 A;  3A3F A;  1VQQ A;  4R4R A;  5I5L A;  2G7U A;  1TF1 A;  2XQZ A;  4EBL A;  4FD8 A;  1G68 A;  3W8K A;  5FEF A;  1KDW A;  2YKH A;  4GHI A;  3A3I A;  4PM8 A;  3MBZ A;  4WEL A;  1LLB A;  3UB7 A;  3IT9 A;  4E3I A;  3VSK A;  3Q07 A;  1M6K A;  4EWF A;  1L0F A;  2BAS A;  3B47 A;  2V0U A;  3CJM A;  2D01 A;  1NRF A;  5G4Z A;  4N1X A;  1J9M A;  5DJT A;  5FDH A;  4F3L B;  2VX8 A;  4F94 A;  2B95 A;  1RGY A;  3MZF A;  3O86 A;  3WWX A;  4DF6 A;  4LV1 A;  1ES2 A;  4EXO A;  3IWI A;  1LSV A;  3I7J A;  1BUE A;  1VM1 A;  2B18 A;  2Y2G A;  3CIT A;  3CZD A;  1OTA A;  3HRE A;  3VP0 A;  3RH8 B;  4IED A;  3MZD A;  1H0M A;  3ZQ5 A;  1ZHH B;  1G6O A;  3T1R A;  1EWZ A;  1H8M A;  3G32 A;  2EFX A;  2QMI A;  4G3W A;  3H9W A;  3UDF A;  1IYO A;  2EWW A;  3MQ0 A;  5TJJ A;  1S6R A;  2J3T C;  1K6S A;  4R3A A;  3C7V A;  1FIL A;  4P85 A;  3VSL A;  1PW1 A;  3AGD A;  2IA2 A;  4WZ5 A;  1XFN A;  2L1M A;  2P74 A;  4R1G A;  4NXF A;  2Y2M A;  5L09 A;  3B42 A;  3FPV A;  3D72 A;  4A5R A;  4WEK A;  2L4R A;  2EXB A;  1PNE A;  1XP4 A;  2HPB A;  1MWS A;  2NUP C;  2W3F A;  5DF8 A;  4DJ2 A;  1JWP A;  4JXV A;  2L0W A;  3EEA A;  4MN6 A;  1YLJ A;  1CF0 A;  3SS5 A;  3O87 A;  1CQA A;  3UPP A;  1S66 L;  2X71 A;  2VA0 A;  4JF6 A;  2NUT C;  1NY0 A;  4GD8 A;  1FCO A;  3CWF A;  4OQG A;  3M6H A;  2VJW A;  5AQA A;  1VHM A;  4MN7 A;  3ZG0 A;  1PRQ A;  3NI9 A;  5HW3 A;  3IS2 B;  4R6L A;  4HJ6 A;  4U3T A;  1ODV A;  2HP6 A;  4HHD A;  5DTS A;  1W5D A;  3TJZ C;  1N9O A;  3S4X A;  3C5A A;  4X6T A;  3U2A A;  5A92 A;  3T4Q A;  4ZRR A;  4I39 A;  5HX9 A;  3ZG5 A;  4H8R A;  2Y2N A;  5EE8 A;  3ZFZ A;  3CMZ A;  3IF6 B;  3UE3 A;  4QU3 A;  3LCE A;  4OQ0 A;  2WKH A;  3HUN A;  3O3V A;  1LT0 A;  1VET B;  4HH2 A;  4U0T A;  3UDX A;  4X68 A;  2WGW B;  1H8Y A;  3H7W B;  4HQA A;  3JVV A;  2VKS A;  2DNS A;  2OWJ A;  2WGV A;  3HLF A;  3BRM A;  3LEZ A;  3EQU A;  1I2W A;  2QYB A;  1UWP X;  5EM1 A;  4QY5 A;  5CER A;  3EGX C;  1P9R A;  3W2Z A;  1YM1 A;  2JHE A;  2OWH A;  5AVF A;  1OJ5 A;  2H10 A;  1FCN A;  4KZ3 A;  4Y13 A;  1KGG A;  5BOH A;  5CHJ A;  4D2O A;  3VMA A;  1XJ2 A;  2QHK A;  3QHY A;  1MBL A;  2XK1 A;  4ZAM A;  4S2L A;  3CLO A;  4OQH A;  3DBA A;  1XKZ A;  4X55 A;  2C6W B;  4S2I A;  4EET B;  3BQ8 A;  4IBR A;  1W7F A;  5IT5 A;  1IEM A;  4KG2 A;  2Y2P A;  5HL1 A;  5FQJ A;  5EM0 A;  5HDD A;  2HV1 A;  1TEM A;  3BQA A;  2P08 A;  4O0P A;  1LHY A;  5J7E A;  2XH9 A;  4X1L A;  2WKR A;  5HAR A;  5HZH A;  4GKU A;  1NRJ A;  3NBL A;  3ICY A;  3N7W A;  2W3E A;  2J3T D;  1PIO A;  5EUA A;  4UEY A;  1ES5 A;  3KSH A;  1S4R A;  2Y55 A;  1E3U D;  1LL9 A;  2VGL M;  3IS2 A;  3ITB A;  5E2F A;  2X01 A;  1HD8 A;  1FR6 A;  4R38 A;  1IOU A;  2ZQD A;  2D02 A;  2Y2J A;  1K57 C;  1YPR A;  2V2F F;  2Y59 A;  3QP6 A;  5FI7 A;  4YNR A;  2PD8 A;  3QP2 A;  5G4Y A;  2HZ5 A;  3BY9 A;  5C5K A;  1ALQ A;  1K0K A;  4IJG A;  3BJN A;  1BLS A;  3BEC A;  2QJ7 A;  3ZVW A;  1LL5 A;  3E98 A;  4C3Q A;  4BL3 A;  3A0V A;  3DTK A;  3LI8 A;  2ZC4 B;  4EQI A;  5GHY A;  4GNU A;  3P01 A;  1D1J A;  3HLG A;  3PHY A;  4ETZ A;  3E2L A;  1BLP A;  3H82 B;  4MCW A;  4XUX A;  1S0W A;  5HWW A;  4NXE A;  3CUE C;  2B02 A;  1L0G A;  1Q2P A;  5J8X A;  2JC7 A;  3DTE A;  4BD1 A;  2VGK A;  3IH9 A;  1BLC A;  3UPO A;  3E4O A;  4XUZ A;  2I72 A;  2E8I A;  3GR2 A;  4ME4 A;  2RL3 A;  3H7W A;  3MKF A;  2M7U A;  3FG8 A;  4XT2 B;  2YKF A;  3FWL A;  2XRO A;  1WYC A;  2ZC6 B;  1ONG A;  4FTX A;  1SCW A;  3JYI A;  4ZJ3 A;  4HJ3 A;  1MXO A;  3RXX A;  5CED A;  3IXH A;  5F1G A;  4X25 A;  3BM6 A;  3DWZ A;  3F1P B;  2Y2K A;  5M19 A;  4GJ4 A;  3LFV A;  4E6X A;  1GHM A;  2EWV A;  4HJ4 A;  4JF4 A;  3EEH A;  3B33 A;  1KOU A;  3S7Q A;  4KUK A;  4QPR A;  4PM5 A;  1W8Y A;  4GCZ A;  5DKL A;  4DE0 A;  2KOI A;  3IF5 A;  1DP9 A;  2R9X A;  3LID A;  1KE3 A;  3D3O A;  4KQR A;  4E3K A;  2Z2L B;  3NOU C;  1SDN A;  3MZE A;  3TE8 A;  4O01 A;  2FZ0 A;  1CJF A;  4BBV A;  4I5S A;  1YLT A;  4OKP A;  5LBR A;  4ZJ1 A;  2PYP A;  3GRJ A;  3S22 A;  3NY4 A;  1OT9 A;  5U47 A;  3T4O A;  3PR6 A;  4MBF A;  5EVL A;  4L9G A;  4EES A;  3IXB A;  2P04 A;  2PAV P;  1IKG A;  3WS1 A;  2V1A A;  3WS4 A;  3M2K A;  5EVE A;  1MKI A;  1RGZ A;  3OPR A;  3KX0 X;  3T12 B;  4KZ4 A;  3VOL A;  3T4J A;  4OOM A;  4KUO A;  5F83 A;  3UMD A;  5TGF A;  3ZG8 B;  4ESP A;  1N9B A;  1T1A A;  4JGR A;  2ZLY A;  3HCY A;  3CG5 A;  3GMW A;  3IX4 A;  1NWZ A;  1I2S A;  3BFC A;  2Y2I A;  4ID4 A;  3LIC A;  4GDB A;  2IWD A;  3BEB A;  2PYR A;  4UA9 A;  4CLC A;  2WKE A;  3VFF A;  4X56 A;  4F3L A;  2ZC5 B;  3V67 A;  4KZ7 A;  2Z6D A;  1OTE A;  4II7 A;  1GSW A;  4HNB A;  4OOY A;  3SZT A;  1XXM A;  2LB9 A;  3W4O A;  4G3V A;  4M4X A;  4R70 A;  1VEU B;  4RVA A;  2W3D A;  4JXG A;  5J3W A;  4HY8 A;  2XD5 A;  1GSX A;  4GHI B;  1TS6 A;  1HLU P;  5EVI A;  4XT2 A;  3ULF A;  3TOI A;  3LIA A;  1Y54 A;  1WE4 A;  1PI5 A;  3CPT A;  2PU4 A;  3G2Z A;  1KE4 A;  2J3W A;  4MDZ A;  2XA7 M;  3CPT B;  5CHU A;  2J9P A;  1C3B A;  4OPY A;  1PI4 A;  3V39 A;  1GHI A;  1H5X A;  2X02 A;  3S7O A;  3NUL A;  4MLL A;  3MQO A;  3UE6 A;  2PR6 A;  3PBN A;  1OT6 A;  4JF5 A;  3G35 A;  2XR0 A;  1W63 Q;  5FAP A;  4OPR A;  2FFF B;  4EEP A;  3NOT C;  2P7J A;  5DVA A;  3MR0 A;  4JGO A;  4C6Y A;  5JYO A;  4LEN A;  2EX2 A;  3MKE A;  4G3K A;  4BBT A;  3HBR A;  5AQB A;  1T18 A;  2ZM8 A;  2VZW A;  5FEG A;  5AJG A;  1ZKJ A;  2V1B A;  1X0O A;  3LIE A;  3Q7V A;  3NEC A;  2OOL A;  3SH8 A;  1WA9 A;  3OZH A;  4HBU A;  1XA7 A;  4EU0 A;  4ZTK A;  5KMW A;  2W27 A;  1NXY A;  2CC1 A;  2O9C A;  5HDS A;  2OAQ 1;  1DP8 A;  1M40 A;  2VK3 A;  2H0T A;  4M3K A;  3IF6 C;  2PHY A;  4RA7 A;  5FSR A;  4EUV A;  4GD6 A;  4MN5 A;  1NZO A;  1PYY A;  4JXW A;  4JGP A;  3IXD A;  3K3D A;  2ZMV A;  3PBR A;  1T1C A;  4GN2 A;  4EUZ A;  1WYB A;  3P7N A;  3O88 A;  1SKO A;  1G5U A;  2Y2Q A;  4GLQ A;  5HPI A;  5EV0 A;  2ZQC A;  3NOP C;  3IHB A;  3QP4 A;  4MNR A;  3VP1 A;  2XFT A;  1ESI A;  1ESU A;  2UWX A;  5FQQ A;  4GW9 A;  4JBF A;  1LI9 A;  1F5M A;  3WRZ A;  1W79 A;  3IXG A;  1H8Z A;  4BEN A;  3T4S A;  3TW8 A;  1GA0 A;  4PM9 A;  4QB8 A;  2JE5 A;  1KGE A;  2ZQ8 A;  2WK0 A;  4WN5 A;  3U4L P;  1OJG A;  1FSY A;  4KZB A;  3R4K A;  3BWL A;  4E3L A;  4JPM A;  5FQ9 A;  1YLW A;  5M1A A;  4HES A;  1KDS A;  4KQO A;  3R7W B;  2IWC A;  5DFX A;  4YWZ A;  1K4E A;  3FPW A;  1PZP A;  3S1Y A;  3LIB A;  5F68 A;  3OOV A;  4YOF A;  3UY6 A;  4S2O A;  1J3W A;  3F1P A;  2OLU A;  3GQZ A;  3V50 A;  2H5S A;  5HFO A;  4OPQ A;  1F2K A;  5L10 A;  4KQQ A;  4K91 A;  4R23 A;  3MXR A;  5DJU A;  3EOI A;  2W1T B;  4WZ5 C;  4LFU A;  4QY6 A;  1MY8 A;  3N8R A;  3Q81 A;  2WKI A;  1MKM A;  2J8Y A;  2FH5 A;  3NIA A;  2AVX A;  5EOE A;  5GHZ A;  4UA7 A;  4NK3 A;  3UN7 A;  3ZNY A;  4BL2 A;  2W1R A;  1YMS A;  4E3M A;  4FH4 A;  2ZC7 A;  3ZVT A;  3C4O A;  1K54 A;  4B4X A;  1N9L A;  2V8F A;  4RX3 A;  3KYE A;  4HIA A;  3NDG A;  1K56 D;  4UQI S;  2EA9 A;  2JBF A;  4I3J A;  1JWV A;  2HDS A;  2ZM0 A;  3Q7V B;  3VOY A;  5F1F A;  4K0X A;  4LRY C;  4EQ1 A;  2BTF P;  2LB5 A;  4GDN A;  5KZH A;  3SS3 A;  3IBJ A;  2DCF A;  1S4S A;  3G6O A;  2W0N A;  3FKV A;  1P9W A;  4I38 A;  1L0E A;  2XLN A;  1QMF A;  1F9I A;  2DMW A;  4IVK A;  3ZDJ A;  5DKK A;  5JYP A;  4LGW A;  3LYX A;  2VV6 A;  2PDR A;  2E8J A;  3PAE A;  3MF0 A;  3IWQ A;  1N4O A;  2XEP A;  4WYY A;  3IX8 A;  3UB6 A;  4UHU A;  4RX2 A;  2GDN A;  1NLZ A;  3SOI A;  3F1N A;  4BMW A;  5CRF A;  4L9E A;  4NXB A;  2V0W A;  1DP6 A;  1XGJ A;  5FAT A;  4I3I A;  1DJB A;  5E2E A;  2I9V A;  3QP5 A;  3N6I A;  1Y4O A;  2QWS A;  3G2Y A;  2ZM2 A;  3QP8 A;  2Y2L A;  2UV0 E;  1S1Z A;  4P87 A;  1PFL A;  4LV3 A;  1XGI A;  3RFB A;  3C4P A;  4UQI M;  4E3N A;  1HVB A;  4S2P A;  4Y5F A;  4R0Q A;  3S7N A;  1BTL A;  1Q2Q A;  5EVI B;  3LEQ A;  5A8B A;  1T1B A;  2Y91 A;  4Y3I A;  4L0L A;  2KDK A;  3ZGA B;  2K31 A;  4XXR A;  3NCK A;  3KSF A;  4HOI A;  5FQM A;  4PKY G;  4S2N A;  3VV4 A;  5A91 A;  1W8Q A;  4N9L A;  3V3R A;  4IUK A;  3G31 A;  3LY3 A;  4OON A;  4NG2 A;  4BQM A;  5CXW A;  3T1X A;  5TFQ A;  4Y15 A;  3Q1F A;  2INW A;  3LR5 A;  4EV4 A;  4S2K A;  3GDI A;  1VEU A;  5HSQ A;  3MSH A;  2VGL S;  2W1T A;  3C2W A;  2V9A A;  2PBY A;  4R4S A;  2WZX A;  3L7H A;  4OPZ A;  4LCL A;  4Q8I A;  5HD5 A;  2EX9 A;  1NYY A;  4HI4 A;  1E25 A;  3WRT A;  1AWI A;  5L8M A;  1NYM A;  1YMX A;  1ZTU A;  3HL9 A;  4BBU A;  3SH9 A;  2ZQ7 A;  2HDR A;  1IYP A;  5FA7 A;  1AXB A;  4CJN A;  3CAX A;  4EW7 A;  2DRW A;  4CPK A;  4EBN A;  4KZ5 A;  4U0X A;  4B93 A;  5AQ7 A;  2WAD A;  2PR5 A;  2QPN A;  1CI9 A;  3OLO A;  4NXG A;  3SH7 A;  5M18 A;  3MS6 A;  5FAQ A;  3A3J A;  2J9O A;  4Y7P A;  4HBT A;  4S2M A;  5GLD A;  1EI5 A;  2PD7 A;  1YSQ A;  2OLV A;  4DJ3 A;  3K2N A;  1UWN X;  2HDU A;  2ZOI A;  1FR1 A;  1L2S A;  1L3L A;  4PKY A;  3JVU A;  4PHT A;  2FFY A;  4B9O A;  4RYE A;  2ZBB A;  5GLB A;  1MZU A;  4DE3 A;  4OLD A;  2VV8 A;  2W3G A;  2B5R A;  1TS7 A;  3OC2 A;  4YFM A;  4RQ9 A;  2Y79 A;  4K08 A;  5E43 A;  2O99 A;  3T4K A;  3HLD A;  3PXP A;  3UME A;  3FZC A;  4UA6 A;  3QNB A;  3HJK A;  5EOO A;  1GCE A;  3IWO A;  1SDE A;  1SKF A;  1NLY A;  4WF0 A;  1NJ4 A;  4KG6 A;  1JNU A;  1ERQ A;  3S7P A;  4PMA A;  4LPZ A;  1GA9 A;  3Q82 A;  4P0M A;  3VE3 A;  3WS0 A;  1FQG A;  5K5B A;  4PAU A;  5KSC A;  3UE1 A;  4B4Z A;  2VV7 A;  4PM7 A;  3MMH A;  1ZG6 A;  5F6A A;  3HLE A;  2JKR M; 
#chains in the Genus database with same CATH homology
 2V1B A;  1X0O A;  1MC0 A;  1TS8 A;  3LIE A;  4ARZ A;  2OOL A;  3FC7 A;  1WA9 A;  4AFI A;  1XFQ A;  3CI6 A;  4EU0 A;  2O9A A;  1BYW A;  5DFY A;  5EFW A;  3UE3 A;  1G28 A;  2W27 A;  1W63 M;  4HP9 A;  3MJQ A;  2O9C A;  2XA7 S;  5HDS A;  2OAQ 1;  1DP8 A;  3LIF A;  1LT0 A;  4WEJ A;  4HH2 A;  2PHY A;  4EUV A;  3H7W B;  4HQA A;  3JVV A;  3MQQ A;  5KIZ A;  2XSS A;  4MN5 A;  5HDC A;  2VKS A;  2PT7 A;  2K7S A;  2OWJ A;  3EQU A;  2K2N A;  4EEU A;  3NHQ A;  4NEE D;  2QYB A;  1UWP X;  2QKP A;  4JGP A;  3K3D A;  4Q0H A;  1LSW A;  4DMZ A;  3OCL A;  2ZMV A;  3PBR A;  1T1C A;  3P7N A;  3EGX C;  1P9R A;  3W2Z A;  2JHE A;  2OWH A;  3LR0 A;  5AVF A;  2J80 A;  4GS9 B;  1OJ5 A;  3T4T A;  1YKD A;  4GLQ A;  5HPI A;  3NOP C;  4P6Z S;  5HWV A;  2CMN A;  5IS1 A;  2GNX A;  3LR4 A;  3KSG A;  2JKR I;  4GW9 A;  1F5M A;  1XJ2 A;  4H6J A;  4JGQ A;  5HPF A;  2QHK A;  3F1O B;  3O5Y A;  1VB6 A;  3T4S A;  1V9Y A;  2QJ5 A;  3TW8 A;  3CLO A;  3PBS A;  3DBA A;  1V9Z A;  3LR3 A;  4WN5 A;  1OJG A;  4EET B;  3BQ8 A;  3BW6 A;  3R4K A;  3BWL A;  1OPX A;  2OAP 1;  5IT5 A;  2O9B A;  1GSV A;  1UGU A;  5AVE A;  5DF9 A;  4DN0 A;  5HDD A;  4KQO A;  5J4E A;  3R7W B;  2HV1 A;  3BQA A;  3EGD C;  2P08 A;  5DFX A;  3C38 A;  4O0P A;  4YWZ A;  5J7E A;  3FPW A;  4CQH A;  3LIB A;  5CX7 A;  5F68 A;  3E0Y A;  2WKR A;  5HZH A;  1T19 A;  3IBR A;  1NRJ A;  3OOV A;  4YOF A;  1OTI A;  2ZMF A;  3ICY A;  3T50 A;  2W3E A;  3T4L A;  4NKP A;  2J3T D;  3F1P A;  3F1O A;  4UEY A;  3C30 A;  3KSH A;  2GX5 A;  3ZYT A;  5DJU A;  3EOI A;  4WLA A;  2W1T B;  1S4R A;  1P97 A;  5TBM A;  3VE4 A;  3CUE A;  4LLO B;  4CLC D;  2VGL M;  3IS2 A;  1MKM A;  3UB8 A;  4R38 A;  1IOU A;  2FH5 A;  4ETX A;  2D02 A;  3SW1 A;  1LSX A;  2HF6 A;  3PBO A;  4YNR A;  3GEC A;  1LL8 A;  2PD8 A;  2W3H A;  5G4Y A;  2R78 A;  3BY9 A;  5C5K A;  4IJG A;  3BJN A;  5HD3 A;  2QJ7 A;  2GJ3 A;  2W1R A;  4Q0I A;  3E98 A;  2H28 A;  3UB9 A;  3A0V A;  3LI8 A;  3A0R A;  1N9L A;  2XRN A;  4HIA A;  1YAX A;  2EA9 A;  3P01 A;  3PBQ A;  4UQI S;  4I3J A;  4ETZ A;  3PHY A;  3H82 B;  4MCW A;  4WL9 A;  3A0S A;  4LRY C;  3OBF A;  4EQ1 A;  2LB5 A;  5HWW A;  2M7V A;  4NXE A;  3CUE C;  2B02 A;  3IBJ A;  4LRZ E;  1S4S A;  3G6O A;  2W0N A;  3H82 A;  1P9W A;  4I38 A;  2HGV A;  4WUJ A;  1F9I A;  2DMW A;  3E4O A;  5DKK A;  3EQV A;  4MMN A;  4ME4 A;  3LYX A;  3KYQ A;  5HL6 A;  2MJ6 A;  3H7W A;  2M7U A;  3FG8 A;  4XT2 B;  2VV6 A;  2JN7 A;  2PDR A;  2YKF A;  2A2L A;  4HH3 A;  2XRO A;  1F98 A;  4P6Z M;  1S1Y A;  1N9N A;  3MF0 A;  1P0Z A;  3UB6 A;  1IFQ A;  5F69 A;  4HJ3 A;  1XJ4 A;  1NLZ A;  3F1N A;  4BMW A;  4L9E A;  4NXB A;  3KO6 A;  2V0W A;  1DP6 A;  3F1P B;  4CLC B;  4GJ4 A;  5F5Y A;  4I3I A;  3LFV A;  1STZ A;  2I9V A;  2EWV A;  3C8C A;  4HJ4 A;  4IUH A;  3EEH A;  5TBM B;  4KQD A;  3B33 A;  2QWS A;  3RTY A;  1KOU A;  3S7Q A;  4KUK A;  4QPR A;  1S1Z A;  2VEA A;  3BY8 A;  3EWK A;  4GCZ A;  5DKL A;  1D06 A;  3RFB A;  4UQI M;  1S67 L;  2KOI A;  2G7U A;  5I5L A;  4L9F A;  1DP9 A;  1TF1 A;  4Y5F A;  1DRM A;  1D7E A;  2A24 B;  3LID A;  2JKT I;  4E04 A;  2YKH A;  3D3O A;  5AJG A;  3OCN A;  3S7N A;  4GHI A;  5A8B A;  1T1B A;  5IU1 A;  4Y3I A;  3NOU C;  4LRX C;  4WEL A;  2A24 A;  4L0L A;  1XJ6 A;  3TE8 A;  4O01 A;  2KDK A;  2K31 A;  1OTD A;  3UB7 A;  2FZ0 A;  3KYZ A;  1H3Q A;  2JKR M;  3KSF A;  4BBV A;  1TD5 A;  4I5S A;  4HOI A;  4PKY G;  2BAS A;  2JKT M;  3B47 A;  3E4Q A;  3VV4 A;  2V0U A;  2D01 A;  5LBR A;  4IUK A;  2PYP A;  2WKP A;  4GS9 A;  5G4Z A;  3PBT A;  5DJT A;  4F3L B;  4CLC C;  2VX8 A;  1OT9 A;  3T4O A;  5HWT A;  3PR6 A;  2INW A;  4EXO A;  3LR5 A;  3NJA A;  4H6J B;  4L9G A;  3GDI A;  4EES A;  2P04 A;  2HJ9 C;  1LSV A;  5KSH A;  3TRC A;  5HSQ A;  2B18 A;  4CLC E;  2V1A A;  2VGL S;  2W1T A;  3C2W A;  2V9A A;  3CIT A;  1OTA A;  5FL3 A;  3RH8 B;  3KX0 X;  5HD5 A;  3VOL A;  3T4J A;  4HI4 A;  4OOM A;  4KUO A;  3MFX A;  3ZQ5 A;  5L8M A;  4HP4 A;  1YSP A;  1ZHH B;  1G6O A;  3UMD A;  4Y2F A;  1ZTU A;  4BBU A;  1T1A A;  4JGR A;  1H8M A;  4OOL A;  3HCY A;  1NWZ A;  3CAX A;  4EW7 A;  2GZA A;  4G3W A;  3H9W A;  3HJI A;  2EWW A;  3MXQ A;  3MQ0 A;  3F1N B;  3K3C A;  3LIC A;  5TJJ A;  2J3T C;  4R3A A;  4B93 A;  2PYR A;  4CLC A;  4EER A;  2PR5 A;  4F3L A;  2IA2 A;  3V67 A;  2Z6C A;  2Z6D A;  4FOF A;  2KX6 A;  1OTE A;  3OLO A;  4II7 A;  4NXG A;  1GSW A;  1XFN A;  4HNB A;  4O8G A;  4Q0J A;  4I3A A;  2L1M A;  2LB9 A;  5MC7 A;  4G3V A;  4Z1W A;  2M1C A;  4NXF A;  4M4X A;  3KSI A;  4R70 A;  2W3D A;  5J3W A;  2PD7 A;  3B42 A;  1YSQ A;  2Y8H A;  4HY8 A;  3FPV A;  1GSX A;  2HJE A;  1EW0 A;  4DJ3 A;  3K2N A;  3D72 A;  4GHI B;  1TS6 A;  1UWN X;  2ZOI A;  4WEK A;  1Y28 A;  2L4R A;  3R7W A;  4XT2 A;  3ULF A;  4PKY A;  1XJ3 A;  2VLG A;  2NUP C;  3LIA A;  2W3F A;  3JVU A;  4PHT A;  4DJ2 A;  1OTB A;  2L0W A;  3EEA A;  4MN6 A;  4B9O A;  2WKQ A;  2ZBB A;  2KLI A;  2J3W A;  4MDZ A;  3PYP A;  1MZU A;  1S66 L;  2XA7 M;  2VV8 A;  2VA0 A;  2W3G A;  2NUT C;  1TS7 A;  3OC2 A;  4RQ9 A;  3CWF A;  2O0Y A;  2VJW A;  1VHM A;  3S7O A;  2Y79 A;  1TS0 A;  4K08 A;  4MN7 A;  4ARZ B;  3MQO A;  4FSF A;  2O99 A;  3UE6 A;  4IHQ A;  2PR6 A;  3T4K A;  3PBN A;  1OT6 A;  3PXP A;  3IS2 B;  3UME A;  4R6L A;  4HJ6 A;  1ODV A;  3HJK A;  4HHD A;  1W63 Q;  2ZOH A;  4EEP A;  3NOT C;  3TJZ C;  1N9O A;  2P7J A;  3LI9 A;  3MR0 A;  4JGO A;  3U2A A;  1NLY A;  4WF0 A;  1JNU A;  3T4Q A;  3S7P A;  4LPZ A;  3VE3 A;  4BJP A;  4G3K A;  4BBT A;  5K5B A;  4PAU A;  4ZRR A;  2VV7 A;  4I39 A;  3MMH A;  1T18 A;  5F6A A;  2VZW A;  4BWI A;  3LUQ A;  3E4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...