5F6AA

Drosophila melanogaster cycle w398a pas-b with empty pocket
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
b'MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cycle
molecule tags Circadian clock protein
source organism Drosophila melanogaster
publication title Drosophila Melanogaster Cycle PAS-B
rcsb
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f6aA00
4NXGA 2VV8A 5AVFA 2P7JA 2L4RA 4JGPA 2WKRA 1OJGA 4L9GA 2QWSA 3H7WB 4LRYC 3F1OB 2PD8A 3LICA 4NXFA 5DJUA 4F3LB 5J7EA 4NXEA 5IS1A 3G6OA 4GW9A 5IU1A 4HY8A 4GHIA 4LLOB 3NJAA 2CMNA 1N9NA 2YKHA 3K3CA 3MXQA 3NHQA 3F1NA 2KX6A 2YKFA 3ULFA 4HJ3A 2QJ7A 3A0VA 3MR0A 1OTDA 2JN7A 2OWJA 3PHYA 4I3AA 1LT0A 2R78A 2BASA 3MJQA 4JGOA 3T50A 2K7SA 1LL8A 3BWLA 4JGQA 4B9OA 3NOTC 3BY9A 2J80A 2L1MA 3UMDA 3CWFA 1XJ3A 2A24B 1S67L 1S1YA 1P0ZA 1VB6A 2WKPA 4LPZA 5F6AA 5TBMB 4DJ2A 2EA9A 4XT2B 4BBUA 2VLGA 1T19A 3A0SA 3SW1A 5DKLA 4KUOA 1S4SA 2VV6A 3GECA 4HOIA 1XJ4A 3GDIA 1UWPX 5EFWA 2OOLA 2V1BA 5DKKA 5HD3A 3ZQ5A 5KIZA 2QKPA 3B33A 1D7EA 3LIFA 2GJ3A 1T1CA 3H9WA 3MQOA 5HSQA 2D01A 3K3DA 1TS7A 3ICYA 3E4QA 4I3JA 4EESA 3LIAA 3CAXA 1OJ5A 4HNBA 3C2WA 1JNUA 2V0WA 3VOLA 3C8CA 3IS2A 2INWA 4HJ4A 4WL9A 5DJTA 3UMEA 4WUJA 4HP4A 5A8BA 4M4XA 4R38A 5HDSA 5AVEA 4EW7A 5J3WA 5HD5A 5J4EA 4HQAA 2ZOIA 4HIAA 4EETB 1LSVA 2VV7A 3F1PA 3LI8A 4HH3A 2PYRA 2Z6DA 1T18A 3LYXA 3F1NB 1F98A 2PR5A 4GS9B 4H6JB 3E4PA 3UB9A 4F3LA 2V0UA 3LIEA 4E04A 1S66L 4NXBA 3LIBA 2L0WA 1DP6A 5G4ZA 3RH8B 4WF0A 1S1ZA 5I5LA 4MN5A 2B02A 2M1CA 2H28A 3EWKA 3H82A 1XJ2A 5HDDA 1TS0A 5TBMA 4WN5A 5G4YA 4YWZA 3LUQA 2WKQA 4PKYG 3D72A 1F9IA 2JHEA 1G28A 4I3IA 4KQDA 3UB8A 4LRZE 4BBVA 2ZBBA 2ZOHA 1T1BA 1DRMA 5HWTA 2QHKA 1MZUA 3H7WA 3A0RA 3EEHA 3F1OA 3FC7A 4R3AA 3UB6A 1DP9A 1V9YA 1BYWA 2HV1A 1OTIA 1DP8A 4GHIB 5HDCA 1LSWA 4MN6A 1LSXA 4L9EA 3VE3A 1GSVA 4HJ6A 5HZHA 2D02A 2KDKA 3IBRA 1OT6A 3LI9A 1EW0A 2V9AA 2PDRA 3MQQA 3NOPC 3OLOA 3BY8A 5F69A 4EEPA 1UGUA 1OTBA 2W0NA 1T1AA 3CLOA 1KOUA 4PKYA 5F5YA 3VE4A 1ODVA 2PD7A 3IS2B 4JGRA 4EEUA 2I9VA 4GCZA 2PYPA 4HHDA 3UB7A 3P7NA 4EERA 5HWVA 4I38A 4R6LA 4LRXC 2A24A 4K08A 1OTAA 3LIDA 3F1PB 1P97A 1Y28A 3MFXA 4L9FA 2PHYA 3KX0X 4XT2A 1OT9A 4WLAA 4BBTA 3HJKA 4GS9A 4H6JA 3RTYA 4DJ3A 2VEAA 1XJ6A 4HH2A 4KUKA 2V1AA 3HJIA 4I39A 5F68A 4R70A 4EQ1A 1N9OA 2W27A 1TS8A 2PR6A 3PYPA 4RQ9A 1WA9A 1V9ZA 1TS6A 4I5SA 2OWHA 3FG8A 3NOUC 1UWNX 2QJ5A 1S4RA 3UE6A 1N9LA 1X0OA 1GSXA 1OTEA 4HP9A 4EXOA 3H82B 5HWWA 1XFQA 4HI4A 1D06A 1XFNA 2Z6CA 1NWZA 1GSWA 3E4OA
chains in the Genus database with same CATH superfamily
1VM1A 2VV8A 4R0QA 3N8RA 3OCNA 4NXEA 1HZOA 2PT7A 4P6ZS 5A92A 3SZTA 5KSCA 2O99A 2JN7A 4M3KA 2BASA 4Y0OA 5EM0A 1W5DA 5HX9A 5A90A 1PWCA 2Q0OA 2VV6A 3GECA 5HW3A 4GZBA 4HBUA 5EVIA 2IWDA 3G4PA 2HDQA 3PBOA 2IA2A 1GA9A 3T4QA 3R4KA 4BENA 4OQHA 4FH2A 1KDWA 4MBHA 5HAQA 2EFUA 2VJWA 3N8LA 4HP4A 5HDSA 5J3WA 1K54A 4DF6A 2Z6DA 5EM1A 4N1HA 4OQGA 3FPWA 5E43A 5CERA 3PBSA 1TS0A 4R4SA 5FI6A 5HFOA 5HWTA 3C38A 2PAVP 3H7WA 5M1AA 3MMHA 3CUEC 1V9YA 3V50A 1EW0A 4EEPA 1MKMA 1NRFA 4E3IA 1HLUP 4Q0JA 3DTIA 5HWVA 2W1TB 4Y0TA 2WADA 3G30A 4ZTKA 3LIDA 3MFXA 2OSUA 1H0MA 2HP5A 3T4TA 4I39A 1K25A 3MKFA 3HLCA 3HLBA 2QJ5A 5C5KA 4CLCC 1GHPA 2XR0A 4EXOA 1NXYA 1GSWA 4HH3A 2B18A 3SH8A 4NXGA 4Y2FA 5AVFA 3S7NA 4NK3A 2WKRA 3F1OB 4GOGA 4R1GA 1SZVA 2M7UA 1KE0A 2XK1A 4H8RA 4WZ4A 1DJCA 3VP3A 5L8MA 1LL8A 4GB7A 1P0ZA 2A49A 3CG5A 3MQ0A 1FCNA 4D2OA 3LO7A 3SW1A 2VA0A 2V8CA 3VP1A 4BQMA 3KSHA 5L09A 3WS0A 3Q7VA 3E4QA 1SKOB 4I3JA 4JPMA 4UHUA 1NY0A 5A91A 1LI9A 3PXPA 2Y2NA 3IS2A 4WL9A 5DJTA 5FAQA 4B93A 1I5QA 2VX8A 1IYOA 3FKVA 2JKGA 4HIAA 4EETB 3IH8A 4S2NA 1L0EA 3CMZA 3DTEA 2ZC7A 5G4ZA 2C5WB 3CZDA 1S1ZA 5EV0A 2M1CA 4E3OA 1XJ2A 1QMFA 4DMZA 4I3IA 4LRZE 5GLCA 3PAEA 2GX5A 1BZAA 5L07A 1DY6A 1P9RA 4OLDA 4WMCA 4GDBA 4L9EA 2KDKA 1BLCA 1BLSA 4QY6A 5CTNA 2Z2LB 3UO9A 5BOHA 3IQAA 3NDEA 4X53A 3IWOA 5FEFA 5K5BA 5AQ7A 4ZDXA 1S4RA 4U0XA 1YSPA 1XFQA 2DMWA 3DTMA 5EVEA 1FR6A 3DTKA 1GHMA 5TGFA 3FWLA 3R7WB 5J7EA 2PU4A 3CJMA 4YOFA 1XXMA 4ARZA 3W4QA 3K3CA 3F1NA 5EVLA 5HARA 1OTDA 4I3AA 2R78A 3S22A 2G2WA 3EGDC 3GMWA 2Y59A 3DAVA 5HPFA 1H8YA 1MBLA 5KMWA 5KZHA 3EQVA 1T19A 4LFUA 1F2KA 4JXWA 3ZQ5A 4DDSA 2ZQ9A 4O0PA 4Z1WA 4RA7A 3TJZC 5FDSA 1IKIA 3VSLA 2HGVA 1OJ5A 4C75A 2ZQ8A 5CGWA 4LV3A 2P9VB 4JXVA 3QP8A 3T12B 4KQRA 4BL3A 1XA7A 5DTSA 3HUOA 2VKSA 1MZUA 1FOFA 4KQOA 4X1LA 1DP8A 2Y2LA 3OBFA 1WE4A 3MQQA 3BM6A 3MZDA 2GNXA 4N9LA 2WKIA 3VOZA 3S7PA 2A2LA 2I9VA 5U47A 3VOYA 4EERA 2ZQ7A 1OTAA 1Y28A 4L9FA 3RTYA 3GV9A 1IKGA 2HP6A 2RCXA 2WGWB 3PAGA 4IUHA 3WS2A 3FZCA 1TS8A 2PR6A 1P9WA 3MZFA 3NDGA 3HLFA 4DKIA 3MF0A 2L4RA 4RYEA 2PD8A 2EXBA 3E0YA 3MKEA 4Y15A 3UN7A 3BLMA 4MBKA 3NJAA 2ZMVA 2YKHA 4WBGA 2KX6A 4HJ3A 2ACGA 2XFSA 4JGOA 4IBXA 2R9WA 1KVMA 1FSYA 2L1MA 2E8IA 1S1YA 5TBMB 4MEZA 2NUTC 3WS1A 4HOIA 5GHXA 3WWXA 1YAXA 3GVBA 4CPKA 1ZTUA 3G35A 2JE5A 5EVID 3C8CA 3GRJA 1VETA 3QNBA 3HUMA 3UMEA 3WS5A 3T1QB 2EWVA 3MS6A 5EPHA 4C3QA 1CI9A 2WAEA 3QP6A 4ID4A 1RGYA 2XDMA 4UQIS 4NKPA 3PBTA 3V3RA 2L0WA 4Y17A 5EE8A 3H82A 4CLCD 1I2SA 2H0YA 4KQDA 3IX3A 1MWSA 1PRQA 4PHTA 1MY8A 3MBZA 5FQ9A 3F1OA 4XXRA 2VGKA 2HDRA 2V1ZA 1KGGA 4E3KA 4Y0UA 5F5YA 3BQAA 2ZM2A 4GCZA 4ZAMA 3MXSA 4BL2A 1K4FA 2WYXA 1FQGA 4EV4A 4X69A 4I5SA 1PIOA 2WKHA 2FFFB 4HP9A 3G34A 1IYSA 1NJ4A 1SKOA 1PI5A 1E3UD 4QD4A 3N8SA 1SHVA 2QWSA 3H7WB 3C4OA 3O3VA 4IJGA 4KG2A 4PM8A 3NI9A 3EQUA 4FD8A 3GQZA 5E2FA 4GD6A 4BLMA 2J80A 3T1SA 1O7EA 4LENA 4QB8A 2OAP1 1K57C 1H3QA 4O8GA 3VP2A 5E2GA 1ES3A 5EFWA 3VV4A 5FASA 5KIZA 2QKPA 4E6WA 1K38A 3ICYA 4BMWA 1OMEA 3CUEA 4HNBA 2VGLS 4A5RA 4AFIA 1A0KA 4ESPA 5FI7A 4HQAA 2ZOIA 1LSVA 2HF6A 3LYXA 4GKUA 5DVAA 2JKRI 5F83A 5FDHA 1VHMA 2I72A 1KGEA 3IF5A 3ZGAB 3JVUA 1GA0A 1HTZA 2ZL1B 3MFDA 3NY4A 5FQMA 4KZ3A 3R7WA 2IWBA 1LSWA 4MN6A 4ARZB 3S7OA 3T1XA 2B5RA 3BY8A 2W3EA 2PD7A 5EVIC 3P7NA 2XEPA 1IEMA 4EW7A 2ZMAA 3B42A 1K55C 3NULA 3NOUC 1GSXA 1D06A 4MN5A 1RGZA 4IUKA 4BJPA 2W1RA 3C7UA 4IVKA 5DTKA 1TF1A 5EOEA 4ZJ2A 1BUEA 4ZBEA 3UMDA 2LB9A 5CX7A 2HDSA 5DKLA 2XLNA 3IH9A 2HP9A 4QU3A 3BYDA 4OP8A 3ITBA 2W3FA 2GJ3A 5HAPA 3ITAA 2HZ5A 3IF6B 4CJNA 3LIAA 4WEKA 1KVLA 2V0WA 5A8BA 3OPLA 4E3MA 2ZLYA 5AVEA 3UE3A 4GS9B 1E25A 3HCYA 4NXBA 3T4OA 4PM5A 4DXCA 4Q8IA 1PFLA 3A3JA 3KYEA 2O9CA 4ZJ1A 4JXSA 4BBVA 3PBNA 3U4LP 1W8YA 1FILA 3IXGA 4KG6A 1OT6A 3LI9A 3OLOA 1FCMA 4PKYA 2Z2MB 4EBPA 1LI0A 3ZVTA 2P9VA 3M2JA 1OPXA 2E8JA 2H0TA 4XT2A 5JYOA 1WYCA 3BQ8A 3WRTA 1VEUB 4R70A 1WA9A 3UE6A 2PRFA 1KDSA 2PU2A 1DJBA 2VK3A 3IX4A 4LRYC 1VQQA 5DJUA 2J8YA 5CXWA 5FA7A 1YPRA 2YKFA 2QJ7A 2OWJA 2J3TC 4R3BA 5FQKA 3SH9A 3UPOA 1YLWA 4BBUA 1YLTA 3NC8A 3Q1FA 5HD3A 1L0GA 5CHMA 2Y2JA 3IF6C 1PYYA 4XUXA 1KE4A 3VOLA 4KQQA 3SS4A 2P74A 4BD0A 4Y7PA 4OONA 2Y2MA 5FQQA 3SH7A 2ZC3B 3E4PA 2Y55A 2FFYA 4K91A 1PNEA 2B02A 1K54C 4WN5A 1QMEA 2DNSA 4LV2A 3D72A 3O88A 3L7HA 4FTXA 3LR5A 1M40A 5DTTA 3ZG8B 3VP0A 1YMXA 5HDCA 4WM9A 3VE3A 1GSVA 5CHUA 3ZG7B 1EROA 4IVIA 2WK0A 2XQZA 2W0NA 4C6YA 4E3LA 1T1AA 2R9XA 3LR0A 1VETB 4LV0A 2EX8A 2Q9NA 3EGXC 3KX0X 4F3LB 2FH5A 4DE0A 4UA7A 3IXDA 3KYZA 2EFXA 4U3TA 3LFVA 1XPBA 3U2AA 2XH9A 3H82B 4OOLA 1L3LA 2P7JA 4R23A 1MPLA 1G6AA 3TE8A 4BWIA 2XRNA 4Y13A 3MR0A 3G2ZA 3ZCZA 3DWZA 4B9OA 3NOTC 1PZOA 3ISGA 2XD5A 5HPIA 3CWFA 2A24B 2VLGA 3A0SA 4JF4A 1O07A 3GDIA 2BG1A 4P87A 2Y91A 1FR1A 4DE3A 4WZ5C 1IOUA 3MQOA 2P08A 4OVDA 1YQSA 4OH0A 5GLAA 1H5XA 2ZD8A 3OPRA 4WUJA 4WYYA 3IT9A 1ZHHB 1T18A 2QZ6A 2O0YA 3ZG5A 4LGWA 2V8FA 3ZG9B 4YWZA 5E2EA 1F9IA 4DJ3A 3UB8A 2QHKA 3IHBA 3T4SA 4N9KA 3FYZA 2ZQCA 4FSFA 3IBRA 1AWIA 4F94A 4KZ4A 1YMSA 3QP5A 3RXWA 1PWGA 4R6LA 4NETA 4Q0IA 4KZ5A 4BBTA 5IT5A 2Y2IA 5AJGA 5GHYA 4X6TA 2V1AA 1HVBA 3IXHA 2AVXA 3FG8A 2A3UA 2X71A 3E4OA 3W8KA 3O87A 2GDNA 4LLOB 4GHIA 4MMNA 4E3JA 5FQIA 4EUVA 5CECA 4JF5A 1CJFA 1N4OA 1K56A 1K6RA 4GLQA 4OPYA 3BY9A 4MDZA 2UV0E 4GN2A 5F6AA 3TSGA 3QP4A 3UE1A 4KUOA 4P6ZM 5FAPA 4FOFA 3LIFA 1MKIA 2EX6A 2XROA 2UWXA 3QP1A 4KENB 3E2LA 1JNUA 3G32A 2ZMFA 5DF9A 2XF3A 4P0MA 5M19A 4OPQA 3FPVA 5CEBA 1M6KA 4H6JB 5F82A 3TRCA 3BRMA 1TD5A 2WKEA 2WUQA 1F5MA 1Y54A 4MCWA 4G3WA 1JVJA 4OOMA 1E3UA 4JBFA 4PM6A 5TBMA 1XGIA 2RL3A 3A3EA 1TVFA 1ZC2A 1S6RA 3AGDA 3ZG0A 3HLGA 1YLZA 3S4XA 4CLCB 2K31A 3P01A 5FL3A 1FCOA 4K08A 3UB9A 1P97A 2XSSA 1AXBA 4L0LA 1TS6A 3HUNA 3SS5A 1ESUA 2ZM0A 4PAUA 3CITA 1STZA 2Z6CA 3BFEA 2JCHA 1JWPA 2Y2PA 3C30A 5A93A 5EECA 3LR4A 4NXFA 1FSWA 5HL1A 4GW9A 1MWRA 4X56A 3W2ZA 4N92A 4FH4A 1W8QA 3T50A 2JBFA 3IWIA 3KSGA 2JKTM 3EOIA 3N7WA 2VGLM 4XT2B 3V5MA 2OLVA 1S4SA 2ZC5B 1VEUA 2ZL1A 5FI2A 5DKKA 4DDYA 2Y2OA 3UY6A 1PI4A 3GTCA 3NECA 4B4XA 2D01A 4YNRA 1U60A 3VMAA 2WZXA 4WELA 4M4XA 2V20A 4JKTA 1IELA 1ZG4A 2PYRA 3Q82A 4F3LA 4KG5A 1IYQA 3UE0A 1IFQA 4E04A 4DRTA 3FV7A 3A3DA 3BECA 4E3NA 2OAQ1 1PZPA 3PBRA 1IYPA 3LUQA 4PKYG 1XP4A 4GD8A 2J9PA 1ONGA 3A0RA 4OPRA 3EEHA 4R3AA 3HREA 3OCLA 3WS4A 3TOIA 1DP9A 2HV1A 1H8ZA 3MSHA 3PTEA 4HJ6A 2D02A 3Q07A 3N6IA 1UGUA 2JKRM 1ERMA 3VE4A 4EEUA 3UB7A 3BEBA 2X02A 1YSQA 5GL9A 4YFMA 3GSGA 5F1FA 1Z6FA 3UNWA 2DCFA 3BFDA 1SDNA 4QWOA 1N9LA 2P04A 2J7VA 3BFFA 2VGJA 3G2YA 5HWWA 3KSIA 5DF8A 4QY5A 4YINA 3M6BA 5DFYA 1NLYA 4K0XA 4O01A 5MC7A 4JXGA 5FQJA 4X1MA 3RFBA 4KZAA 3HBRA 3V67A 1K55A 1LT0A 2OLUA 3QNCA 3BWLA 4X25A 2XA7M 5DFXA 4BD1A 3IXBA 3T1RA 4S2PA 2IWCA 1N9BA 2JC7A 4K0WA 4HBTA 3IBJA 2EWWA 3LEQA 3BLSA 2M7VA 3QP2A 4EWFA 2GZAA 4DXBA 3QHYA 2EXAA 3VP4A 1W7FA 3F1PA 5FATA 1K0KA 3OPHA 1CEGA 1S66L 1NYMA 4E6XA 3ZNTA 5J8XA 5I5LA 5EUAA 2H28A 2PBDP 4S2IA 4S2JA 5G4YA 1BLPA 1K6SA 3ZFZA 3ZNYA 5AQAA 4DE1A 4N1XA 4RX3A 4UAAA 4GHIB 5TR7A 5KSHA 1MWUA 1ES4A 3MXRA 3AGFA 1OTBA 1KOUA 2ZJ9A 4LV1A 3OC2A 1BLHA 4EBLA 1ES5A 1NZUA 3UPNA 4EQIA 4X68A 5GHZA 4WLAA 4GS9A 1ERQA 1NZOA 4KUKA 1N9OA 3UDFA 4S2MA 2OWHA 4KZ7A 1FIKA 2CC1A 4GNUA 4MLLA 2Q9MA 2W3GA 1ONHA 4G3KA 3TG9A 3C4PA 2ZQDA 1OJGA 4D60A 5CGXA 4PMAA 4JLFA 3HLWA 2CMNA 4PM7A 4GDNA 4RX2A 4NEED 3MJQA 4JGQA 4B88A 1S67L 4LPZA 4Y5FA 1I2WA 4KZ8A 3ZYTA 5LBRA 5GLBA 1XJ4A 1YT4A 1K4EA 5CTMA 4QHCA 1D7EA 3T4KA 3CPTB 4OP5A 4P6BA 2KLIA 1ACFA 3K3DA 3VFFA 4PPRA 5CGSA 1W79A 2PBYA 2WGIA 4O7DA 3IWQA 3D9YA 2H5SA 2V0UA 1DJAA 3LIBA 4LCMA 4IEDA 4S2NC 4HEFA 3EWKA 1G68A 4DN0A 4OOYA 1G28A 1CQAA 3PBQA 2HPBA 2ZOHA 1DRMA 3BFGA 3WRZA 3FC7A 1MXOA 4S2OA 3LEZA 4UA6A 5G18A 2V9AA 1TEMA 2PDRA 4RVAA 2O9BA 3KSFA 3IHAA 3BFCA 2HJ9C 2A24A 2G7UA 4OKPA 1SDEA 4H6JA 2W27A 1V9ZA 2ZC4B 4R4RA 4FCFA 1ES2A 1CK3A 3VSKA 4EBNA 4S2KA 3A3FA 3LICA 1K57A 3L9KA 1H8MA 5AQ9A 3TW8A 3NIAA 2XA7S 3CHWP 1GCEA 2ZM8A 3OOVA 3SOIA 5HL6A 2J9OA 1MWTA 1XKZA 3NBLA 2ZC6B 5L2FA 1XA1A 3O86A 4MNRA 3M6HA 1T1CA 3K2NA 4EESA 4IBRA 3CAXA 3C2WA 1Y4OA 1PW8A 3ZVWA 5HD5A 2VV7A 2JKTI 3JPUA 1F98A 2PR5A 2Y2GA 4G3VA 3RH8B 3UDIA 2O9AA 2JHEA 3UPPA 2WAFA 1CI8A 1E4DA 2Y2QA 3UB6A 1BYWA 1OTIA 5DF7A 4ZJ3A 3NOPC 5F69A 4KZ6A 1NRJA 3C7VA 3CLOA 1EI5A 3IS2B 3LCEA 3AGEA 1YLPA 3DBAA 3LR3A 1ZKJA 1JWVA 1XJ6A 5F68A 3OZHA 3E2KA 1OTEA 4UQIM 2WGVA 2C6WB 3P09A 5FAOA 3Q7ZA 3P98A 4JGPA 2K2NA 3G6OA 4HY8A 3VFHA 3W4PA 3S7QA 4KZBA 1RCJA 1SCWA 1K56D 2V2FF 4QPRA 2K7SA 1JTGA 4DJ2A 2EA9A 3HL9A 1UWPX 1JWZA 5I94A 1CEFA 3OPPA 3H9WA 5L10A 5HSQA 4LCLA 2G2UA 2INWA 4HJ4A 3KYQA 4WMCD 2W1TA 2XD1A 3LI8A 1J9MA 4MN7A 4Q0HA 5HAIA 2WGWA 2DRWA 3LY3A 1DP6A 4Z9QA 3W4OA 3ZHHA 3ZDJA 5HDDA 2Y4AA 3HVFA 4ZRRA 1TDLA 5EVIB 1YLYA 5FEGA 2W3HA 1XX2A 5HZHA 5IS1A 4WZ5A 1L0DA 2Y2KA 1GHIA 3MZEA 4JGRA 4MBFA 4HHDA 4I38A 3F1PB 1OT9A 4UA9A 4HH2A 3M2KA 4EQ1A 3JYIA 4RQ9A 3EEAA 3CPTA 4CQHA 4HESA 4HI4A 1G6OA 3BJNA 5M18A 3BW6A 4XUZA 1KE3A 2QPNA 1BTLA 3GR2A 1RP5A 3O5YA 3D4FA 5E2HA 5IU1A 3D3OA 2J3TD 4IHQA 4CLCA 3MXQA 2MJ6A 2HJEA 2B95A 3ULFA 1BT5A 2KOIA 4Y3IA 3I7JA 5CHJA 1J3WA 1LL5A 4PM9A 1VB6A 5GLDA 4GJ4A 1LHYA 2VZWA 4CLCE 4ETXA 4OLGA 3B33A 4NG2A 3T4LA 4KZ9A 1TS7A 3B3XA 3NCKA 4FUWA 3G31A 1NYYA 2Y2HA 3RJUA 4B4ZA 3N4IA 5J4EA 2XFTA 3HLDA 2OV5A 3E98A 4OQ0A 3A3IA 5IHVA 3KO6A 1L0FA 1ALQA 1C3BA 2Y8HA 4EU0A 5D3OA 2QMIA 3RXXA 1ZG6A 3LY4A 2LB5A 5CRFA 2HDUA 1NLZA 1WYBA 1T1BA 4ETZA 4ME4A 1PW1A 3Q7VB 3PR6A 1LSXA 5EOOA 3JVVA 3C5AA 1TDGA 2BLSA 1Z09A 5FSRA 1CF0A 1KGFA 4JF6A 3CI6A 4LRXC 1MC0A 3HJKA 2Y79A 2VEAA 3SS3A 1YKDA 4EUZA 3PYPA 1PWDA 3UDXA 1UWNX 1W63M 1X0OA 1JTDA 2QYBA 1XFNA 1NWZA 4U0TA 1Q2QA 2H10A 3V3SA 1Q2PA 2EX2A 1HD8A 5TJJA 3Q81A 4L9GA 4DE2A 2WZZA 1YM1A 4UEYA 1LL9A 1D1JA 1N9NA 2NUPC 3NHQA 3B47A 3S1YA 3A0VA 3PHYA 4S2LA 1XJ3A 2WKPA 1XGJA 1LLBA 3FKWA 2BTFP 2OOLA 2V1BA 2JKFA 5CEDA 3UB5P 2W3DA 2XGNA 4OQIA 3HLEA 1L2SA 1ESIA 3DW0A 4R38A 3F1NB 1BSGA 3LIEA 3V39A 4WF0A 4X55A 1W63Q 2X01A 2WKQA 2ZQAA 2ZBBA 2EX9A 3DWKA 1S0WA 4QJGA 5JYPA 1BULA 1SKFA 5AQBA 5TFQA 4R3JA 2FZ0A 2J3WA 1ODVA 2PYPA 3T4JA 1YLJA 2PHYA 4P85A 3HJIA 4WEJA 3IX8A 1EWZA 4II7A 4OPZA 5F1GA 1G5UA 3LGOA 3IF6A
chains in the Genus database with same CATH topology
2VV8A 2QWSA 3H7WB 3LICA 3OCNA 4NXEA 4LLOB 4GHIA 4IJGA 4MMNA 2PT7A 4P6ZS 4EUVA 3EQUA 1H8MA 3TW8A 2O99A 2JN7A 2XA7S 2BASA 4GLQA 3BY9A 2J80A 4MDZA 2OAP1 5F6AA 1H3QA 4O8GA 3OOVA 5HL6A 4KUOA 2VV6A 3GECA 4P6ZM 5EFWA 3VV4A 5KIZA 4FOFA 3PBOA 2QKPA 2IA2A 3LIFA 1T1CA 3T4QA 3K2NA 2XROA 3R4KA 3ICYA 4BMWA 4EESA 3CUEA 3CAXA 4HNBA 2VGLS 3C2WA 1JNUA 4AFIA 2ZMFA 5DF9A 2VJWA 4HP4A 5HDSA 5J3WA 5HD5A 4HQAA 2ZOIA 1LSVA 2VV7A 3FPVA 2HF6A 2Z6DA 2JKTI 3LYXA 1F98A 2PR5A 4H6JB 3TRCA 2JKRI 1TD5A 1F5MA 4G3VA 4MCWA 3FPWA 1VHMA 3RH8B 4G3WA 4OOMA 2O9AA 3PBSA 1TS0A 5TBMA 3JVUA 2JHEA 5HWTA 3C38A 3H7WA 3R7WA 3MMHA 3CUEC 3UB6A 1V9YA 1BYWA 1OTIA 1LSWA 4MN6A 4ARZB 3S7OA 3NOPC 5F69A 4CLCB 1EW0A 4EEPA 1NRJA 1MKMA 3BY8A 2K31A 2W3EA 3CLOA 3P01A 5FL3A 2PD7A 3IS2B 4Q0JA 3P7NA 5HWVA 2W1TB 3DBAA 4K08A 3LIDA 3MFXA 1P97A 3LR3A 3UB9A 4EW7A 2XSSA 1XJ6A 3T4TA 5F68A 4I39A 3B42A 4L0LA 1TS6A 3NOUC 2QJ5A 5C5KA 4CLCC 1GSXA 1OTEA 4EXOA 4UQIM 4PAUA 1D06A 3CITA 1STZA 2Z6CA 4MN5A 1GSWA 4HH3A 2B18A 4IUKA 4NXGA 4Y2FA 3C30A 5AVFA 3S7NA 2W1RA 4JGPA 2WKRA 4BJPA 2K2NA 3F1OB 3LR4A 4NXFA 3G6OA 4GW9A 2M7UA 4HY8A 3W2ZA 1TF1A 3S7QA 5L8MA 3T50A 4QPRA 3KSGA 2K7SA 1LL8A 3UMDA 2JKTM 4DJ2A 3EOIA 1P0ZA 2LB9A 3MQ0A 5CX7A 2VGLM 2EA9A 4XT2B 3SW1A 2VA0A 5DKLA 1S4SA 1UWPX 3KSHA 5DKKA 2W3FA 2GJ3A 3H9WA 5HSQA 2D01A 4YNRA 3E4QA 4I3JA 3LIAA 4WEKA 3PXPA 2V0WA 3IS2A 2INWA 4HJ4A 4WL9A 4WELA 3KYQA 5DJTA 4B93A 5A8BA 4M4XA 5AVEA 2W1TA 3UE3A 2VX8A 4HIAA 4EETB 3LI8A 2PYRA 4GS9B 4F3LA 4MN7A 1IFQA 4Q0HA 4E04A 4NXBA 3HCYA 3T4OA 1DP6A 5G4ZA 1S1ZA 2M1CA 2O9CA 2OAQ1 1XJ2A 5HDDA 4DMZA 3PBRA 3LUQA 4PKYG 4BBVA 3PBNA 4I3IA 4ZRRA 4LRZE 2GX5A 3A0RA 1P9RA 3EEHA 4R3AA 3OCLA 1DP9A 2HV1A 2W3HA 4L9EA 4HJ6A 5HZHA 5IS1A 2D02A 2KDKA 1OT6A 3LI9A 3OLOA 1UGUA 2JKRM 4PKYA 3VE4A 4JGRA 4EEUA 3UB7A 4HHDA 4I38A 1OPXA 1YSQA 3F1PB 4XT2A 1OT9A 4HH2A 3BQ8A 4EQ1A 4R70A 4RQ9A 1WA9A 5K5BA 3EEAA 3UE6A 1S4RA 1N9LA 4CQHA 2P04A 1YSPA 5HWWA 1XFQA 1G6OA 2DMWA 4HI4A 3BJNA 3BW6A 3KSIA 5DFYA 4LRYC 3O5YA 1NLYA 4O01A 5DJUA 3R7WB 5J7EA 5MC7A 5IU1A 3D3OA 4YOFA 2J3TD 4IHQA 4ARZA 3K3CA 3MXQA 4CLCA 3F1NA 3RFBA 2MJ6A 2YKFA 2HJEA 3ULFA 2QJ7A 1OTDA 3V67A 2OWJA 2KOIA 4I3AA 1LT0A 2R78A 2J3TC 3BWLA 3EGDC 4Y3IA 5HPFA 2XA7M 1VB6A 5DFXA 4BBUA 3EQVA 1T19A 4GJ4A 2VZWA 4CLCE 5HD3A 4ETXA 3ZQ5A 3IBJA 2EWWA 3B33A 4O0PA 2M7VA 4Z1WA 3T4LA 3TJZC 1TS7A 2HGVA 1OJ5A 3VOLA 2GZAA 5J4EA 3F1PA 3E98A 3E4PA 1S66L 3KO6A 2Y8HA 4EU0A 5I5LA 2B02A 2LB5A 2H28A 4WN5A 5G4YA 3D72A 1NLZA 1T1BA 4ETZA 3LR5A 4ME4A 2VKSA 1MZUA 4KQOA 1DP8A 3PR6A 4GHIB 5HDCA 5KSHA 3OBFA 1LSXA 3VE3A 1GSVA 3MQQA 3JVVA 2GNXA 1OTBA 2W0NA 1T1AA 1KOUA 3S7PA 2A2LA 3LR0A 3OC2A 2I9VA 4EERA 3CI6A 4LRXC 1OTAA 3EGXC 1MC0A 1Y28A 4L9FA 3KX0X 4WLAA 3HJKA 4GS9A 2FH5A 2Y79A 3RTYA 2VEAA 4F3LB 1YKDA 4IUHA 4KUKA 1N9OA 1TS8A 2PR6A 3PYPA 3KYZA 2OWHA 3LFVA 1P9WA 1W63M 1UWNX 3U2AA 1X0OA 3H82B 2QYBA 1XFNA 2W3GA 1NWZA 4OOLA 4G3KA 3MF0A 5TJJA 2P7JA 2L4RA 4L9GA 1OJGA 2PD8A 3E0YA 4UEYA 3TE8A 3NJAA 2CMNA 4BWIA 1N9NA 2XRNA 2YKHA 2ZMVA 2NUPC 3NHQA 2KX6A 3B47A 4HJ3A 4NEED 3A0VA 3MR0A 3PHYA 4JGOA 3MJQA 4JGQA 4B9OA 3NOTC 2L1MA 5HPIA 3CWFA 1S67L 1XJ3A 2A24B 1S1YA 2WKPA 4LPZA 4Y5FA 5TBMB 3ZYTA 2VLGA 3A0SA 2NUTC 5LBRA 4HOIA 1XJ4A 3GDIA 2OOLA 2V1BA 1D7EA 3T4KA 1YAXA 1IOUA 3MQOA 2P08A 2KLIA 3K3DA 1ZTUA 2W3DA 3C8CA 3UMEA 4WUJA 4R38A 2EWVA 1ZHHB 1T18A 2O0YA 3F1NB 2V0UA 3LIEA 4UQIS 4NKPA 3PBTA 3LIBA 2L0WA 4WF0A 3EWKA 1W63Q 3H82A 4DN0A 4CLCD 4YWZA 2WKQA 1F9IA 4DJ3A 1G28A 3UB8A 4KQDA 3PBQA 2ZBBA 2ZOHA 1DRMA 4PHTA 2QHKA 3T4SA 3F1OA 3FC7A 4FSFA 3IBRA 2V9AA 2PDRA 2O9BA 3KSFA 2FZ0A 2J3WA 5F5YA 3BQAA 1ODVA 4GCZA 2PYPA 2HJ9C 3T4JA 4R6LA 2A24A 2G7UA 4Q0IA 2PHYA 4BBTA 5IT5A 4H6JA 5AJGA 2V1AA 3HJIA 4WEJA 2W27A 1V9ZA 4I5SA 3FG8A 4HP9A 4II7A 3E4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXG A;  2VV8 A;  5AVF A;  2P7J A;  2L4R A;  4JGP A;  2WKR A;  1OJG A;  4L9G A;  2QWS A;  3H7W B;  4LRY C;  3F1O B;  2PD8 A;  3LIC A;  4NXF A;  5DJU A;  4F3L B;  5J7E A;  4NXE A;  5IS1 A;  3G6O A;  4GW9 A;  5IU1 A;  4HY8 A;  4GHI A;  4LLO B;  3NJA A;  2CMN A;  1N9N A;  2YKH A;  3K3C A;  3MXQ A;  3NHQ A;  3F1N A;  2KX6 A;  2YKF A;  3ULF A;  4HJ3 A;  2QJ7 A;  3A0V A;  3MR0 A;  1OTD A;  2JN7 A;  2OWJ A;  3PHY A;  4I3A A;  1LT0 A;  2R78 A;  2BAS A;  3MJQ A;  4JGO A;  3T50 A;  2K7S A;  1LL8 A;  3BWL A;  4JGQ A;  4B9O A;  3NOT C;  3BY9 A;  2J80 A;  2L1M A;  3UMD A;  3CWF A;  1XJ3 A;  2A24 B;  1S67 L;  1S1Y A;  1P0Z A;  1VB6 A;  2WKP A;  4LPZ A;  5F6A A;  5TBM B;  4DJ2 A;  2EA9 A;  4XT2 B;  4BBU A;  2VLG A;  1T19 A;  3A0S A;  3SW1 A;  5DKL A;  4KUO A;  1S4S A;  2VV6 A;  3GEC A;  4HOI A;  1XJ4 A;  3GDI A;  1UWP X;  5EFW A;  2OOL A;  2V1B A;  5DKK A;  5HD3 A;  3ZQ5 A;  5KIZ A;  2QKP A;  3B33 A;  1D7E A;  3LIF A;  2GJ3 A;  1T1C A;  3H9W A;  3MQO A;  5HSQ A;  2D01 A;  3K3D A;  1TS7 A;  3ICY A;  3E4Q A;  4I3J A;  4EES A;  3LIA A;  3CAX A;  1OJ5 A;  4HNB A;  3C2W A;  1JNU A;  2V0W A;  3VOL A;  3C8C A;  3IS2 A;  2INW A;  4HJ4 A;  4WL9 A;  5DJT A;  3UME A;  4WUJ A;  4HP4 A;  5A8B A;  4M4X A;  4R38 A;  5HDS A;  5AVE A;  4EW7 A;  5J3W A;  5HD5 A;  5J4E A;  4HQA A;  2ZOI A;  4HIA A;  4EET B;  1LSV A;  2VV7 A;  3F1P A;  3LI8 A;  4HH3 A;  2PYR A;  2Z6D A;  1T18 A;  3LYX A;  3F1N B;  1F98 A;  2PR5 A;  4GS9 B;  4H6J B;  3E4P A;  3UB9 A;  4F3L A;  2V0U A;  3LIE A;  4E04 A;  1S66 L;  4NXB A;  3LIB A;  2L0W A;  1DP6 A;  5G4Z A;  3RH8 B;  4WF0 A;  1S1Z A;  5I5L A;  4MN5 A;  2B02 A;  2M1C A;  2H28 A;  3EWK A;  3H82 A;  1XJ2 A;  5HDD A;  1TS0 A;  5TBM A;  4WN5 A;  5G4Y A;  4YWZ A;  3LUQ A;  2WKQ A;  4PKY G;  3D72 A;  1F9I A;  2JHE A;  1G28 A;  4I3I A;  4KQD A;  3UB8 A;  4LRZ E;  4BBV A;  2ZBB A;  2ZOH A;  1T1B A;  1DRM A;  5HWT A;  2QHK A;  1MZU A;  3H7W A;  3A0R A;  3EEH A;  3F1O A;  3FC7 A;  4R3A A;  3UB6 A;  1DP9 A;  1V9Y A;  1BYW A;  2HV1 A;  1OTI A;  1DP8 A;  4GHI B;  5HDC A;  1LSW A;  4MN6 A;  1LSX A;  4L9E A;  3VE3 A;  1GSV A;  4HJ6 A;  5HZH A;  2D02 A;  2KDK A;  3IBR A;  1OT6 A;  3LI9 A;  1EW0 A;  2V9A A;  2PDR A;  3MQQ A;  3NOP C;  3OLO A;  3BY8 A;  5F69 A;  4EEP A;  1UGU A;  1OTB A;  2W0N A;  1T1A A;  3CLO A;  1KOU A;  4PKY A;  5F5Y A;  3VE4 A;  1ODV A;  2PD7 A;  3IS2 B;  4JGR A;  4EEU A;  2I9V A;  4GCZ A;  2PYP A;  4HHD A;  3UB7 A;  3P7N A;  4EER A;  5HWV A;  4I38 A;  4R6L A;  4LRX C;  2A24 A;  4K08 A;  1OTA A;  3LID A;  3F1P B;  1P97 A;  1Y28 A;  3MFX A;  4L9F A;  2PHY A;  3KX0 X;  4XT2 A;  1OT9 A;  4WLA A;  4BBT A;  3HJK A;  4GS9 A;  4H6J A;  3RTY A;  4DJ3 A;  2VEA A;  1XJ6 A;  4HH2 A;  4KUK A;  2V1A A;  3HJI A;  4I39 A;  5F68 A;  4R70 A;  4EQ1 A;  1N9O A;  2W27 A;  1TS8 A;  2PR6 A;  3PYP A;  4RQ9 A;  1WA9 A;  1V9Z A;  1TS6 A;  4I5S A;  2OWH A;  3FG8 A;  3NOU C;  1UWN X;  2QJ5 A;  1S4R A;  3UE6 A;  1N9L A;  1X0O A;  1GSX A;  1OTE A;  4HP9 A;  4EXO A;  3H82 B;  5HWW A;  1XFQ A;  4HI4 A;  1D06 A;  1XFN A;  2Z6C A;  1NWZ A;  1GSW A;  3E4O A; 
#chains in the Genus database with same CATH topology
 1VM1 A;  2VV8 A;  4R0Q A;  3N8R A;  3OCN A;  4NXE A;  1HZO A;  2PT7 A;  4P6Z S;  5A92 A;  3SZT A;  5KSC A;  2O99 A;  2JN7 A;  4M3K A;  2BAS A;  4Y0O A;  5EM0 A;  1W5D A;  5HX9 A;  5A90 A;  1PWC A;  2Q0O A;  2VV6 A;  3GEC A;  5HW3 A;  4GZB A;  4HBU A;  5EVI A;  2IWD A;  3G4P A;  2HDQ A;  3PBO A;  2IA2 A;  1GA9 A;  3T4Q A;  3R4K A;  4BEN A;  4OQH A;  4FH2 A;  1KDW A;  4MBH A;  5HAQ A;  2EFU A;  2VJW A;  3N8L A;  4HP4 A;  5HDS A;  5J3W A;  1K54 A;  4DF6 A;  2Z6D A;  5EM1 A;  4N1H A;  4OQG A;  3FPW A;  5E43 A;  5CER A;  3PBS A;  1TS0 A;  4R4S A;  5FI6 A;  5HFO A;  5HWT A;  3C38 A;  2PAV P;  3H7W A;  5M1A A;  3MMH A;  3CUE C;  1V9Y A;  3V50 A;  1EW0 A;  4EEP A;  1MKM A;  1NRF A;  4E3I A;  1HLU P;  4Q0J A;  3DTI A;  5HWV A;  2W1T B;  4Y0T A;  2WAD A;  3G30 A;  4ZTK A;  3LID A;  3MFX A;  2OSU A;  1H0M A;  2HP5 A;  3T4T A;  4I39 A;  1K25 A;  3MKF A;  3HLC A;  3HLB A;  2QJ5 A;  5C5K A;  4CLC C;  1GHP A;  2XR0 A;  4EXO A;  1NXY A;  1GSW A;  4HH3 A;  2B18 A;  3SH8 A;  4NXG A;  4Y2F A;  5AVF A;  3S7N A;  4NK3 A;  2WKR A;  3F1O B;  4GOG A;  4R1G A;  1SZV A;  2M7U A;  1KE0 A;  2XK1 A;  4H8R A;  4WZ4 A;  1DJC A;  3VP3 A;  5L8M A;  1LL8 A;  4GB7 A;  1P0Z A;  2A49 A;  3CG5 A;  3MQ0 A;  1FCN A;  4D2O A;  3LO7 A;  3SW1 A;  2VA0 A;  2V8C A;  3VP1 A;  4BQM A;  3KSH A;  5L09 A;  3WS0 A;  3Q7V A;  3E4Q A;  1SKO B;  4I3J A;  4JPM A;  4UHU A;  1NY0 A;  5A91 A;  1LI9 A;  3PXP A;  2Y2N A;  3IS2 A;  4WL9 A;  5DJT A;  5FAQ A;  4B93 A;  1I5Q A;  2VX8 A;  1IYO A;  3FKV A;  2JKG A;  4HIA A;  4EET B;  3IH8 A;  4S2N A;  1L0E A;  3CMZ A;  3DTE A;  2ZC7 A;  5G4Z A;  2C5W B;  3CZD A;  1S1Z A;  5EV0 A;  2M1C A;  4E3O A;  1XJ2 A;  1QMF A;  4DMZ A;  4I3I A;  4LRZ E;  5GLC A;  3PAE A;  2GX5 A;  1BZA A;  5L07 A;  1DY6 A;  1P9R A;  4OLD A;  4WMC A;  4GDB A;  4L9E A;  2KDK A;  1BLC A;  1BLS A;  4QY6 A;  5CTN A;  2Z2L B;  3UO9 A;  5BOH A;  3IQA A;  3NDE A;  4X53 A;  3IWO A;  5FEF A;  5K5B A;  5AQ7 A;  4ZDX A;  1S4R A;  4U0X A;  1YSP A;  1XFQ A;  2DMW A;  3DTM A;  5EVE A;  1FR6 A;  3DTK A;  1GHM A;  5TGF A;  3FWL A;  3R7W B;  5J7E A;  2PU4 A;  3CJM A;  4YOF A;  1XXM A;  4ARZ A;  3W4Q A;  3K3C A;  3F1N A;  5EVL A;  5HAR A;  1OTD A;  4I3A A;  2R78 A;  3S22 A;  2G2W A;  3EGD C;  3GMW A;  2Y59 A;  3DAV A;  5HPF A;  1H8Y A;  1MBL A;  5KMW A;  5KZH A;  3EQV A;  1T19 A;  4LFU A;  1F2K A;  4JXW A;  3ZQ5 A;  4DDS A;  2ZQ9 A;  4O0P A;  4Z1W A;  4RA7 A;  3TJZ C;  5FDS A;  1IKI A;  3VSL A;  2HGV A;  1OJ5 A;  4C75 A;  2ZQ8 A;  5CGW A;  4LV3 A;  2P9V B;  4JXV A;  3QP8 A;  3T12 B;  4KQR A;  4BL3 A;  1XA7 A;  5DTS A;  3HUO A;  2VKS A;  1MZU A;  1FOF A;  4KQO A;  4X1L A;  1DP8 A;  2Y2L A;  3OBF A;  1WE4 A;  3MQQ A;  3BM6 A;  3MZD A;  2GNX A;  4N9L A;  2WKI A;  3VOZ A;  3S7P A;  2A2L A;  2I9V A;  5U47 A;  3VOY A;  4EER A;  2ZQ7 A;  1OTA A;  1Y28 A;  4L9F A;  3RTY A;  3GV9 A;  1IKG A;  2HP6 A;  2RCX A;  2WGW B;  3PAG A;  4IUH A;  3WS2 A;  3FZC A;  1TS8 A;  2PR6 A;  1P9W A;  3MZF A;  3NDG A;  3HLF A;  4DKI A;  3MF0 A;  2L4R A;  4RYE A;  2PD8 A;  2EXB A;  3E0Y A;  3MKE A;  4Y15 A;  3UN7 A;  3BLM A;  4MBK A;  3NJA A;  2ZMV A;  2YKH A;  4WBG A;  2KX6 A;  4HJ3 A;  2ACG A;  2XFS A;  4JGO A;  4IBX A;  2R9W A;  1KVM A;  1FSY A;  2L1M A;  2E8I A;  1S1Y A;  5TBM B;  4MEZ A;  2NUT C;  3WS1 A;  4HOI A;  5GHX A;  3WWX A;  1YAX A;  3GVB A;  4CPK A;  1ZTU A;  3G35 A;  2JE5 A;  5EVI D;  3C8C A;  3GRJ A;  1VET A;  3QNB A;  3HUM A;  3UME A;  3WS5 A;  3T1Q B;  2EWV A;  3MS6 A;  5EPH A;  4C3Q A;  1CI9 A;  2WAE A;  3QP6 A;  4ID4 A;  1RGY A;  2XDM A;  4UQI S;  4NKP A;  3PBT A;  3V3R A;  2L0W A;  4Y17 A;  5EE8 A;  3H82 A;  4CLC D;  1I2S A;  2H0Y A;  4KQD A;  3IX3 A;  1MWS A;  1PRQ A;  4PHT A;  1MY8 A;  3MBZ A;  5FQ9 A;  3F1O A;  4XXR A;  2VGK A;  2HDR A;  2V1Z A;  1KGG A;  4E3K A;  4Y0U A;  5F5Y A;  3BQA A;  2ZM2 A;  4GCZ A;  4ZAM A;  3MXS A;  4BL2 A;  1K4F A;  2WYX A;  1FQG A;  4EV4 A;  4X69 A;  4I5S A;  1PIO A;  2WKH A;  2FFF B;  4HP9 A;  3G34 A;  1IYS A;  1NJ4 A;  1SKO A;  1PI5 A;  1E3U D;  4QD4 A;  3N8S A;  1SHV A;  2QWS A;  3H7W B;  3C4O A;  3O3V A;  4IJG A;  4KG2 A;  4PM8 A;  3NI9 A;  3EQU A;  4FD8 A;  3GQZ A;  5E2F A;  4GD6 A;  4BLM A;  2J80 A;  3T1S A;  1O7E A;  4LEN A;  4QB8 A;  2OAP 1;  1K57 C;  1H3Q A;  4O8G A;  3VP2 A;  5E2G A;  1ES3 A;  5EFW A;  3VV4 A;  5FAS A;  5KIZ A;  2QKP A;  4E6W A;  1K38 A;  3ICY A;  4BMW A;  1OME A;  3CUE A;  4HNB A;  2VGL S;  4A5R A;  4AFI A;  1A0K A;  4ESP A;  5FI7 A;  4HQA A;  2ZOI A;  1LSV A;  2HF6 A;  3LYX A;  4GKU A;  5DVA A;  2JKR I;  5F83 A;  5FDH A;  1VHM A;  2I72 A;  1KGE A;  3IF5 A;  3ZGA B;  3JVU A;  1GA0 A;  1HTZ A;  2ZL1 B;  3MFD A;  3NY4 A;  5FQM A;  4KZ3 A;  3R7W A;  2IWB A;  1LSW A;  4MN6 A;  4ARZ B;  3S7O A;  3T1X A;  2B5R A;  3BY8 A;  2W3E A;  2PD7 A;  5EVI C;  3P7N A;  2XEP A;  1IEM A;  4EW7 A;  2ZMA A;  3B42 A;  1K55 C;  3NUL A;  3NOU C;  1GSX A;  1D06 A;  4MN5 A;  1RGZ A;  4IUK A;  4BJP A;  2W1R A;  3C7U A;  4IVK A;  5DTK A;  1TF1 A;  5EOE A;  4ZJ2 A;  1BUE A;  4ZBE A;  3UMD A;  2LB9 A;  5CX7 A;  2HDS A;  5DKL A;  2XLN A;  3IH9 A;  2HP9 A;  4QU3 A;  3BYD A;  4OP8 A;  3ITB A;  2W3F A;  2GJ3 A;  5HAP A;  3ITA A;  2HZ5 A;  3IF6 B;  4CJN A;  3LIA A;  4WEK A;  1KVL A;  2V0W A;  5A8B A;  3OPL A;  4E3M A;  2ZLY A;  5AVE A;  3UE3 A;  4GS9 B;  1E25 A;  3HCY A;  4NXB A;  3T4O A;  4PM5 A;  4DXC A;  4Q8I A;  1PFL A;  3A3J A;  3KYE A;  2O9C A;  4ZJ1 A;  4JXS A;  4BBV A;  3PBN A;  3U4L P;  1W8Y A;  1FIL A;  3IXG A;  4KG6 A;  1OT6 A;  3LI9 A;  3OLO A;  1FCM A;  4PKY A;  2Z2M B;  4EBP A;  1LI0 A;  3ZVT A;  2P9V A;  3M2J A;  1OPX A;  2E8J A;  2H0T A;  4XT2 A;  5JYO A;  1WYC A;  3BQ8 A;  3WRT A;  1VEU B;  4R70 A;  1WA9 A;  3UE6 A;  2PRF A;  1KDS A;  2PU2 A;  1DJB A;  2VK3 A;  3IX4 A;  4LRY C;  1VQQ A;  5DJU A;  2J8Y A;  5CXW A;  5FA7 A;  1YPR A;  2YKF A;  2QJ7 A;  2OWJ A;  2J3T C;  4R3B A;  5FQK A;  3SH9 A;  3UPO A;  1YLW A;  4BBU A;  1YLT A;  3NC8 A;  3Q1F A;  5HD3 A;  1L0G A;  5CHM A;  2Y2J A;  3IF6 C;  1PYY A;  4XUX A;  1KE4 A;  3VOL A;  4KQQ A;  3SS4 A;  2P74 A;  4BD0 A;  4Y7P A;  4OON A;  2Y2M A;  5FQQ A;  3SH7 A;  2ZC3 B;  3E4P A;  2Y55 A;  2FFY A;  4K91 A;  1PNE A;  2B02 A;  1K54 C;  4WN5 A;  1QME A;  2DNS A;  4LV2 A;  3D72 A;  3O88 A;  3L7H A;  4FTX A;  3LR5 A;  1M40 A;  5DTT A;  3ZG8 B;  3VP0 A;  1YMX A;  5HDC A;  4WM9 A;  3VE3 A;  1GSV A;  5CHU A;  3ZG7 B;  1ERO A;  4IVI A;  2WK0 A;  2XQZ A;  2W0N A;  4C6Y A;  4E3L A;  1T1A A;  2R9X A;  3LR0 A;  1VET B;  4LV0 A;  2EX8 A;  2Q9N A;  3EGX C;  3KX0 X;  4F3L B;  2FH5 A;  4DE0 A;  4UA7 A;  3IXD A;  3KYZ A;  2EFX A;  4U3T A;  3LFV A;  1XPB A;  3U2A A;  2XH9 A;  3H82 B;  4OOL A;  1L3L A;  2P7J A;  4R23 A;  1MPL A;  1G6A A;  3TE8 A;  4BWI A;  2XRN A;  4Y13 A;  3MR0 A;  3G2Z A;  3ZCZ A;  3DWZ A;  4B9O A;  3NOT C;  1PZO A;  3ISG A;  2XD5 A;  5HPI A;  3CWF A;  2A24 B;  2VLG A;  3A0S A;  4JF4 A;  1O07 A;  3GDI A;  2BG1 A;  4P87 A;  2Y91 A;  1FR1 A;  4DE3 A;  4WZ5 C;  1IOU A;  3MQO A;  2P08 A;  4OVD A;  1YQS A;  4OH0 A;  5GLA A;  1H5X A;  2ZD8 A;  3OPR A;  4WUJ A;  4WYY A;  3IT9 A;  1ZHH B;  1T18 A;  2QZ6 A;  2O0Y A;  3ZG5 A;  4LGW A;  2V8F A;  3ZG9 B;  4YWZ A;  5E2E A;  1F9I A;  4DJ3 A;  3UB8 A;  2QHK A;  3IHB A;  3T4S A;  4N9K A;  3FYZ A;  2ZQC A;  4FSF A;  3IBR A;  1AWI A;  4F94 A;  4KZ4 A;  1YMS A;  3QP5 A;  3RXW A;  1PWG A;  4R6L A;  4NET A;  4Q0I A;  4KZ5 A;  4BBT A;  5IT5 A;  2Y2I A;  5AJG A;  5GHY A;  4X6T A;  2V1A A;  1HVB A;  3IXH A;  2AVX A;  3FG8 A;  2A3U A;  2X71 A;  3E4O A;  3W8K A;  3O87 A;  2GDN A;  4LLO B;  4GHI A;  4MMN A;  4E3J A;  5FQI A;  4EUV A;  5CEC A;  4JF5 A;  1CJF A;  1N4O A;  1K56 A;  1K6R A;  4GLQ A;  4OPY A;  3BY9 A;  4MDZ A;  2UV0 E;  4GN2 A;  5F6A A;  3TSG A;  3QP4 A;  3UE1 A;  4KUO A;  4P6Z M;  5FAP A;  4FOF A;  3LIF A;  1MKI A;  2EX6 A;  2XRO A;  2UWX A;  3QP1 A;  4KEN B;  3E2L A;  1JNU A;  3G32 A;  2ZMF A;  5DF9 A;  2XF3 A;  4P0M A;  5M19 A;  4OPQ A;  3FPV A;  5CEB A;  1M6K A;  4H6J B;  5F82 A;  3TRC A;  3BRM A;  1TD5 A;  2WKE A;  2WUQ A;  1F5M A;  1Y54 A;  4MCW A;  4G3W A;  1JVJ A;  4OOM A;  1E3U A;  4JBF A;  4PM6 A;  5TBM A;  1XGI A;  2RL3 A;  3A3E A;  1TVF A;  1ZC2 A;  1S6R A;  3AGD A;  3ZG0 A;  3HLG A;  1YLZ A;  3S4X A;  4CLC B;  2K31 A;  3P01 A;  5FL3 A;  1FCO A;  4K08 A;  3UB9 A;  1P97 A;  2XSS A;  1AXB A;  4L0L A;  1TS6 A;  3HUN A;  3SS5 A;  1ESU A;  2ZM0 A;  4PAU A;  3CIT A;  1STZ A;  2Z6C A;  3BFE A;  2JCH A;  1JWP A;  2Y2P A;  3C30 A;  5A93 A;  5EEC A;  3LR4 A;  4NXF A;  1FSW A;  5HL1 A;  4GW9 A;  1MWR A;  4X56 A;  3W2Z A;  4N92 A;  4FH4 A;  1W8Q A;  3T50 A;  2JBF A;  3IWI A;  3KSG A;  2JKT M;  3EOI A;  3N7W A;  2VGL M;  4XT2 B;  3V5M A;  2OLV A;  1S4S A;  2ZC5 B;  1VEU A;  2ZL1 A;  5FI2 A;  5DKK A;  4DDY A;  2Y2O A;  3UY6 A;  1PI4 A;  3GTC A;  3NEC A;  4B4X A;  2D01 A;  4YNR A;  1U60 A;  3VMA A;  2WZX A;  4WEL A;  4M4X A;  2V20 A;  4JKT A;  1IEL A;  1ZG4 A;  2PYR A;  3Q82 A;  4F3L A;  4KG5 A;  1IYQ A;  3UE0 A;  1IFQ A;  4E04 A;  4DRT A;  3FV7 A;  3A3D A;  3BEC A;  4E3N A;  2OAQ 1;  1PZP A;  3PBR A;  1IYP A;  3LUQ A;  4PKY G;  1XP4 A;  4GD8 A;  2J9P A;  1ONG A;  3A0R A;  4OPR A;  3EEH A;  4R3A A;  3HRE A;  3OCL A;  3WS4 A;  3TOI A;  1DP9 A;  2HV1 A;  1H8Z A;  3MSH A;  3PTE A;  4HJ6 A;  2D02 A;  3Q07 A;  3N6I A;  1UGU A;  2JKR M;  1ERM A;  3VE4 A;  4EEU A;  3UB7 A;  3BEB A;  2X02 A;  1YSQ A;  5GL9 A;  4YFM A;  3GSG A;  5F1F A;  1Z6F A;  3UNW A;  2DCF A;  3BFD A;  1SDN A;  4QWO A;  1N9L A;  2P04 A;  2J7V A;  3BFF A;  2VGJ A;  3G2Y A;  5HWW A;  3KSI A;  5DF8 A;  4QY5 A;  4YIN A;  3M6B A;  5DFY A;  1NLY A;  4K0X A;  4O01 A;  5MC7 A;  4JXG A;  5FQJ A;  4X1M A;  3RFB A;  4KZA A;  3HBR A;  3V67 A;  1K55 A;  1LT0 A;  2OLU A;  3QNC A;  3BWL A;  4X25 A;  2XA7 M;  5DFX A;  4BD1 A;  3IXB A;  3T1R A;  4S2P A;  2IWC A;  1N9B A;  2JC7 A;  4K0W A;  4HBT A;  3IBJ A;  2EWW A;  3LEQ A;  3BLS A;  2M7V A;  3QP2 A;  4EWF A;  2GZA A;  4DXB A;  3QHY A;  2EXA A;  3VP4 A;  1W7F A;  3F1P A;  5FAT A;  1K0K A;  3OPH A;  1CEG A;  1S66 L;  1NYM A;  4E6X A;  3ZNT A;  5J8X A;  5I5L A;  5EUA A;  2H28 A;  2PBD P;  4S2I A;  4S2J A;  5G4Y A;  1BLP A;  1K6S A;  3ZFZ A;  3ZNY A;  5AQA A;  4DE1 A;  4N1X A;  4RX3 A;  4UAA A;  4GHI B;  5TR7 A;  5KSH A;  1MWU A;  1ES4 A;  3MXR A;  3AGF A;  1OTB A;  1KOU A;  2ZJ9 A;  4LV1 A;  3OC2 A;  1BLH A;  4EBL A;  1ES5 A;  1NZU A;  3UPN A;  4EQI A;  4X68 A;  5GHZ A;  4WLA A;  4GS9 A;  1ERQ A;  1NZO A;  4KUK A;  1N9O A;  3UDF A;  4S2M A;  2OWH A;  4KZ7 A;  1FIK A;  2CC1 A;  4GNU A;  4MLL A;  2Q9M A;  2W3G A;  1ONH A;  4G3K A;  3TG9 A;  3C4P A;  2ZQD A;  1OJG A;  4D60 A;  5CGX A;  4PMA A;  4JLF A;  3HLW A;  2CMN A;  4PM7 A;  4GDN A;  4RX2 A;  4NEE D;  3MJQ A;  4JGQ A;  4B88 A;  1S67 L;  4LPZ A;  4Y5F A;  1I2W A;  4KZ8 A;  3ZYT A;  5LBR A;  5GLB A;  1XJ4 A;  1YT4 A;  1K4E A;  5CTM A;  4QHC A;  1D7E A;  3T4K A;  3CPT B;  4OP5 A;  4P6B A;  2KLI A;  1ACF A;  3K3D A;  3VFF A;  4PPR A;  5CGS A;  1W79 A;  2PBY A;  2WGI A;  4O7D A;  3IWQ A;  3D9Y A;  2H5S A;  2V0U A;  1DJA A;  3LIB A;  4LCM A;  4IED A;  4S2N C;  4HEF A;  3EWK A;  1G68 A;  4DN0 A;  4OOY A;  1G28 A;  1CQA A;  3PBQ A;  2HPB A;  2ZOH A;  1DRM A;  3BFG A;  3WRZ A;  3FC7 A;  1MXO A;  4S2O A;  3LEZ A;  4UA6 A;  5G18 A;  2V9A A;  1TEM A;  2PDR A;  4RVA A;  2O9B A;  3KSF A;  3IHA A;  3BFC A;  2HJ9 C;  2A24 A;  2G7U A;  4OKP A;  1SDE A;  4H6J A;  2W27 A;  1V9Z A;  2ZC4 B;  4R4R A;  4FCF A;  1ES2 A;  1CK3 A;  3VSK A;  4EBN A;  4S2K A;  3A3F A;  3LIC A;  1K57 A;  3L9K A;  1H8M A;  5AQ9 A;  3TW8 A;  3NIA A;  2XA7 S;  3CHW P;  1GCE A;  2ZM8 A;  3OOV A;  3SOI A;  5HL6 A;  2J9O A;  1MWT A;  1XKZ A;  3NBL A;  2ZC6 B;  5L2F A;  1XA1 A;  3O86 A;  4MNR A;  3M6H A;  1T1C A;  3K2N A;  4EES A;  4IBR A;  3CAX A;  3C2W A;  1Y4O A;  1PW8 A;  3ZVW A;  5HD5 A;  2VV7 A;  2JKT I;  3JPU A;  1F98 A;  2PR5 A;  2Y2G A;  4G3V A;  3RH8 B;  3UDI A;  2O9A A;  2JHE A;  3UPP A;  2WAF A;  1CI8 A;  1E4D A;  2Y2Q A;  3UB6 A;  1BYW A;  1OTI A;  5DF7 A;  4ZJ3 A;  3NOP C;  5F69 A;  4KZ6 A;  1NRJ A;  3C7V A;  3CLO A;  1EI5 A;  3IS2 B;  3LCE A;  3AGE A;  1YLP A;  3DBA A;  3LR3 A;  1ZKJ A;  1JWV A;  1XJ6 A;  5F68 A;  3OZH A;  3E2K A;  1OTE A;  4UQI M;  2WGV A;  2C6W B;  3P09 A;  5FAO A;  3Q7Z A;  3P98 A;  4JGP A;  2K2N A;  3G6O A;  4HY8 A;  3VFH A;  3W4P A;  3S7Q A;  4KZB A;  1RCJ A;  1SCW A;  1K56 D;  2V2F F;  4QPR A;  2K7S A;  1JTG A;  4DJ2 A;  2EA9 A;  3HL9 A;  1UWP X;  1JWZ A;  5I94 A;  1CEF A;  3OPP A;  3H9W A;  5L10 A;  5HSQ A;  4LCL A;  2G2U A;  2INW A;  4HJ4 A;  3KYQ A;  4WMC D;  2W1T A;  2XD1 A;  3LI8 A;  1J9M A;  4MN7 A;  4Q0H A;  5HAI A;  2WGW A;  2DRW A;  3LY3 A;  1DP6 A;  4Z9Q A;  3W4O A;  3ZHH A;  3ZDJ A;  5HDD A;  2Y4A A;  3HVF A;  4ZRR A;  1TDL A;  5EVI B;  1YLY A;  5FEG A;  2W3H A;  1XX2 A;  5HZH A;  5IS1 A;  4WZ5 A;  1L0D A;  2Y2K A;  1GHI A;  3MZE A;  4JGR A;  4MBF A;  4HHD A;  4I38 A;  3F1P B;  1OT9 A;  4UA9 A;  4HH2 A;  3M2K A;  4EQ1 A;  3JYI A;  4RQ9 A;  3EEA A;  3CPT A;  4CQH A;  4HES A;  4HI4 A;  1G6O A;  3BJN A;  5M18 A;  3BW6 A;  4XUZ A;  1KE3 A;  2QPN A;  1BTL A;  3GR2 A;  1RP5 A;  3O5Y A;  3D4F A;  5E2H A;  5IU1 A;  3D3O A;  2J3T D;  4IHQ A;  4CLC A;  3MXQ A;  2MJ6 A;  2HJE A;  2B95 A;  3ULF A;  1BT5 A;  2KOI A;  4Y3I A;  3I7J A;  5CHJ A;  1J3W A;  1LL5 A;  4PM9 A;  1VB6 A;  5GLD A;  4GJ4 A;  1LHY A;  2VZW A;  4CLC E;  4ETX A;  4OLG A;  3B33 A;  4NG2 A;  3T4L A;  4KZ9 A;  1TS7 A;  3B3X A;  3NCK A;  4FUW A;  3G31 A;  1NYY A;  2Y2H A;  3RJU A;  4B4Z A;  3N4I A;  5J4E A;  2XFT A;  3HLD A;  2OV5 A;  3E98 A;  4OQ0 A;  3A3I A;  5IHV A;  3KO6 A;  1L0F A;  1ALQ A;  1C3B A;  2Y8H A;  4EU0 A;  5D3O A;  2QMI A;  3RXX A;  1ZG6 A;  3LY4 A;  2LB5 A;  5CRF A;  2HDU A;  1NLZ A;  1WYB A;  1T1B A;  4ETZ A;  4ME4 A;  1PW1 A;  3Q7V B;  3PR6 A;  1LSX A;  5EOO A;  3JVV A;  3C5A A;  1TDG A;  2BLS A;  1Z09 A;  5FSR A;  1CF0 A;  1KGF A;  4JF6 A;  3CI6 A;  4LRX C;  1MC0 A;  3HJK A;  2Y79 A;  2VEA A;  3SS3 A;  1YKD A;  4EUZ A;  3PYP A;  1PWD A;  3UDX A;  1UWN X;  1W63 M;  1X0O A;  1JTD A;  2QYB A;  1XFN A;  1NWZ A;  4U0T A;  1Q2Q A;  2H10 A;  3V3S A;  1Q2P A;  2EX2 A;  1HD8 A;  5TJJ A;  3Q81 A;  4L9G A;  4DE2 A;  2WZZ A;  1YM1 A;  4UEY A;  1LL9 A;  1D1J A;  1N9N A;  2NUP C;  3NHQ A;  3B47 A;  3S1Y A;  3A0V A;  3PHY A;  4S2L A;  1XJ3 A;  2WKP A;  1XGJ A;  1LLB A;  3FKW A;  2BTF P;  2OOL A;  2V1B A;  2JKF A;  5CED A;  3UB5 P;  2W3D A;  2XGN A;  4OQI A;  3HLE A;  1L2S A;  1ESI A;  3DW0 A;  4R38 A;  3F1N B;  1BSG A;  3LIE A;  3V39 A;  4WF0 A;  4X55 A;  1W63 Q;  2X01 A;  2WKQ A;  2ZQA A;  2ZBB A;  2EX9 A;  3DWK A;  1S0W A;  4QJG A;  5JYP A;  1BUL A;  1SKF A;  5AQB A;  5TFQ A;  4R3J A;  2FZ0 A;  2J3W A;  1ODV A;  2PYP A;  3T4J A;  1YLJ A;  2PHY A;  4P85 A;  3HJI A;  4WEJ A;  3IX8 A;  1EWZ A;  4II7 A;  4OPZ A;  5F1G A;  1G5U A;  3LGO A;  3IF6 A; 
#chains in the Genus database with same CATH homology
 2VV8 A;  2QWS A;  3H7W B;  3LIC A;  3OCN A;  4NXE A;  4LLO B;  4GHI A;  4IJG A;  4MMN A;  2PT7 A;  4P6Z S;  4EUV A;  3EQU A;  1H8M A;  3TW8 A;  2O99 A;  2JN7 A;  2XA7 S;  2BAS A;  4GLQ A;  3BY9 A;  2J80 A;  4MDZ A;  2OAP 1;  5F6A A;  1H3Q A;  4O8G A;  3OOV A;  5HL6 A;  4KUO A;  2VV6 A;  3GEC A;  4P6Z M;  5EFW A;  3VV4 A;  5KIZ A;  4FOF A;  3PBO A;  2QKP A;  2IA2 A;  3LIF A;  1T1C A;  3T4Q A;  3K2N A;  2XRO A;  3R4K A;  3ICY A;  4BMW A;  4EES A;  3CUE A;  3CAX A;  4HNB A;  2VGL S;  3C2W A;  1JNU A;  4AFI A;  2ZMF A;  5DF9 A;  2VJW A;  4HP4 A;  5HDS A;  5J3W A;  5HD5 A;  4HQA A;  2ZOI A;  1LSV A;  2VV7 A;  3FPV A;  2HF6 A;  2Z6D A;  2JKT I;  3LYX A;  1F98 A;  2PR5 A;  4H6J B;  3TRC A;  2JKR I;  1TD5 A;  1F5M A;  4G3V A;  4MCW A;  3FPW A;  1VHM A;  3RH8 B;  4G3W A;  4OOM A;  2O9A A;  3PBS A;  1TS0 A;  5TBM A;  3JVU A;  2JHE A;  5HWT A;  3C38 A;  3H7W A;  3R7W A;  3MMH A;  3CUE C;  3UB6 A;  1V9Y A;  1BYW A;  1OTI A;  1LSW A;  4MN6 A;  4ARZ B;  3S7O A;  3NOP C;  5F69 A;  4CLC B;  1EW0 A;  4EEP A;  1NRJ A;  1MKM A;  3BY8 A;  2K31 A;  2W3E A;  3CLO A;  3P01 A;  5FL3 A;  2PD7 A;  3IS2 B;  4Q0J A;  3P7N A;  5HWV A;  2W1T B;  3DBA A;  4K08 A;  3LID A;  3MFX A;  1P97 A;  3LR3 A;  3UB9 A;  4EW7 A;  2XSS A;  1XJ6 A;  3T4T A;  5F68 A;  4I39 A;  3B42 A;  4L0L A;  1TS6 A;  3NOU C;  2QJ5 A;  5C5K A;  4CLC C;  1GSX A;  1OTE A;  4EXO A;  4UQI M;  4PAU A;  1D06 A;  3CIT A;  1STZ A;  2Z6C A;  4MN5 A;  1GSW A;  4HH3 A;  2B18 A;  4IUK A;  4NXG A;  4Y2F A;  3C30 A;  5AVF A;  3S7N A;  2W1R A;  4JGP A;  2WKR A;  4BJP A;  2K2N A;  3F1O B;  3LR4 A;  4NXF A;  3G6O A;  4GW9 A;  2M7U A;  4HY8 A;  3W2Z A;  1TF1 A;  3S7Q A;  5L8M A;  3T50 A;  4QPR A;  3KSG A;  2K7S A;  1LL8 A;  3UMD A;  2JKT M;  4DJ2 A;  3EOI A;  1P0Z A;  2LB9 A;  3MQ0 A;  5CX7 A;  2VGL M;  2EA9 A;  4XT2 B;  3SW1 A;  2VA0 A;  5DKL A;  1S4S A;  1UWP X;  3KSH A;  5DKK A;  2W3F A;  2GJ3 A;  3H9W A;  5HSQ A;  2D01 A;  4YNR A;  3E4Q A;  4I3J A;  3LIA A;  4WEK A;  3PXP A;  2V0W A;  3IS2 A;  2INW A;  4HJ4 A;  4WL9 A;  4WEL A;  3KYQ A;  5DJT A;  4B93 A;  5A8B A;  4M4X A;  5AVE A;  2W1T A;  3UE3 A;  2VX8 A;  4HIA A;  4EET B;  3LI8 A;  2PYR A;  4GS9 B;  4F3L A;  4MN7 A;  1IFQ A;  4Q0H A;  4E04 A;  4NXB A;  3HCY A;  3T4O A;  1DP6 A;  5G4Z A;  1S1Z A;  2M1C A;  2O9C A;  2OAQ 1;  1XJ2 A;  5HDD A;  4DMZ A;  3PBR A;  3LUQ A;  4PKY G;  4BBV A;  3PBN A;  4I3I A;  4ZRR A;  4LRZ E;  2GX5 A;  3A0R A;  1P9R A;  3EEH A;  4R3A A;  3OCL A;  1DP9 A;  2HV1 A;  2W3H A;  4L9E A;  4HJ6 A;  5HZH A;  5IS1 A;  2D02 A;  2KDK A;  1OT6 A;  3LI9 A;  3OLO A;  1UGU A;  2JKR M;  4PKY A;  3VE4 A;  4JGR A;  4EEU A;  3UB7 A;  4HHD A;  4I38 A;  1OPX A;  1YSQ A;  3F1P B;  4XT2 A;  1OT9 A;  4HH2 A;  3BQ8 A;  4EQ1 A;  4R70 A;  4RQ9 A;  1WA9 A;  5K5B A;  3EEA A;  3UE6 A;  1S4R A;  1N9L A;  4CQH A;  2P04 A;  1YSP A;  5HWW A;  1XFQ A;  1G6O A;  2DMW A;  4HI4 A;  3BJN A;  3BW6 A;  3KSI A;  5DFY A;  4LRY C;  3O5Y A;  1NLY A;  4O01 A;  5DJU A;  3R7W B;  5J7E A;  5MC7 A;  5IU1 A;  3D3O A;  4YOF A;  2J3T D;  4IHQ A;  4ARZ A;  3K3C A;  3MXQ A;  4CLC A;  3F1N A;  3RFB A;  2MJ6 A;  2YKF A;  2HJE A;  3ULF A;  2QJ7 A;  1OTD A;  3V67 A;  2OWJ A;  2KOI A;  4I3A A;  1LT0 A;  2R78 A;  2J3T C;  3BWL A;  3EGD C;  4Y3I A;  5HPF A;  2XA7 M;  1VB6 A;  5DFX A;  4BBU A;  3EQV A;  1T19 A;  4GJ4 A;  2VZW A;  4CLC E;  5HD3 A;  4ETX A;  3ZQ5 A;  3IBJ A;  2EWW A;  3B33 A;  4O0P A;  2M7V A;  4Z1W A;  3T4L A;  3TJZ C;  1TS7 A;  2HGV A;  1OJ5 A;  3VOL A;  2GZA A;  5J4E A;  3F1P A;  3E98 A;  3E4P A;  1S66 L;  3KO6 A;  2Y8H A;  4EU0 A;  5I5L A;  2B02 A;  2LB5 A;  2H28 A;  4WN5 A;  5G4Y A;  3D72 A;  1NLZ A;  1T1B A;  4ETZ A;  3LR5 A;  4ME4 A;  2VKS A;  1MZU A;  4KQO A;  1DP8 A;  3PR6 A;  4GHI B;  5HDC A;  5KSH A;  3OBF A;  1LSX A;  3VE3 A;  1GSV A;  3MQQ A;  3JVV A;  2GNX A;  1OTB A;  2W0N A;  1T1A A;  1KOU A;  3S7P A;  2A2L A;  3LR0 A;  3OC2 A;  2I9V A;  4EER A;  3CI6 A;  4LRX C;  1OTA A;  3EGX C;  1MC0 A;  1Y28 A;  4L9F A;  3KX0 X;  4WLA A;  3HJK A;  4GS9 A;  2FH5 A;  2Y79 A;  3RTY A;  2VEA A;  4F3L B;  1YKD A;  4IUH A;  4KUK A;  1N9O A;  1TS8 A;  2PR6 A;  3PYP A;  3KYZ A;  2OWH A;  3LFV A;  1P9W A;  1W63 M;  1UWN X;  3U2A A;  1X0O A;  3H82 B;  2QYB A;  1XFN A;  2W3G A;  1NWZ A;  4OOL A;  4G3K A;  3MF0 A;  5TJJ A;  2P7J A;  2L4R A;  4L9G A;  1OJG A;  2PD8 A;  3E0Y A;  4UEY A;  3TE8 A;  3NJA A;  2CMN A;  4BWI A;  1N9N A;  2XRN A;  2YKH A;  2ZMV A;  2NUP C;  3NHQ A;  2KX6 A;  3B47 A;  4HJ3 A;  4NEE D;  3A0V A;  3MR0 A;  3PHY A;  4JGO A;  3MJQ A;  4JGQ A;  4B9O A;  3NOT C;  2L1M A;  5HPI A;  3CWF A;  1S67 L;  1XJ3 A;  2A24 B;  1S1Y A;  2WKP A;  4LPZ A;  4Y5F A;  5TBM B;  3ZYT A;  2VLG A;  3A0S A;  2NUT C;  5LBR A;  4HOI A;  1XJ4 A;  3GDI A;  2OOL A;  2V1B A;  1D7E A;  3T4K A;  1YAX A;  1IOU A;  3MQO A;  2P08 A;  2KLI A;  3K3D A;  1ZTU A;  2W3D A;  3C8C A;  3UME A;  4WUJ A;  4R38 A;  2EWV A;  1ZHH B;  1T18 A;  2O0Y A;  3F1N B;  2V0U A;  3LIE A;  4UQI S;  4NKP A;  3PBT A;  3LIB A;  2L0W A;  4WF0 A;  3EWK A;  1W63 Q;  3H82 A;  4DN0 A;  4CLC D;  4YWZ A;  2WKQ A;  1F9I A;  4DJ3 A;  1G28 A;  3UB8 A;  4KQD A;  3PBQ A;  2ZBB A;  2ZOH A;  1DRM A;  4PHT A;  2QHK A;  3T4S A;  3F1O A;  3FC7 A;  4FSF A;  3IBR A;  2V9A A;  2PDR A;  2O9B A;  3KSF A;  2FZ0 A;  2J3W A;  5F5Y A;  3BQA A;  1ODV A;  4GCZ A;  2PYP A;  2HJ9 C;  3T4J A;  4R6L A;  2A24 A;  2G7U A;  4Q0I A;  2PHY A;  4BBT A;  5IT5 A;  4H6J A;  5AJG A;  2V1A A;  3HJI A;  4WEJ A;  2W27 A;  1V9Z A;  4I5S A;  3FG8 A;  4HP9 A;  4II7 A;  3E4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...