5F6AA

Drosophila melanogaster cycle w398a pas-b with empty pocket
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cycle
publication title Drosophila Melanogaster Cycle PAS-B
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f6aA00
2PHYA 4EEUA 1LT0A 1S67L 4PKYG 1N9LA 1OT9A 2V1AA 1TS7A 2ZOHA 3PYPA 3UB6A 3UB9A 2WKRA 4I3JA 1OTIA 4HH3A 4L9EA 3LIBA 2PD7A 4GHIB 5J4EA 3UMEA 3NOUC 5HDSA 5AVFA 4YWZA 3B33A 3F1OB 2D02A 1MZUA 4HH2A 2W27A 4F3LB 3ULFA 1XJ4A 4HIAA 3F1PA 3F1NB 1S1YA 3H7WB 2V9AA 3LICA 1NWZA 2ZBBA 4BBUA 2Z6DA 3MJQA 4KQDA 2V0UA 4XT2B 1EW0A 4LLOB 3RTYA 1LSXA 1LSVA 1TS6A 3C8CA 3IS2B 4JGRA 1LL8A 2WKQA 4L9GA 4KUOA 3CLOA 4HOIA 3LIDA 4PKYA 5DKKA 3FG8A 4WUJA 1UGUA 3CAXA 4BBTA 4MN5A 1OTBA 3RH8B 4DJ3A 4EESA 2PR5A 1UWNX 2JHEA 4HP9A 3BY9A 5A8BA 5EFWA 3PHYA 4R70A 2V0WA 2QJ7A 2A24A 5HZHA 4H6JA 5IU1A 5HD5A 3LIAA 3MR0A 2QHKA 2QJ5A 2VLGA 1OTDA 1F9IA 4R3AA 3P7NA 4WN5A 1DP8A 5I5LA 4GS9B 4MN6A 4R6LA 1S4RA 1OTEA 5F68A 2INWA 2P7JA 3A0RA 1S1ZA 3H82A 3UB7A 3ICYA 4HJ3A 5G4ZA 5F69A 5J7EA 5KIZA 2VV8A 4B9OA 3UB8A 4GHIA 4GCZA 2GJ3A 3NOTC 1OJ5A 3A0SA 4KUKA 2YKHA 3KX0X 3IBRA 3F1OA 2CMNA 1XJ3A 3LIFA 4I3IA 2PYPA 4E04A 4F3LA 2R78A 1GSVA 3MXQA 3SW1A 3UMDA 1P0ZA 1N9NA 3MQOA 5F6AA 3NHQA 5TBMB 3GDIA 5G4YA 4LRXC 3OLOA 3F1NA 3LUQA 1DP6A 3H7WA 3G6OA 4JGOA 1TS0A 4K08A 5DKLA 4EW7A 4RQ9A 4XT2A 1TS8A 1T19A 3IS2A 3VOLA 1D7EA 1JNUA 3E4QA 1F98A 4EEPA 2B02A 2YKFA 3HJIA 4WLAA 1UWPX 1S66L 4HQAA 4NXGA 4JGQA 2I9VA 5DJTA 1T1AA 5IS1A 3D72A 3H9WA 1XFNA 1T1CA 1G28A 1GSXA 4HJ4A 4LRZE 1XFQA 1V9YA 4M4XA 2OWJA 4WF0A 3A0VA 1ODVA 1XJ2A 4I38A 2L4RA 3VE3A 1P97A 2M1CA 2PD8A 4EQ1A 4HI4A 1BYWA 5HD3A 4I3AA 2OWHA 5F5YA 4EERA 1KOUA 3LYXA 1OTAA 4NXBA 2KDKA 2H28A 1T18A 5DJUA 4GS9A 1OT6A 2VV7A 2D01A 2WKPA 2QWSA 2K7SA 3BY8A 4NXFA 1WA9A 2V1BA 3HJKA 1N9OA 1XJ6A 3EEHA 3NJAA 5HWWA 2Z6CA 3E4PA 3K3CA 2VEAA 2PDRA 5HWTA 4HNBA 1T1BA 2PR6A 4GW9A 3F1PB 4NXEA 4WL9A 2EA9A 4HP4A 5HDDA 5HSQA 5HDCA 3MFXA 4L9FA 1GSWA 2J80A 2KX6A 2QKPA 3NOPC 5AVEA 3LI9A 5TBMA 1X0OA 2HV1A 5HWVA 4R38A 3UE6A 2BASA 3BWLA 3MQQA 3CWFA 4LPZA 3FC7A 2PYRA 1V9ZA 3VE4A 3LIEA 4JGPA 4DJ2A 4I5SA 3E4OA 2JN7A 2A24B 4H6JB 2OOLA 3LI8A 3GECA 1D06A 3EWKA 2L0WA 4LRYC 2ZOIA 4HHDA 1DP9A 1S4SA 2W0NA 1DRMA 2VV6A 4I39A 4EETB 5J3WA 3ZQ5A 3K3DA 1LSWA 4HY8A 4BBVA 3C2WA 1Y28A 4HJ6A 4EXOA 3H82B 3T50A 2L1MA 1OJGA 1VB6A
chains in the Genus database with same CATH superfamily
4EEUA 1NXYA 4MCWA 3ISGA 2UWXA 5L09A 1TS7A 2JKTI 2ZOHA 1K55C 5L07A 5DF7A 5HW3A 1CF0A 3ZG9B 2WKRA 1OTIA 5GHZA 3KSFA 1PW1A 4GDNA 5FQQA 3UMEA 3NECA 3NOUC 3T4KA 3M6BA 4YWZA 4EUZA 3PBOA 4BENA 3LR4A 2HDSA 4RYEA 2VA0A 2W27A 4KENB 4WMCD 5FQ9A 4F3LB 3ULFA 1YM1A 1XJ4A 2XH9A 3DTKA 3F1PA 4S2OA 3IWIA 2HP9A 4UA9A 3H7WB 2ZQDA 1ZTUA 3KSHA 4KQDA 5GHYA 1PRQA 2ZQ8A 1PNEA 3IWQA 3VOZA 3C8CA 4JGRA 4DXBA 4QHCA 3SS3A 5TGFA 2GNXA 2WKQA 4Q0JA 2WKIA 5EPHA 3CPTB 4X1LA 1IELA 1YLYA 4MN7A 4FH4A 4JLFA 2E8JA 4IBXA 3Q07A 3QP8A 1KGFA 5EM1A 1NYYA 2XLNA 3L9KA 2UV0E 1BTLA 3BY9A 4WELA 3TRCA 4MEZA 4P6ZS 5EM0A 1ZKJA 3MSHA 1MWTA 1F2KA 4FCFA 2HDRA 3T1SA 3MR0A 3ZGAB 4GB7A 2QJ5A 3M2KA 4JXVA 4LGWA 4X68A 1OTDA 4P85A 3GRJA 4Y17A 4DMZA 3W8KA 2Y2JA 2ZC4B 4E3NA 3FKVA 3EOIA 2XD5A 1JVJA 3DTEA 5FAQA 3H82A 4HJ3A 5G4ZA 4XUZA 3FPVA 5KSHA 3SH9A 5FQJA 3BLMA 2ZM8A 5KIZA 4EQIA 3PXPA 3U2AA 1VETB 5FAOA 2JCHA 5FI7A 1J3WA 3GTCA 1S0WA 3UB8A 1MY8A 4GCZA 4OPZA 1K57A 3A3JA 4CJNA 3KX0X 3QNBA 5FDSA 4QD4A 2CMNA 4OQ0A 4NEED 3LFVA 3TJZC 4F3LA 2R78A 3W4QA 4ZBEA 3CITA 3MBZA 3HBRA 4D2OA 2PBYA 3H7WA 5CTMA 2WGVA 4PM7A 4JGOA 1CI8A 5DKLA 4MDZA 4PM6A 4E3OA 1K6SA 4EW7A 4RQ9A 1ALQA 4CLCC 3HLWA 4O0PA 1KE4A 4KZBA 2GX5A 2A49A 1OMEA 4EEPA 4G3KA 3QP1A 3IWOA 4OOYA 4WYYA 3HLEA 1K38A 3CPTA 1GHPA 4QY6A 1FCMA 4WLAA 1L2SA 2PAVP 3VP1A 1PWGA 1UWPX 3C7VA 3W4OA 2I9VA 4K0XA 5DJTA 2VGLS 1MWUA 5I94A 5IS1A 3UDIA 4BD0A 1MWRA 4R4SA 4DN0A 1G28A 4RVAA 2O99A 2XGNA 1XFQA 2Y2KA 1XA1A 1ONGA 4DXCA 4PPRA 3KYQA 4E3IA 3UNWA 2FZ0A 3IX8A 1K0KA 2PD8A 2X71A 3QP2A 1WYBA 3PBTA 1BYWA 3A3DA 3UDXA 5HD3A 4DKIA 3DWKA 3G35A 4XXRA 4NXBA 1H5XA 4O7DA 3FKWA 4B4XA 1O7EA 3SZTA 2D01A 2WKPA 2QWSA 5GLAA 1HZOA 3T12B 3C4OA 2V1BA 5FASA 4OLGA 3EEHA 3NJAA 4NETA 4UEYA 5HWWA 2Z6CA 5KSCA 2VEAA 2PDRA 3CG5A 3Q82A 5EE8A 5AQBA 1VETA 2XD1A 4GW9A 3A3FA 3N8LA 4ZRRA 1LLBA 4E3LA 2HP6A 2JE5A 4ID4A 5AJGA 3TE8A 3N6IA 4KG5A 4E3MA 2ZJ9A 1L0GA 2QKPA 3LEZA 1CK3A 3BLSA 3ZDJA 4CLCE 5MC7A 1YAXA 5CX7A 4QWOA 2NUPC 1E25A 4Z9QA 1DY6A 1RCJA 4Y3IA 2OLUA 2HV1A 4OQGA 1W5DA 2JKTM 3BWLA 2X01A 3U4LP 2J9PA 5HFOA 4LPZA 4BJPA 3ZNTA 5FEFA 1V9ZA 4LV1A 4UQIS 2J8YA 3E4OA 2WADA 3N8SA 2XA7M 4CQHA 1VHMA 2OOLA 3LI8A 5EVIB 1D06A 5EUAA 3S7PA 1YLWA 2XF3A 2H5SA 5KZHA 4LRYC 2ZOIA 3HLFA 4HHDA 2WZZA 3BFFA 3T1XA 1P9RA 2W0NA 4GZBA 2VV6A 2ZQ9A 5M1AA 2OSUA 2GDNA 3ZQ5A 3Q1FA 3O87A 4BBVA 4AFIA 4HJ6A 3AGDA 4WEKA 4OQHA 4EUVA 2A2LA 1OJGA 2PHYA 3E98A 1EROA 1YQSA 4Y7PA 3Q7VB 1LI9A 2IWBA 3PBNA 3UB9A 2O0YA 4K91A 3ZNYA 4L9EA 1D1JA 4GHIB 1KVMA 1E4DA 1MWSA 3S22A 3C30A 5HDSA 3B33A 3JVUA 3FYZA 2QZ6A 4HH2A 3SOIA 2XRNA 3CI6A 3UB5P 5IT5A 1NJ4A 3QP4A 2XROA 5FL3A 3TG9A 2PT7A 3BQ8A 1SKFA 4EBLA 3HUNA 2V9AA 3LICA 1NWZA 2EX2A 3MJQA 1EW0A 2Z2LB 3UY6A 1J9MA 5C5KA 1LSXA 1LSVA 3A3IA 1A0KA 2FFFB 2M7VA 1HTZA 3IXHA 1CQAA 3CLOA 2OAQ1 4OP8A 1NY0A 4ZDXA 3FG8A 4WUJA 2BTFP 1UGUA 4X6TA 3CAXA 5EOEA 4PMAA 5DF9A 1PI4A 2NUTC 3RH8B 4EESA 2PR5A 2JHEA 4N1HA 4HP9A 2ZM2A 3HLGA 5A8BA 3SS5A 3M2JA 3I7JA 5EFWA 3PHYA 2JKRI 4FUWA 2QJ7A 3WRZA 3PR6A 4UAAA 3MMHA 5JYPA 2ZC5B 1G5UA 5EVIA 3MFDA 1OPXA 5GLCA 1H8ZA 1YSPA 1CEFA 5CERA 3QNCA 1GHMA 2QHKA 2QMIA 2Y79A 4JPMA 2ZQ7A 2O9BA 4U0XA 1F9IA 1YKDA 5F83A 4R3AA 2CC1A 5CRFA 5HARA 3EGXC 2PBDP 4R6LA 1C3BA 5FAPA 3MS6A 4FTXA 2INWA 2P7JA 3MZEA 2OLVA 3A0RA 3UB7A 3ICYA 4OONA 3QP5A 3NDEA 3G31A 3HL9A 5E2FA 4Y13A 4CLCD 1L0FA 2R9WA 1FIKA 4GN2A 1NLYA 3ZHHA 4UA6A 2X02A 3Q7VA 4Y0OA 2VGLM 4R3BA 5J7EA 3N7WA 1ONHA 5HPFA 1EI5A 2VV8A 2XA7S 4KG2A 5HX9A 4GHIA 3KYZA 3NIAA 2JBFA 3IT9A 3BM6A 3IQAA 1IKIA 1XJ3A 3LIFA 4I3IA 4E04A 5EV0A 3V50A 1PI5A 3NDGA 2W1TB 1N4OA 4DRTA 3SW1A 3EEAA 3MQOA 3UN7A 1HD8A 3NHQA 1H3QA 3GDIA 3JPUA 4LRXC 4QPRA 2ZQAA 3GV9A 5FEGA 3G6OA 1YMSA 2P9VB 1WE4A 1BT5A 1TEMA 1SZVA 1W8QA 1W63Q 3VFFA 1ERQA 3E4QA 1XGJA 5L8MA 2FFYA 2B5RA 3WS5A 1FILA 2HDQA 4IBRA 3Q7ZA 3S1YA 2XDMA 2Y2LA 4KQQA 3LY4A 5EVIC 1S66L 4HQAA 4NXGA 3R4KA 4JGQA 3IH8A 4DE2A 4X1MA 4YOFA 3GR2A 2V8FA 4LFUA 3NY4A 4OKPA 1XFNA 4ZJ1A 4PM5A 5CEDA 4JF6A 4CPKA 3IX4A 1V9YA 1YLTA 4OPYA 2OWJA 1SDNA 3A0VA 1KGGA 2HDUA 4I38A 4RX2A 2M1CA 3OPLA 4UA7A 2RCXA 2DCFA 4I3AA 5AQAA 1PWDA 2HP5A 5F5YA 3S7OA 3V3SA 3D3OA 4EERA 4GD6A 2E8IA 1OTAA 1ERMA 1TD5A 2W3HA 3UPOA 1T18A 1OT6A 2VV7A 1LL5A 5GHXA 2K7SA 3O88A 4S2JA 5M19A 4NXFA 4UQIM 4WBGA 1Q2PA 5CHJA 2EXAA 3ZG8B 1XJ6A 4GNUA 2IWCA 2B18A 2Y2IA 2VK3A 4Q8IA 4ZAMA 3OPPA 1KGEA 4MBKA 4HNBA 1H8MA 2ZQCA 2FH5A 4NXEA 4ZJ3A 1Y54A 4WL9A 5GLDA 1Z6FA 1I2WA 2EA9A 3G34A 4L9FA 1GSWA 4DE3A 4EV4A 3HREA 3S7NA 3HLDA 3T1QB 3EQVA 2W1TA 3OPHA 3A3EA 5EVLA 3W2ZA 3MQQA 1VEUB 3OBFA 4BL2A 2P9VA 4LENA 1M6KA 1XX2A 1TDLA 4N92A 2IWDA 4S2MA 3FC7A 3VFHA 4KZ7A 5HL1A 5DTSA 1FSWA 3HUOA 3LIEA 3MQ0A 1Y4OA 4KZ5A 2KOIA 3B47A 4I5SA 5CXWA 1ESUA 5E2GA 2EX6A 4H6JB 3KO6A 1STZA 3WS1A 1W7FA 2Q0OA 3GECA 3BRMA 5A91A 2HPBA 3EWKA 2L0WA 3ZFZA 4KZ9A 3TW8A 3TSGA 2A3UA 4ZJ2A 2O9AA 1YT4A 5J8XA 1DRMA 2EX8A 4PHTA 5J3WA 1AWIA 3BW6A 4Y0TA 3VOYA 1MBLA 2VGKA 2XFSA 1HLUP 3V5MA 1VQQA 5BOHA 2V8CA 2HGVA 1TF1A 1K57C 1LT0A 3K2NA 3O3VA 4PKYG 2Z2MB 1OT9A 1O07A 5CECA 1FCOA 4EBPA 2OAP1 1FCNA 2JKRM 2R9XA 4FSFA 2Y4AA 3OCLA 2H0YA 4U0TA 4X56A 4HH3A 3IXBA 5E2HA 1U60A 2G7UA 2V2FF 2PD7A 3E0YA 3LIBA 5J4EA 2J3TC 3MXRA 1DJAA 5CHUA 3F1OB 2D02A 2PU2A 3OZHA 1MZUA 3RFBA 4O8GA 4GDBA 3L7HA 2JKFA 2ZC3B 4HEFA 2XEPA 4PM9A 3CUEA 4P87A 2Z6DA 1L0EA 2Y8HA 4DE1A 4UHUA 4XT2B 1FQGA 2I72A 4LLOB 2BLSA 5U47A 3WRTA 3RTYA 1TS6A 3VSLA 4JXSA 4L9GA 4KUOA 5IHVA 4HOIA 1VEUA 3HLCA 3LR0A 3LIDA 4PKYA 5DKKA 1FR6A 3B3XA 1TDGA 2WGWB 3GMWA 1JWVA 5L2FA 4MN5A 1OTBA 4MBFA 2LB9A 1PW8A 2Y2PA 4DJ3A 1DJBA 1UWNX 2WKEA 3BYDA 1MKIA 5EECA 1LL9A 2WK0A 5HAPA 2V0WA 4DE0A 1RGYA 1NZUA 3T4QA 4MMNA 1GHIA 4H6JA 1FSYA 5FI2A 5HZHA 3IHBA 1BLSA 4OPQA 3DTMA 3LIAA 2WGIA 1XA7A 4E6WA 5EOOA 1QMFA 1W8YA 3VSKA 1K4FA 2VLGA 3RXXA 3KSIA 2XK1A 2HJ9C 3UDFA 3UE1A 2Y2GA 4M3KA 3PBSA 1DP8A 3RJUA 5I5LA 5DTKA 2WZXA 4GS9B 4MN6A 3C5AA 4NKPA 3UE3A 1IOUA 1QMEA 4EWFA 4II7A 4IUHA 4JXWA 4C75A 5F69A 4WZ4A 1E3UD 3BQAA 3NBLA 2IA2A 3PBQA 4PM8A 2GZAA 4HESA 5HAIA 4B9OA 3CUEC 2Y2QA 2PRFA 5EVID 3ZVTA 1OJ5A 4NK3A 4KUKA 4KZ8A 3IBRA 3F1OA 4FD8A 3BECA 5E43A 5FQKA 1IYPA 3FV7A 5JYOA 2Y2HA 1K55A 2PYPA 1ZC2A 1G6AA 1GSVA 3MXQA 3HLBA 1P0ZA 5HL6A 3ITBA 5F6AA 2W3GA 5TBMB 5G4YA 4Y0UA 1ES3A 2WYXA 5F1FA 2Y2OA 1KE0A 1DP6A 1SHVA 1L3LA 1PFLA 4B4ZA 1NRJA 3SH8A 4X69A 3W4PA 1ACFA 1K56A 4EBNA 4XT2A 4Z1WA 2HZ5A 3NCKA 1TS8A 3VP2A 2ZL1B 5GLBA 1F98A 2K31A 3TOIA 1YLJA 4GD8A 2B02A 4ETXA 4OOMA 1SKOB 3LCEA 4KQOA 1K54A 2WGWA 4CLCB 3IX3A 3VMAA 3OCNA 5A90A 1H0MA 1CJFA 1F5MA 4N9KA 3IF6B 3H9WA 3DWZA 1T1CA 2EX9A 2ZMAA 4HJ4A 5FATA 1BULA 4L0LA 4DDSA 4R0QA 5FA7A 1ESIA 4H8RA 3O86A 3C4PA 2J9OA 2G2UA 3EQUA 3PAGA 4FH2A 1XJ2A 5CTNA 5DFXA 3E2KA 1P97A 4IHQA 4S2PA 5FQMA 4JKTA 4S2NA 2J7VA 3GVBA 3LYXA 4YINA 4G3VA 2O9CA 4GS9A 4KZAA 1S6RA 3VV4A 3BY8A 3P98A 3T4JA 3C7UA 2P08A 2Q9NA 1N9OA 3HJKA 4GKUA 3RXWA 1AXBA 3IXGA 3JYIA 2BG1A 2B95A 3IHAA 4X55A 3K3CA 2WKHA 3DTIA 2PR6A 3JVVA 1MC0A 3N8RA 3HUMA 3V3RA 1GA9A 4IVKA 5HDDA 5HSQA 2C5WB 3R7WB 5HDCA 4OLDA 1GA0A 2KX6A 1DJCA 4YFMA 2W3DA 1XKZA 3ZCZA 4LCLA 5AVEA 4JF4A 5TBMA 2XSSA 4GJ4A 1X0OA 5HWVA 3MZFA 4R38A 5CGSA 3UE6A 1NRFA 2BASA 4B93A 1K54C 2H10A 4R4RA 1IKGA 1FOFA 1PZOA 1KE3A 4OP5A 4RX3A 4ME4A 3GSGA 2PYRA 2ZL1A 4QB8A 2AVXA 3M6HA 4Y2FA 2ZMFA 3LGOA 3ITAA 2W3FA 4BL3A 2ZLYA 4BD1A 1SKOA 2A24B 1ZHHB 4CLCA 3LY3A 2VJWA 1ES5A 2P04A 4OVDA 3IF6A 3KSGA 4S2NC 2J3TD 3G30A 4WMCA 3KYEA 5KMWA 4I39A 3BFDA 4EETB 4KG6A 3DAVA 3OOVA 4C3QA 3K3DA 3QP6A 2EWVA 3FPWA 5DVAA 4KZ3A 3CMZA 4LCMA 1GCEA 4HY8A 1PZPA 4GOGA 4EXOA 3AGFA 1VB6A 1XPBA 5F82A 1Q2QA 3PBRA 1S67L 1RGZA 5D3OA 5TR7A 2VKSA 1N9LA 2V1AA 3BFGA 1IFQA 3PYPA 3BFCA 4EU0A 3OPRA 4LV0A 3UPPA 3UB6A 2Y59A 2ZC6B 2VGJA 4I3JA 3IF5A 1XGIA 4QY5A 2ZC7A 2JKGA 3MF0A 3G2YA 4B88A 5AVFA 3LEQA 3CHWP 1LI0A 1YMXA 2V1ZA 1RP5A 2Y2MA 4Q0IA 5DF8A 4HIAA 4O01A 5AQ7A 4DDYA 3VP0A 2Y55A 3F1NB 1S1YA 1Z09A 4KZ6A 4G3WA 1ZG4A 3D9YA 2ZBBA 3EGDC 4BBUA 3Q81A 3R7WA 2ZD8A 2V0UA 1K6RA 3ZVWA 2P74A 3BFEA 3IS2B 4QJGA 1I5QA 4S2IA 2JC7A 1LL8A 1K25A 1KDSA 3BEBA 4YNRA 5FI6A 4MBHA 4X53A 3HVFA 5L10A 1PYYA 4WZ5A 4P6BA 1CI9A 4BBTA 5EVEA 3FWLA 3IF6C 3SH7A 2W1RA 3BJNA 2J3WA 4C6YA 5F1GA 5HAQA 1MPLA 1K4EA 4FOFA 3DBAA 4R70A 5K5BA 2XR0A 4OPRA 2A24A 2QPNA 3P01A 5IU1A 3G2ZA 4Y15A 1BLCA 5HD5A 5LBRA 2ZMVA 3T4TA 3UO9A 2EWWA 4BWIA 1NZOA 3WS4A 1IEMA 2EFXA 5AQ9A 4E3KA 4HBTA 4ETZA 3P7NA 4IJGA 4WN5A 1KVLA 1W79A 1S4RA 5TFQA 3UPNA 2LB5A 1OTEA 5F68A 4NG2A 5TJJA 4R1GA 5HPIA 1SCWA 1P9WA 1S1ZA 4OQIA 1YLZA 3VP3A 2PU4A 4N1XA 4E3JA 2W3EA 2C6WB 1N9BA 1BSGA 1VM1A 3D4FA 5CEBA 4Y5FA 3SS4A 5A92A 3OC2A 2DNSA 4BQMA 2HF6A 2GJ3A 4OOLA 1BLHA 3S7QA 3NOTC 3A0SA 3MXSA 4DF6A 2YKHA 5GL9A 1FR1A 3WS0A 1NLZA 4X25A 2V20A 1W63M 3UMDA 1XXMA 1N9NA 1I2SA 3IBJA 1JWZA 3ZYTA 3OLOA 3F1NA 3LUQA 4MLLA 4WZ5C 2Y2NA 5FDHA 1TS0A 4K08A 4Q0HA 3V67A 4JF5A 4WEJA 1PIOA 1T19A 3IS2A 3VOLA 1D7EA 1EWZA 3T4LA 1JNUA 4ARZB 1HVBA 3V39A 5FSRA 2YKFA 4IUKA 3HJIA 2OV5A 1YPRA 4KZ4A 3QHYA 3CJMA 1T1AA 1IYOA 2ZM0A 3D72A 4LV2A 1GSXA 5CHMA 4LRZE 4R3JA 4M4XA 5E2EA 4BMWA 5M18A 1JWPA 2Y91A 4WF0A 4PAUA 2DRWA 1ODVA 3S4XA 1G6OA 4R23A 1IYSA 5FQIA 2L4RA 3VE3A 1JTGA 3NULA 1K56D 4D60A 4EQ1A 4K0WA 3G32A 4HI4A 1XP4A 1JTDA 3B42A 3NI9A 2OWHA 5CGWA 1KOUA 2XQZA 4LV3A 1NYMA 4U3TA 2KDKA 2H28A 5DJUA 5DFYA 1LHYA 1H8YA 1BLPA 1SDEA 3MKFA 2EFUA 4ESPA 1WA9A 4A5RA 2HJEA 3C38A 3O5YA 4HBUA 4JBFA 3IXDA 4S2KA 1CEGA 3LR3A 3E4PA 2QYBA 4JXGA 4P6ZM 2XFTA 4N9LA 5HWTA 1T1BA 1YSQA 3FZCA 3N4IA 3F1PB 3ZG0A 3P09A 4S2LA 2KLIA 4ZTKA 3NC8A 4HP4A 4MNRA 5A93A 3MFXA 4GLQA 2J80A 1M40A 4WM9A 3T4OA 3MZDA 3LO7A 3NOPC 1IYQA 1TVFA 4P0MA 3LI9A 4IVIA 5G18A 5DTTA 2RL3A 1ES2A 3HCYA 4BLMA 1ZG6A 4KQRA 3WS2A 2DMWA 3T4SA 1ES4A 3CWFA 2K2NA 3ZG5A 2G2WA 1MKMA 2WUQA 3AGEA 3MKEA 4ARZA 3VE4A 2VX8A 1WYCA 4JGPA 4DJ2A 3G4PA 1YLPA 4XUXA 3UE0A 1PWCA 1BUEA 3DW0A 2JN7A 2M7UA 4QU3A 2ACGA 1E3UA 2MJ6A 3IH9A 2VZWA 3CZDA 4RA7A 3T1RA 3WWXA 3ZG7B 4E6XA 2WAEA 1DP9A 2H0TA 3PTEA 1S4SA 4F94A 1G68A 5CGXA 2Q9MA 3PAEA 2EXBA 1BZAA 4OH0A 1LSWA 3E2LA 3C2WA 1Y28A 3VP4A 1KDWA 3LR5A 2WAFA 4IEDA 1L0DA 3GQZA 3H82B 3T50A 2L1MA 1MXOA
chains in the Genus database with same CATH topology
2PHYA 2HGVA 1TF1A 3E98A 4EEUA 1LT0A 3K2NA 3PBRA 1S67L 4PKYG 4MCWA 2VKSA 1N9LA 1OT9A 2V1AA 1TS7A 2JKTI 2ZOHA 1IFQA 3PYPA 4EU0A 2OAP1 3PBNA 3UB9A 3UB6A 2JKRM 2WKRA 2O0YA 4FSFA 4I3JA 1OTIA 3OCLA 3KSFA 4HH3A 4L9EA 2G7UA 3E0YA 3LIBA 2PD7A 4GHIB 5J4EA 3UMEA 3MF0A 2J3TC 3C30A 3NOUC 3T4KA 5HDSA 5AVFA 4YWZA 3B33A 3PBOA 3JVUA 3F1OB 2D02A 3LR4A 1MZUA 4HH2A 3RFBA 2VA0A 2W27A 2XRNA 3CI6A 4F3LB 4O8GA 3ULFA 5IT5A 1XJ4A 4Q0IA 2XROA 4HIAA 4O01A 3F1PA 5FL3A 2PT7A 3F1NB 3BQ8A 1S1YA 3H7WB 2V9AA 1ZTUA 3KSHA 3LICA 4G3WA 1NWZA 2ZBBA 3CUEA 3EGDC 4BBUA 2Z6DA 3MJQA 2Y8HA 4KQDA 3R7WA 2V0UA 4XT2B 1EW0A 5C5KA 4LLOB 3RTYA 1LSXA 1LSVA 1TS6A 3C8CA 3IS2B 4JGRA 2M7VA 1LL8A 2GNXA 2WKQA 4L9GA 4KUOA 4Q0JA 4YNRA 3CLOA 4HOIA 2OAQ1 3LR0A 3LIDA 4PKYA 5DKKA 3FG8A 4WUJA 1UGUA 3CAXA 4BBTA 4MN7A 4MN5A 1OTBA 5DF9A 2LB9A 2NUTC 3RH8B 4DJ3A 2W1RA 3BJNA 4EESA 2J3WA 2PR5A 1UWNX 2JHEA 4HP9A 3BY9A 4WELA 3TRCA 5A8BA 4P6ZS 4FOFA 3DBAA 5EFWA 3PHYA 2JKRI 4R70A 2V0WA 2QJ7A 5K5BA 3PR6A 3T4QA 2A24A 4MMNA 3P01A 5HZHA 4H6JA 5IU1A 3MMHA 5HD5A 5LBRA 2ZMVA 3T4TA 3LIAA 1OPXA 2EWWA 4BWIA 1YSPA 3MR0A 2QHKA 2Y79A 2QJ5A 2VLGA 2O9BA 3KSIA 2HJ9C 1OTDA 1F9IA 1YKDA 4R3AA 4ETZA 3P7NA 4DMZA 4IJGA 4WN5A 3PBSA 1DP8A 3EGXC 5I5LA 4GS9B 4MN6A 3EOIA 4R6LA 1S4RA 4NKPA 3UE3A 1IOUA 2LB5A 1OTEA 5F68A 5TJJA 5HPIA 2INWA 4II7A 2P7JA 3A0RA 1P9WA 4IUHA 1S1ZA 3H82A 3UB7A 3ICYA 4HJ3A 5G4ZA 5F69A 4CLCD 3BQAA 2IA2A 3PBQA 3FPVA 2W3EA 1NLYA 5KSHA 2VGLM 5J7EA 5HPFA 2GZAA 5KIZA 3PXPA 4EUVA 2VV8A 3U2AA 4B9OA 2XA7S 4Y5FA 3CUEC 3OC2A 3UB8A 2HF6A 4GHIA 4GCZA 2GJ3A 4OOLA 3S7QA 3KYZA 3NOTC 1OJ5A 3A0SA 4KUKA 2YKHA 3KX0X 3IBRA 3F1OA 2CMNA 1XJ3A 4NEED 3LIFA 3LFVA 4I3IA 2PYPA 4E04A 1NLZA 3TJZC 4F3LA 2R78A 2W1TB 1GSVA 3MXQA 1W63M 3SW1A 3EEAA 1P0ZA 1N9NA 5HL6A 3MQOA 3UMDA 5F6AA 3CITA 3IBJA 2W3GA 3NHQA 5TBMB 1H3QA 3GDIA 5G4YA 3ZYTA 4LRXC 3OLOA 4QPRA 3F1NA 3LUQA 1DP6A 3H7WA 3G6OA 4JGOA 1NRJA 1TS0A 4K08A 5DKLA 4Q0HA 3V67A 4MDZA 4EW7A 4RQ9A 4XT2A 4Z1WA 4CLCC 4WEJA 1W63Q 4O0PA 1TS8A 1T19A 3IS2A 3VOLA 1D7EA 3T4LA 1JNUA 4ARZB 3E4QA 2GX5A 1F98A 2K31A 5L8MA 4EEPA 4G3KA 2B02A 4ETXA 2YKFA 4IUKA 3HJIA 4WLAA 4OOMA 1UWPX 1S66L 4KQOA 4HQAA 4NXGA 4CLCB 3R4KA 4JGQA 2I9VA 5DJTA 2VGLS 1T1AA 3OCNA 4YOFA 5IS1A 1F5MA 3D72A 3H9WA 1XFNA 1T1CA 4DN0A 1G28A 1GSXA 4HJ4A 2O99A 4L0LA 4LRZE 1XFQA 1V9YA 4M4XA 4BMWA 2OWJA 4WF0A 4PAUA 3A0VA 1ODVA 1G6OA 3KYQA 3EQUA 1XJ2A 4I38A 2L4RA 2FZ0A 5DFXA 3VE3A 1P97A 2M1CA 2PD8A 4IHQA 4EQ1A 3PBTA 4HI4A 1BYWA 5HD3A 3B42A 4I3AA 2OWHA 5F5YA 3S7OA 3D3OA 4EERA 1KOUA 3LYXA 1OTAA 4NXBA 4G3VA 1TD5A 2W3HA 2O9CA 2KDKA 2H28A 1T18A 5DJUA 4GS9A 1OT6A 2VV7A 2D01A 2WKPA 5DFYA 2QWSA 3VV4A 2K7SA 3BY8A 4NXFA 1WA9A 4UQIM 3T4JA 2V1BA 3HJKA 2HJEA 1N9OA 2P08A 3C38A 3O5YA 1XJ6A 3EEHA 2B18A 3NJAA 4UEYA 5HWWA 2Z6CA 3LR3A 3E4PA 3K3CA 2QYBA 2VEAA 2PDRA 4P6ZM 5HWTA 4HNBA 1H8MA 1T1BA 2PR6A 3JVVA 1YSQA 1MC0A 2FH5A 4GW9A 3F1PB 4ZRRA 4NXEA 4WL9A 2KLIA 2EA9A 4HP4A 5AJGA 5HDDA 5HSQA 3R7WB 5HDCA 3TE8A 3MFXA 4L9FA 4GLQA 1GSWA 2J80A 3S7NA 2KX6A 3T4OA 3EQVA 2QKPA 3NOPC 2W1TA 4CLCE 2W3DA 5MC7A 1YAXA 5CX7A 5AVEA 2NUPC 3LI9A 5TBMA 4Y3IA 2XSSA 4GJ4A 1X0OA 2HV1A 5HWVA 4R38A 3UE6A 2BASA 2JKTM 3BWLA 3W2ZA 3MQQA 4B93A 3HCYA 3OBFA 2DMWA 3T4SA 3CWFA 2K2NA 4LPZA 4BJPA 3FC7A 1MKMA 4ME4A 2PYRA 1V9ZA 4ARZA 3VE4A 2VX8A 3LIEA 3MQ0A 4Y2FA 4JGPA 4DJ2A 4UQIS 2ZMFA 2KOIA 3B47A 2W3FA 4I5SA 3E4OA 2JN7A 2M7UA 2A24B 1ZHHB 2XA7M 3KO6A 1STZA 4H6JB 4CLCA 2MJ6A 4CQHA 1VHMA 2OOLA 3LI8A 2VJWA 2VZWA 3GECA 1D06A 2P04A 3S7PA 3KSGA 3EWKA 2L0WA 2J3TD 3TW8A 4LRYC 2ZOIA 4HHDA 1DP9A 2O9AA 1P9RA 1S4SA 2W0NA 1DRMA 2VV6A 4I39A 4EETB 4PHTA 3OOVA 5J3WA 3ZQ5A 3K3DA 3BW6A 2EWVA 3FPWA 1LSWA 4HY8A 4BBVA 4AFIA 3C2WA 1Y28A 3LR5A 4HJ6A 4EXOA 4WEKA 3H82B 3T50A 2L1MA 2A2LA 1OJGA 1VB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHY A;  4EEU A;  1LT0 A;  1S67 L;  4PKY G;  1N9L A;  1OT9 A;  2V1A A;  1TS7 A;  2ZOH A;  3PYP A;  3UB6 A;  3UB9 A;  2WKR A;  4I3J A;  1OTI A;  4HH3 A;  4L9E A;  3LIB A;  2PD7 A;  4GHI B;  5J4E A;  3UME A;  3NOU C;  5HDS A;  5AVF A;  4YWZ A;  3B33 A;  3F1O B;  2D02 A;  1MZU A;  4HH2 A;  2W27 A;  4F3L B;  3ULF A;  1XJ4 A;  4HIA A;  3F1P A;  3F1N B;  1S1Y A;  3H7W B;  2V9A A;  3LIC A;  1NWZ A;  2ZBB A;  4BBU A;  2Z6D A;  3MJQ A;  4KQD A;  2V0U A;  4XT2 B;  1EW0 A;  4LLO B;  3RTY A;  1LSX A;  1LSV A;  1TS6 A;  3C8C A;  3IS2 B;  4JGR A;  1LL8 A;  2WKQ A;  4L9G A;  4KUO A;  3CLO A;  4HOI A;  3LID A;  4PKY A;  5DKK A;  3FG8 A;  4WUJ A;  1UGU A;  3CAX A;  4BBT A;  4MN5 A;  1OTB A;  3RH8 B;  4DJ3 A;  4EES A;  2PR5 A;  1UWN X;  2JHE A;  4HP9 A;  3BY9 A;  5A8B A;  5EFW A;  3PHY A;  4R70 A;  2V0W A;  2QJ7 A;  2A24 A;  5HZH A;  4H6J A;  5IU1 A;  5HD5 A;  3LIA A;  3MR0 A;  2QHK A;  2QJ5 A;  2VLG A;  1OTD A;  1F9I A;  4R3A A;  3P7N A;  4WN5 A;  1DP8 A;  5I5L A;  4GS9 B;  4MN6 A;  4R6L A;  1S4R A;  1OTE A;  5F68 A;  2INW A;  2P7J A;  3A0R A;  1S1Z A;  3H82 A;  3UB7 A;  3ICY A;  4HJ3 A;  5G4Z A;  5F69 A;  5J7E A;  5KIZ A;  2VV8 A;  4B9O A;  3UB8 A;  4GHI A;  4GCZ A;  2GJ3 A;  3NOT C;  1OJ5 A;  3A0S A;  4KUK A;  2YKH A;  3KX0 X;  3IBR A;  3F1O A;  2CMN A;  1XJ3 A;  3LIF A;  4I3I A;  2PYP A;  4E04 A;  4F3L A;  2R78 A;  1GSV A;  3MXQ A;  3SW1 A;  3UMD A;  1P0Z A;  1N9N A;  3MQO A;  5F6A A;  3NHQ A;  5TBM B;  3GDI A;  5G4Y A;  4LRX C;  3OLO A;  3F1N A;  3LUQ A;  1DP6 A;  3H7W A;  3G6O A;  4JGO A;  1TS0 A;  4K08 A;  5DKL A;  4EW7 A;  4RQ9 A;  4XT2 A;  1TS8 A;  1T19 A;  3IS2 A;  3VOL A;  1D7E A;  1JNU A;  3E4Q A;  1F98 A;  4EEP A;  2B02 A;  2YKF A;  3HJI A;  4WLA A;  1UWP X;  1S66 L;  4HQA A;  4NXG A;  4JGQ A;  2I9V A;  5DJT A;  1T1A A;  5IS1 A;  3D72 A;  3H9W A;  1XFN A;  1T1C A;  1G28 A;  1GSX A;  4HJ4 A;  4LRZ E;  1XFQ A;  1V9Y A;  4M4X A;  2OWJ A;  4WF0 A;  3A0V A;  1ODV A;  1XJ2 A;  4I38 A;  2L4R A;  3VE3 A;  1P97 A;  2M1C A;  2PD8 A;  4EQ1 A;  4HI4 A;  1BYW A;  5HD3 A;  4I3A A;  2OWH A;  5F5Y A;  4EER A;  1KOU A;  3LYX A;  1OTA A;  4NXB A;  2KDK A;  2H28 A;  1T18 A;  5DJU A;  4GS9 A;  1OT6 A;  2VV7 A;  2D01 A;  2WKP A;  2QWS A;  2K7S A;  3BY8 A;  4NXF A;  1WA9 A;  2V1B A;  3HJK A;  1N9O A;  1XJ6 A;  3EEH A;  3NJA A;  5HWW A;  2Z6C A;  3E4P A;  3K3C A;  2VEA A;  2PDR A;  5HWT A;  4HNB A;  1T1B A;  2PR6 A;  4GW9 A;  3F1P B;  4NXE A;  4WL9 A;  2EA9 A;  4HP4 A;  5HDD A;  5HSQ A;  5HDC A;  3MFX A;  4L9F A;  1GSW A;  2J80 A;  2KX6 A;  2QKP A;  3NOP C;  5AVE A;  3LI9 A;  5TBM A;  1X0O A;  2HV1 A;  5HWV A;  4R38 A;  3UE6 A;  2BAS A;  3BWL A;  3MQQ A;  3CWF A;  4LPZ A;  3FC7 A;  2PYR A;  1V9Z A;  3VE4 A;  3LIE A;  4JGP A;  4DJ2 A;  4I5S A;  3E4O A;  2JN7 A;  2A24 B;  4H6J B;  2OOL A;  3LI8 A;  3GEC A;  1D06 A;  3EWK A;  2L0W A;  4LRY C;  2ZOI A;  4HHD A;  1DP9 A;  1S4S A;  2W0N A;  1DRM A;  2VV6 A;  4I39 A;  4EET B;  5J3W A;  3ZQ5 A;  3K3D A;  1LSW A;  4HY8 A;  4BBV A;  3C2W A;  1Y28 A;  4HJ6 A;  4EXO A;  3H82 B;  3T50 A;  2L1M A;  1OJG A;  1VB6 A; 
#chains in the Genus database with same CATH topology
 4EEU A;  1NXY A;  4MCW A;  3ISG A;  2UWX A;  5L09 A;  1TS7 A;  2JKT I;  2ZOH A;  1K55 C;  5L07 A;  5DF7 A;  5HW3 A;  1CF0 A;  3ZG9 B;  2WKR A;  1OTI A;  5GHZ A;  3KSF A;  1PW1 A;  4GDN A;  5FQQ A;  3UME A;  3NEC A;  3NOU C;  3T4K A;  3M6B A;  4YWZ A;  4EUZ A;  3PBO A;  4BEN A;  3LR4 A;  2HDS A;  4RYE A;  2VA0 A;  2W27 A;  4KEN B;  4WMC D;  5FQ9 A;  4F3L B;  3ULF A;  1YM1 A;  1XJ4 A;  2XH9 A;  3DTK A;  3F1P A;  4S2O A;  3IWI A;  2HP9 A;  4UA9 A;  3H7W B;  2ZQD A;  1ZTU A;  3KSH A;  4KQD A;  5GHY A;  1PRQ A;  2ZQ8 A;  1PNE A;  3IWQ A;  3VOZ A;  3C8C A;  4JGR A;  4DXB A;  4QHC A;  3SS3 A;  5TGF A;  2GNX A;  2WKQ A;  4Q0J A;  2WKI A;  5EPH A;  3CPT B;  4X1L A;  1IEL A;  1YLY A;  4MN7 A;  4FH4 A;  4JLF A;  2E8J A;  4IBX A;  3Q07 A;  3QP8 A;  1KGF A;  5EM1 A;  1NYY A;  2XLN A;  3L9K A;  2UV0 E;  1BTL A;  3BY9 A;  4WEL A;  3TRC A;  4MEZ A;  4P6Z S;  5EM0 A;  1ZKJ A;  3MSH A;  1MWT A;  1F2K A;  4FCF A;  2HDR A;  3T1S A;  3MR0 A;  3ZGA B;  4GB7 A;  2QJ5 A;  3M2K A;  4JXV A;  4LGW A;  4X68 A;  1OTD A;  4P85 A;  3GRJ A;  4Y17 A;  4DMZ A;  3W8K A;  2Y2J A;  2ZC4 B;  4E3N A;  3FKV A;  3EOI A;  2XD5 A;  1JVJ A;  3DTE A;  5FAQ A;  3H82 A;  4HJ3 A;  5G4Z A;  4XUZ A;  3FPV A;  5KSH A;  3SH9 A;  5FQJ A;  3BLM A;  2ZM8 A;  5KIZ A;  4EQI A;  3PXP A;  3U2A A;  1VET B;  5FAO A;  2JCH A;  5FI7 A;  1J3W A;  3GTC A;  1S0W A;  3UB8 A;  1MY8 A;  4GCZ A;  4OPZ A;  1K57 A;  3A3J A;  4CJN A;  3KX0 X;  3QNB A;  5FDS A;  4QD4 A;  2CMN A;  4OQ0 A;  4NEE D;  3LFV A;  3TJZ C;  4F3L A;  2R78 A;  3W4Q A;  4ZBE A;  3CIT A;  3MBZ A;  3HBR A;  4D2O A;  2PBY A;  3H7W A;  5CTM A;  2WGV A;  4PM7 A;  4JGO A;  1CI8 A;  5DKL A;  4MDZ A;  4PM6 A;  4E3O A;  1K6S A;  4EW7 A;  4RQ9 A;  1ALQ A;  4CLC C;  3HLW A;  4O0P A;  1KE4 A;  4KZB A;  2GX5 A;  2A49 A;  1OME A;  4EEP A;  4G3K A;  3QP1 A;  3IWO A;  4OOY A;  4WYY A;  3HLE A;  1K38 A;  3CPT A;  1GHP A;  4QY6 A;  1FCM A;  4WLA A;  1L2S A;  2PAV P;  3VP1 A;  1PWG A;  1UWP X;  3C7V A;  3W4O A;  2I9V A;  4K0X A;  5DJT A;  2VGL S;  1MWU A;  5I94 A;  5IS1 A;  3UDI A;  4BD0 A;  1MWR A;  4R4S A;  4DN0 A;  1G28 A;  4RVA A;  2O99 A;  2XGN A;  1XFQ A;  2Y2K A;  1XA1 A;  1ONG A;  4DXC A;  4PPR A;  3KYQ A;  4E3I A;  3UNW A;  2FZ0 A;  3IX8 A;  1K0K A;  2PD8 A;  2X71 A;  3QP2 A;  1WYB A;  3PBT A;  1BYW A;  3A3D A;  3UDX A;  5HD3 A;  4DKI A;  3DWK A;  3G35 A;  4XXR A;  4NXB A;  1H5X A;  4O7D A;  3FKW A;  4B4X A;  1O7E A;  3SZT A;  2D01 A;  2WKP A;  2QWS A;  5GLA A;  1HZO A;  3T12 B;  3C4O A;  2V1B A;  5FAS A;  4OLG A;  3EEH A;  3NJA A;  4NET A;  4UEY A;  5HWW A;  2Z6C A;  5KSC A;  2VEA A;  2PDR A;  3CG5 A;  3Q82 A;  5EE8 A;  5AQB A;  1VET A;  2XD1 A;  4GW9 A;  3A3F A;  3N8L A;  4ZRR A;  1LLB A;  4E3L A;  2HP6 A;  2JE5 A;  4ID4 A;  5AJG A;  3TE8 A;  3N6I A;  4KG5 A;  4E3M A;  2ZJ9 A;  1L0G A;  2QKP A;  3LEZ A;  1CK3 A;  3BLS A;  3ZDJ A;  4CLC E;  5MC7 A;  1YAX A;  5CX7 A;  4QWO A;  2NUP C;  1E25 A;  4Z9Q A;  1DY6 A;  1RCJ A;  4Y3I A;  2OLU A;  2HV1 A;  4OQG A;  1W5D A;  2JKT M;  3BWL A;  2X01 A;  3U4L P;  2J9P A;  5HFO A;  4LPZ A;  4BJP A;  3ZNT A;  5FEF A;  1V9Z A;  4LV1 A;  4UQI S;  2J8Y A;  3E4O A;  2WAD A;  3N8S A;  2XA7 M;  4CQH A;  1VHM A;  2OOL A;  3LI8 A;  5EVI B;  1D06 A;  5EUA A;  3S7P A;  1YLW A;  2XF3 A;  2H5S A;  5KZH A;  4LRY C;  2ZOI A;  3HLF A;  4HHD A;  2WZZ A;  3BFF A;  3T1X A;  1P9R A;  2W0N A;  4GZB A;  2VV6 A;  2ZQ9 A;  5M1A A;  2OSU A;  2GDN A;  3ZQ5 A;  3Q1F A;  3O87 A;  4BBV A;  4AFI A;  4HJ6 A;  3AGD A;  4WEK A;  4OQH A;  4EUV A;  2A2L A;  1OJG A;  2PHY A;  3E98 A;  1ERO A;  1YQS A;  4Y7P A;  3Q7V B;  1LI9 A;  2IWB A;  3PBN A;  3UB9 A;  2O0Y A;  4K91 A;  3ZNY A;  4L9E A;  1D1J A;  4GHI B;  1KVM A;  1E4D A;  1MWS A;  3S22 A;  3C30 A;  5HDS A;  3B33 A;  3JVU A;  3FYZ A;  2QZ6 A;  4HH2 A;  3SOI A;  2XRN A;  3CI6 A;  3UB5 P;  5IT5 A;  1NJ4 A;  3QP4 A;  2XRO A;  5FL3 A;  3TG9 A;  2PT7 A;  3BQ8 A;  1SKF A;  4EBL A;  3HUN A;  2V9A A;  3LIC A;  1NWZ A;  2EX2 A;  3MJQ A;  1EW0 A;  2Z2L B;  3UY6 A;  1J9M A;  5C5K A;  1LSX A;  1LSV A;  3A3I A;  1A0K A;  2FFF B;  2M7V A;  1HTZ A;  3IXH A;  1CQA A;  3CLO A;  2OAQ 1;  4OP8 A;  1NY0 A;  4ZDX A;  3FG8 A;  4WUJ A;  2BTF P;  1UGU A;  4X6T A;  3CAX A;  5EOE A;  4PMA A;  5DF9 A;  1PI4 A;  2NUT C;  3RH8 B;  4EES A;  2PR5 A;  2JHE A;  4N1H A;  4HP9 A;  2ZM2 A;  3HLG A;  5A8B A;  3SS5 A;  3M2J A;  3I7J A;  5EFW A;  3PHY A;  2JKR I;  4FUW A;  2QJ7 A;  3WRZ A;  3PR6 A;  4UAA A;  3MMH A;  5JYP A;  2ZC5 B;  1G5U A;  5EVI A;  3MFD A;  1OPX A;  5GLC A;  1H8Z A;  1YSP A;  1CEF A;  5CER A;  3QNC A;  1GHM A;  2QHK A;  2QMI A;  2Y79 A;  4JPM A;  2ZQ7 A;  2O9B A;  4U0X A;  1F9I A;  1YKD A;  5F83 A;  4R3A A;  2CC1 A;  5CRF A;  5HAR A;  3EGX C;  2PBD P;  4R6L A;  1C3B A;  5FAP A;  3MS6 A;  4FTX A;  2INW A;  2P7J A;  3MZE A;  2OLV A;  3A0R A;  3UB7 A;  3ICY A;  4OON A;  3QP5 A;  3NDE A;  3G31 A;  3HL9 A;  5E2F A;  4Y13 A;  4CLC D;  1L0F A;  2R9W A;  1FIK A;  4GN2 A;  1NLY A;  3ZHH A;  4UA6 A;  2X02 A;  3Q7V A;  4Y0O A;  2VGL M;  4R3B A;  5J7E A;  3N7W A;  1ONH A;  5HPF A;  1EI5 A;  2VV8 A;  2XA7 S;  4KG2 A;  5HX9 A;  4GHI A;  3KYZ A;  3NIA A;  2JBF A;  3IT9 A;  3BM6 A;  3IQA A;  1IKI A;  1XJ3 A;  3LIF A;  4I3I A;  4E04 A;  5EV0 A;  3V50 A;  1PI5 A;  3NDG A;  2W1T B;  1N4O A;  4DRT A;  3SW1 A;  3EEA A;  3MQO A;  3UN7 A;  1HD8 A;  3NHQ A;  1H3Q A;  3GDI A;  3JPU A;  4LRX C;  4QPR A;  2ZQA A;  3GV9 A;  5FEG A;  3G6O A;  1YMS A;  2P9V B;  1WE4 A;  1BT5 A;  1TEM A;  1SZV A;  1W8Q A;  1W63 Q;  3VFF A;  1ERQ A;  3E4Q A;  1XGJ A;  5L8M A;  2FFY A;  2B5R A;  3WS5 A;  1FIL A;  2HDQ A;  4IBR A;  3Q7Z A;  3S1Y A;  2XDM A;  2Y2L A;  4KQQ A;  3LY4 A;  5EVI C;  1S66 L;  4HQA A;  4NXG A;  3R4K A;  4JGQ A;  3IH8 A;  4DE2 A;  4X1M A;  4YOF A;  3GR2 A;  2V8F A;  4LFU A;  3NY4 A;  4OKP A;  1XFN A;  4ZJ1 A;  4PM5 A;  5CED A;  4JF6 A;  4CPK A;  3IX4 A;  1V9Y A;  1YLT A;  4OPY A;  2OWJ A;  1SDN A;  3A0V A;  1KGG A;  2HDU A;  4I38 A;  4RX2 A;  2M1C A;  3OPL A;  4UA7 A;  2RCX A;  2DCF A;  4I3A A;  5AQA A;  1PWD A;  2HP5 A;  5F5Y A;  3S7O A;  3V3S A;  3D3O A;  4EER A;  4GD6 A;  2E8I A;  1OTA A;  1ERM A;  1TD5 A;  2W3H A;  3UPO A;  1T18 A;  1OT6 A;  2VV7 A;  1LL5 A;  5GHX A;  2K7S A;  3O88 A;  4S2J A;  5M19 A;  4NXF A;  4UQI M;  4WBG A;  1Q2P A;  5CHJ A;  2EXA A;  3ZG8 B;  1XJ6 A;  4GNU A;  2IWC A;  2B18 A;  2Y2I A;  2VK3 A;  4Q8I A;  4ZAM A;  3OPP A;  1KGE A;  4MBK A;  4HNB A;  1H8M A;  2ZQC A;  2FH5 A;  4NXE A;  4ZJ3 A;  1Y54 A;  4WL9 A;  5GLD A;  1Z6F A;  1I2W A;  2EA9 A;  3G34 A;  4L9F A;  1GSW A;  4DE3 A;  4EV4 A;  3HRE A;  3S7N A;  3HLD A;  3T1Q B;  3EQV A;  2W1T A;  3OPH A;  3A3E A;  5EVL A;  3W2Z A;  3MQQ A;  1VEU B;  3OBF A;  4BL2 A;  2P9V A;  4LEN A;  1M6K A;  1XX2 A;  1TDL A;  4N92 A;  2IWD A;  4S2M A;  3FC7 A;  3VFH A;  4KZ7 A;  5HL1 A;  5DTS A;  1FSW A;  3HUO A;  3LIE A;  3MQ0 A;  1Y4O A;  4KZ5 A;  2KOI A;  3B47 A;  4I5S A;  5CXW A;  1ESU A;  5E2G A;  2EX6 A;  4H6J B;  3KO6 A;  1STZ A;  3WS1 A;  1W7F A;  2Q0O A;  3GEC A;  3BRM A;  5A91 A;  2HPB A;  3EWK A;  2L0W A;  3ZFZ A;  4KZ9 A;  3TW8 A;  3TSG A;  2A3U A;  4ZJ2 A;  2O9A A;  1YT4 A;  5J8X A;  1DRM A;  2EX8 A;  4PHT A;  5J3W A;  1AWI A;  3BW6 A;  4Y0T A;  3VOY A;  1MBL A;  2VGK A;  2XFS A;  1HLU P;  3V5M A;  1VQQ A;  5BOH A;  2V8C A;  2HGV A;  1TF1 A;  1K57 C;  1LT0 A;  3K2N A;  3O3V A;  4PKY G;  2Z2M B;  1OT9 A;  1O07 A;  5CEC A;  1FCO A;  4EBP A;  2OAP 1;  1FCN A;  2JKR M;  2R9X A;  4FSF A;  2Y4A A;  3OCL A;  2H0Y A;  4U0T A;  4X56 A;  4HH3 A;  3IXB A;  5E2H A;  1U60 A;  2G7U A;  2V2F F;  2PD7 A;  3E0Y A;  3LIB A;  5J4E A;  2J3T C;  3MXR A;  1DJA A;  5CHU A;  3F1O B;  2D02 A;  2PU2 A;  3OZH A;  1MZU A;  3RFB A;  4O8G A;  4GDB A;  3L7H A;  2JKF A;  2ZC3 B;  4HEF A;  2XEP A;  4PM9 A;  3CUE A;  4P87 A;  2Z6D A;  1L0E A;  2Y8H A;  4DE1 A;  4UHU A;  4XT2 B;  1FQG A;  2I72 A;  4LLO B;  2BLS A;  5U47 A;  3WRT A;  3RTY A;  1TS6 A;  3VSL A;  4JXS A;  4L9G A;  4KUO A;  5IHV A;  4HOI A;  1VEU A;  3HLC A;  3LR0 A;  3LID A;  4PKY A;  5DKK A;  1FR6 A;  3B3X A;  1TDG A;  2WGW B;  3GMW A;  1JWV A;  5L2F A;  4MN5 A;  1OTB A;  4MBF A;  2LB9 A;  1PW8 A;  2Y2P A;  4DJ3 A;  1DJB A;  1UWN X;  2WKE A;  3BYD A;  1MKI A;  5EEC A;  1LL9 A;  2WK0 A;  5HAP A;  2V0W A;  4DE0 A;  1RGY A;  1NZU A;  3T4Q A;  4MMN A;  1GHI A;  4H6J A;  1FSY A;  5FI2 A;  5HZH A;  3IHB A;  1BLS A;  4OPQ A;  3DTM A;  3LIA A;  2WGI A;  1XA7 A;  4E6W A;  5EOO A;  1QMF A;  1W8Y A;  3VSK A;  1K4F A;  2VLG A;  3RXX A;  3KSI A;  2XK1 A;  2HJ9 C;  3UDF A;  3UE1 A;  2Y2G A;  4M3K A;  3PBS A;  1DP8 A;  3RJU A;  5I5L A;  5DTK A;  2WZX A;  4GS9 B;  4MN6 A;  3C5A A;  4NKP A;  3UE3 A;  1IOU A;  1QME A;  4EWF A;  4II7 A;  4IUH A;  4JXW A;  4C75 A;  5F69 A;  4WZ4 A;  1E3U D;  3BQA A;  3NBL A;  2IA2 A;  3PBQ A;  4PM8 A;  2GZA A;  4HES A;  5HAI A;  4B9O A;  3CUE C;  2Y2Q A;  2PRF A;  5EVI D;  3ZVT A;  1OJ5 A;  4NK3 A;  4KUK A;  4KZ8 A;  3IBR A;  3F1O A;  4FD8 A;  3BEC A;  5E43 A;  5FQK A;  1IYP A;  3FV7 A;  5JYO A;  2Y2H A;  1K55 A;  2PYP A;  1ZC2 A;  1G6A A;  1GSV A;  3MXQ A;  3HLB A;  1P0Z A;  5HL6 A;  3ITB A;  5F6A A;  2W3G A;  5TBM B;  5G4Y A;  4Y0U A;  1ES3 A;  2WYX A;  5F1F A;  2Y2O A;  1KE0 A;  1DP6 A;  1SHV A;  1L3L A;  1PFL A;  4B4Z A;  1NRJ A;  3SH8 A;  4X69 A;  3W4P A;  1ACF A;  1K56 A;  4EBN A;  4XT2 A;  4Z1W A;  2HZ5 A;  3NCK A;  1TS8 A;  3VP2 A;  2ZL1 B;  5GLB A;  1F98 A;  2K31 A;  3TOI A;  1YLJ A;  4GD8 A;  2B02 A;  4ETX A;  4OOM A;  1SKO B;  3LCE A;  4KQO A;  1K54 A;  2WGW A;  4CLC B;  3IX3 A;  3VMA A;  3OCN A;  5A90 A;  1H0M A;  1CJF A;  1F5M A;  4N9K A;  3IF6 B;  3H9W A;  3DWZ A;  1T1C A;  2EX9 A;  2ZMA A;  4HJ4 A;  5FAT A;  1BUL A;  4L0L A;  4DDS A;  4R0Q A;  5FA7 A;  1ESI A;  4H8R A;  3O86 A;  3C4P A;  2J9O A;  2G2U A;  3EQU A;  3PAG A;  4FH2 A;  1XJ2 A;  5CTN A;  5DFX A;  3E2K A;  1P97 A;  4IHQ A;  4S2P A;  5FQM A;  4JKT A;  4S2N A;  2J7V A;  3GVB A;  3LYX A;  4YIN A;  4G3V A;  2O9C A;  4GS9 A;  4KZA A;  1S6R A;  3VV4 A;  3BY8 A;  3P98 A;  3T4J A;  3C7U A;  2P08 A;  2Q9N A;  1N9O A;  3HJK A;  4GKU A;  3RXW A;  1AXB A;  3IXG A;  3JYI A;  2BG1 A;  2B95 A;  3IHA A;  4X55 A;  3K3C A;  2WKH A;  3DTI A;  2PR6 A;  3JVV A;  1MC0 A;  3N8R A;  3HUM A;  3V3R A;  1GA9 A;  4IVK A;  5HDD A;  5HSQ A;  2C5W B;  3R7W B;  5HDC A;  4OLD A;  1GA0 A;  2KX6 A;  1DJC A;  4YFM A;  2W3D A;  1XKZ A;  3ZCZ A;  4LCL A;  5AVE A;  4JF4 A;  5TBM A;  2XSS A;  4GJ4 A;  1X0O A;  5HWV A;  3MZF A;  4R38 A;  5CGS A;  3UE6 A;  1NRF A;  2BAS A;  4B93 A;  1K54 C;  2H10 A;  4R4R A;  1IKG A;  1FOF A;  1PZO A;  1KE3 A;  4OP5 A;  4RX3 A;  4ME4 A;  3GSG A;  2PYR A;  2ZL1 A;  4QB8 A;  2AVX A;  3M6H A;  4Y2F A;  2ZMF A;  3LGO A;  3ITA A;  2W3F A;  4BL3 A;  2ZLY A;  4BD1 A;  1SKO A;  2A24 B;  1ZHH B;  4CLC A;  3LY3 A;  2VJW A;  1ES5 A;  2P04 A;  4OVD A;  3IF6 A;  3KSG A;  4S2N C;  2J3T D;  3G30 A;  4WMC A;  3KYE A;  5KMW A;  4I39 A;  3BFD A;  4EET B;  4KG6 A;  3DAV A;  3OOV A;  4C3Q A;  3K3D A;  3QP6 A;  2EWV A;  3FPW A;  5DVA A;  4KZ3 A;  3CMZ A;  4LCM A;  1GCE A;  4HY8 A;  1PZP A;  4GOG A;  4EXO A;  3AGF A;  1VB6 A;  1XPB A;  5F82 A;  1Q2Q A;  3PBR A;  1S67 L;  1RGZ A;  5D3O A;  5TR7 A;  2VKS A;  1N9L A;  2V1A A;  3BFG A;  1IFQ A;  3PYP A;  3BFC A;  4EU0 A;  3OPR A;  4LV0 A;  3UPP A;  3UB6 A;  2Y59 A;  2ZC6 B;  2VGJ A;  4I3J A;  3IF5 A;  1XGI A;  4QY5 A;  2ZC7 A;  2JKG A;  3MF0 A;  3G2Y A;  4B88 A;  5AVF A;  3LEQ A;  3CHW P;  1LI0 A;  1YMX A;  2V1Z A;  1RP5 A;  2Y2M A;  4Q0I A;  5DF8 A;  4HIA A;  4O01 A;  5AQ7 A;  4DDY A;  3VP0 A;  2Y55 A;  3F1N B;  1S1Y A;  1Z09 A;  4KZ6 A;  4G3W A;  1ZG4 A;  3D9Y A;  2ZBB A;  3EGD C;  4BBU A;  3Q81 A;  3R7W A;  2ZD8 A;  2V0U A;  1K6R A;  3ZVW A;  2P74 A;  3BFE A;  3IS2 B;  4QJG A;  1I5Q A;  4S2I A;  2JC7 A;  1LL8 A;  1K25 A;  1KDS A;  3BEB A;  4YNR A;  5FI6 A;  4MBH A;  4X53 A;  3HVF A;  5L10 A;  1PYY A;  4WZ5 A;  4P6B A;  1CI9 A;  4BBT A;  5EVE A;  3FWL A;  3IF6 C;  3SH7 A;  2W1R A;  3BJN A;  2J3W A;  4C6Y A;  5F1G A;  5HAQ A;  1MPL A;  1K4E A;  4FOF A;  3DBA A;  4R70 A;  5K5B A;  2XR0 A;  4OPR A;  2A24 A;  2QPN A;  3P01 A;  5IU1 A;  3G2Z A;  4Y15 A;  1BLC A;  5HD5 A;  5LBR A;  2ZMV A;  3T4T A;  3UO9 A;  2EWW A;  4BWI A;  1NZO A;  3WS4 A;  1IEM A;  2EFX A;  5AQ9 A;  4E3K A;  4HBT A;  4ETZ A;  3P7N A;  4IJG A;  4WN5 A;  1KVL A;  1W79 A;  1S4R A;  5TFQ A;  3UPN A;  2LB5 A;  1OTE A;  5F68 A;  4NG2 A;  5TJJ A;  4R1G A;  5HPI A;  1SCW A;  1P9W A;  1S1Z A;  4OQI A;  1YLZ A;  3VP3 A;  2PU4 A;  4N1X A;  4E3J A;  2W3E A;  2C6W B;  1N9B A;  1BSG A;  1VM1 A;  3D4F A;  5CEB A;  4Y5F A;  3SS4 A;  5A92 A;  3OC2 A;  2DNS A;  4BQM A;  2HF6 A;  2GJ3 A;  4OOL A;  1BLH A;  3S7Q A;  3NOT C;  3A0S A;  3MXS A;  4DF6 A;  2YKH A;  5GL9 A;  1FR1 A;  3WS0 A;  1NLZ A;  4X25 A;  2V20 A;  1W63 M;  3UMD A;  1XXM A;  1N9N A;  1I2S A;  3IBJ A;  1JWZ A;  3ZYT A;  3OLO A;  3F1N A;  3LUQ A;  4MLL A;  4WZ5 C;  2Y2N A;  5FDH A;  1TS0 A;  4K08 A;  4Q0H A;  3V67 A;  4JF5 A;  4WEJ A;  1PIO A;  1T19 A;  3IS2 A;  3VOL A;  1D7E A;  1EWZ A;  3T4L A;  1JNU A;  4ARZ B;  1HVB A;  3V39 A;  5FSR A;  2YKF A;  4IUK A;  3HJI A;  2OV5 A;  1YPR A;  4KZ4 A;  3QHY A;  3CJM A;  1T1A A;  1IYO A;  2ZM0 A;  3D72 A;  4LV2 A;  1GSX A;  5CHM A;  4LRZ E;  4R3J A;  4M4X A;  5E2E A;  4BMW A;  5M18 A;  1JWP A;  2Y91 A;  4WF0 A;  4PAU A;  2DRW A;  1ODV A;  3S4X A;  1G6O A;  4R23 A;  1IYS A;  5FQI A;  2L4R A;  3VE3 A;  1JTG A;  3NUL A;  1K56 D;  4D60 A;  4EQ1 A;  4K0W A;  3G32 A;  4HI4 A;  1XP4 A;  1JTD A;  3B42 A;  3NI9 A;  2OWH A;  5CGW A;  1KOU A;  2XQZ A;  4LV3 A;  1NYM A;  4U3T A;  2KDK A;  2H28 A;  5DJU A;  5DFY A;  1LHY A;  1H8Y A;  1BLP A;  1SDE A;  3MKF A;  2EFU A;  4ESP A;  1WA9 A;  4A5R A;  2HJE A;  3C38 A;  3O5Y A;  4HBU A;  4JBF A;  3IXD A;  4S2K A;  1CEG A;  3LR3 A;  3E4P A;  2QYB A;  4JXG A;  4P6Z M;  2XFT A;  4N9L A;  5HWT A;  1T1B A;  1YSQ A;  3FZC A;  3N4I A;  3F1P B;  3ZG0 A;  3P09 A;  4S2L A;  2KLI A;  4ZTK A;  3NC8 A;  4HP4 A;  4MNR A;  5A93 A;  3MFX A;  4GLQ A;  2J80 A;  1M40 A;  4WM9 A;  3T4O A;  3MZD A;  3LO7 A;  3NOP C;  1IYQ A;  1TVF A;  4P0M A;  3LI9 A;  4IVI A;  5G18 A;  5DTT A;  2RL3 A;  1ES2 A;  3HCY A;  4BLM A;  1ZG6 A;  4KQR A;  3WS2 A;  2DMW A;  3T4S A;  1ES4 A;  3CWF A;  2K2N A;  3ZG5 A;  2G2W A;  1MKM A;  2WUQ A;  3AGE A;  3MKE A;  4ARZ A;  3VE4 A;  2VX8 A;  1WYC A;  4JGP A;  4DJ2 A;  3G4P A;  1YLP A;  4XUX A;  3UE0 A;  1PWC A;  1BUE A;  3DW0 A;  2JN7 A;  2M7U A;  4QU3 A;  2ACG A;  1E3U A;  2MJ6 A;  3IH9 A;  2VZW A;  3CZD A;  4RA7 A;  3T1R A;  3WWX A;  3ZG7 B;  4E6X A;  2WAE A;  1DP9 A;  2H0T A;  3PTE A;  1S4S A;  4F94 A;  1G68 A;  5CGX A;  2Q9M A;  3PAE A;  2EXB A;  1BZA A;  4OH0 A;  1LSW A;  3E2L A;  3C2W A;  1Y28 A;  3VP4 A;  1KDW A;  3LR5 A;  2WAF A;  4IED A;  1L0D A;  3GQZ A;  3H82 B;  3T50 A;  2L1M A;  1MXO A; 
#chains in the Genus database with same CATH homology
 2PHY A;  2HGV A;  1TF1 A;  3E98 A;  4EEU A;  1LT0 A;  3K2N A;  3PBR A;  1S67 L;  4PKY G;  4MCW A;  2VKS A;  1N9L A;  1OT9 A;  2V1A A;  1TS7 A;  2JKT I;  2ZOH A;  1IFQ A;  3PYP A;  4EU0 A;  2OAP 1;  3PBN A;  3UB9 A;  3UB6 A;  2JKR M;  2WKR A;  2O0Y A;  4FSF A;  4I3J A;  1OTI A;  3OCL A;  3KSF A;  4HH3 A;  4L9E A;  2G7U A;  3E0Y A;  3LIB A;  2PD7 A;  4GHI B;  5J4E A;  3UME A;  3MF0 A;  2J3T C;  3C30 A;  3NOU C;  3T4K A;  5HDS A;  5AVF A;  4YWZ A;  3B33 A;  3PBO A;  3JVU A;  3F1O B;  2D02 A;  3LR4 A;  1MZU A;  4HH2 A;  3RFB A;  2VA0 A;  2W27 A;  2XRN A;  3CI6 A;  4F3L B;  4O8G A;  3ULF A;  5IT5 A;  1XJ4 A;  4Q0I A;  2XRO A;  4HIA A;  4O01 A;  3F1P A;  5FL3 A;  2PT7 A;  3F1N B;  3BQ8 A;  1S1Y A;  3H7W B;  2V9A A;  1ZTU A;  3KSH A;  3LIC A;  4G3W A;  1NWZ A;  2ZBB A;  3CUE A;  3EGD C;  4BBU A;  2Z6D A;  3MJQ A;  2Y8H A;  4KQD A;  3R7W A;  2V0U A;  4XT2 B;  1EW0 A;  5C5K A;  4LLO B;  3RTY A;  1LSX A;  1LSV A;  1TS6 A;  3C8C A;  3IS2 B;  4JGR A;  2M7V A;  1LL8 A;  2GNX A;  2WKQ A;  4L9G A;  4KUO A;  4Q0J A;  4YNR A;  3CLO A;  4HOI A;  2OAQ 1;  3LR0 A;  3LID A;  4PKY A;  5DKK A;  3FG8 A;  4WUJ A;  1UGU A;  3CAX A;  4BBT A;  4MN7 A;  4MN5 A;  1OTB A;  5DF9 A;  2LB9 A;  2NUT C;  3RH8 B;  4DJ3 A;  2W1R A;  3BJN A;  4EES A;  2J3W A;  2PR5 A;  1UWN X;  2JHE A;  4HP9 A;  3BY9 A;  4WEL A;  3TRC A;  5A8B A;  4P6Z S;  4FOF A;  3DBA A;  5EFW A;  3PHY A;  2JKR I;  4R70 A;  2V0W A;  2QJ7 A;  5K5B A;  3PR6 A;  3T4Q A;  2A24 A;  4MMN A;  3P01 A;  5HZH A;  4H6J A;  5IU1 A;  3MMH A;  5HD5 A;  5LBR A;  2ZMV A;  3T4T A;  3LIA A;  1OPX A;  2EWW A;  4BWI A;  1YSP A;  3MR0 A;  2QHK A;  2Y79 A;  2QJ5 A;  2VLG A;  2O9B A;  3KSI A;  2HJ9 C;  1OTD A;  1F9I A;  1YKD A;  4R3A A;  4ETZ A;  3P7N A;  4DMZ A;  4IJG A;  4WN5 A;  3PBS A;  1DP8 A;  3EGX C;  5I5L A;  4GS9 B;  4MN6 A;  3EOI A;  4R6L A;  1S4R A;  4NKP A;  3UE3 A;  1IOU A;  2LB5 A;  1OTE A;  5F68 A;  5TJJ A;  5HPI A;  2INW A;  4II7 A;  2P7J A;  3A0R A;  1P9W A;  4IUH A;  1S1Z A;  3H82 A;  3UB7 A;  3ICY A;  4HJ3 A;  5G4Z A;  5F69 A;  4CLC D;  3BQA A;  2IA2 A;  3PBQ A;  3FPV A;  2W3E A;  1NLY A;  5KSH A;  2VGL M;  5J7E A;  5HPF A;  2GZA A;  5KIZ A;  3PXP A;  4EUV A;  2VV8 A;  3U2A A;  4B9O A;  2XA7 S;  4Y5F A;  3CUE C;  3OC2 A;  3UB8 A;  2HF6 A;  4GHI A;  4GCZ A;  2GJ3 A;  4OOL A;  3S7Q A;  3KYZ A;  3NOT C;  1OJ5 A;  3A0S A;  4KUK A;  2YKH A;  3KX0 X;  3IBR A;  3F1O A;  2CMN A;  1XJ3 A;  4NEE D;  3LIF A;  3LFV A;  4I3I A;  2PYP A;  4E04 A;  1NLZ A;  3TJZ C;  4F3L A;  2R78 A;  2W1T B;  1GSV A;  3MXQ A;  1W63 M;  3SW1 A;  3EEA A;  1P0Z A;  1N9N A;  5HL6 A;  3MQO A;  3UMD A;  5F6A A;  3CIT A;  3IBJ A;  2W3G A;  3NHQ A;  5TBM B;  1H3Q A;  3GDI A;  5G4Y A;  3ZYT A;  4LRX C;  3OLO A;  4QPR A;  3F1N A;  3LUQ A;  1DP6 A;  3H7W A;  3G6O A;  4JGO A;  1NRJ A;  1TS0 A;  4K08 A;  5DKL A;  4Q0H A;  3V67 A;  4MDZ A;  4EW7 A;  4RQ9 A;  4XT2 A;  4Z1W A;  4CLC C;  4WEJ A;  1W63 Q;  4O0P A;  1TS8 A;  1T19 A;  3IS2 A;  3VOL A;  1D7E A;  3T4L A;  1JNU A;  4ARZ B;  3E4Q A;  2GX5 A;  1F98 A;  2K31 A;  5L8M A;  4EEP A;  4G3K A;  2B02 A;  4ETX A;  2YKF A;  4IUK A;  3HJI A;  4WLA A;  4OOM A;  1UWP X;  1S66 L;  4KQO A;  4HQA A;  4NXG A;  4CLC B;  3R4K A;  4JGQ A;  2I9V A;  5DJT A;  2VGL S;  1T1A A;  3OCN A;  4YOF A;  5IS1 A;  1F5M A;  3D72 A;  3H9W A;  1XFN A;  1T1C A;  4DN0 A;  1G28 A;  1GSX A;  4HJ4 A;  2O99 A;  4L0L A;  4LRZ E;  1XFQ A;  1V9Y A;  4M4X A;  4BMW A;  2OWJ A;  4WF0 A;  4PAU A;  3A0V A;  1ODV A;  1G6O A;  3KYQ A;  3EQU A;  1XJ2 A;  4I38 A;  2L4R A;  2FZ0 A;  5DFX A;  3VE3 A;  1P97 A;  2M1C A;  2PD8 A;  4IHQ A;  4EQ1 A;  3PBT A;  4HI4 A;  1BYW A;  5HD3 A;  3B42 A;  4I3A A;  2OWH A;  5F5Y A;  3S7O A;  3D3O A;  4EER A;  1KOU A;  3LYX A;  1OTA A;  4NXB A;  4G3V A;  1TD5 A;  2W3H A;  2O9C A;  2KDK A;  2H28 A;  1T18 A;  5DJU A;  4GS9 A;  1OT6 A;  2VV7 A;  2D01 A;  2WKP A;  5DFY A;  2QWS A;  3VV4 A;  2K7S A;  3BY8 A;  4NXF A;  1WA9 A;  4UQI M;  3T4J A;  2V1B A;  3HJK A;  2HJE A;  1N9O A;  2P08 A;  3C38 A;  3O5Y A;  1XJ6 A;  3EEH A;  2B18 A;  3NJA A;  4UEY A;  5HWW A;  2Z6C A;  3LR3 A;  3E4P A;  3K3C A;  2QYB A;  2VEA A;  2PDR A;  4P6Z M;  5HWT A;  4HNB A;  1H8M A;  1T1B A;  2PR6 A;  3JVV A;  1YSQ A;  1MC0 A;  2FH5 A;  4GW9 A;  3F1P B;  4ZRR A;  4NXE A;  4WL9 A;  2KLI A;  2EA9 A;  4HP4 A;  5AJG A;  5HDD A;  5HSQ A;  3R7W B;  5HDC A;  3TE8 A;  3MFX A;  4L9F A;  4GLQ A;  1GSW A;  2J80 A;  3S7N A;  2KX6 A;  3T4O A;  3EQV A;  2QKP A;  3NOP C;  2W1T A;  4CLC E;  2W3D A;  5MC7 A;  1YAX A;  5CX7 A;  5AVE A;  2NUP C;  3LI9 A;  5TBM A;  4Y3I A;  2XSS A;  4GJ4 A;  1X0O A;  2HV1 A;  5HWV A;  4R38 A;  3UE6 A;  2BAS A;  2JKT M;  3BWL A;  3W2Z A;  3MQQ A;  4B93 A;  3HCY A;  3OBF A;  2DMW A;  3T4S A;  3CWF A;  2K2N A;  4LPZ A;  4BJP A;  3FC7 A;  1MKM A;  4ME4 A;  2PYR A;  1V9Z A;  4ARZ A;  3VE4 A;  2VX8 A;  3LIE A;  3MQ0 A;  4Y2F A;  4JGP A;  4DJ2 A;  4UQI S;  2ZMF A;  2KOI A;  3B47 A;  2W3F A;  4I5S A;  3E4O A;  2JN7 A;  2M7U A;  2A24 B;  1ZHH B;  2XA7 M;  3KO6 A;  1STZ A;  4H6J B;  4CLC A;  2MJ6 A;  4CQH A;  1VHM A;  2OOL A;  3LI8 A;  2VJW A;  2VZW A;  3GEC A;  1D06 A;  2P04 A;  3S7P A;  3KSG A;  3EWK A;  2L0W A;  2J3T D;  3TW8 A;  4LRY C;  2ZOI A;  4HHD A;  1DP9 A;  2O9A A;  1P9R A;  1S4S A;  2W0N A;  1DRM A;  2VV6 A;  4I39 A;  4EET B;  4PHT A;  3OOV A;  5J3W A;  3ZQ5 A;  3K3D A;  3BW6 A;  2EWV A;  3FPW A;  1LSW A;  4HY8 A;  4BBV A;  4AFI A;  3C2W A;  1Y28 A;  3LR5 A;  4HJ6 A;  4EXO A;  4WEK A;  3H82 B;  3T50 A;  2L1M A;  2A2L A;  1OJG A;  1VB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...