5F6FA

S. aureus mepr g34r mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
141
structure length
141
Chain Sequence
QSNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQRHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S. aureus MepR G34R Mutant
rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
molecule keywords MarR family regulatory protein
total genus 54
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f6fA00
1WI9A 1ULYA 4LB5A 2VONA 1T38A 1R7JA 1H9TA 4Y13A 2PEXA 1R5GA 3FF5A 3ECOA 4GYGA 5E1ZB 2L3DA 5HDNA 2V6CA 1QBJA 5FFZA 1IZ1A 1FYKA 3PFIA 1BIAA 1P4XA 1IUYA 4NQWA 5A2QZ 4PDKA 4LG0A 2XAGA 2LF7A 2XRNA 4JK1X 4RGUA 1DDNA 5D6EA 1BBYA 3KLNA 2M1BA 1YO5C 1Z05A 2RN7A 5H6RA 5HS9A 1GHCA 1HW5A 5LEJA 4I0AA 2G7HA 1P2FA 3GF2A 1BI1A 5BS6A 3G73A 5F64A 3TOBA 3JAMK 4N9HA 3ELKA 3HRUA 1ZHFA 5J8CA 4U0YA 1BI0A 4M71A 1TTYA 5L3BA 1YIOA 4BHCA 4A12A 3K1PA 1YS6A 1HSTA 2RVCA 4YIFA 3BPVA 3JTHA 1WKMA 5LEKA 4R8HA 5IT9Z 1D3YA 3QU3A 1ZRFA 1ON2A 5FO5A 3T8TA 1RUNA 2E7XA 3IRQA 3WTVC 2DTRA 4P5OA 2WWYA 1IXCA 2KJBA 3RIRA 5E8IA 3L2CA 1EV7A 1MJBA 2VT2A 2QBYB 4LLGF 3RYRA 2O6GE 2FXAA 2UZKA 1F5TA 2HOEA 2FBIA 3JW4A 5FFXA 4UUVA 1HKQA 3LA2A 3TDZC 4G7ZF 4A5MA 3ZMZA 1KQ8A 1SD7A 5ICEA 1ZG5A 5EEGA 3T8RA 4AIJA 2F5DA 3I4PA 5JI6A 4LG0B 1IN4A 1G4DA 1UCRA 3M9AA 1FY7A 4WF2A 2Q0OA 3KP4A 3F6OA 1J9IA 3F6VA 5CLSA 3FZVA 2MH9A 3LAPA 2GA2A 4U88A 3NEUA 3BROA 5BMZA 2E7WA 2C6YA 1UFMA 3GZ5A 5TRDA 2K27A 3R6SA 1PDNC 3VODA 4GXOA 2MLGA 3ULQB 2PG4A 3DV8A 4H0EA 5D8KB 4B09A 2OQGA 2LKPA 3V7RA 4U0WA 5LBQA 2IP2A 3N97A 2FSWA 3L09A 3TQNA 3P9CA 2Z3YA 2QLZA 3T0YA 3GFLA 4A5NA 1FSEA 3KEOA 4QLCU 2DBBA 3KP3A 4A0YA 3QPHA 2FMYA 3LFKA 4R79A 3V8JA 2DW4A 1LNWA 1ZN2A 4N9IA 3FWEA 1T39A 1E2XA 4KIGA 2BEOA 2NNNA 5DCMB 4JBAA 1ZG1A 1OR7A 1OPCA 2D1VA 1P4AA 2YU3A 3V8LA 4ZH4F 1MJ9A 4WXHA 4M74A 4L5IA 5CVIA 2Z9OA 2L4MA 2DU9A 2J5PA 2V1DA 5E1XA 2L4AA 5DCFA 5LGTA 3JSOA 1B6AA 2PBIA 1TQPA 2F5EA 4U7DA 1HQCA 5L3DA 3HSEA 1I5ZA 2H94A 3BP8A 4EM2A 2Z5UA 1QO0D 1YYVA 2ISYA 4IHTA 2R7FA 2VC0A 4I01A 4WWCA 1IW7F 3GUDA 1MD0A 3H3ZA 1KYZA 1J2XA 1XGNA 1I1GA 4IRGA 2Y75A 3J81Z 4P55A 2O61A 2F5FA 1IRFA 3R60A 1KYWA 2ZNZA 3GFMA 2W84A 2RQPA 3Q9SA 1XSDA 2YPRA 1ZGJA 3SZTA 2XHKA 5HS8A 4Q5SF 4G6QA 2RC4A 5CVJA 1OYIA 3GO5A 4ZYEA 1O3QA 3K1NA 5HVQC 2O3FA 2BGCA 4RGSA 2QYOA 2FMLA 3MCZA 1PUEE 2FA5A 1O7FA 1UHMA 1J7KA 2IA1A 3QAHA 4ESFA 1FBSA 1BJAA 2P5KA 1T6SA 1JHFA 1BIBA 2CO5A 2FBHA 3WTWC 1K78A 3BPXA 4IRHA 4A0ZA 3ZMDA 4ZYHA 4QWQA 2A3SA 2H6BA 3HRTA 1ZRCA 5LRRA 3CUQA 2STTA 5D6FA 4LGWA 2DPDA 1MDMB 1T2KA 5D5VB 2QM3A 1XN7A 1BI2A 4LMYA 3R61A 3KP2A 3WTXC 3RI4A 3ABUA 4UXNA 5LGNA 4M9SA 2P5VA 4MQVA 2EA2A 4CXFA 4O3MA 1XB4A 1Q1HA 3WODF 5FD6A 1LDJA 3J80K 4HYEA 1FX7A 2IPQX 4G7OF 2ZFWA 2V79A 2JPCA 3P9KA 4BYYA 3JSPA 3C18A 2LDUA 2KIMA 2VBYA 1G6NA 4HV6A 3FXUA 2NYXA 1LJ9A 2FRHA 5FLXK 2EFOA 1J75A 2MC3A 2CSOA 4UVCA 1FPQA 1XGOA 2OZ6A 2GIVA 2HQRA 4L5JA 4KN7X 3I53A 3FM5A 1HXDA 5KVRA 2FF4A 1BM9A 3RDIA 1NHAA 3IWZA 3GZ6A 4I0BA 3K2ZA 2FEZA 4L9VA 3IL2A 3IHUA 3KP5A 1USSA 4G6DA 5K1YA 1O57A 3PQKA 3DKWA 3AAFA 1K7AA 4ENKA 3L7WA 3PQJA 1ON1A 1LDDA 3K1MA 2RDPA 4JQFA 5LRSA 3Q9VA 5DD4A 4B8XA 2E1CA 2EJRA 1FC3A 2KJCA 4ENMA 1QZYA 5L3EA 1OKRA 5E20A 1U8RA 3CO6C 5HDKA 3BOQA 2ACJA 3HSFA 3B73A 3MQ0A 1QPMA 5EEHA 3I58A 2JSCA 1VTNC 1O3RA 2E1NA 2ELHA 2IT0A 4IF4A 3HHGA 2QZ8A 5L3GA 1XMKA 1FZPB 2DQRA 2UXNA 2Z99A 4WCGA 2ADUA 2UXXA 2A6EF 1IRGA 3D0SA 1L0OC 4EGYA 3J7AO 2AS5F 1U5TC 2ZXJA 1EH7A 1SD5A 3KP6A 1S29A 2B0LA 1IXSB 2OA4A 3ML6A 2GAUA 3J80Z 4ZZDA 5D5UB 3M7GA 4MTEA 1F1ZA 4UVAA 3FMSA 4CZZA 1PP7U 5TJJA 5CYVA 1X3UA 2A6HF 2F2EA 4AVPA 4IRIA 5BQTA 2A5YB 3KETA 4MHGA 4ZYDA 1W4MA 2OQRA 2FU4A 2XGXA 4HQMA 2HR3A 3LA7A 3MFKA 3RTRA 2ETHA 3GFIA 3ZMTA 4A2UA 1I27A 2HYFA 2ISZA 4UNOA 2OU2A 3V7CA 1USTA 3HIFA 1T98A 2EWNA 3COAC 4KUMA 3RYPA 3M8FA 4HLXA 3MWMA 4I2OA 1ZLKA 1XDSA 1SD6A 4MNUA 4YFKF 3ZMSA 5LHGA 3ZPLA 1V4RA 4K2EA 4LLNA 3E3VA 4RB2C 2W24A 2JZYA 1P6RA 3DP7A 3O6BB 2LSOA 3DPLC 1TQIA 3P7NA 3F8NA 3TDUC 1CF7B 4HX8A 4EJUA 3H92A 3U9GA 1B9MA 3BJ6A 3REOA 2JT1A 3QP5A 3RKYA 1LEAA 3EUHA 2K86A 5DDGA 3CLOA 4AIHA 2YR2A 2QBYA 3BJOA 2R7DA 1XDUA 2QQ9A 4XRFA 1R23A 3RJPA 4U7BA 3R0AA 3E5XA 1WRJA 2MH2A 1EH8A 2CG4A 3RPUA 2H27A 5ICCA 1GXQA 2HFHA 2COMA 2DAOA 2DO7A 2DI3A 4M9XA 4BHPA 2ZBKA 1SMYF 4LK0F 2WTEA 1D5VA 4F7ZA 2HTSA 2IA2A 2W25A 2Q8KA 4HDUA 2XKOA 3GWZA 4Z2YA 1OYYA 2M30A 2X0LA 3JAMZ 4LB6B 5ILVA 4E70A 2KIUA 2DK8A 5D5WB 2M8EA 1V3FA 3C3WA 1B9NA 5D4RA 1GVJA 2BV6A 4P9FA 4BQAA 1R1VA 3ISPA 4HAMA 2PMHA 1DPRA 2EB7A 3KZYA 1IN7A 3Q5FA 2EFPA 4HLYA 4A6DA 4EMSA 2P7VB 1FBUA 4ESJA 1U5TA 5LLQA 1U78A 2FNAA 4CICA 5JR3A 3WU0A 1I6XA 4OU0A 3E97A 4KFCA 4EGZA 2OBPA 4HX4A 5FGMA 3T5XA 1YW9A 4XSXF 5LHIA 3CDHA 2IRFG 3TOAA 3WTUC 2Q2EA 1B4AA 1U5TB 4O5VA 4PGGA 2EFWA 1MZBA 1Z7UA 1REPC 1ZGAA 4MEYF 3FHZA 2H09A 1YW7A 2A68F 4RGRA 4TV7A 3RKWA 2O03A 4IHSA 2ZMEB 1S7OA 5BPIA 2Y0MA 2DPUA 3HUGA 1YS7A 3VEPA 5F6FA 3WTTC 2QWWA 1ZAOA 3O2PE 5E1WA 1YLFA 2XAJA 3FMQA 3F23A 4ZYGA 3CTAA 2A61A 5K5RA 2XV4S 4OOIA 4OIRF 1WSUA 3SZPA 1A04A 4FHTA 4FX4A 1QGPA 5HS7A 2GXBA 4I98B 4EJTA 3F22A 5IT9K 2NAZA 4UV8A 2VT3A 3KLOA 4HF1A 5DD8A 5HLHA 4RGXA 1EH6A 1T0FA 5LHHA 1BN5A 4YIIA 1IN8A 3F8FA 4KMFA 3EETA 4IVNA 1QQIA 5D4SA 5ED4A 4L18B 3ERED 3G3ZA 4CO8A 2V1XA 2W85A 3I59B 1LQ1A 4KIBA 2HZTA 4XLNF 2VBZA 4S05A 1YFHA 1AOYA 3I64A 3KFWX 5AONA 3LAJA 3EDPA 3TKYA 4HQEA 4U0VA 2FQ3A 4ETSA 5H20A 1DP7P 3K0LA 5FB2A 1BI3A 1GXPA 3HHHA 3BY6A 4EV0A 1HW1A 3HRSA 3B02A 1BOAA 3TO7A 3H3UA 4Q4ZF 3ZMUA 1TBXA 3MAJA 2AXLA 1W5TA 4HDVA 1IN6A 3ABTA 2PLYA 1KU2A 1QZZA 3V4GA 1QNTA 2DFIA 3HOTA 1DPUA 1XSVA 2EV0A 2M5WA 2JPBA 2VXZA 3ZP5A 2P4WA 3KCCA 1G3TA 3L9FA 5AIPA 3WGHA 4ESBA 2IJLA 1TW2A 3HTSB 5ICGA 1OMIA 3BJAA 2NNYA 5K5QA 1JGSA 2VBXA 1FYMA 1ZH5A 3F72A 5FLXZ 1RI7A 4EJOA 1G3SA 5JFRA 4RB0A 4HF0A 3IC7A 1FP1D 1IN5A 4WXCA 1XCBA 2VODA 3ZN1A 3N4MA 2HS5A 1I1SA 1ONVA 2K4JA 2OAZA 2V9VA 2K02A 4RAZA 4LLLA 1MGTA 3DQVC 3F3XA 2ZMEA 4ENNA 2HWVA 2K7LA 1FOKA 2FE3A 2FOKA 2MD5A 1BC8C 4GGGA 1S8NA 1G3WA 3ROUA 2OZUA 3L00A 1FLIA 1JHHA 4FT8A 4M72A 1LDKB 4HA8A 4ENJA 1TQMA 4BNCA 1XGMA 2DLLA 3EYIA 3WTZA 2IVMA 3E6CC 2VOPA 4PCQA 2GWRA 3U1DA 2KRFA 2XKPA 1FBQA 5KK1A 1AWCA 4YFXF 2JRTA 3BDDA 3CO7C 3IKTA 2X4HA 4D0PA 3I71A 1TNSA 1HKTA 1O3SA 2D2WA 2XAHA 3DF8A 2ZO4A 4AWXB 1YQAA 3U2RA 3V7SA 3GLXA 1J0RA 1UHWA 2G9WA 1RZ4A 2RGVA 3W6JB 1HBXG 5BPDA 4PZJA 3GFJA 1MKMA 2IA0A 4ON0A 5DEQA 1XMAA 4GO1A 5DUKA 1XSXA 4G9YA 4KIFA 4KDPA 1Z1DA 2A07F 2HKXA 3I54A 5J8FA 2ZJ2A 1K78B 1D8JA 3C1DA 4EM1A 1KU7A 1W7PA 1Z91A 1FP2A 3QOPA 3LSTA 2BE5F 4WX9A 1ZARA 3ECHA 2VOOA 1R00A 1L3LA 2MA3A 1SAXA 2HKOA 4LFUA 5HLIA 3DXJF 3E5QA 2OD5A 2TDXA 3F21A 3ZMVA 2DK5A 2EV6A 2J5OA 4KT5C 1HKSA 1R58A 4UVBA 5K5OA 3HYIA 1C0WA 3GXOA 3SFZA 4CGZA 1WQ2A 1OYWA 4L9JA 2CWEA 4L9TA 1SFUA 1F4KA 3QP6A 2QENA 4EM0B 4OMZA 2XAFA 1KQ9A 4M9ZA 2PJPA 3WGIA 2HEOA 3R0JA 1B1BA 2QUFA 1LVAA 3RPQA 2K4BA 5E17F 2H6CA 3GW2A 2PMUA 2M45A 4HW0A 3GVAA 3LQRA 1S7AA 2VE9A 4MGRA 4BXUA 3D5LA 4I7HA 1H0MA 3MEXA 2XAQA 4M73A 1MJAA 2P7CB 1R1UA 1P4WA 3FX3A 2DQLA 2XIGA 4DNCA 4P9UA 3HRMA 2YX4A 1RNLA 2KKOA 4KMUX 4NB5A 2Y48A 2CQKA 3F8BA 2CW0F 3R4KA 2PI0A 5H6QA 1RUOA 5F1RA 3WTSC 5CVRA 1F9NA 2NRAC 3LQQA 3KEQA 1MDMA 1W7PB 2XASA 3S2WA 2O0YA 4R1HA 2MLKA 4BHBA 4HZFA 1ZG3A 2G7UA 3WTYC 2PN6A 2QQAA 1SFXA 4OINF 4A0XA 2YSRA 5D5XB 2VN2A 3GX4X 3KE2A 4I09A 2XVCA 4RB1A 1ZLJA 3C7JA 3TGNA 3JTGA 5A2QK 3MZYA 1YW8A 2CGPA 3T1BA 2FBKA 4P96A 1ODDA 4YG2F 4AIKA 3BZ6A 3I5UA 1UB9A 1TLHB 2GA1A 3BWGA 3FM3A 1HSJA 2CYYA 4Q48A 4FX0A 2R3SA 4NHJA 3M8EA 1BC7C 3EYYA 4CYDA 1D8KA 3FXRA 5L3CA 1IF1A 4LJZF 6PAXA 1SD4A 2GZWA 1TNTA 4OIPF 1S6LA 5HLGA 3K9TA 3WU1B 1U2WA 4Y15A 2D45A 3TO9A 5LGUA 3IKVA 1J5YA 1KA8A 1CF7A 3QU6A 4KICA 3IRRA 2HGCA 5HOOA 1RIOH 3I59A 3LWFA 3EQLF 2W57A 2RNJA 2GQQA 5DV5A 1Y0UA 3I0TA 2UWMA 4HBLA 5AIQA 4YFNF 2O8XA 2HQNA 4L0YB 2QVOA 4G94A 5E8GA 4XSZF 5DCMA 2P6SA 3E6BA 5FD5A 4CDGA 4HF2A 1ZYRF 2P6TA 3HSRA 1Z6RA 4L0ZB 3K69A 2DT5A 3LA3A 1W5SA 4I02A 2WV0A 3FMRA 2M87A 4WXDA 1Z6TA 4HX7A 4KN4X 5HDGA 2HDCA 4EJVA 5ILUA 2JTVA 4DQ2A 2QQBA 4BAYA 3F8CA 1SMTA 2PFBA 1R36A 3SXYA 3WE3A 5IT3A 3CUQC 5DYMA 4OIOF 2VBWA 3GYHX 1XCVA 3OV8A 3SQNA 2XUBA 1STZA 1U3EM 1JXSA 2BBYA 2NS0A 2EA4A 2F5CA 4G7HF 2ZKZA 1WWXA 2EV5A 3O3KA 3GEZA 1FSHA 4KA4A 2MBFA 4A6EA 4KNYA 5CJ9A 1U6GA 1Z9CA 3ZN0A 4UV9A 1TW3A 1IAWA 4XLPF 4AD9A 4S04A 4RAYA 3W6KB 2Z33A 1B59A 1LB2A 1K6OA 3F8MA 2GXGA 4WK8F 1KQ0A 5BOXA 2L02A 4MQ9F 3IWFA 3VB2A 2YX7A 1H9GA 1FWZA 5ERIA 2EFNA 1FNNA 1ZRDA 4PGHA 3WG9A 3HOSA 4GYIA 3SHFA 4G8XA 3E6MA 2KIFA 3CUOA 4UHTA 2RKHA 2P5LC 4RB3C 2LF8A 4IPAA 3KP7A 3WE2A 1R1TA 3E5UA 1SFEA 4CHUA 3M1EA 1W7PD 5JVTA 2XROA 4M6YA 4LD5A 2VC1A 3E6DA 2EK5A 3HTUA 3NRVA 1FT9A 3WGGA 4OMYA 3VFZA 5CVUA 5CVVA 4L9NA 1YG2A 1PP8F 4HOBA 3MZHA 5L3FA 4OIQF 4EVIA 4HV5A 2ZCWA 3RKXA 1K79A 2V1UA 1LEBA 2HTJA 4IXAA 4RS8A 3ZQ7A 3QRFF 4M6XA 1YTYA 2VE8A 2WC2A 4GCVA 4Y17A 1E17A 4LK1F 2CFXA 3DFGA 3P9IA 3DEUA 2EFQA 1R5HA 2ESNA 3TO6A 4ASNA 5JHUA 1IXRC 3DPTA 5ICFA 1XD7A 4XBFA 4ZZLA 2IW5A 1P92A 3KZZA 3V8KA 3FXQA 5E18F 1KU3A 2LNBA 3QPTA 1DUXC 2A69F 2ESHA 1CGPA 2FNPA 2L01A 4O6JA 4EJWA 1S3JA 2RV8A 4BH9A 1FYLA 1HW2A 4IJAA 1ZREA 1G3YA 2ZNYA 5D8LB 2STWA 4MEXF 1J59A 1XGSA 2BYVE 2HYGD 5ILSA 5DUIA 3J81K 4EQQA 3CUQB 2L54A 3OOPA 1R22A 3VOEA 5J6XA 2P8TA 4Q47A 2PQ8A 1JE8A 1KU9A 3CJNA 3NQOA 2D1HA 4KYWA 1KGSA 4MTDA 1O7LA 4N0BA 1O3TA
chains in the Genus database with same CATH superfamily
1WI9A 1ULYA 2CQXA 4LB5A 2VONA 1T38A 1R7JA 1H9TA 2HOTA 4E7LA 4Y13A 5IP7J 2DYRH 2PEXA 1R5GA 3FF5A 2GBYA 3ECOA 3P5JA 4GYGA 4XRMA 4HNUA 1JUSA 2WB1N 2JMWA 4M3GA 5E1ZB 2L3DA 4CCKA 3BTIA 1GT0C 5HDNA 3EUHC 4A3FJ 1JKPC 2V6CA 1QBJA 2ZXIA 4F55A 3FXJA 5FFZA 1IZ1A 2EINH 4FE4A 1FYKA 2ZC2A 3PFIA 1BIAA 1P4XA 3H5AA 3ZGKA 1GUUA 2Y31A 3DKXA 1IUYA 4NQWA 5A2QZ 4PDKA 3IH3A 4LG0A 2XAGA 2LF7A 5FRMA 2K3FA 4BXFA 2BZTA 2XRNA 2DA6A 4JK1X 4RGUA 1T56A 1RETA 2A05A 1DDNA 5D6EA 1BBYA 3KLNA 2M1BA 1YO5C 1Z05A 5DM6F 5JLWA 2RN7A 5H6RA 3G71I 5HS9A 3ZQLA 3LFUA 4HSRA 3OSFA 3QYFA 1GHCA 1HW5A 5LEJA 1WH5A 2G7HA 2ICWG 3OIQA 4I0AA 2R7VA 4ABZA 1P2FA 3OS2A 3I9V2 3IH4A 2F6CA 3G4SI 3GF2A 1BI1A 1YOVB 4KISA 5BS6A 2BHYA 5M3MJ 2H8RA 3G73A 5F64A 4OAYA 3TOBA 1A36A 3JAMK 4N9HA 3FBIB 4A3MJ 3LSGA 1FOYA 4CUGA 1LFPA 1BR1A 3ELKA 2E1MC 3HRUA 2XPUA 3ZQFA 1ZHFA 1ETXA 5J8CA 2LOOA 4U0YA 3CMMA 1BI0A 3CP2A 4M71A 1TTYA 5L3BA 3BR1A 1YIOA 1GLNA 3DLAA 4BHCA 4A12A 3K1PA 2Y9ZA 4A3EJ 2PJRA 1YS6A 4MTDA 1RC9A 4CYCA 1HSTA 2QGUA 2RVCA 2L5QA 3FKIJ 4CYCB 1QRYA 3LOCA 5B1AH 4YIFA 3BPVA 3JTHA 1YITI 1WKMA 9ANTA 5LEKA 5J1RA 3CMEI 3CMYA 4R8HA 3UKGA 5IT9Z 4E7ZA 1D3YA 1MMSA 3QU3A 1ZRFA 3CCRI 1ERDA 1ON2A 5FO5A 4BE2A 3T8TA 4XLAA 2RAEA 3H36A 3BTJA 4MFEA 5JVGF 1RUNA 2E7XA 3IRQA 3WTVC 2DTRA 3PO2J 5IP9J 4CH7A 1NG7A 2GOMA 2M2EA 4P5OA 4HNTA 2WWYA 1IXCA 4MLOA 1ETWA 2KJBA 3RIRA 5E8IA 3L2CA 2KP6A 1ETYA 1EV7A 1MJBA 2VT2A 1Z3XA 2QBYB 1MMGA 4LLGF 3RYRA 1W36C 4XORA 2O6GE 2FXAA 4RM3A 2UZKA 1FTZA 2XRLA 3K4KA 4AC0A 1X4PA 1F5TA 2HOEA 2FBIA 3JW4A 5FFXA 4UUVA 4BL0B 4JOMA 3OYKA 3GTLJ 1XC5A 1OR7C 1YJWI 1HKQA 3JREA 2M7BA 3LA2A 3TDZC 4G7ZF 4A5MA 3ZMZA 1KQ8A 2CQNA 2M4KA 1YJNI 1SD7A 5ICEA 1RESA 1IJWC 4XRSA 2EH3A 1ZG5A 5EEGA 4OWRB 3HGYA 1UZCA 3OR1C 1LE8A 1OCTC 4EEFG 3T8RA 4AIJA 2F5DA 3I4PA 1R6RA 5JI6A 2IGNA 3S1RJ 3VYTB 3IAS2 4Z6YA 1ZK8A 1W0UA 4LG0B 1IN4A 1G4DA 1UCRA 1XPXA 4BUPA 3M9AA 1FY7A 4WF2A 2Q0OA 3KP4A 5B3SH 3F6OA 1J9IA 4DYRA 3F6VA 4C2TA 2Y0SA 5CLSA 3FZVA 1NG6A 2BVMA 2MH9A 2GA2A 2TCTA 5GAHJ 4U88A 3I56I 3LAPA 1RKTA 5E3MA 1IRZA 3LSIA 3NEUA 3BROA 5BMZA 2E7WA 2ECCA 3RQIA 4FISA 3JRFA 2C6YA 4CA0A 1UFMA 3GZ5A 3SDGA 5M5XJ 4C3JJ 5TRDA 2EBIA 1IDYA 3GTJJ 4AU7A 2K27A 3R6SA 3K70D 1PDNC 3VODA 3DTKA 4GXOA 2MLGA 3DEEA 2XPWA 3ULQB 2HZDA 2PG4A 3DV8A 2PMZA 4H0EA 5D8KB 2CV0A 1S5LC 4B09A 2OQGA 2LKPA 3V7RA 2B7EA 3OYFA 3OYAA 4U0WA 1HOMA 5LBQA 4QIWN 2IP2A 3N97A 1TWHJ 2FSWA 3L09A 3TQNA 2E1MB 3BZCA 3P9CA 2Z3YA 3RQ4A 5EDNA 2QLZA 4NDLA 3T0YA 3H5RA 3GFLA 4A5NA 1TT0A 2AO9A 5EZHA 1FSEA 1LFBA 2Z1DA 4M6VA 3KEOA 4QLCU 1GV5A 2HVSA 3QODA 1ITYA 2DDAA 2DBBA 3KP3A 4A0YA 5C4JJ 3QPHA 3HB9A 1HC8A 2FMYA 3LFKA 3SJMA 4R79A 4N4NB 3V8JA 2DW4A 4LIUA 1HDDC 1LNWA 1ZN2A 4N9IA 3HOXJ 3ABKH 4IO9F 5FKNA 4UB8C 3FWEA 1T39A 5HNHA 3OS1A 3HL2A 1E2XA 3EUAA 4KIGA 4FQGA 2VPRA 2BEOA 2NNNA 5DCMB 4JBAA 1ZG1A 1Q1VA 1OR7A 1OPCA 2D1VA 5C3EJ 1P4AA 3OL4A 2K40A 2YU3A 3V8LA 1R4MB 3O8HA 1H8AC 4ZH4F 1MJ9A 4WXHA 1A35A 4M74A 5GPCA 3L2WA 2DODA 4L5IA 4RMNA 5CVIA 2Z9OA 2L4MA 2DU9A 4U87A 1ORKA 2J5PA 4NC6A 3AKZA 1WPKA 3BTLA 2V1DA 5E1XA 2L4AA 5DCFA 4AYBA 5LGTA 3JSOA 1B6AA 2JUCA 2PBIA 2DYSH 1VZ0A 1TQPA 1N75A 2F5EA 4U7DA 1HQCA 5L3DA 3HSEA 3QPLA 3BP8A 1I5ZA 2H94A 3OYLA 1LPQA 4EM2A 2Z5UA 1WJFA 1QO0D 4LOCA 1YYVA 1X1AA 2ISYA 4IHTA 2M34A 2R7FA 2VC0A 1I50J 4I01A 4WWCA 1IW7F 2LRDA 3GUDA 1MD0A 3H3ZA 1KYZA 1J2XA 1XGNA 1UAAA 1I1GA 2BXYA 2RNGA 2LTPA 4IRGA 2Y75A 3J81Z 1UJ8A 5J4YA 4P55A 4BDZA 2O61A 2F5FA 1IRFA 3R60A 3CZ6A 1KYWA 2ZNZA 3GFMA 2W84A 2L9SA 2RQPA 1IV8A 1R49A 5BNGA 3JRAA 2XGDA 1YX5A 3Q9SA 2DMQA 4E7SA 1XSDA 2YPRA 1ZGJA 3SZTA 2XHKA 4PJNA 5HS8A 4GDFA 4AM3A 1U9OA 4G6QA 4Q5SF 4XOTA 2RC4A 5CVJA 5EG0B 1OYIA 3GO5A 4ZYEA 4IHXA 4IHYA 2L9NA 1O4XA 1O3QA 3K1NA 2JJ7A 5HVQC 2VIXA 3MVPA 2DA5A 2KT0A 2BGCA 2O3FA 3G2BA 3DLLF 1CQTA 2ID6A 4RGSA 3VYRB 3HPHA 2G0EA 4E7KA 4PJ0C 2QYOA 4KJZA 2NVUB 2CMPA 1D0YA 2NOGA 2IS6A 1QZEA 2L7MP 3ABLH 2FMLA 1WH7A 2NS7A 4GFBA 3MCZA 1PUEE 4XQFA 3AFHA 3DCFA 1V54H 3OIPA 3TW6A 2FA5A 1O7FA 1UHMA 5JLXA 1J7KA 1DQUA 2NXNB 4PFOA 2IA1A 3QAHA 1RPWA 1ZGWA 4ESFA 1FBSA 3GCMA 1BJAA 2KLOA 1ETVA 1ETQA 2P5KA 1T6SA 3OIOA 1JHFA 1BIBA 2ZJPF 2CO5A 2FBHA 3WTWC 1K78A 4JP0A 4XLFA 3BPXA 3PIPF 4IRHA 2VJJA 2X9DA 4A0ZA 3ZMDA 4ZYHA 4QWQA 1SC7A 4D7MA 4D5CA 4KITB 2A3SA 3LSJA 2H6BA 3KYCB 2IGOA 2Y2ZA 2F4MB 1MH4A 1NTCA 1VQ4I 4JX5A 3HRTA 4XN0A 1ZRCA 5LRRA 3CUQA 2STTA 2KL4A 2BHZA 5D6FA 4V19K 4LGWA 2L7KA 2DPDA 4XLEA 1MDMB 1TT5B 1T2KA 5D5VB 2QM3A 1XN7A 3O8GA 3SZGA 2ME0A 3S93A 1BI2A 2R5YA 1JI8A 1D0ZA 4LMYA 2AQFA 4XRSG 3R61A 3KP2A 3WTXC 3RI4A 3ABUA 4IQ4A 3WU2C 4UXNA 3ZQGA 5LGNA 3CDLA 4M9SA 3S1QJ 2P5VA 4MQVA 2EA2A 4CXFA 2K5CA 4O3MA 1XB4A 1Q1HA 2PX9A 3WODF 4M3EA 4I99C 5FD6A 1LDJA 4NC8A 3J80K 2VKDA 1LE8B 4HYEA 4D1QA 4BDYA 4FTHA 2W82A 4BE0A 1FX7A 3ONQA 2EPFA 3H0DA 3CESA 2IPQX 1E3PA 4G7OF 2HXIA 4ZDLA 4BY7J 2ZFWA 2B63J 2V79A 1VQ6I 2JPCA 3P9KA 4BYYA 3JSPA 2R5YB 3CCQI 3C18A 4B3XA 3MKYB 3M8JA 1FOXA 2LDUA 3HZJA 4A3LJ 2KIMA 2VBYA 1G6NA 4HV6A 3FXUA 1YRNA 3ESWB 1OJLA 2NYXA 1LJ9A 1VQMI 2OC6A 2FOWA 2FRHA 1Z67A 5EEAA 3DBLB 5FKKA 5IP6A 5FLXK 2EFOA 2FX0A 3KX2A 3GTMJ 1J75A 4S0HB 2MC3A 2CSOA 3BR6A 2BY0A 4UVCA 1ENHA 1FPQA 4IZZA 1XGOA 1JTXA 2OZ6A 2CW8A 2GIVA 2HQRA 3GBGA 4XN3A 2CFOA 4L5JA 1FOWA 4KN7X 1TWAJ 3I53A 3FM5A 1HXDA 5KVRA 2CS3A 1E0EA 2JA2A 2FF4A 1BM9A 3K7AJ 1NHAA 3IWZA 3RDIA 5EGOB 4I0BA 3K2ZA 3GZ6A 2FEZA 4L9VA 2LK2A 3IL2A 3W2AA 1KONA 3IHUA 3KP5A 2LBFB 1USSA 3AG3H 5KHDA 1B72A 1SANA 4XM3A 3QQAA 3PFYA 4G6DA 5K1YA 1O57A 3KYLA 3M4OJ 5J1UA 3PQKA 4RLFA 1T95A 4BS9A 4GRIA 3DKWA 2CUZA 2VKHA 1X58A 3AAFA 1K7AA 3PM1A 2JA8J 4ENKA 3L7WA 3PQJA 1ON1A 1LDDA 4IEJA 1IC8A 3K1MA 1BR4A 1Y6IA 2RDPA 4JQFA 2CW7A 3Q9VA 5LRSA 4HEA2 3VDXA 3S3NA 3H0GJ 3OY9A 4A3IJ 5DD4A 4B8XA 2E1CA 2EJRA 3JRCA 1FC3A 2KJCA 5FKLA 3RPUD 4ENMA 1YIJI 1WCMJ 1QZYA 5L3EA 1OKRA 5E20A 1BOBA 5HNFA 2M0MA 1U8RA 3CO6C 5HDKA 5EF6A 1HCRA 2X1CA 3F9KA 2QSFX 5FRNA 3BOQA 2ACJA 4A3BJ 4XMYA 2BXZA 3HSFA 3PSIA 3OOUA 5IPAA 3B73A 3MQ0A 4I6ZA 1MBHA 2OJED 3IAM2 1QPMA 3FK6A 3I58A 2JSCA 5EEHA 1VTNC 3BG6A 1O3RA 3PO3J 2E1NA 2ELHA 5K7FA 2IT0A 4IF4A 2K3PA 1OCPA 4MFDA 3BCBA 3HHGA 2QZ8A 4LITA 3K4MA 3BG5A 4CCNA 3MKZA 5L3GA 1XMKA 2JUGA 1ETOA 1FZPB 2DQRA 2UXNA 2Z99A 4WCGA 2ADUA 2UXXA 2A6EF 1IRGA 1XX5A 3D0SA 4PSXA 1A31A 2AHQA 2Q1ZB 1L0OC 4P1WA 4EGYA 3J7AO 3OYJA 1E3OC 1U5TC 2AS5F 2ZXJA 1EH7A 1SD5A 3KP6A 4BACA 1R9TJ 1S29A 2B0LA 3QYEA 1MMAA 1FMVA 4MO7A 1IXSB 3A1YA 4DW6A 2OA4A 2UV1A 2GAUA 3ML6A 3J80Z 4ZZDA 2R7OA 5D5UB 1SEUA 2ZXHA 3OYBA 2XF6A 3M7GA 3LSRA 4MTEA 2W00A 1F1ZA 4UVAA 3FMSA 4CZZA 1PP7U 5TJJA 5CYVA 2KHMA 1X3UA 2A6HF 2F2EA 3Q0WA 1JKOC 3MKLA 3FISA 3PIOF 4ZTJA 3S15J 4AVPA 4IRIA 3S32A 2XGCA 3L2QA 2EIMH 2A5YB 1SAUA 2FQ4A 5BQTA 3KETA 4MHGA 1X2NA 4ZYDA 1W4MA 2CUJA 3Q3SA 5DTDA 2GXAA 3PNVA 3ZRGA 1UHSA 2OQRA 4Y52J 2FU4A 2XGXA 1VQNI 2CH0A 4HQMA 1TZLA 2V9PA 2HR3A 3LA7A 2DA7A 3MFKA 3RTRA 2ETHA 1DU0A 3MMYB 1K61A 3GFIA 3ZMTA 2R7QA 2TRTA 3KZIC 4RDUA 2H1KA 2F5VA 3BC8A 1I27A 4A2UA 1UG0A 1MMNA 2HYFA 1D5YA 4E7HA 1Z0XA 3TBIA 4BJ6C 2ISZA 2MGQA 4UNOA 1MBJA 2OU2A 3V7CA 1USTA 3QWLA 2MYSA 3M07A 3BR0A 2ZXWH 3HIFA 1T98A 1LVKA 2EWNA 3OSGA 3COAC 4KUMA 3RYPA 3RSNA 1S9HA 3M8FA 3MWMA 4HLXA 1HF0A 1ZLKA 4I2OA 1XDSA 1SD6A 4B4CA 4MNUA 3PUBA 1POGA 4NUBA 4YFKF 3HOUJ 1ZQ3P 1DP3A 2X85A 3ZMSA 5LHGA 3BR5A 2DA1A 3KPHA 1FEXA 4E6KG 3OYCA 3ZPLA 1V4RA 4K2EA 4C2UA 4LLNA 3BT9A 3E3VA 4RB2C 2W24A 1MBEA 1R71A 1T33A 2M3AA 3ASNH 5IYCJ 2JZYA 5GPAA 2NVQJ 1P6RA 2W1OA 3DP7A 1WHUA 3O6BB 2LSOA 1OQYA 3DPLC 1TQIA 3P7NA 3F8NA 2IS4A 3TDUC 1CF7B 4HX8A 4EJUA 4F52A 3C2GA 1K4SA 3CC4I 1Y56A 3K6GA 4A3JJ 4C3HJ 2HOSA 3H92A 2HPMA 3JRGA 3U9GA 1B9MA 3BJ6A 3REOA 4CSWA 2JT1A 4W97A 3HOVJ 2JA6J 3CCMI 4DGWB 1APLC 4LIVA 1V5FA 3QP5A 3CQZJ 3RKYA 1A6QA 3LMMA 2BW3B 1LEAA 2CV2A 2M0CA 3JR9A 3PL8A 5FROA 3EUHA 2K86A 3SYTA 5DDGA 3CLOA 2VLAA 2Y30A 2DA3A 4AIHA 4F91B 2HU9A 2YR2A 3KYDB 4A3KJ 3GTPJ 2QBYA 3BJOA 3BLYA 2R7DA 1XDUA 2QQ9A 1WJBA 4X0GA 4XRFA 3NAUA 2DA2A 3L2VA 1R23A 1JUPA 3RJPA 3TEDA 2KRCA 4U7BA 3R0AA 3E5XA 1WRJA 2K9SA 1EH8A 2MH2A 2CG4A 3RPUA 1TWCJ 2CQ7A 1SFKA 5TGTA 2H27A 3K4BA 5ICCA 1GXQA 4ZYAA 1EF4A 4CCJA 2IEKA 2HFHA 2COMA 3U1KA 2DAOA 1MMDA 4CZCA 2FJ1A 2DO7A 2DI3A 2BY3A 3K4NA 4M9XA 5F0HA 4BHPA 2ZBKA 2OV7A 2HVRA 1SMYF 4LK0F 2WTEA 2M8GX 1D5VA 1GV2A 1Y39A 4F7ZA 2HTSA 3HPGA 3G6EI 1EKEA 4ZJZA 2IA2A 3BG9A 3VYSB 1B8IB 2W25A 2K85A 2Q8KA 4HDUA 4XLCA 2XKOA 5TISC 3FXKA 2V9KA 2K9NA 3GWZA 4XL9A 4Z2YA 1OYYA 1PJRA 3D5RC 2M30A 2X0LA 5JHFA 3JAMZ 4LB6B 1Y0NA 1JT6A 2VQGA 5ILVA 4E70A 4Y7NJ 2KIUA 2DK8A 5D5WB 2M8EA 1V3FA 1I3QJ 4IHWA 1UMQA 1BW6A 2LREA 3CC2I 3L2UA 3CJTB 2MC4A 5EYRA 1B72B 1FIPA 3C3WA 5HODA 4J00A 1IO2A 1B9NA 3JRIA 5D4RA 1GVJA 2BV6A 3OR2C 4P9FA 4BQAA 4UB6C 5EGOA 1KZHA 1R1VA 3ISPA 3TP0A 1ACIA 3IP4B 4HAMA 2PMHA 2DMUA 1DPRA 3AG1H 2EB7A 1F36A 2QKLB 3KZYA 1T0FC 4BJTA 1IN7A 3Q5FA 3K10A 2EFPA 2CQQA 2LVSA 1WJAA 2NOJB 5FKOA 4JX4A 4HLYA 1MBKA 4A6DA 4EMSA 2DN0A 2P7VB 2WA0A 2E35A 1FBUA 2WAQA 2NVXJ 1U5TA 4ESJA 5LLQA 1U78A 2FNAA 1H88C 4CICA 5JR3A 3WU0A 3ZQIA 1I6XA 4OU0A 3E97A 4KFCA 3H5NA 4BY1J 4EGZA 1NK3P 1K83J 1WJDA 3CF5F 2OBPA 2ID3A 3DPUA 2ELKA 1OLTA 4HX4A 2EIKH 5FGMA 3T5XA 1QVUA 1YW9A 3KIOA 4XSXF 2Z16A 4XOPA 5LHIA 3ZCOA 3E0JB 1ZKGA 4RAGA 3U21A 3CDHA 2IRFG 3C2HA 3TOAA 5M3FJ 3WTUC 4X6AJ 4G6TB 3AG4H 4DBQA 4HG2A 4ITVA 2Q2EA 3OMYA 1B4AA 1U5TB 4O5VA 4PGGA 1X1DA 2EFWA 1AU7A 5IY5H 2IXSA 4ZDOA 1MZBA 1X3WB 3DU5A 1Z7UA 1REPC 1ZGAA 1PVEA 4MEYF 3FHZA 3L2RA 2H09A 4XICA 1YW7A 4BEHB 3HG9A 2A68F 4RGRA 4TV7A 4C30A 3RKWA 5J47A 2O03A 4IHSA 2HYJA 2ZMEB 3AG2H 1S7OA 5BPIA 2Y0MA 2DPUA 3H9QA 4W1UA 3HUGA 1QPIA 4A3DJ 2RQQA 1YS7A 3VEPA 5F6FA 3WTTC 5M5WJ 5LD2C 2DMTA 3HEFA 2DT7B 2QWWA 1ZAOA 2VASA 2KDZA 3O2PE 3CMAI 2H8WA 1YLFA 2XAJA 3FMQA 4Y33A 5E1WA 3F23A 1MNEA 1R4NB 2MSYA 4ZYGA 3CTAA 1PUFB 2A61A 5K5RA 2XV4S 4RLQA 4OOIA 3PJRA 4OIRF 1HA8A 4IQJA 1WSUA 3SZPA 1A04A 4B47A 4FHTA 4FX4A 4BGDA 1QGPA 2DTZA 2Z2SB 2JWTA 3HGGA 5HS7A 1WI3A 2GXBA 1GVDA 3DWLE 4I98B 1Z7LA 2OCCH 4EJTA 5J3LA 1FIAA 3F22A 3EPZA 5IT9K 2NAZA 1B8IA 4BBRJ 1D1CA 4UV8A 1U0JA 2VT3A 1JTYA 3S3MA 1TP4A 3KLOA 4HF1A 3Q0UA 5DD8A 5J40A 5HLHA 3GTQJ 4X1EA 2DDBA 4RGXA 1EH6A 1T0FA 4PFPA 5FJ8J 3W2WA 5LHHA 1BN5A 4YIIA 3OYGA 1IN8A 3F8FA 4KMFA 3H9JA 3EETA 4IVNA 1WJ5A 1QQIA 2GLOA 5D4SA 5ED4A 4L18B 2R7WA 3ERED 3G3ZA 4CO8A 5B1BH 2V1XA 2W85A 3I59B 5IYBJ 1LQ1A 1K4TA 2OF7A 4KIBA 2HZTA 5C4XJ 4XLNF 2LY9A 2VBZA 3DBHB 4S05A 1YFHA 2XC7A 2K9LA 3HOWJ 2IGKA 1ZR4A 1AOYA 3I64A 3KFWX 5AONA 4ZC3A 3EDPA 3LAJA 1FJLA 3TKYA 4HQEA 2KFDA 1D1AA 5EG0A 1WZ2A 2K9QA 1LKXA 4U0VA 2FQ3A 4ETSA 5F27A 3HC7A 5H20A 1DP7P 3K0LA 5FB2A 1BI3A 1VQKI 3I4NJ 1GXPA 3CCSI 3HHHA 3BY6A 4EV0A 1HW1A 2QF7A 3FK7A 4M3DA 3HRSA 2EILH 3B02A 1BOAA 2O8KA 3TO7A 3H3UA 4Q4ZF 4PJMA 3S3OA 3CCUI 3ZMUA 2ZJRF 1GDTA 1TBXA 3MAJA 2AXLA 1W5TA 4HDVA 1YRNB 3S1MJ 1IN6A 3ABTA 2R7ZJ 3RCOA 2CJJA 2PLYA 1KU2A 1QZZA 3V4GA 1QNTA 4NBQA 1N77A 2DFIA 3HOTA 3S17J 1DPUA 4NC7A 1XSVA 2EV0A 2IGMA 2W48A 2BW3A 3A4CA 4B44A 1M1EB 2NVTJ 2M5WA 2O7OA 2JPBA 2VXZA 3ZP5A 3DTIA 2P4WA 4XNFA 3KCCA 1G59A 1G3TA 3L9FA 5AIPA 2WAFA 3WGHA 4EATA 4ESBA 2BVLA 3BCAA 2IJLA 4IX7A 1TW2A 1MSFC 1OCCH 2DOAA 3HTSB 3FXOA 5ICGA 3IUOA 2XAUA 1OMIA 2M4GA 4CCMA 3BJAA 3K4CA 2NNYA 5K5QA 1JGSA 1X3ZB 5IOZA 2VBXA 2QA4I 1FYMA 2XGEA 1FTTA 2WV1A 1ZH5A 3F72A 5FLXZ 1RI7A 4EJOA 1G3SA 2QEXI 5JFRA 4RB0A 4HF0A 2XSDC 3IC7A 1MH3A 3RZDJ 4J19A 4BU2A 1FP1D 1IN5A 4WXCA 1XCBA 2VODA 3ZN1A 4UUSB 3N4MA 3GTGJ 4D5FA 4II2A 2HS5A 2MABA 2NVYJ 2V6EA 1I1SA 4B48A 1IRXA 2EZLA 1ONVA 2K4JA 2OAZA 2V9VA 2K02A 4RAZA 2W4SA 4MIMA 4LLLA 3HBLA 3BG3A 1MGTA 1TC3C 4E7JA 2E34A 3DQVC 1MNDA 3OYHA 2HQAA 2QSHX 1WJCA 3F3XA 2ZMEA 4ENNA 2ZJQF 2HWVA 2K7LA 2KISA 1FOKA 2VL8A 2FE3A 1AKHA 5FLVA 2FOKA 2MD5A 1BC8C 1LUJB 4GGGA 4BKXA 4DZJA 1S8NA 3TL4X 1G3WA 5EZGA 3ROUA 1VNDA 2OZUA 2B9SA 3ZXSA 2KPMA 3L00A 1FLIA 1JHHA 2E60A 2E71A 3I3LA 1VQ5I 1WGXA 4FT8A 3NWTA 4JX6A 4M72A 4D9JA 5F1JA 2VQHA 1LDKB 2QKMB 4HA8A 5E3LA 4ENJA 1OFCX 3QPSA 1TQMA 1W5CC 4XKWA 2X6WA 3I4MJ 1VQ7I 3JRBA 4G12A 4BNCA 1XGMA 2DLLA 3EYIA 3WTZA 2IVMA 3E6CC 2VOPA 2WBMA 3A01B 4PCQA 2GWRA 1Y8QB 2HXOA 4ANJA 3U1DA 2JQ7A 2JVGA 2KRFA 1VQPI 4DJAA 2XKPA 1MSEC 2D5VA 4HNVA 1FBQA 5KK1A 1W36D 1AWCA 2E19A 4YFXF 2CRGA 4XKVA 2JRTA 3BDDA 5KNLA 2R5ZB 3CO7C 1Z77A 3HJEA 2A5WA 3IKTA 1PYVA 2X4HA 3J7YJ 2L9VA 4D0PA 1OCRH 2V1NA 3I71A 1TNSA 2KDOA 1HKTA 3V42A 1O3SA 2X6OA 3OYMA 2D2WA 2XAHA 4XR6A 2XF7A 3DF8A 1DGRM 5C44J 4DOZA 3BTCA 1Z3YA 2ZO4A 3PNYA 1V5EA 5CQEA 4AWXB 3BQYA 1YQAA 3U2RA 2RREA 3V7SA 1AKHB 3ABMH 3GLXA 1J0RA 4XONA 1UHWA 2I8DA 2G9WA 4HPQA 1Y8RB 1RZ4A 2DMNA 2RGVA 3W6JB 5J1YA 1HBXG 4YIRX 5BPDA 4PZJA 3GFJA 1OCZH 2E5NA 2X51A 1MKMA 3A0HC 1JUMA 2IA0A 2OUMA 3I55I 1VFCA 3J7ZI 1VQ8I 4ON0A 2CU7A 2AQEA 5KAFC 5DEQA 1RKWA 5F08A 2Y69H 4M3FA 3J7AY 2DJNA 1XMAA 4GO1A 1A5JA 4G9YA 1XSXA 4KIFA 5DUKA 4PJLA 4B3AA 1UG2A 2ZB9A 4KDPA 1Z1DA 2A07F 3W3CA 2UUZA 2HKXA 3I54A 5J8FA 1FMWA 2ZJ2A 2XB5A 1K78B 1TWGJ 3S8PA 4CCOA 1D8JA 3C1DA 1QHGA 1VI0A 2HDDA 3LSHA 2YS9A 1Y1WJ 4EM1A 1KU7A 2GIZA 1W7PA 1Z91A 3H35A 1BL0A 5EJCA 2AXTC 2WB1A 1FP2A 3QOPA 4NNJA 3LSTA 2BE5F 4WX9A 1ZARA 1V5GA 3ECHA 2VOOA 2EZKA 1WVRA 1R00A 2F4IA 1W0TA 1L3LA 2DCEA 2JRMA 1T08B 5GAGJ 2MA3A 4V2GA 1SAXA 3HOZJ 2HKOA 2WAQN 4LFUA 5HLIA 3DXJF 4KT6A 3AL0B 4PUSA 3E5QA 2OD5A 2TDXA 5KCMA 2VI6A 3F21A 3G1LA 4M3BA 1BW5A 2YUSA 3ZMVA 2DK5A 3JCUC 2EV6A 3DEWA 1P7JA 2FUG2 2J5OA 2MG4A 2VQLA 4KT5C 2R5ZA 3SEQA 1IG7A 1HKSA 2JN6A 1R58A 2GOXB 4UVBA 2LBFA 1JJ6C 3PNTA 2EZIA 5K5OA 2HI3A 4E7IA 3A02A 3HYIA 3SDBA 1C0WA 3FXLA 2E5ZA 3GXOA 3SFZA 4CGZA 5GP9A 3BR2A 1WQ2A 1OYWA 4L9JA 2CWEA 4L9TA 5F04A 3ZQQA 1ZTRA 1S72I 2A6TA 1SFUA 1F4KA 1HLVA 3QP6A 3HUGB 2IS1A 2QENA 1IUFA 1VF9A 3SFIA 1RR7A 4EM0B 5M5YJ 1QA6A 3K2AA 4OMZA 2XAFA 1KQ9A 3M3YJ 4C9YA 4M9ZA 2PJPA 3WGIA 2HEOA 3R0JA 1B1BA 4PJJA 2NS8A 4ZDPA 2QUFA 2CUEA 1LVAA 4HSTA 3RPQA 1XTAA 3FHNA 3VSKA 2K4BA 2LD5A 2Q2EB 2X6XA 4NQWB 1SVLA 2H6CA 5E17F 1Y1VJ 3BZKA 2PMUA 3GW2A 2M45A 2KZVA 1I39A 4HW0A 3GVAA 3LQRA 4DYCA 1S7AA 2VE9A 3FKJA 2R7RA 2R7TA 5F0FA 1X1PA 2BOLA 4MGRA 4BXUA 3D5LA 4I7HA 1H0MA 3H3VK 3MEXA 3ERMA 4BBSJ 3F0CA 3VPRA 4XKBA 2XAQA 3QOEA 5K7HA 4M73A 3DTEA 2Y9YA 2R93J 3CD6I 4A3GJ 2QSGX 1MJAA 2HNHA 2P7CB 2JK3A 5KAIC 1S7EA 1R1UA 1P4WA 2K9MA 3FX3A 2ZFUA 2DQLA 2XIGA 3D1NI 2L2OA 3CJRB 4DNCA 3HRMA 3UR3C 4P9UA 1T8IA 2ZSIB 2YX4A 4II3A 1RNLA 2KKOA 4KMUX 2O9LA 1X4OA 2DMPA 4NB5A 3CCLI 2Y48A 1MBFA 1X2MA 2CQKA 3F8BA 2X1DA 3BR3A 2CW0F 3R4KA 1DU6A 3G1MA 1MW7A 2PI0A 3OS0A 2E2HJ 5H6QA 1RUOA 3A03A 5F1RA 3WTSC 4AIDA 1QU3A 3C2BA 5CVRA 1N25A 3X2QH 2V26A 1F9NA 2NRAC 3LQQA 3KEQA 1MDMA 1W7PB 2LP0A 3CCEI 2LYCA 2XASA 3S2WA 2O0YA 4R1HA 4XK4A 4QTRA 3OYNA 2MLKA 4BHBA 4QSHA 2LY1A 4IL6C 4HZFA 1ZG3A 2G7UA 2XSJC 2LG4A 3WTYC 2P0WA 2PN6A 3OWTA 2QQAA 1IV6A 1SFXA 3MD2A 4IHVA 4OINF 4IOAF 4A0XA 2YSRA 3KEYA 5D5XB 1EA3A 2VN2A 3GX4X 2I5UA 3KE2A 4I09A 2F48A 2XVCA 4RB1A 3JRHA 3TMOA 1ZLJA 4Y3OA 3C7JA 3TGNA 2COBA 1J09A 2VUMJ 4BQNA 2KIQA 4F3QA 3JTGA 3H9GA 5FLMJ 4YRVA 5A2QK 3OL3A 1LFUP 3MZYA 2I10A 5IOYA 1NH3A 4PSWA 2PJRB 1YW8A 2QQ8A 2CGPA 2DFEA 3T1BA 1JJ8C 1DGWY 2FBKA 1SFOJ 4P96A 1ODDA 4YG2F 4AIKA 1MIJA 4B1RA 1W1WE 3BZ6A 3I5UA 1UB9A 3ZOBA 2VKEA 4AUXA 1K6YA 1TLHB 1I3AA 2LC2A 2LMDA 3LSKA 2GA1A 3A2KA 1YHQI 1U8BA 3BWGA 1MNMC 3FM3A 2O5RA 4FE7A 4PK4A 3RKQA 2DT6A 1HSJA 2CYYA 3B6CA 3CP8A 4Q48A 4FX0A 1BR2A 2R3SA 4NHJA 2WY7Q 3M8EA 1BC7C 2E2IJ 4DBRA 3EYYA 4CYDA 5J4VA 2ME6A 3LSMA 1D8KA 3ZQCA 3WHBA 3CF2A 3FXRA 4XKCA 3HKZN 4C2MJ 5L3CA 1IF1A 4LJZF 2E2JJ 6PAXA 1SD4A 2GZWA 1TNTA 4OIPF 1S6LA 4DYQA 5HLGA 3NARA 3K9TA 3WU1B 3HDDA 3QYBA 3CJQB 2ZMEC 1VQ9I 1U2WA 4Y15A 1E3HA 1U9NA 1IDZA 2D45A 3HM5A 3AL0C 3TO9A 2CV1A 3N05A 5LGUA 3IKVA 1J5YA 1KA8A 4BQOA 1CF7A 3QU6A 2OCEA 4BJ5C 4KICA 3IRRA 2HGCA 5HOOA 1RIOH 2BY1A 2JA5J 3W6VA 1SVMA 2EQRA 3I59A 3LWFA 4RAFA 2KMUA 3EQLF 2W57A 3VWBA 2N8GA 5HLTA 2KRHA 1X19A 2RNJA 2XB0X 2GQQA 3PUFA 3JRDA 5DV5A 1Y0UA 2VPLA 3I0TA 2UWMA 2XPVA 3K4LA 3TP3A 4HBLA 2R92J 5AIQA 4XLHA 4YFNF 2O8XA 1H89C 2HQNA 3BG7A 4L0YB 2HOAA 1Z21A 2QVOA 4JYKA 2LKXA 1SVOA 2HQ5A 4G94A 2DXIA 5E8GA 4XSZF 1TL8A 2X6YA 2P6SA 5DCMA 1BJZA 1YJ9I 3E6BA 3VSLA 3LNQA 5FD5A 4CDGA 4HF2A 3TW7A 1ZYRF 2P6TA 3HSRA 1Z6RA 1P9QC 4L0ZB 2VJIA 3D5SC 3E7LA 3DKYA 3K69A 2DT5A 2WAEA 2QCOA 5F0CA 1UELB 3LA3A 1YE9A 2IS2A 1W5SA 2VJ4A 2VQCA 2M7AA 2E1OA 4I02A 2WV0A 3FMRA 2M87A 4FCYA 2P81A 3OYEA 4WXDA 2W7NA 1Z6TA 1PUFA 3IV5A 4HX7A 4KN4X 5HDGA 2HDCA 4EJVA 2XF5A 2OPTA 1XS9A 1N78A 2MW8A 1V55H 2ECBA 3Q0VA 2JTVA 5ILUA 3OYIA 4DQ2A 2QQBA 5GADJ 4BAYA 3F8CA 2LLKA 5GTIC 4LG3A 3H1CA 1SMTA 4FASD 3CCJI 1WJEA 2L9RA 2OTLI 2PFBA 1R36A 2FD5A 4RA2A 4BEHA 3SXYA 5FKMA 3OYDA 3WE3A 5IT3A 2R7XA 3CUQC 3GZNB 5DYMA 4OIOF 5E79C 3FDYA 3W2VA 2VBWA 1WFXA 3GYHX 2PMZN 5IYDJ 1XCVA 3OV8A 3GMEA 4L5EA 4A3CJ 3GTOJ 3SQNA 2XUBA 1STZA 2DOFA 1U3EM 1JXSA 2BBYA 2NS0A 4AVZA 3L1PA 2EA4A 4D7NA 2F5CA 4G7HF 2ZKZA 3S2DJ 1WWXA 2EV5A 3O3KA 3GEZA 3WG7H 3A0BC 3IH2A 1FSHA 2M9HA 4KA4A 2V4JC 1RR8C 2MBFA 4Y4RA 3E1SA 4A6EA 5GTHC 4KNYA 5CJ9A 1U6GA 3MZ8A 1Z9CA 2DA4A 1NK2P 3ZQHA 3ZN0A 3K70C 4UV9A 1TW3A 4IOCF 1IAWA 1ZELA 4XLPF 4AD9A 4S04A 4BE1A 2OTJI 4H4KC 5K7ZA 4RAYA 3S1NJ 3W6KB 2Z33A 1VQOI 1B59A 1LB2A 1K6OA 3F8MA 2GXGA 4UUSA 2XDVA 4WK8F 1KQ0A 4RBOA 2R4GA 5BOXA 2R0QC 2L02A 2H1LA 4MQ9F 3IWFA 4BXXJ 3VB2A 4V2FA 2YX7A 1HDPA 1H9GA 1FWZA 5ERIA 2EFNA 1FNNA 2MD0A 1ZRDA 4PGHA 3WG9A 1JGGA 3HOSA 3PSFA 5DS9A 4GYIA 4N4OB 1P7IA 5E3OA 1X1BA 2VB6A 3SHFA 4G8XA 3E6MA 2KIFA 4XIDA 3CUOA 4OAZA 4DZPA 4UHTA 4YELA 5H2FC 2CUFA 2RKHA 1XG1A 3ZR8X 3CCVI 2P5LC 4QPOA 4RB3C 3UNGC 2LF8A 4IPAA 4AYBN 3KP7A 3WE2A 4UY8I 1R1TA 4J01A 3E5UA 3SEZA 3S16J 2LH9A 2V7FA 1MBGA 1I6HJ 1SFEA 2JA7J 4CHUA 3BQZA 4ZTFA 2X48A 1IGNA 2LY2A 3CLQA 2WADA 4UUTA 3M1EA 1W7PD 5JVTA 2XROA 4FETA 4M6YA 4LD5A 1ETKA 3FIWA 2HDWA 2KZGA 5CKTA 2L7ZA 2VC1A 3E6DA 2EK5A 3HTUA 2VXDA 3NRVA 1FT9A 2EIJH 3WGGA 4OMYA 3VFZA 3RZOJ 5CVUA 2Y0SN 2ELJA 4F92B 5E3NA 1F43A 4F93B 5CVVA 4L9NA 2X1EA 1G2HA 3ASOH 2DOEA 2ZSHB 1YG2A 1PP8F 4HOBA 2R7UA 1G8XA 1X1CA 3K4JA 3MZHA 1JKQC 5CQGA 1EJ9A 5L3FA 1YI2I 3GTKJ 2EZHA 3WHCA 4E4HA 4OIQF 4EVIA 2VJ5A 4HV5A 1QHHD 2ZCWA 3RKXA 1AHDP 1K79A 2V1UA 1LEBA 2HTJA 3DU6A 4IXAA 4RS8A 3ZQ7A 3QRFF 1AA7A 4A69C 3CDIA 4M6XA 1YTYA 2VE8A 2WC2A 1A6IA 3GLLA 5DM7F 3MKWB 2LFBA 4GCVA 2L0KA 4Y17A 2R7SA 1E17A 4LK1F 2CFXA 3CCYA 3DFGA 2IAIA 5CPRB 4QPQA 3P9IA 3G1OA 1R5ID 3DEUA 3M1CA 5B66C 2EFQA 1R5HA 2ESNA 3TO6A 4ASNA 5JHUA 3A01A 2L7FP 1IXRC 3LSPA 3DPTA 5ICFA 5B5EC 4IKFA 2DJIA 5GAEJ 3HOYJ 2DFFA 1XMXA 3HKZA 1XD7A 2JSPA 4XBFA 4ZZLA 1YX3A 2IW5A 1P92A 3HXLA 3KZZA 3S14J 3V8KA 3FXQA 1D0XA 5E18F 2VKVA 1KU3A 2LKSA 4I76A 4DIQA 2LNBA 3FBNB 3QPTA 1DUXC 1TWFJ 2A69F 2HPIA 3B6AA 4A93J 2ESHA 2KQRA 1CGPA 2DFHA 2FNPA 2L01A 1VQLI 4O6JA 1D1BA 4EJWA 1S3JA 2RV8A 4BH9A 2E36A 4C3IJ 4IJAA 1FYLA 1HW2A 1RRJA 1ZREA 1JKRC 2JVHA 3FXMA 4B43A 1G3YA 1BA5A 2ZNYA 5D8LB 1JT0A 2STWA 4MEXF 1J59A 1XGSA 2BYVE 2F4OB 2HYGD 2IBDA 5ILSA 5DUIA 3MN2A 3J81K 3S2HJ 5LFAA 2YU9J 4EQQA 2HVQA 3CUQB 2L54A 3OOPA 1R22A 3DBRB 1OISA 3VOEA 4BQQA 5J6XA 2WY8Q 2P8TA 4Q47A 2PQ8A 3VYUB 3CC7I 1JE8A 3NWSA 1OCOH 1ZR2A 2MFZA 2BY2A 1KU9A 3NQOA 2LR8A 4YEJA 3EUKL 2GM4A 2D1HA 1QVTA 4KYWA 3LL7A 4CCLA 1KGSA 3CJNA 1O7LA 4N0BA 4RM2A 1O3TA 4HRIA
chains in the Genus database with same CATH topology
1WI9A 1ULYA 4LB5A 2VONA 1T38A 1R7JA 1H9TA 4Y13A 2PEXA 1R5GA 3FF5A 3ECOA 4GYGA 5E1ZB 2L3DA 5HDNA 2V6CA 1QBJA 5FFZA 1IZ1A 1FYKA 3PFIA 1BIAA 1P4XA 1IUYA 4NQWA 5A2QZ 4PDKA 4LG0A 2XAGA 2LF7A 2XRNA 4JK1X 4RGUA 1DDNA 5D6EA 1BBYA 3KLNA 2M1BA 1YO5C 1Z05A 2RN7A 5H6RA 5HS9A 1GHCA 1HW5A 5LEJA 4I0AA 2G7HA 1P2FA 3GF2A 1BI1A 5BS6A 3G73A 5F64A 3TOBA 3JAMK 4N9HA 3ELKA 3HRUA 1ZHFA 5J8CA 4U0YA 1BI0A 4M71A 1TTYA 5L3BA 1YIOA 4BHCA 4A12A 3K1PA 1YS6A 1HSTA 2RVCA 4YIFA 3BPVA 3JTHA 1WKMA 5LEKA 4R8HA 5IT9Z 1D3YA 3QU3A 1ZRFA 1ON2A 5FO5A 3T8TA 1RUNA 2E7XA 3IRQA 3WTVC 2DTRA 4P5OA 2WWYA 1IXCA 2KJBA 3RIRA 5E8IA 3L2CA 1EV7A 1MJBA 2VT2A 2QBYB 4LLGF 3RYRA 2O6GE 2FXAA 2UZKA 1F5TA 2HOEA 2FBIA 3JW4A 5FFXA 4UUVA 1HKQA 3LA2A 3TDZC 4G7ZF 4A5MA 3ZMZA 1KQ8A 1SD7A 5ICEA 1ZG5A 5EEGA 3T8RA 4AIJA 2F5DA 3I4PA 5JI6A 4LG0B 1IN4A 1G4DA 1UCRA 3M9AA 1FY7A 4WF2A 2Q0OA 3KP4A 3F6OA 1J9IA 3F6VA 5CLSA 3FZVA 2MH9A 3LAPA 2GA2A 4U88A 3NEUA 3BROA 5BMZA 2E7WA 2C6YA 1UFMA 3GZ5A 5TRDA 2K27A 3R6SA 1PDNC 3VODA 4GXOA 2MLGA 3ULQB 2PG4A 3DV8A 4H0EA 5D8KB 4B09A 2OQGA 2LKPA 3V7RA 4U0WA 5LBQA 2IP2A 3N97A 2FSWA 3L09A 3TQNA 3P9CA 2Z3YA 2QLZA 3T0YA 3GFLA 4A5NA 1FSEA 3KEOA 4QLCU 2DBBA 3KP3A 4A0YA 3QPHA 2FMYA 3LFKA 4R79A 3V8JA 2DW4A 1LNWA 1ZN2A 4N9IA 3FWEA 1T39A 1E2XA 4KIGA 2BEOA 2NNNA 5DCMB 4JBAA 1ZG1A 1OR7A 1OPCA 2D1VA 1P4AA 2YU3A 3V8LA 4ZH4F 1MJ9A 4WXHA 4M74A 4L5IA 5CVIA 2Z9OA 2L4MA 2DU9A 2J5PA 2V1DA 5E1XA 2L4AA 5DCFA 5LGTA 3JSOA 1B6AA 2PBIA 1TQPA 2F5EA 4U7DA 1HQCA 5L3DA 3HSEA 1I5ZA 2H94A 3BP8A 4EM2A 2Z5UA 1QO0D 1YYVA 2ISYA 4IHTA 2R7FA 2VC0A 4I01A 4WWCA 1IW7F 3GUDA 1MD0A 3H3ZA 1KYZA 1J2XA 1XGNA 1I1GA 4IRGA 2Y75A 3J81Z 4P55A 2O61A 2F5FA 1IRFA 3R60A 1KYWA 2ZNZA 3GFMA 2W84A 2RQPA 3Q9SA 1XSDA 2YPRA 1ZGJA 3SZTA 2XHKA 5HS8A 4Q5SF 4G6QA 2RC4A 5CVJA 1OYIA 3GO5A 4ZYEA 1O3QA 3K1NA 5HVQC 2O3FA 2BGCA 4RGSA 2QYOA 2FMLA 3MCZA 1PUEE 2FA5A 1O7FA 1UHMA 1J7KA 2IA1A 3QAHA 4ESFA 1FBSA 1BJAA 2P5KA 1T6SA 1JHFA 1BIBA 2CO5A 2FBHA 3WTWC 1K78A 3BPXA 4IRHA 4A0ZA 3ZMDA 4ZYHA 4QWQA 2A3SA 2H6BA 3HRTA 1ZRCA 5LRRA 3CUQA 2STTA 5D6FA 4LGWA 2DPDA 1MDMB 1T2KA 5D5VB 2QM3A 1XN7A 1BI2A 4LMYA 3R61A 3KP2A 3WTXC 3RI4A 3ABUA 4UXNA 5LGNA 4M9SA 2P5VA 4MQVA 2EA2A 4CXFA 4O3MA 1XB4A 1Q1HA 3WODF 5FD6A 1LDJA 3J80K 4HYEA 1FX7A 2IPQX 4G7OF 2ZFWA 2V79A 2JPCA 3P9KA 4BYYA 3JSPA 3C18A 2LDUA 2KIMA 2VBYA 1G6NA 4HV6A 3FXUA 2NYXA 1LJ9A 2FRHA 5FLXK 2EFOA 1J75A 2MC3A 2CSOA 4UVCA 1FPQA 1XGOA 2OZ6A 2GIVA 2HQRA 4L5JA 4KN7X 3I53A 3FM5A 1HXDA 5KVRA 2FF4A 1BM9A 3RDIA 1NHAA 3IWZA 3GZ6A 4I0BA 3K2ZA 2FEZA 4L9VA 3IL2A 3IHUA 3KP5A 1USSA 4G6DA 5K1YA 1O57A 3PQKA 3DKWA 3AAFA 1K7AA 4ENKA 3L7WA 3PQJA 1ON1A 1LDDA 3K1MA 2RDPA 4JQFA 5LRSA 3Q9VA 5DD4A 4B8XA 2E1CA 2EJRA 1FC3A 2KJCA 4ENMA 1QZYA 5L3EA 1OKRA 5E20A 1U8RA 3CO6C 5HDKA 3BOQA 2ACJA 3HSFA 3B73A 3MQ0A 1QPMA 5EEHA 3I58A 2JSCA 1VTNC 1O3RA 2E1NA 2ELHA 2IT0A 4IF4A 3HHGA 2QZ8A 5L3GA 1XMKA 1FZPB 2DQRA 2UXNA 2Z99A 4WCGA 2ADUA 2UXXA 2A6EF 1IRGA 3D0SA 1L0OC 4EGYA 3J7AO 2AS5F 1U5TC 2ZXJA 1EH7A 1SD5A 3KP6A 1S29A 2B0LA 1IXSB 2OA4A 3ML6A 2GAUA 3J80Z 4ZZDA 5D5UB 3M7GA 4MTEA 1F1ZA 4UVAA 3FMSA 4CZZA 1PP7U 5TJJA 5CYVA 1X3UA 2A6HF 2F2EA 4AVPA 4IRIA 5BQTA 2A5YB 3KETA 4MHGA 4ZYDA 1W4MA 2OQRA 2FU4A 2XGXA 4HQMA 2HR3A 3LA7A 3MFKA 3RTRA 2ETHA 3GFIA 3ZMTA 4A2UA 1I27A 2HYFA 2ISZA 4UNOA 2OU2A 3V7CA 1USTA 3HIFA 1T98A 2EWNA 3COAC 4KUMA 3RYPA 3M8FA 4HLXA 3MWMA 4I2OA 1ZLKA 1XDSA 1SD6A 4MNUA 4YFKF 3ZMSA 5LHGA 3ZPLA 1V4RA 4K2EA 4LLNA 3E3VA 4RB2C 2W24A 2JZYA 1P6RA 3DP7A 3O6BB 2LSOA 3DPLC 1TQIA 3P7NA 3F8NA 3TDUC 1CF7B 4HX8A 4EJUA 3H92A 3U9GA 1B9MA 3BJ6A 3REOA 2JT1A 3QP5A 3RKYA 1LEAA 3EUHA 2K86A 5DDGA 3CLOA 4AIHA 2YR2A 2QBYA 3BJOA 2R7DA 1XDUA 2QQ9A 4XRFA 1R23A 3RJPA 4U7BA 3R0AA 3E5XA 1WRJA 2MH2A 1EH8A 2CG4A 3RPUA 2H27A 5ICCA 1GXQA 2HFHA 2COMA 2DAOA 2DO7A 2DI3A 4M9XA 4BHPA 2ZBKA 1SMYF 4LK0F 2WTEA 1D5VA 4F7ZA 2HTSA 2IA2A 2W25A 2Q8KA 4HDUA 2XKOA 3GWZA 4Z2YA 1OYYA 2M30A 2X0LA 3JAMZ 4LB6B 5ILVA 4E70A 2KIUA 2DK8A 5D5WB 2M8EA 1V3FA 3C3WA 1B9NA 5D4RA 1GVJA 2BV6A 4P9FA 4BQAA 1R1VA 3ISPA 4HAMA 2PMHA 1DPRA 2EB7A 3KZYA 1IN7A 3Q5FA 2EFPA 4HLYA 4A6DA 4EMSA 2P7VB 1FBUA 4ESJA 1U5TA 5LLQA 1U78A 2FNAA 4CICA 5JR3A 3WU0A 1I6XA 4OU0A 3E97A 4KFCA 4EGZA 2OBPA 4HX4A 5FGMA 3T5XA 1YW9A 4XSXF 5LHIA 3CDHA 2IRFG 3TOAA 3WTUC 2Q2EA 1B4AA 1U5TB 4O5VA 4PGGA 2EFWA 1MZBA 1Z7UA 1REPC 1ZGAA 4MEYF 3FHZA 2H09A 1YW7A 2A68F 4RGRA 4TV7A 3RKWA 2O03A 4IHSA 2ZMEB 1S7OA 5BPIA 2Y0MA 2DPUA 3HUGA 1YS7A 3VEPA 5F6FA 3WTTC 2QWWA 1ZAOA 3O2PE 5E1WA 1YLFA 2XAJA 3FMQA 3F23A 4ZYGA 3CTAA 2A61A 5K5RA 2XV4S 4OOIA 4OIRF 1WSUA 3SZPA 1A04A 4FHTA 4FX4A 1QGPA 5HS7A 2GXBA 4I98B 4EJTA 3F22A 5IT9K 2NAZA 4UV8A 2VT3A 3KLOA 4HF1A 5DD8A 5HLHA 4RGXA 1EH6A 1T0FA 5LHHA 1BN5A 4YIIA 1IN8A 3F8FA 4KMFA 3EETA 4IVNA 1QQIA 5D4SA 5ED4A 4L18B 3ERED 3G3ZA 4CO8A 2V1XA 2W85A 3I59B 1LQ1A 4KIBA 2HZTA 4XLNF 2VBZA 4S05A 1YFHA 1AOYA 3I64A 3KFWX 5AONA 3LAJA 3EDPA 3TKYA 4HQEA 4U0VA 2FQ3A 4ETSA 5H20A 1DP7P 3K0LA 5FB2A 1BI3A 1GXPA 3HHHA 3BY6A 4EV0A 1HW1A 3HRSA 3B02A 1BOAA 3TO7A 3H3UA 4Q4ZF 3ZMUA 1TBXA 3MAJA 2AXLA 1W5TA 4HDVA 1IN6A 3ABTA 2PLYA 1KU2A 1QZZA 3V4GA 1QNTA 2DFIA 3HOTA 1DPUA 1XSVA 2EV0A 2M5WA 2JPBA 2VXZA 3ZP5A 2P4WA 3KCCA 1G3TA 3L9FA 5AIPA 3WGHA 4ESBA 2IJLA 1TW2A 3HTSB 5ICGA 1OMIA 3BJAA 2NNYA 5K5QA 1JGSA 2VBXA 1FYMA 1ZH5A 3F72A 5FLXZ 1RI7A 4EJOA 1G3SA 5JFRA 4RB0A 4HF0A 3IC7A 1FP1D 1IN5A 4WXCA 1XCBA 2VODA 3ZN1A 3N4MA 2HS5A 1I1SA 1ONVA 2K4JA 2OAZA 2V9VA 2K02A 4RAZA 4LLLA 1MGTA 3DQVC 3F3XA 2ZMEA 4ENNA 2HWVA 2K7LA 1FOKA 2FE3A 2FOKA 2MD5A 1BC8C 4GGGA 1S8NA 1G3WA 3ROUA 2OZUA 3L00A 1FLIA 1JHHA 4FT8A 4M72A 1LDKB 4HA8A 4ENJA 1TQMA 4BNCA 1XGMA 2DLLA 3EYIA 3WTZA 2IVMA 3E6CC 2VOPA 4PCQA 2GWRA 3U1DA 2KRFA 2XKPA 1FBQA 5KK1A 1AWCA 4YFXF 2JRTA 3BDDA 3CO7C 3IKTA 2X4HA 4D0PA 3I71A 1TNSA 1HKTA 1O3SA 2D2WA 2XAHA 3DF8A 2ZO4A 4AWXB 1YQAA 3U2RA 3V7SA 3GLXA 1J0RA 1UHWA 2G9WA 1RZ4A 2RGVA 3W6JB 1HBXG 5BPDA 4PZJA 3GFJA 1MKMA 2IA0A 4ON0A 5DEQA 1XMAA 4GO1A 5DUKA 1XSXA 4G9YA 4KIFA 4KDPA 1Z1DA 2A07F 2HKXA 3I54A 5J8FA 2ZJ2A 1K78B 1D8JA 3C1DA 4EM1A 1KU7A 1W7PA 1Z91A 1FP2A 3QOPA 3LSTA 2BE5F 4WX9A 1ZARA 3ECHA 2VOOA 1R00A 1L3LA 2MA3A 1SAXA 2HKOA 4LFUA 5HLIA 3DXJF 3E5QA 2OD5A 2TDXA 3F21A 3ZMVA 2DK5A 2EV6A 2J5OA 4KT5C 1HKSA 1R58A 4UVBA 5K5OA 3HYIA 1C0WA 3GXOA 3SFZA 4CGZA 1WQ2A 1OYWA 4L9JA 2CWEA 4L9TA 1SFUA 1F4KA 3QP6A 2QENA 4EM0B 4OMZA 2XAFA 1KQ9A 4M9ZA 2PJPA 3WGIA 2HEOA 3R0JA 1B1BA 2QUFA 1LVAA 3RPQA 2K4BA 5E17F 2H6CA 3GW2A 2PMUA 2M45A 4HW0A 3GVAA 3LQRA 1S7AA 2VE9A 4MGRA 4BXUA 3D5LA 4I7HA 1H0MA 3MEXA 2XAQA 4M73A 1MJAA 2P7CB 1R1UA 1P4WA 3FX3A 2DQLA 2XIGA 4DNCA 4P9UA 3HRMA 2YX4A 1RNLA 2KKOA 4KMUX 4NB5A 2Y48A 2CQKA 3F8BA 2CW0F 3R4KA 2PI0A 5H6QA 1RUOA 5F1RA 3WTSC 5CVRA 1F9NA 2NRAC 3LQQA 3KEQA 1MDMA 1W7PB 2XASA 3S2WA 2O0YA 4R1HA 2MLKA 4BHBA 4HZFA 1ZG3A 2G7UA 3WTYC 2PN6A 2QQAA 1SFXA 4OINF 4A0XA 2YSRA 5D5XB 2VN2A 3GX4X 3KE2A 4I09A 2XVCA 4RB1A 1ZLJA 3C7JA 3TGNA 3JTGA 5A2QK 3MZYA 1YW8A 2CGPA 3T1BA 2FBKA 4P96A 1ODDA 4YG2F 4AIKA 3BZ6A 3I5UA 1UB9A 1TLHB 2GA1A 3BWGA 3FM3A 1HSJA 2CYYA 4Q48A 4FX0A 2R3SA 4NHJA 3M8EA 1BC7C 3EYYA 4CYDA 1D8KA 3FXRA 5L3CA 1IF1A 4LJZF 6PAXA 1SD4A 2GZWA 1TNTA 4OIPF 1S6LA 5HLGA 3K9TA 3WU1B 1U2WA 4Y15A 2D45A 3TO9A 5LGUA 3IKVA 1J5YA 1KA8A 1CF7A 3QU6A 4KICA 3IRRA 2HGCA 5HOOA 1RIOH 3I59A 3LWFA 3EQLF 2W57A 2RNJA 2GQQA 5DV5A 1Y0UA 3I0TA 2UWMA 4HBLA 5AIQA 4YFNF 2O8XA 2HQNA 4L0YB 2QVOA 4G94A 5E8GA 4XSZF 5DCMA 2P6SA 3E6BA 5FD5A 4CDGA 4HF2A 1ZYRF 2P6TA 3HSRA 1Z6RA 4L0ZB 3K69A 2DT5A 3LA3A 1W5SA 4I02A 2WV0A 3FMRA 2M87A 4WXDA 1Z6TA 4HX7A 4KN4X 5HDGA 2HDCA 4EJVA 5ILUA 2JTVA 4DQ2A 2QQBA 4BAYA 3F8CA 1SMTA 2PFBA 1R36A 3SXYA 3WE3A 5IT3A 3CUQC 5DYMA 4OIOF 2VBWA 3GYHX 1XCVA 3OV8A 3SQNA 2XUBA 1STZA 1U3EM 1JXSA 2BBYA 2NS0A 2EA4A 2F5CA 4G7HF 2ZKZA 1WWXA 2EV5A 3O3KA 3GEZA 1FSHA 4KA4A 2MBFA 4A6EA 4KNYA 5CJ9A 1U6GA 1Z9CA 3ZN0A 4UV9A 1TW3A 1IAWA 4XLPF 4AD9A 4S04A 4RAYA 3W6KB 2Z33A 1B59A 1LB2A 1K6OA 3F8MA 2GXGA 4WK8F 1KQ0A 5BOXA 2L02A 4MQ9F 3IWFA 3VB2A 2YX7A 1H9GA 1FWZA 5ERIA 2EFNA 1FNNA 1ZRDA 4PGHA 3WG9A 3HOSA 4GYIA 3SHFA 4G8XA 3E6MA 2KIFA 3CUOA 4UHTA 2RKHA 2P5LC 4RB3C 2LF8A 4IPAA 3KP7A 3WE2A 1R1TA 3E5UA 1SFEA 4CHUA 3M1EA 1W7PD 5JVTA 2XROA 4M6YA 4LD5A 2VC1A 3E6DA 2EK5A 3HTUA 3NRVA 1FT9A 3WGGA 4OMYA 3VFZA 5CVUA 5CVVA 4L9NA 1YG2A 1PP8F 4HOBA 3MZHA 5L3FA 4OIQF 4EVIA 4HV5A 2ZCWA 3RKXA 1K79A 2V1UA 1LEBA 2HTJA 4IXAA 4RS8A 3ZQ7A 3QRFF 4M6XA 1YTYA 2VE8A 2WC2A 4GCVA 4Y17A 1E17A 4LK1F 2CFXA 3DFGA 3P9IA 3DEUA 2EFQA 1R5HA 2ESNA 3TO6A 4ASNA 5JHUA 1IXRC 3DPTA 5ICFA 1XD7A 4XBFA 4ZZLA 2IW5A 1P92A 3KZZA 3V8KA 3FXQA 5E18F 1KU3A 2LNBA 3QPTA 1DUXC 2A69F 2ESHA 1CGPA 2FNPA 2L01A 4O6JA 4EJWA 1S3JA 2RV8A 4BH9A 1FYLA 1HW2A 4IJAA 1ZREA 1G3YA 2ZNYA 5D8LB 2STWA 4MEXF 1J59A 1XGSA 2BYVE 2HYGD 5ILSA 5DUIA 3J81K 4EQQA 3CUQB 2L54A 3OOPA 1R22A 3VOEA 5J6XA 2P8TA 4Q47A 2PQ8A 1JE8A 1KU9A 3CJNA 3NQOA 2D1HA 4KYWA 1KGSA 4MTDA 1O7LA 4N0BA 1O3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI9 A;  1ULY A;  4LB5 A;  2VON A;  1T38 A;  1R7J A;  1H9T A;  4Y13 A;  2PEX A;  1R5G A;  3FF5 A;  3ECO A;  4GYG A;  5E1Z B;  2L3D A;  5HDN A;  2V6C A;  1QBJ A;  5FFZ A;  1IZ1 A;  1FYK A;  3PFI A;  1BIA A;  1P4X A;  1IUY A;  4NQW A;  5A2Q Z;  4PDK A;  4LG0 A;  2XAG A;  2LF7 A;  2XRN A;  4JK1 X;  4RGU A;  1DDN A;  5D6E A;  1BBY A;  3KLN A;  2M1B A;  1YO5 C;  1Z05 A;  2RN7 A;  5H6R A;  5HS9 A;  1GHC A;  1HW5 A;  5LEJ A;  4I0A A;  2G7H A;  1P2F A;  3GF2 A;  1BI1 A;  5BS6 A;  3G73 A;  5F64 A;  3TOB A;  3JAM K;  4N9H A;  3ELK A;  3HRU A;  1ZHF A;  5J8C A;  4U0Y A;  1BI0 A;  4M71 A;  1TTY A;  5L3B A;  1YIO A;  4BHC A;  4A12 A;  3K1P A;  1YS6 A;  1HST A;  2RVC A;  4YIF A;  3BPV A;  3JTH A;  1WKM A;  5LEK A;  4R8H A;  5IT9 Z;  1D3Y A;  3QU3 A;  1ZRF A;  1ON2 A;  5FO5 A;  3T8T A;  1RUN A;  2E7X A;  3IRQ A;  3WTV C;  2DTR A;  4P5O A;  2WWY A;  1IXC A;  2KJB A;  3RIR A;  5E8I A;  3L2C A;  1EV7 A;  1MJB A;  2VT2 A;  2QBY B;  4LLG F;  3RYR A;  2O6G E;  2FXA A;  2UZK A;  1F5T A;  2HOE A;  2FBI A;  3JW4 A;  5FFX A;  4UUV A;  1HKQ A;  3LA2 A;  3TDZ C;  4G7Z F;  4A5M A;  3ZMZ A;  1KQ8 A;  1SD7 A;  5ICE A;  1ZG5 A;  5EEG A;  3T8R A;  4AIJ A;  2F5D A;  3I4P A;  5JI6 A;  4LG0 B;  1IN4 A;  1G4D A;  1UCR A;  3M9A A;  1FY7 A;  4WF2 A;  2Q0O A;  3KP4 A;  3F6O A;  1J9I A;  3F6V A;  5CLS A;  3FZV A;  2MH9 A;  3LAP A;  2GA2 A;  4U88 A;  3NEU A;  3BRO A;  5BMZ A;  2E7W A;  2C6Y A;  1UFM A;  3GZ5 A;  5TRD A;  2K27 A;  3R6S A;  1PDN C;  3VOD A;  4GXO A;  2MLG A;  3ULQ B;  2PG4 A;  3DV8 A;  4H0E A;  5D8K B;  4B09 A;  2OQG A;  2LKP A;  3V7R A;  4U0W A;  5LBQ A;  2IP2 A;  3N97 A;  2FSW A;  3L09 A;  3TQN A;  3P9C A;  2Z3Y A;  2QLZ A;  3T0Y A;  3GFL A;  4A5N A;  1FSE A;  3KEO A;  4QLC U;  2DBB A;  3KP3 A;  4A0Y A;  3QPH A;  2FMY A;  3LFK A;  4R79 A;  3V8J A;  2DW4 A;  1LNW A;  1ZN2 A;  4N9I A;  3FWE A;  1T39 A;  1E2X A;  4KIG A;  2BEO A;  2NNN A;  5DCM B;  4JBA A;  1ZG1 A;  1OR7 A;  1OPC A;  2D1V A;  1P4A A;  2YU3 A;  3V8L A;  4ZH4 F;  1MJ9 A;  4WXH A;  4M74 A;  4L5I A;  5CVI A;  2Z9O A;  2L4M A;  2DU9 A;  2J5P A;  2V1D A;  5E1X A;  2L4A A;  5DCF A;  5LGT A;  3JSO A;  1B6A A;  2PBI A;  1TQP A;  2F5E A;  4U7D A;  1HQC A;  5L3D A;  3HSE A;  1I5Z A;  2H94 A;  3BP8 A;  4EM2 A;  2Z5U A;  1QO0 D;  1YYV A;  2ISY A;  4IHT A;  2R7F A;  2VC0 A;  4I01 A;  4WWC A;  1IW7 F;  3GUD A;  1MD0 A;  3H3Z A;  1KYZ A;  1J2X A;  1XGN A;  1I1G A;  4IRG A;  2Y75 A;  3J81 Z;  4P55 A;  2O61 A;  2F5F A;  1IRF A;  3R60 A;  1KYW A;  2ZNZ A;  3GFM A;  2W84 A;  2RQP A;  3Q9S A;  1XSD A;  2YPR A;  1ZGJ A;  3SZT A;  2XHK A;  5HS8 A;  4Q5S F;  4G6Q A;  2RC4 A;  5CVJ A;  1OYI A;  3GO5 A;  4ZYE A;  1O3Q A;  3K1N A;  5HVQ C;  2O3F A;  2BGC A;  4RGS A;  2QYO A;  2FML A;  3MCZ A;  1PUE E;  2FA5 A;  1O7F A;  1UHM A;  1J7K A;  2IA1 A;  3QAH A;  4ESF A;  1FBS A;  1BJA A;  2P5K A;  1T6S A;  1JHF A;  1BIB A;  2CO5 A;  2FBH A;  3WTW C;  1K78 A;  3BPX A;  4IRH A;  4A0Z A;  3ZMD A;  4ZYH A;  4QWQ A;  2A3S A;  2H6B A;  3HRT A;  1ZRC A;  5LRR A;  3CUQ A;  2STT A;  5D6F A;  4LGW A;  2DPD A;  1MDM B;  1T2K A;  5D5V B;  2QM3 A;  1XN7 A;  1BI2 A;  4LMY A;  3R61 A;  3KP2 A;  3WTX C;  3RI4 A;  3ABU A;  4UXN A;  5LGN A;  4M9S A;  2P5V A;  4MQV A;  2EA2 A;  4CXF A;  4O3M A;  1XB4 A;  1Q1H A;  3WOD F;  5FD6 A;  1LDJ A;  3J80 K;  4HYE A;  1FX7 A;  2IPQ X;  4G7O F;  2ZFW A;  2V79 A;  2JPC A;  3P9K A;  4BYY A;  3JSP A;  3C18 A;  2LDU A;  2KIM A;  2VBY A;  1G6N A;  4HV6 A;  3FXU A;  2NYX A;  1LJ9 A;  2FRH A;  5FLX K;  2EFO A;  1J75 A;  2MC3 A;  2CSO A;  4UVC A;  1FPQ A;  1XGO A;  2OZ6 A;  2GIV A;  2HQR A;  4L5J A;  4KN7 X;  3I53 A;  3FM5 A;  1HXD A;  5KVR A;  2FF4 A;  1BM9 A;  3RDI A;  1NHA A;  3IWZ A;  3GZ6 A;  4I0B A;  3K2Z A;  2FEZ A;  4L9V A;  3IL2 A;  3IHU A;  3KP5 A;  1USS A;  4G6D A;  5K1Y A;  1O57 A;  3PQK A;  3DKW A;  3AAF A;  1K7A A;  4ENK A;  3L7W A;  3PQJ A;  1ON1 A;  1LDD A;  3K1M A;  2RDP A;  4JQF A;  5LRS A;  3Q9V A;  5DD4 A;  4B8X A;  2E1C A;  2EJR A;  1FC3 A;  2KJC A;  4ENM A;  1QZY A;  5L3E A;  1OKR A;  5E20 A;  1U8R A;  3CO6 C;  5HDK A;  3BOQ A;  2ACJ A;  3HSF A;  3B73 A;  3MQ0 A;  1QPM A;  5EEH A;  3I58 A;  2JSC A;  1VTN C;  1O3R A;  2E1N A;  2ELH A;  2IT0 A;  4IF4 A;  3HHG A;  2QZ8 A;  5L3G A;  1XMK A;  1FZP B;  2DQR A;  2UXN A;  2Z99 A;  4WCG A;  2ADU A;  2UXX A;  2A6E F;  1IRG A;  3D0S A;  1L0O C;  4EGY A;  3J7A O;  2AS5 F;  1U5T C;  2ZXJ A;  1EH7 A;  1SD5 A;  3KP6 A;  1S29 A;  2B0L A;  1IXS B;  2OA4 A;  3ML6 A;  2GAU A;  3J80 Z;  4ZZD A;  5D5U B;  3M7G A;  4MTE A;  1F1Z A;  4UVA A;  3FMS A;  4CZZ A;  1PP7 U;  5TJJ A;  5CYV A;  1X3U A;  2A6H F;  2F2E A;  4AVP A;  4IRI A;  5BQT A;  2A5Y B;  3KET A;  4MHG A;  4ZYD A;  1W4M A;  2OQR A;  2FU4 A;  2XGX A;  4HQM A;  2HR3 A;  3LA7 A;  3MFK A;  3RTR A;  2ETH A;  3GFI A;  3ZMT A;  4A2U A;  1I27 A;  2HYF A;  2ISZ A;  4UNO A;  2OU2 A;  3V7C A;  1UST A;  3HIF A;  1T98 A;  2EWN A;  3COA C;  4KUM A;  3RYP A;  3M8F A;  4HLX A;  3MWM A;  4I2O A;  1ZLK A;  1XDS A;  1SD6 A;  4MNU A;  4YFK F;  3ZMS A;  5LHG A;  3ZPL A;  1V4R A;  4K2E A;  4LLN A;  3E3V A;  4RB2 C;  2W24 A;  2JZY A;  1P6R A;  3DP7 A;  3O6B B;  2LSO A;  3DPL C;  1TQI A;  3P7N A;  3F8N A;  3TDU C;  1CF7 B;  4HX8 A;  4EJU A;  3H92 A;  3U9G A;  1B9M A;  3BJ6 A;  3REO A;  2JT1 A;  3QP5 A;  3RKY A;  1LEA A;  3EUH A;  2K86 A;  5DDG A;  3CLO A;  4AIH A;  2YR2 A;  2QBY A;  3BJO A;  2R7D A;  1XDU A;  2QQ9 A;  4XRF A;  1R23 A;  3RJP A;  4U7B A;  3R0A A;  3E5X A;  1WRJ A;  2MH2 A;  1EH8 A;  2CG4 A;  3RPU A;  2H27 A;  5ICC A;  1GXQ A;  2HFH A;  2COM A;  2DAO A;  2DO7 A;  2DI3 A;  4M9X A;  4BHP A;  2ZBK A;  1SMY F;  4LK0 F;  2WTE A;  1D5V A;  4F7Z A;  2HTS A;  2IA2 A;  2W25 A;  2Q8K A;  4HDU A;  2XKO A;  3GWZ A;  4Z2Y A;  1OYY A;  2M30 A;  2X0L A;  3JAM Z;  4LB6 B;  5ILV A;  4E70 A;  2KIU A;  2DK8 A;  5D5W B;  2M8E A;  1V3F A;  3C3W A;  1B9N A;  5D4R A;  1GVJ A;  2BV6 A;  4P9F A;  4BQA A;  1R1V A;  3ISP A;  4HAM A;  2PMH A;  1DPR A;  2EB7 A;  3KZY A;  1IN7 A;  3Q5F A;  2EFP A;  4HLY A;  4A6D A;  4EMS A;  2P7V B;  1FBU A;  4ESJ A;  1U5T A;  5LLQ A;  1U78 A;  2FNA A;  4CIC A;  5JR3 A;  3WU0 A;  1I6X A;  4OU0 A;  3E97 A;  4KFC A;  4EGZ A;  2OBP A;  4HX4 A;  5FGM A;  3T5X A;  1YW9 A;  4XSX F;  5LHI A;  3CDH A;  2IRF G;  3TOA A;  3WTU C;  2Q2E A;  1B4A A;  1U5T B;  4O5V A;  4PGG A;  2EFW A;  1MZB A;  1Z7U A;  1REP C;  1ZGA A;  4MEY F;  3FHZ A;  2H09 A;  1YW7 A;  2A68 F;  4RGR A;  4TV7 A;  3RKW A;  2O03 A;  4IHS A;  2ZME B;  1S7O A;  5BPI A;  2Y0M A;  2DPU A;  3HUG A;  1YS7 A;  3VEP A;  5F6F A;  3WTT C;  2QWW A;  1ZAO A;  3O2P E;  5E1W A;  1YLF A;  2XAJ A;  3FMQ A;  3F23 A;  4ZYG A;  3CTA A;  2A61 A;  5K5R A;  2XV4 S;  4OOI A;  4OIR F;  1WSU A;  3SZP A;  1A04 A;  4FHT A;  4FX4 A;  1QGP A;  5HS7 A;  2GXB A;  4I98 B;  4EJT A;  3F22 A;  5IT9 K;  2NAZ A;  4UV8 A;  2VT3 A;  3KLO A;  4HF1 A;  5DD8 A;  5HLH A;  4RGX A;  1EH6 A;  1T0F A;  5LHH A;  1BN5 A;  4YII A;  1IN8 A;  3F8F A;  4KMF A;  3EET A;  4IVN A;  1QQI A;  5D4S A;  5ED4 A;  4L18 B;  3ERE D;  3G3Z A;  4CO8 A;  2V1X A;  2W85 A;  3I59 B;  1LQ1 A;  4KIB A;  2HZT A;  4XLN F;  2VBZ A;  4S05 A;  1YFH A;  1AOY A;  3I64 A;  3KFW X;  5AON A;  3LAJ A;  3EDP A;  3TKY A;  4HQE A;  4U0V A;  2FQ3 A;  4ETS A;  5H20 A;  1DP7 P;  3K0L A;  5FB2 A;  1BI3 A;  1GXP A;  3HHH A;  3BY6 A;  4EV0 A;  1HW1 A;  3HRS A;  3B02 A;  1BOA A;  3TO7 A;  3H3U A;  4Q4Z F;  3ZMU A;  1TBX A;  3MAJ A;  2AXL A;  1W5T A;  4HDV A;  1IN6 A;  3ABT A;  2PLY A;  1KU2 A;  1QZZ A;  3V4G A;  1QNT A;  2DFI A;  3HOT A;  1DPU A;  1XSV A;  2EV0 A;  2M5W A;  2JPB A;  2VXZ A;  3ZP5 A;  2P4W A;  3KCC A;  1G3T A;  3L9F A;  5AIP A;  3WGH A;  4ESB A;  2IJL A;  1TW2 A;  3HTS B;  5ICG A;  1OMI A;  3BJA A;  2NNY A;  5K5Q A;  1JGS A;  2VBX A;  1FYM A;  1ZH5 A;  3F72 A;  5FLX Z;  1RI7 A;  4EJO A;  1G3S A;  5JFR A;  4RB0 A;  4HF0 A;  3IC7 A;  1FP1 D;  1IN5 A;  4WXC A;  1XCB A;  2VOD A;  3ZN1 A;  3N4M A;  2HS5 A;  1I1S A;  1ONV A;  2K4J A;  2OAZ A;  2V9V A;  2K02 A;  4RAZ A;  4LLL A;  1MGT A;  3DQV C;  3F3X A;  2ZME A;  4ENN A;  2HWV A;  2K7L A;  1FOK A;  2FE3 A;  2FOK A;  2MD5 A;  1BC8 C;  4GGG A;  1S8N A;  1G3W A;  3ROU A;  2OZU A;  3L00 A;  1FLI A;  1JHH A;  4FT8 A;  4M72 A;  1LDK B;  4HA8 A;  4ENJ A;  1TQM A;  4BNC A;  1XGM A;  2DLL A;  3EYI A;  3WTZ A;  2IVM A;  3E6C C;  2VOP A;  4PCQ A;  2GWR A;  3U1D A;  2KRF A;  2XKP A;  1FBQ A;  5KK1 A;  1AWC A;  4YFX F;  2JRT A;  3BDD A;  3CO7 C;  3IKT A;  2X4H A;  4D0P A;  3I71 A;  1TNS A;  1HKT A;  1O3S A;  2D2W A;  2XAH A;  3DF8 A;  2ZO4 A;  4AWX B;  1YQA A;  3U2R A;  3V7S A;  3GLX A;  1J0R A;  1UHW A;  2G9W A;  1RZ4 A;  2RGV A;  3W6J B;  1HBX G;  5BPD A;  4PZJ A;  3GFJ A;  1MKM A;  2IA0 A;  4ON0 A;  5DEQ A;  1XMA A;  4GO1 A;  5DUK A;  1XSX A;  4G9Y A;  4KIF A;  4KDP A;  1Z1D A;  2A07 F;  2HKX A;  3I54 A;  5J8F A;  2ZJ2 A;  1K78 B;  1D8J A;  3C1D A;  4EM1 A;  1KU7 A;  1W7P A;  1Z91 A;  1FP2 A;  3QOP A;  3LST A;  2BE5 F;  4WX9 A;  1ZAR A;  3ECH A;  2VOO A;  1R00 A;  1L3L A;  2MA3 A;  1SAX A;  2HKO A;  4LFU A;  5HLI A;  3DXJ F;  3E5Q A;  2OD5 A;  2TDX A;  3F21 A;  3ZMV A;  2DK5 A;  2EV6 A;  2J5O A;  4KT5 C;  1HKS A;  1R58 A;  4UVB A;  5K5O A;  3HYI A;  1C0W A;  3GXO A;  3SFZ A;  4CGZ A;  1WQ2 A;  1OYW A;  4L9J A;  2CWE A;  4L9T A;  1SFU A;  1F4K A;  3QP6 A;  2QEN A;  4EM0 B;  4OMZ A;  2XAF A;  1KQ9 A;  4M9Z A;  2PJP A;  3WGI A;  2HEO A;  3R0J A;  1B1B A;  2QUF A;  1LVA A;  3RPQ A;  2K4B A;  5E17 F;  2H6C A;  3GW2 A;  2PMU A;  2M45 A;  4HW0 A;  3GVA A;  3LQR A;  1S7A A;  2VE9 A;  4MGR A;  4BXU A;  3D5L A;  4I7H A;  1H0M A;  3MEX A;  2XAQ A;  4M73 A;  1MJA A;  2P7C B;  1R1U A;  1P4W A;  3FX3 A;  2DQL A;  2XIG A;  4DNC A;  4P9U A;  3HRM A;  2YX4 A;  1RNL A;  2KKO A;  4KMU X;  4NB5 A;  2Y48 A;  2CQK A;  3F8B A;  2CW0 F;  3R4K A;  2PI0 A;  5H6Q A;  1RUO A;  5F1R A;  3WTS C;  5CVR A;  1F9N A;  2NRA C;  3LQQ A;  3KEQ A;  1MDM A;  1W7P B;  2XAS A;  3S2W A;  2O0Y A;  4R1H A;  2MLK A;  4BHB A;  4HZF A;  1ZG3 A;  2G7U A;  3WTY C;  2PN6 A;  2QQA A;  1SFX A;  4OIN F;  4A0X A;  2YSR A;  5D5X B;  2VN2 A;  3GX4 X;  3KE2 A;  4I09 A;  2XVC A;  4RB1 A;  1ZLJ A;  3C7J A;  3TGN A;  3JTG A;  5A2Q K;  3MZY A;  1YW8 A;  2CGP A;  3T1B A;  2FBK A;  4P96 A;  1ODD A;  4YG2 F;  4AIK A;  3BZ6 A;  3I5U A;  1UB9 A;  1TLH B;  2GA1 A;  3BWG A;  3FM3 A;  1HSJ A;  2CYY A;  4Q48 A;  4FX0 A;  2R3S A;  4NHJ A;  3M8E A;  1BC7 C;  3EYY A;  4CYD A;  1D8K A;  3FXR A;  5L3C A;  1IF1 A;  4LJZ F;  6PAX A;  1SD4 A;  2GZW A;  1TNT A;  4OIP F;  1S6L A;  5HLG A;  3K9T A;  3WU1 B;  1U2W A;  4Y15 A;  2D45 A;  3TO9 A;  5LGU A;  3IKV A;  1J5Y A;  1KA8 A;  1CF7 A;  3QU6 A;  4KIC A;  3IRR A;  2HGC A;  5HOO A;  1RIO H;  3I59 A;  3LWF A;  3EQL F;  2W57 A;  2RNJ A;  2GQQ A;  5DV5 A;  1Y0U A;  3I0T A;  2UWM A;  4HBL A;  5AIQ A;  4YFN F;  2O8X A;  2HQN A;  4L0Y B;  2QVO A;  4G94 A;  5E8G A;  4XSZ F;  5DCM A;  2P6S A;  3E6B A;  5FD5 A;  4CDG A;  4HF2 A;  1ZYR F;  2P6T A;  3HSR A;  1Z6R A;  4L0Z B;  3K69 A;  2DT5 A;  3LA3 A;  1W5S A;  4I02 A;  2WV0 A;  3FMR A;  2M87 A;  4WXD A;  1Z6T A;  4HX7 A;  4KN4 X;  5HDG A;  2HDC A;  4EJV A;  5ILU A;  2JTV A;  4DQ2 A;  2QQB A;  4BAY A;  3F8C A;  1SMT A;  2PFB A;  1R36 A;  3SXY A;  3WE3 A;  5IT3 A;  3CUQ C;  5DYM A;  4OIO F;  2VBW A;  3GYH X;  1XCV A;  3OV8 A;  3SQN A;  2XUB A;  1STZ A;  1U3E M;  1JXS A;  2BBY A;  2NS0 A;  2EA4 A;  2F5C A;  4G7H F;  2ZKZ A;  1WWX A;  2EV5 A;  3O3K A;  3GEZ A;  1FSH A;  4KA4 A;  2MBF A;  4A6E A;  4KNY A;  5CJ9 A;  1U6G A;  1Z9C A;  3ZN0 A;  4UV9 A;  1TW3 A;  1IAW A;  4XLP F;  4AD9 A;  4S04 A;  4RAY A;  3W6K B;  2Z33 A;  1B59 A;  1LB2 A;  1K6O A;  3F8M A;  2GXG A;  4WK8 F;  1KQ0 A;  5BOX A;  2L02 A;  4MQ9 F;  3IWF A;  3VB2 A;  2YX7 A;  1H9G A;  1FWZ A;  5ERI A;  2EFN A;  1FNN A;  1ZRD A;  4PGH A;  3WG9 A;  3HOS A;  4GYI A;  3SHF A;  4G8X A;  3E6M A;  2KIF A;  3CUO A;  4UHT A;  2RKH A;  2P5L C;  4RB3 C;  2LF8 A;  4IPA A;  3KP7 A;  3WE2 A;  1R1T A;  3E5U A;  1SFE A;  4CHU A;  3M1E A;  1W7P D;  5JVT A;  2XRO A;  4M6Y A;  4LD5 A;  2VC1 A;  3E6D A;  2EK5 A;  3HTU A;  3NRV A;  1FT9 A;  3WGG A;  4OMY A;  3VFZ A;  5CVU A;  5CVV A;  4L9N A;  1YG2 A;  1PP8 F;  4HOB A;  3MZH A;  5L3F A;  4OIQ F;  4EVI A;  4HV5 A;  2ZCW A;  3RKX A;  1K79 A;  2V1U A;  1LEB A;  2HTJ A;  4IXA A;  4RS8 A;  3ZQ7 A;  3QRF F;  4M6X A;  1YTY A;  2VE8 A;  2WC2 A;  4GCV A;  4Y17 A;  1E17 A;  4LK1 F;  2CFX A;  3DFG A;  3P9I A;  3DEU A;  2EFQ A;  1R5H A;  2ESN A;  3TO6 A;  4ASN A;  5JHU A;  1IXR C;  3DPT A;  5ICF A;  1XD7 A;  4XBF A;  4ZZL A;  2IW5 A;  1P92 A;  3KZZ A;  3V8K A;  3FXQ A;  5E18 F;  1KU3 A;  2LNB A;  3QPT A;  1DUX C;  2A69 F;  2ESH A;  1CGP A;  2FNP A;  2L01 A;  4O6J A;  4EJW A;  1S3J A;  2RV8 A;  4BH9 A;  1FYL A;  1HW2 A;  4IJA A;  1ZRE A;  1G3Y A;  2ZNY A;  5D8L B;  2STW A;  4MEX F;  1J59 A;  1XGS A;  2BYV E;  2HYG D;  5ILS A;  5DUI A;  3J81 K;  4EQQ A;  3CUQ B;  2L54 A;  3OOP A;  1R22 A;  3VOE A;  5J6X A;  2P8T A;  4Q47 A;  2PQ8 A;  1JE8 A;  1KU9 A;  3CJN A;  3NQO A;  2D1H A;  4KYW A;  1KGS A;  4MTD A;  1O7L A;  4N0B A;  1O3T A; 
#chains in the Genus database with same CATH topology
 1WI9 A;  1ULY A;  2CQX A;  4LB5 A;  2VON A;  1T38 A;  1R7J A;  1H9T A;  2HOT A;  4E7L A;  4Y13 A;  5IP7 J;  2DYR H;  2PEX A;  1R5G A;  3FF5 A;  2GBY A;  3ECO A;  3P5J A;  4GYG A;  4XRM A;  4HNU A;  1JUS A;  2WB1 N;  2JMW A;  4M3G A;  5E1Z B;  2L3D A;  4CCK A;  3BTI A;  1GT0 C;  5HDN A;  3EUH C;  4A3F J;  1JKP C;  2V6C A;  1QBJ A;  2ZXI A;  4F55 A;  3FXJ A;  5FFZ A;  1IZ1 A;  2EIN H;  4FE4 A;  1FYK A;  2ZC2 A;  3PFI A;  1BIA A;  1P4X A;  3H5A A;  3ZGK A;  1GUU A;  2Y31 A;  3DKX A;  1IUY A;  4NQW A;  5A2Q Z;  4PDK A;  3IH3 A;  4LG0 A;  2XAG A;  2LF7 A;  5FRM A;  2K3F A;  4BXF A;  2BZT A;  2XRN A;  2DA6 A;  4JK1 X;  4RGU A;  1T56 A;  1RET A;  2A05 A;  1DDN A;  5D6E A;  1BBY A;  3KLN A;  2M1B A;  1YO5 C;  1Z05 A;  5DM6 F;  5JLW A;  2RN7 A;  5H6R A;  3G71 I;  5HS9 A;  3ZQL A;  3LFU A;  4HSR A;  3OSF A;  3QYF A;  1GHC A;  1HW5 A;  5LEJ A;  1WH5 A;  2G7H A;  2ICW G;  3OIQ A;  4I0A A;  2R7V A;  4ABZ A;  1P2F A;  3OS2 A;  3I9V 2;  3IH4 A;  2F6C A;  3G4S I;  3GF2 A;  1BI1 A;  1YOV B;  4KIS A;  5BS6 A;  2BHY A;  5M3M J;  2H8R A;  3G73 A;  5F64 A;  4OAY A;  3TOB A;  1A36 A;  3JAM K;  4N9H A;  3FBI B;  4A3M J;  3LSG A;  1FOY A;  4CUG A;  1LFP A;  1BR1 A;  3ELK A;  2E1M C;  3HRU A;  2XPU A;  3ZQF A;  1ZHF A;  1ETX A;  5J8C A;  2LOO A;  4U0Y A;  3CMM A;  1BI0 A;  3CP2 A;  4M71 A;  1TTY A;  5L3B A;  3BR1 A;  1YIO A;  1GLN A;  3DLA A;  4BHC A;  4A12 A;  3K1P A;  2Y9Z A;  4A3E J;  2PJR A;  1YS6 A;  4MTD A;  1RC9 A;  4CYC A;  1HST A;  2QGU A;  2RVC A;  2L5Q A;  3FKI J;  4CYC B;  1QRY A;  3LOC A;  5B1A H;  4YIF A;  3BPV A;  3JTH A;  1YIT I;  1WKM A;  9ANT A;  5LEK A;  5J1R A;  3CME I;  3CMY A;  4R8H A;  3UKG A;  5IT9 Z;  4E7Z A;  1D3Y A;  1MMS A;  3QU3 A;  1ZRF A;  3CCR I;  1ERD A;  1ON2 A;  5FO5 A;  4BE2 A;  3T8T A;  4XLA A;  2RAE A;  3H36 A;  3BTJ A;  4MFE A;  5JVG F;  1RUN A;  2E7X A;  3IRQ A;  3WTV C;  2DTR A;  3PO2 J;  5IP9 J;  4CH7 A;  1NG7 A;  2GOM A;  2M2E A;  4P5O A;  4HNT A;  2WWY A;  1IXC A;  4MLO A;  1ETW A;  2KJB A;  3RIR A;  5E8I A;  3L2C A;  2KP6 A;  1ETY A;  1EV7 A;  1MJB A;  2VT2 A;  1Z3X A;  2QBY B;  1MMG A;  4LLG F;  3RYR A;  1W36 C;  4XOR A;  2O6G E;  2FXA A;  4RM3 A;  2UZK A;  1FTZ A;  2XRL A;  3K4K A;  4AC0 A;  1X4P A;  1F5T A;  2HOE A;  2FBI A;  3JW4 A;  5FFX A;  4UUV A;  4BL0 B;  4JOM A;  3OYK A;  3GTL J;  1XC5 A;  1OR7 C;  1YJW I;  1HKQ A;  3JRE A;  2M7B A;  3LA2 A;  3TDZ C;  4G7Z F;  4A5M A;  3ZMZ A;  1KQ8 A;  2CQN A;  2M4K A;  1YJN I;  1SD7 A;  5ICE A;  1RES A;  1IJW C;  4XRS A;  2EH3 A;  1ZG5 A;  5EEG A;  4OWR B;  3HGY A;  1UZC A;  3OR1 C;  1LE8 A;  1OCT C;  4EEF G;  3T8R A;  4AIJ A;  2F5D A;  3I4P A;  1R6R A;  5JI6 A;  2IGN A;  3S1R J;  3VYT B;  3IAS 2;  4Z6Y A;  1ZK8 A;  1W0U A;  4LG0 B;  1IN4 A;  1G4D A;  1UCR A;  1XPX A;  4BUP A;  3M9A A;  1FY7 A;  4WF2 A;  2Q0O A;  3KP4 A;  5B3S H;  3F6O A;  1J9I A;  4DYR A;  3F6V A;  4C2T A;  2Y0S A;  5CLS A;  3FZV A;  1NG6 A;  2BVM A;  2MH9 A;  2GA2 A;  2TCT A;  5GAH J;  4U88 A;  3I56 I;  3LAP A;  1RKT A;  5E3M A;  1IRZ A;  3LSI A;  3NEU A;  3BRO A;  5BMZ A;  2E7W A;  2ECC A;  3RQI A;  4FIS A;  3JRF A;  2C6Y A;  4CA0 A;  1UFM A;  3GZ5 A;  3SDG A;  5M5X J;  4C3J J;  5TRD A;  2EBI A;  1IDY A;  3GTJ J;  4AU7 A;  2K27 A;  3R6S A;  3K70 D;  1PDN C;  3VOD A;  3DTK A;  4GXO A;  2MLG A;  3DEE A;  2XPW A;  3ULQ B;  2HZD A;  2PG4 A;  3DV8 A;  2PMZ A;  4H0E A;  5D8K B;  2CV0 A;  1S5L C;  4B09 A;  2OQG A;  2LKP A;  3V7R A;  2B7E A;  3OYF A;  3OYA A;  4U0W A;  1HOM A;  5LBQ A;  4QIW N;  2IP2 A;  3N97 A;  1TWH J;  2FSW A;  3L09 A;  3TQN A;  2E1M B;  3BZC A;  3P9C A;  2Z3Y A;  3RQ4 A;  5EDN A;  2QLZ A;  4NDL A;  3T0Y A;  3H5R A;  3GFL A;  4A5N A;  1TT0 A;  2AO9 A;  5EZH A;  1FSE A;  1LFB A;  2Z1D A;  4M6V A;  3KEO A;  4QLC U;  1GV5 A;  2HVS A;  3QOD A;  1ITY A;  2DDA A;  2DBB A;  3KP3 A;  4A0Y A;  5C4J J;  3QPH A;  3HB9 A;  1HC8 A;  2FMY A;  3LFK A;  3SJM A;  4R79 A;  4N4N B;  3V8J A;  2DW4 A;  4LIU A;  1HDD C;  1LNW A;  1ZN2 A;  4N9I A;  3HOX J;  3ABK H;  4IO9 F;  5FKN A;  4UB8 C;  3FWE A;  1T39 A;  5HNH A;  3OS1 A;  3HL2 A;  1E2X A;  3EUA A;  4KIG A;  4FQG A;  2VPR A;  2BEO A;  2NNN A;  5DCM B;  4JBA A;  1ZG1 A;  1Q1V A;  1OR7 A;  1OPC A;  2D1V A;  5C3E J;  1P4A A;  3OL4 A;  2K40 A;  2YU3 A;  3V8L A;  1R4M B;  3O8H A;  1H8A C;  4ZH4 F;  1MJ9 A;  4WXH A;  1A35 A;  4M74 A;  5GPC A;  3L2W A;  2DOD A;  4L5I A;  4RMN A;  5CVI A;  2Z9O A;  2L4M A;  2DU9 A;  4U87 A;  1ORK A;  2J5P A;  4NC6 A;  3AKZ A;  1WPK A;  3BTL A;  2V1D A;  5E1X A;  2L4A A;  5DCF A;  4AYB A;  5LGT A;  3JSO A;  1B6A A;  2JUC A;  2PBI A;  2DYS H;  1VZ0 A;  1TQP A;  1N75 A;  2F5E A;  4U7D A;  1HQC A;  5L3D A;  3HSE A;  3QPL A;  3BP8 A;  1I5Z A;  2H94 A;  3OYL A;  1LPQ A;  4EM2 A;  2Z5U A;  1WJF A;  1QO0 D;  4LOC A;  1YYV A;  1X1A A;  2ISY A;  4IHT A;  2M34 A;  2R7F A;  2VC0 A;  1I50 J;  4I01 A;  4WWC A;  1IW7 F;  2LRD A;  3GUD A;  1MD0 A;  3H3Z A;  1KYZ A;  1J2X A;  1XGN A;  1UAA A;  1I1G A;  2BXY A;  2RNG A;  2LTP A;  4IRG A;  2Y75 A;  3J81 Z;  1UJ8 A;  5J4Y A;  4P55 A;  4BDZ A;  2O61 A;  2F5F A;  1IRF A;  3R60 A;  3CZ6 A;  1KYW A;  2ZNZ A;  3GFM A;  2W84 A;  2L9S A;  2RQP A;  1IV8 A;  1R49 A;  5BNG A;  3JRA A;  2XGD A;  1YX5 A;  3Q9S A;  2DMQ A;  4E7S A;  1XSD A;  2YPR A;  1ZGJ A;  3SZT A;  2XHK A;  4PJN A;  5HS8 A;  4GDF A;  4AM3 A;  1U9O A;  4G6Q A;  4Q5S F;  4XOT A;  2RC4 A;  5CVJ A;  5EG0 B;  1OYI A;  3GO5 A;  4ZYE A;  4IHX A;  4IHY A;  2L9N A;  1O4X A;  1O3Q A;  3K1N A;  2JJ7 A;  5HVQ C;  2VIX A;  3MVP A;  2DA5 A;  2KT0 A;  2BGC A;  2O3F A;  3G2B A;  3DLL F;  1CQT A;  2ID6 A;  4RGS A;  3VYR B;  3HPH A;  2G0E A;  4E7K A;  4PJ0 C;  2QYO A;  4KJZ A;  2NVU B;  2CMP A;  1D0Y A;  2NOG A;  2IS6 A;  1QZE A;  2L7M P;  3ABL H;  2FML A;  1WH7 A;  2NS7 A;  4GFB A;  3MCZ A;  1PUE E;  4XQF A;  3AFH A;  3DCF A;  1V54 H;  3OIP A;  3TW6 A;  2FA5 A;  1O7F A;  1UHM A;  5JLX A;  1J7K A;  1DQU A;  2NXN B;  4PFO A;  2IA1 A;  3QAH A;  1RPW A;  1ZGW A;  4ESF A;  1FBS A;  3GCM A;  1BJA A;  2KLO A;  1ETV A;  1ETQ A;  2P5K A;  1T6S A;  3OIO A;  1JHF A;  1BIB A;  2ZJP F;  2CO5 A;  2FBH A;  3WTW C;  1K78 A;  4JP0 A;  4XLF A;  3BPX A;  3PIP F;  4IRH A;  2VJJ A;  2X9D A;  4A0Z A;  3ZMD A;  4ZYH A;  4QWQ A;  1SC7 A;  4D7M A;  4D5C A;  4KIT B;  2A3S A;  3LSJ A;  2H6B A;  3KYC B;  2IGO A;  2Y2Z A;  2F4M B;  1MH4 A;  1NTC A;  1VQ4 I;  4JX5 A;  3HRT A;  4XN0 A;  1ZRC A;  5LRR A;  3CUQ A;  2STT A;  2KL4 A;  2BHZ A;  5D6F A;  4V19 K;  4LGW A;  2L7K A;  2DPD A;  4XLE A;  1MDM B;  1TT5 B;  1T2K A;  5D5V B;  2QM3 A;  1XN7 A;  3O8G A;  3SZG A;  2ME0 A;  3S93 A;  1BI2 A;  2R5Y A;  1JI8 A;  1D0Z A;  4LMY A;  2AQF A;  4XRS G;  3R61 A;  3KP2 A;  3WTX C;  3RI4 A;  3ABU A;  4IQ4 A;  3WU2 C;  4UXN A;  3ZQG A;  5LGN A;  3CDL A;  4M9S A;  3S1Q J;  2P5V A;  4MQV A;  2EA2 A;  4CXF A;  2K5C A;  4O3M A;  1XB4 A;  1Q1H A;  2PX9 A;  3WOD F;  4M3E A;  4I99 C;  5FD6 A;  1LDJ A;  4NC8 A;  3J80 K;  2VKD A;  1LE8 B;  4HYE A;  4D1Q A;  4BDY A;  4FTH A;  2W82 A;  4BE0 A;  1FX7 A;  3ONQ A;  2EPF A;  3H0D A;  3CES A;  2IPQ X;  1E3P A;  4G7O F;  2HXI A;  4ZDL A;  4BY7 J;  2ZFW A;  2B63 J;  2V79 A;  1VQ6 I;  2JPC A;  3P9K A;  4BYY A;  3JSP A;  2R5Y B;  3CCQ I;  3C18 A;  4B3X A;  3MKY B;  3M8J A;  1FOX A;  2LDU A;  3HZJ A;  4A3L J;  2KIM A;  2VBY A;  1G6N A;  4HV6 A;  3FXU A;  1YRN A;  3ESW B;  1OJL A;  2NYX A;  1LJ9 A;  1VQM I;  2OC6 A;  2FOW A;  2FRH A;  1Z67 A;  5EEA A;  3DBL B;  5FKK A;  5IP6 A;  5FLX K;  2EFO A;  2FX0 A;  3KX2 A;  3GTM J;  1J75 A;  4S0H B;  2MC3 A;  2CSO A;  3BR6 A;  2BY0 A;  4UVC A;  1ENH A;  1FPQ A;  4IZZ A;  1XGO A;  1JTX A;  2OZ6 A;  2CW8 A;  2GIV A;  2HQR A;  3GBG A;  4XN3 A;  2CFO A;  4L5J A;  1FOW A;  4KN7 X;  1TWA J;  3I53 A;  3FM5 A;  1HXD A;  5KVR A;  2CS3 A;  1E0E A;  2JA2 A;  2FF4 A;  1BM9 A;  3K7A J;  1NHA A;  3IWZ A;  3RDI A;  5EGO B;  4I0B A;  3K2Z A;  3GZ6 A;  2FEZ A;  4L9V A;  2LK2 A;  3IL2 A;  3W2A A;  1KON A;  3IHU A;  3KP5 A;  2LBF B;  1USS A;  3AG3 H;  5KHD A;  1B72 A;  1SAN A;  4XM3 A;  3QQA A;  3PFY A;  4G6D A;  5K1Y A;  1O57 A;  3KYL A;  3M4O J;  5J1U A;  3PQK A;  4RLF A;  1T95 A;  4BS9 A;  4GRI A;  3DKW A;  2CUZ A;  2VKH A;  1X58 A;  3AAF A;  1K7A A;  3PM1 A;  2JA8 J;  4ENK A;  3L7W A;  3PQJ A;  1ON1 A;  1LDD A;  4IEJ A;  1IC8 A;  3K1M A;  1BR4 A;  1Y6I A;  2RDP A;  4JQF A;  2CW7 A;  3Q9V A;  5LRS A;  4HEA 2;  3VDX A;  3S3N A;  3H0G J;  3OY9 A;  4A3I J;  5DD4 A;  4B8X A;  2E1C A;  2EJR A;  3JRC A;  1FC3 A;  2KJC A;  5FKL A;  3RPU D;  4ENM A;  1YIJ I;  1WCM J;  1QZY A;  5L3E A;  1OKR A;  5E20 A;  1BOB A;  5HNF A;  2M0M A;  1U8R A;  3CO6 C;  5HDK A;  5EF6 A;  1HCR A;  2X1C A;  3F9K A;  2QSF X;  5FRN A;  3BOQ A;  2ACJ A;  4A3B J;  4XMY A;  2BXZ A;  3HSF A;  3PSI A;  3OOU A;  5IPA A;  3B73 A;  3MQ0 A;  4I6Z A;  1MBH A;  2OJE D;  3IAM 2;  1QPM A;  3FK6 A;  3I58 A;  2JSC A;  5EEH A;  1VTN C;  3BG6 A;  1O3R A;  3PO3 J;  2E1N A;  2ELH A;  5K7F A;  2IT0 A;  4IF4 A;  2K3P A;  1OCP A;  4MFD A;  3BCB A;  3HHG A;  2QZ8 A;  4LIT A;  3K4M A;  3BG5 A;  4CCN A;  3MKZ A;  5L3G A;  1XMK A;  2JUG A;  1ETO A;  1FZP B;  2DQR A;  2UXN A;  2Z99 A;  4WCG A;  2ADU A;  2UXX A;  2A6E F;  1IRG A;  1XX5 A;  3D0S A;  4PSX A;  1A31 A;  2AHQ A;  2Q1Z B;  1L0O C;  4P1W A;  4EGY A;  3J7A O;  3OYJ A;  1E3O C;  1U5T C;  2AS5 F;  2ZXJ A;  1EH7 A;  1SD5 A;  3KP6 A;  4BAC A;  1R9T J;  1S29 A;  2B0L A;  3QYE A;  1MMA A;  1FMV A;  4MO7 A;  1IXS B;  3A1Y A;  4DW6 A;  2OA4 A;  2UV1 A;  2GAU A;  3ML6 A;  3J80 Z;  4ZZD A;  2R7O A;  5D5U B;  1SEU A;  2ZXH A;  3OYB A;  2XF6 A;  3M7G A;  3LSR A;  4MTE A;  2W00 A;  1F1Z A;  4UVA A;  3FMS A;  4CZZ A;  1PP7 U;  5TJJ A;  5CYV A;  2KHM A;  1X3U A;  2A6H F;  2F2E A;  3Q0W A;  1JKO C;  3MKL A;  3FIS A;  3PIO F;  4ZTJ A;  3S15 J;  4AVP A;  4IRI A;  3S32 A;  2XGC A;  3L2Q A;  2EIM H;  2A5Y B;  1SAU A;  2FQ4 A;  5BQT A;  3KET A;  4MHG A;  1X2N A;  4ZYD A;  1W4M A;  2CUJ A;  3Q3S A;  5DTD A;  2GXA A;  3PNV A;  3ZRG A;  1UHS A;  2OQR A;  4Y52 J;  2FU4 A;  2XGX A;  1VQN I;  2CH0 A;  4HQM A;  1TZL A;  2V9P A;  2HR3 A;  3LA7 A;  2DA7 A;  3MFK A;  3RTR A;  2ETH A;  1DU0 A;  3MMY B;  1K61 A;  3GFI A;  3ZMT A;  2R7Q A;  2TRT A;  3KZI C;  4RDU A;  2H1K A;  2F5V A;  3BC8 A;  1I27 A;  4A2U A;  1UG0 A;  1MMN A;  2HYF A;  1D5Y A;  4E7H A;  1Z0X A;  3TBI A;  4BJ6 C;  2ISZ A;  2MGQ A;  4UNO A;  1MBJ A;  2OU2 A;  3V7C A;  1UST A;  3QWL A;  2MYS A;  3M07 A;  3BR0 A;  2ZXW H;  3HIF A;  1T98 A;  1LVK A;  2EWN A;  3OSG A;  3COA C;  4KUM A;  3RYP A;  3RSN A;  1S9H A;  3M8F A;  3MWM A;  4HLX A;  1HF0 A;  1ZLK A;  4I2O A;  1XDS A;  1SD6 A;  4B4C A;  4MNU A;  3PUB A;  1POG A;  4NUB A;  4YFK F;  3HOU J;  1ZQ3 P;  1DP3 A;  2X85 A;  3ZMS A;  5LHG A;  3BR5 A;  2DA1 A;  3KPH A;  1FEX A;  4E6K G;  3OYC A;  3ZPL A;  1V4R A;  4K2E A;  4C2U A;  4LLN A;  3BT9 A;  3E3V A;  4RB2 C;  2W24 A;  1MBE A;  1R71 A;  1T33 A;  2M3A A;  3ASN H;  5IYC J;  2JZY A;  5GPA A;  2NVQ J;  1P6R A;  2W1O A;  3DP7 A;  1WHU A;  3O6B B;  2LSO A;  1OQY A;  3DPL C;  1TQI A;  3P7N A;  3F8N A;  2IS4 A;  3TDU C;  1CF7 B;  4HX8 A;  4EJU A;  4F52 A;  3C2G A;  1K4S A;  3CC4 I;  1Y56 A;  3K6G A;  4A3J J;  4C3H J;  2HOS A;  3H92 A;  2HPM A;  3JRG A;  3U9G A;  1B9M A;  3BJ6 A;  3REO A;  4CSW A;  2JT1 A;  4W97 A;  3HOV J;  2JA6 J;  3CCM I;  4DGW B;  1APL C;  4LIV A;  1V5F A;  3QP5 A;  3CQZ J;  3RKY A;  1A6Q A;  3LMM A;  2BW3 B;  1LEA A;  2CV2 A;  2M0C A;  3JR9 A;  3PL8 A;  5FRO A;  3EUH A;  2K86 A;  3SYT A;  5DDG A;  3CLO A;  2VLA A;  2Y30 A;  2DA3 A;  4AIH A;  4F91 B;  2HU9 A;  2YR2 A;  3KYD B;  4A3K J;  3GTP J;  2QBY A;  3BJO A;  3BLY A;  2R7D A;  1XDU A;  2QQ9 A;  1WJB A;  4X0G A;  4XRF A;  3NAU A;  2DA2 A;  3L2V A;  1R23 A;  1JUP A;  3RJP A;  3TED A;  2KRC A;  4U7B A;  3R0A A;  3E5X A;  1WRJ A;  2K9S A;  1EH8 A;  2MH2 A;  2CG4 A;  3RPU A;  1TWC J;  2CQ7 A;  1SFK A;  5TGT A;  2H27 A;  3K4B A;  5ICC A;  1GXQ A;  4ZYA A;  1EF4 A;  4CCJ A;  2IEK A;  2HFH A;  2COM A;  3U1K A;  2DAO A;  1MMD A;  4CZC A;  2FJ1 A;  2DO7 A;  2DI3 A;  2BY3 A;  3K4N A;  4M9X A;  5F0H A;  4BHP A;  2ZBK A;  2OV7 A;  2HVR A;  1SMY F;  4LK0 F;  2WTE A;  2M8G X;  1D5V A;  1GV2 A;  1Y39 A;  4F7Z A;  2HTS A;  3HPG A;  3G6E I;  1EKE A;  4ZJZ A;  2IA2 A;  3BG9 A;  3VYS B;  1B8I B;  2W25 A;  2K85 A;  2Q8K A;  4HDU A;  4XLC A;  2XKO A;  5TIS C;  3FXK A;  2V9K A;  2K9N A;  3GWZ A;  4XL9 A;  4Z2Y A;  1OYY A;  1PJR A;  3D5R C;  2M30 A;  2X0L A;  5JHF A;  3JAM Z;  4LB6 B;  1Y0N A;  1JT6 A;  2VQG A;  5ILV A;  4E70 A;  4Y7N J;  2KIU A;  2DK8 A;  5D5W B;  2M8E A;  1V3F A;  1I3Q J;  4IHW A;  1UMQ A;  1BW6 A;  2LRE A;  3CC2 I;  3L2U A;  3CJT B;  2MC4 A;  5EYR A;  1B72 B;  1FIP A;  3C3W A;  5HOD A;  4J00 A;  1IO2 A;  1B9N A;  3JRI A;  5D4R A;  1GVJ A;  2BV6 A;  3OR2 C;  4P9F A;  4BQA A;  4UB6 C;  5EGO A;  1KZH A;  1R1V A;  3ISP A;  3TP0 A;  1ACI A;  3IP4 B;  4HAM A;  2PMH A;  2DMU A;  1DPR A;  3AG1 H;  2EB7 A;  1F36 A;  2QKL B;  3KZY A;  1T0F C;  4BJT A;  1IN7 A;  3Q5F A;  3K10 A;  2EFP A;  2CQQ A;  2LVS A;  1WJA A;  2NOJ B;  5FKO A;  4JX4 A;  4HLY A;  1MBK A;  4A6D A;  4EMS A;  2DN0 A;  2P7V B;  2WA0 A;  2E35 A;  1FBU A;  2WAQ A;  2NVX J;  1U5T A;  4ESJ A;  5LLQ A;  1U78 A;  2FNA A;  1H88 C;  4CIC A;  5JR3 A;  3WU0 A;  3ZQI A;  1I6X A;  4OU0 A;  3E97 A;  4KFC A;  3H5N A;  4BY1 J;  4EGZ A;  1NK3 P;  1K83 J;  1WJD A;  3CF5 F;  2OBP A;  2ID3 A;  3DPU A;  2ELK A;  1OLT A;  4HX4 A;  2EIK H;  5FGM A;  3T5X A;  1QVU A;  1YW9 A;  3KIO A;  4XSX F;  2Z16 A;  4XOP A;  5LHI A;  3ZCO A;  3E0J B;  1ZKG A;  4RAG A;  3U21 A;  3CDH A;  2IRF G;  3C2H A;  3TOA A;  5M3F J;  3WTU C;  4X6A J;  4G6T B;  3AG4 H;  4DBQ A;  4HG2 A;  4ITV A;  2Q2E A;  3OMY A;  1B4A A;  1U5T B;  4O5V A;  4PGG A;  1X1D A;  2EFW A;  1AU7 A;  5IY5 H;  2IXS A;  4ZDO A;  1MZB A;  1X3W B;  3DU5 A;  1Z7U A;  1REP C;  1ZGA A;  1PVE A;  4MEY F;  3FHZ A;  3L2R A;  2H09 A;  4XIC A;  1YW7 A;  4BEH B;  3HG9 A;  2A68 F;  4RGR A;  4TV7 A;  4C30 A;  3RKW A;  5J47 A;  2O03 A;  4IHS A;  2HYJ A;  2ZME B;  3AG2 H;  1S7O A;  5BPI A;  2Y0M A;  2DPU A;  3H9Q A;  4W1U A;  3HUG A;  1QPI A;  4A3D J;  2RQQ A;  1YS7 A;  3VEP A;  5F6F A;  3WTT C;  5M5W J;  5LD2 C;  2DMT A;  3HEF A;  2DT7 B;  2QWW A;  1ZAO A;  2VAS A;  2KDZ A;  3O2P E;  3CMA I;  2H8W A;  1YLF A;  2XAJ A;  3FMQ A;  4Y33 A;  5E1W A;  3F23 A;  1MNE A;  1R4N B;  2MSY A;  4ZYG A;  3CTA A;  1PUF B;  2A61 A;  5K5R A;  2XV4 S;  4RLQ A;  4OOI A;  3PJR A;  4OIR F;  1HA8 A;  4IQJ A;  1WSU A;  3SZP A;  1A04 A;  4B47 A;  4FHT A;  4FX4 A;  4BGD A;  1QGP A;  2DTZ A;  2Z2S B;  2JWT A;  3HGG A;  5HS7 A;  1WI3 A;  2GXB A;  1GVD A;  3DWL E;  4I98 B;  1Z7L A;  2OCC H;  4EJT A;  5J3L A;  1FIA A;  3F22 A;  3EPZ A;  5IT9 K;  2NAZ A;  1B8I A;  4BBR J;  1D1C A;  4UV8 A;  1U0J A;  2VT3 A;  1JTY A;  3S3M A;  1TP4 A;  3KLO A;  4HF1 A;  3Q0U A;  5DD8 A;  5J40 A;  5HLH A;  3GTQ J;  4X1E A;  2DDB A;  4RGX A;  1EH6 A;  1T0F A;  4PFP A;  5FJ8 J;  3W2W A;  5LHH A;  1BN5 A;  4YII A;  3OYG A;  1IN8 A;  3F8F A;  4KMF A;  3H9J A;  3EET A;  4IVN A;  1WJ5 A;  1QQI A;  2GLO A;  5D4S A;  5ED4 A;  4L18 B;  2R7W A;  3ERE D;  3G3Z A;  4CO8 A;  5B1B H;  2V1X A;  2W85 A;  3I59 B;  5IYB J;  1LQ1 A;  1K4T A;  2OF7 A;  4KIB A;  2HZT A;  5C4X J;  4XLN F;  2LY9 A;  2VBZ A;  3DBH B;  4S05 A;  1YFH A;  2XC7 A;  2K9L A;  3HOW J;  2IGK A;  1ZR4 A;  1AOY A;  3I64 A;  3KFW X;  5AON A;  4ZC3 A;  3EDP A;  3LAJ A;  1FJL A;  3TKY A;  4HQE A;  2KFD A;  1D1A A;  5EG0 A;  1WZ2 A;  2K9Q A;  1LKX A;  4U0V A;  2FQ3 A;  4ETS A;  5F27 A;  3HC7 A;  5H20 A;  1DP7 P;  3K0L A;  5FB2 A;  1BI3 A;  1VQK I;  3I4N J;  1GXP A;  3CCS I;  3HHH A;  3BY6 A;  4EV0 A;  1HW1 A;  2QF7 A;  3FK7 A;  4M3D A;  3HRS A;  2EIL H;  3B02 A;  1BOA A;  2O8K A;  3TO7 A;  3H3U A;  4Q4Z F;  4PJM A;  3S3O A;  3CCU I;  3ZMU A;  2ZJR F;  1GDT A;  1TBX A;  3MAJ A;  2AXL A;  1W5T A;  4HDV A;  1YRN B;  3S1M J;  1IN6 A;  3ABT A;  2R7Z J;  3RCO A;  2CJJ A;  2PLY A;  1KU2 A;  1QZZ A;  3V4G A;  1QNT A;  4NBQ A;  1N77 A;  2DFI A;  3HOT A;  3S17 J;  1DPU A;  4NC7 A;  1XSV A;  2EV0 A;  2IGM A;  2W48 A;  2BW3 A;  3A4C A;  4B44 A;  1M1E B;  2NVT J;  2M5W A;  2O7O A;  2JPB A;  2VXZ A;  3ZP5 A;  3DTI A;  2P4W A;  4XNF A;  3KCC A;  1G59 A;  1G3T A;  3L9F A;  5AIP A;  2WAF A;  3WGH A;  4EAT A;  4ESB A;  2BVL A;  3BCA A;  2IJL A;  4IX7 A;  1TW2 A;  1MSF C;  1OCC H;  2DOA A;  3HTS B;  3FXO A;  5ICG A;  3IUO A;  2XAU A;  1OMI A;  2M4G A;  4CCM A;  3BJA A;  3K4C A;  2NNY A;  5K5Q A;  1JGS A;  1X3Z B;  5IOZ A;  2VBX A;  2QA4 I;  1FYM A;  2XGE A;  1FTT A;  2WV1 A;  1ZH5 A;  3F72 A;  5FLX Z;  1RI7 A;  4EJO A;  1G3S A;  2QEX I;  5JFR A;  4RB0 A;  4HF0 A;  2XSD C;  3IC7 A;  1MH3 A;  3RZD J;  4J19 A;  4BU2 A;  1FP1 D;  1IN5 A;  4WXC A;  1XCB A;  2VOD A;  3ZN1 A;  4UUS B;  3N4M A;  3GTG J;  4D5F A;  4II2 A;  2HS5 A;  2MAB A;  2NVY J;  2V6E A;  1I1S A;  4B48 A;  1IRX A;  2EZL A;  1ONV A;  2K4J A;  2OAZ A;  2V9V A;  2K02 A;  4RAZ A;  2W4S A;  4MIM A;  4LLL A;  3HBL A;  3BG3 A;  1MGT A;  1TC3 C;  4E7J A;  2E34 A;  3DQV C;  1MND A;  3OYH A;  2HQA A;  2QSH X;  1WJC A;  3F3X A;  2ZME A;  4ENN A;  2ZJQ F;  2HWV A;  2K7L A;  2KIS A;  1FOK A;  2VL8 A;  2FE3 A;  1AKH A;  5FLV A;  2FOK A;  2MD5 A;  1BC8 C;  1LUJ B;  4GGG A;  4BKX A;  4DZJ A;  1S8N A;  3TL4 X;  1G3W A;  5EZG A;  3ROU A;  1VND A;  2OZU A;  2B9S A;  3ZXS A;  2KPM A;  3L00 A;  1FLI A;  1JHH A;  2E60 A;  2E71 A;  3I3L A;  1VQ5 I;  1WGX A;  4FT8 A;  3NWT A;  4JX6 A;  4M72 A;  4D9J A;  5F1J A;  2VQH A;  1LDK B;  2QKM B;  4HA8 A;  5E3L A;  4ENJ A;  1OFC X;  3QPS A;  1TQM A;  1W5C C;  4XKW A;  2X6W A;  3I4M J;  1VQ7 I;  3JRB A;  4G12 A;  4BNC A;  1XGM A;  2DLL A;  3EYI A;  3WTZ A;  2IVM A;  3E6C C;  2VOP A;  2WBM A;  3A01 B;  4PCQ A;  2GWR A;  1Y8Q B;  2HXO A;  4ANJ A;  3U1D A;  2JQ7 A;  2JVG A;  2KRF A;  1VQP I;  4DJA A;  2XKP A;  1MSE C;  2D5V A;  4HNV A;  1FBQ A;  5KK1 A;  1W36 D;  1AWC A;  2E19 A;  4YFX F;  2CRG A;  4XKV A;  2JRT A;  3BDD A;  5KNL A;  2R5Z B;  3CO7 C;  1Z77 A;  3HJE A;  2A5W A;  3IKT A;  1PYV A;  2X4H A;  3J7Y J;  2L9V A;  4D0P A;  1OCR H;  2V1N A;  3I71 A;  1TNS A;  2KDO A;  1HKT A;  3V42 A;  1O3S A;  2X6O A;  3OYM A;  2D2W A;  2XAH A;  4XR6 A;  2XF7 A;  3DF8 A;  1DGR M;  5C44 J;  4DOZ A;  3BTC A;  1Z3Y A;  2ZO4 A;  3PNY A;  1V5E A;  5CQE A;  4AWX B;  3BQY A;  1YQA A;  3U2R A;  2RRE A;  3V7S A;  1AKH B;  3ABM H;  3GLX A;  1J0R A;  4XON A;  1UHW A;  2I8D A;  2G9W A;  4HPQ A;  1Y8R B;  1RZ4 A;  2DMN A;  2RGV A;  3W6J B;  5J1Y A;  1HBX G;  4YIR X;  5BPD A;  4PZJ A;  3GFJ A;  1OCZ H;  2E5N A;  2X51 A;  1MKM A;  3A0H C;  1JUM A;  2IA0 A;  2OUM A;  3I55 I;  1VFC A;  3J7Z I;  1VQ8 I;  4ON0 A;  2CU7 A;  2AQE A;  5KAF C;  5DEQ A;  1RKW A;  5F08 A;  2Y69 H;  4M3F A;  3J7A Y;  2DJN A;  1XMA A;  4GO1 A;  1A5J A;  4G9Y A;  1XSX A;  4KIF A;  5DUK A;  4PJL A;  4B3A A;  1UG2 A;  2ZB9 A;  4KDP A;  1Z1D A;  2A07 F;  3W3C A;  2UUZ A;  2HKX A;  3I54 A;  5J8F A;  1FMW A;  2ZJ2 A;  2XB5 A;  1K78 B;  1TWG J;  3S8P A;  4CCO A;  1D8J A;  3C1D A;  1QHG A;  1VI0 A;  2HDD A;  3LSH A;  2YS9 A;  1Y1W J;  4EM1 A;  1KU7 A;  2GIZ A;  1W7P A;  1Z91 A;  3H35 A;  1BL0 A;  5EJC A;  2AXT C;  2WB1 A;  1FP2 A;  3QOP A;  4NNJ A;  3LST A;  2BE5 F;  4WX9 A;  1ZAR A;  1V5G A;  3ECH A;  2VOO A;  2EZK A;  1WVR A;  1R00 A;  2F4I A;  1W0T A;  1L3L A;  2DCE A;  2JRM A;  1T08 B;  5GAG J;  2MA3 A;  4V2G A;  1SAX A;  3HOZ J;  2HKO A;  2WAQ N;  4LFU A;  5HLI A;  3DXJ F;  4KT6 A;  3AL0 B;  4PUS A;  3E5Q A;  2OD5 A;  2TDX A;  5KCM A;  2VI6 A;  3F21 A;  3G1L A;  4M3B A;  1BW5 A;  2YUS A;  3ZMV A;  2DK5 A;  3JCU C;  2EV6 A;  3DEW A;  1P7J A;  2FUG 2;  2J5O A;  2MG4 A;  2VQL A;  4KT5 C;  2R5Z A;  3SEQ A;  1IG7 A;  1HKS A;  2JN6 A;  1R58 A;  2GOX B;  4UVB A;  2LBF A;  1JJ6 C;  3PNT A;  2EZI A;  5K5O A;  2HI3 A;  4E7I A;  3A02 A;  3HYI A;  3SDB A;  1C0W A;  3FXL A;  2E5Z A;  3GXO A;  3SFZ A;  4CGZ A;  5GP9 A;  3BR2 A;  1WQ2 A;  1OYW A;  4L9J A;  2CWE A;  4L9T A;  5F04 A;  3ZQQ A;  1ZTR A;  1S72 I;  2A6T A;  1SFU A;  1F4K A;  1HLV A;  3QP6 A;  3HUG B;  2IS1 A;  2QEN A;  1IUF A;  1VF9 A;  3SFI A;  1RR7 A;  4EM0 B;  5M5Y J;  1QA6 A;  3K2A A;  4OMZ A;  2XAF A;  1KQ9 A;  3M3Y J;  4C9Y A;  4M9Z A;  2PJP A;  3WGI A;  2HEO A;  3R0J A;  1B1B A;  4PJJ A;  2NS8 A;  4ZDP A;  2QUF A;  2CUE A;  1LVA A;  4HST A;  3RPQ A;  1XTA A;  3FHN A;  3VSK A;  2K4B A;  2LD5 A;  2Q2E B;  2X6X A;  4NQW B;  1SVL A;  2H6C A;  5E17 F;  1Y1V J;  3BZK A;  2PMU A;  3GW2 A;  2M45 A;  2KZV A;  1I39 A;  4HW0 A;  3GVA A;  3LQR A;  4DYC A;  1S7A A;  2VE9 A;  3FKJ A;  2R7R A;  2R7T A;  5F0F A;  1X1P A;  2BOL A;  4MGR A;  4BXU A;  3D5L A;  4I7H A;  1H0M A;  3H3V K;  3MEX A;  3ERM A;  4BBS J;  3F0C A;  3VPR A;  4XKB A;  2XAQ A;  3QOE A;  5K7H A;  4M73 A;  3DTE A;  2Y9Y A;  2R93 J;  3CD6 I;  4A3G J;  2QSG X;  1MJA A;  2HNH A;  2P7C B;  2JK3 A;  5KAI C;  1S7E A;  1R1U A;  1P4W A;  2K9M A;  3FX3 A;  2ZFU A;  2DQL A;  2XIG A;  3D1N I;  2L2O A;  3CJR B;  4DNC A;  3HRM A;  3UR3 C;  4P9U A;  1T8I A;  2ZSI B;  2YX4 A;  4II3 A;  1RNL A;  2KKO A;  4KMU X;  2O9L A;  1X4O A;  2DMP A;  4NB5 A;  3CCL I;  2Y48 A;  1MBF A;  1X2M A;  2CQK A;  3F8B A;  2X1D A;  3BR3 A;  2CW0 F;  3R4K A;  1DU6 A;  3G1M A;  1MW7 A;  2PI0 A;  3OS0 A;  2E2H J;  5H6Q A;  1RUO A;  3A03 A;  5F1R A;  3WTS C;  4AID A;  1QU3 A;  3C2B A;  5CVR A;  1N25 A;  3X2Q H;  2V26 A;  1F9N A;  2NRA C;  3LQQ A;  3KEQ A;  1MDM A;  1W7P B;  2LP0 A;  3CCE I;  2LYC A;  2XAS A;  3S2W A;  2O0Y A;  4R1H A;  4XK4 A;  4QTR A;  3OYN A;  2MLK A;  4BHB A;  4QSH A;  2LY1 A;  4IL6 C;  4HZF A;  1ZG3 A;  2G7U A;  2XSJ C;  2LG4 A;  3WTY C;  2P0W A;  2PN6 A;  3OWT A;  2QQA A;  1IV6 A;  1SFX A;  3MD2 A;  4IHV A;  4OIN F;  4IOA F;  4A0X A;  2YSR A;  3KEY A;  5D5X B;  1EA3 A;  2VN2 A;  3GX4 X;  2I5U A;  3KE2 A;  4I09 A;  2F48 A;  2XVC A;  4RB1 A;  3JRH A;  3TMO A;  1ZLJ A;  4Y3O A;  3C7J A;  3TGN A;  2COB A;  1J09 A;  2VUM J;  4BQN A;  2KIQ A;  4F3Q A;  3JTG A;  3H9G A;  5FLM J;  4YRV A;  5A2Q K;  3OL3 A;  1LFU P;  3MZY A;  2I10 A;  5IOY A;  1NH3 A;  4PSW A;  2PJR B;  1YW8 A;  2QQ8 A;  2CGP A;  2DFE A;  3T1B A;  1JJ8 C;  1DGW Y;  2FBK A;  1SFO J;  4P96 A;  1ODD A;  4YG2 F;  4AIK A;  1MIJ A;  4B1R A;  1W1W E;  3BZ6 A;  3I5U A;  1UB9 A;  3ZOB A;  2VKE A;  4AUX A;  1K6Y A;  1TLH B;  1I3A A;  2LC2 A;  2LMD A;  3LSK A;  2GA1 A;  3A2K A;  1YHQ I;  1U8B A;  3BWG A;  1MNM C;  3FM3 A;  2O5R A;  4FE7 A;  4PK4 A;  3RKQ A;  2DT6 A;  1HSJ A;  2CYY A;  3B6C A;  3CP8 A;  4Q48 A;  4FX0 A;  1BR2 A;  2R3S A;  4NHJ A;  2WY7 Q;  3M8E A;  1BC7 C;  2E2I J;  4DBR A;  3EYY A;  4CYD A;  5J4V A;  2ME6 A;  3LSM A;  1D8K A;  3ZQC A;  3WHB A;  3CF2 A;  3FXR A;  4XKC A;  3HKZ N;  4C2M J;  5L3C A;  1IF1 A;  4LJZ F;  2E2J J;  6PAX A;  1SD4 A;  2GZW A;  1TNT A;  4OIP F;  1S6L A;  4DYQ A;  5HLG A;  3NAR A;  3K9T A;  3WU1 B;  3HDD A;  3QYB A;  3CJQ B;  2ZME C;  1VQ9 I;  1U2W A;  4Y15 A;  1E3H A;  1U9N A;  1IDZ A;  2D45 A;  3HM5 A;  3AL0 C;  3TO9 A;  2CV1 A;  3N05 A;  5LGU A;  3IKV A;  1J5Y A;  1KA8 A;  4BQO A;  1CF7 A;  3QU6 A;  2OCE A;  4BJ5 C;  4KIC A;  3IRR A;  2HGC A;  5HOO A;  1RIO H;  2BY1 A;  2JA5 J;  3W6V A;  1SVM A;  2EQR A;  3I59 A;  3LWF A;  4RAF A;  2KMU A;  3EQL F;  2W57 A;  3VWB A;  2N8G A;  5HLT A;  2KRH A;  1X19 A;  2RNJ A;  2XB0 X;  2GQQ A;  3PUF A;  3JRD A;  5DV5 A;  1Y0U A;  2VPL A;  3I0T A;  2UWM A;  2XPV A;  3K4L A;  3TP3 A;  4HBL A;  2R92 J;  5AIQ A;  4XLH A;  4YFN F;  2O8X A;  1H89 C;  2HQN A;  3BG7 A;  4L0Y B;  2HOA A;  1Z21 A;  2QVO A;  4JYK A;  2LKX A;  1SVO A;  2HQ5 A;  4G94 A;  2DXI A;  5E8G A;  4XSZ F;  1TL8 A;  2X6Y A;  2P6S A;  5DCM A;  1BJZ A;  1YJ9 I;  3E6B A;  3VSL A;  3LNQ A;  5FD5 A;  4CDG A;  4HF2 A;  3TW7 A;  1ZYR F;  2P6T A;  3HSR A;  1Z6R A;  1P9Q C;  4L0Z B;  2VJI A;  3D5S C;  3E7L A;  3DKY A;  3K69 A;  2DT5 A;  2WAE A;  2QCO A;  5F0C A;  1UEL B;  3LA3 A;  1YE9 A;  2IS2 A;  1W5S A;  2VJ4 A;  2VQC A;  2M7A A;  2E1O A;  4I02 A;  2WV0 A;  3FMR A;  2M87 A;  4FCY A;  2P81 A;  3OYE A;  4WXD A;  2W7N A;  1Z6T A;  1PUF A;  3IV5 A;  4HX7 A;  4KN4 X;  5HDG A;  2HDC A;  4EJV A;  2XF5 A;  2OPT A;  1XS9 A;  1N78 A;  2MW8 A;  1V55 H;  2ECB A;  3Q0V A;  2JTV A;  5ILU A;  3OYI A;  4DQ2 A;  2QQB A;  5GAD J;  4BAY A;  3F8C A;  2LLK A;  5GTI C;  4LG3 A;  3H1C A;  1SMT A;  4FAS D;  3CCJ I;  1WJE A;  2L9R A;  2OTL I;  2PFB A;  1R36 A;  2FD5 A;  4RA2 A;  4BEH A;  3SXY A;  5FKM A;  3OYD A;  3WE3 A;  5IT3 A;  2R7X A;  3CUQ C;  3GZN B;  5DYM A;  4OIO F;  5E79 C;  3FDY A;  3W2V A;  2VBW A;  1WFX A;  3GYH X;  2PMZ N;  5IYD J;  1XCV A;  3OV8 A;  3GME A;  4L5E A;  4A3C J;  3GTO J;  3SQN A;  2XUB A;  1STZ A;  2DOF A;  1U3E M;  1JXS A;  2BBY A;  2NS0 A;  4AVZ A;  3L1P A;  2EA4 A;  4D7N A;  2F5C A;  4G7H F;  2ZKZ A;  3S2D J;  1WWX A;  2EV5 A;  3O3K A;  3GEZ A;  3WG7 H;  3A0B C;  3IH2 A;  1FSH A;  2M9H A;  4KA4 A;  2V4J C;  1RR8 C;  2MBF A;  4Y4R A;  3E1S A;  4A6E A;  5GTH C;  4KNY A;  5CJ9 A;  1U6G A;  3MZ8 A;  1Z9C A;  2DA4 A;  1NK2 P;  3ZQH A;  3ZN0 A;  3K70 C;  4UV9 A;  1TW3 A;  4IOC F;  1IAW A;  1ZEL A;  4XLP F;  4AD9 A;  4S04 A;  4BE1 A;  2OTJ I;  4H4K C;  5K7Z A;  4RAY A;  3S1N J;  3W6K B;  2Z33 A;  1VQO I;  1B59 A;  1LB2 A;  1K6O A;  3F8M A;  2GXG A;  4UUS A;  2XDV A;  4WK8 F;  1KQ0 A;  4RBO A;  2R4G A;  5BOX A;  2R0Q C;  2L02 A;  2H1L A;  4MQ9 F;  3IWF A;  4BXX J;  3VB2 A;  4V2F A;  2YX7 A;  1HDP A;  1H9G A;  1FWZ A;  5ERI A;  2EFN A;  1FNN A;  2MD0 A;  1ZRD A;  4PGH A;  3WG9 A;  1JGG A;  3HOS A;  3PSF A;  5DS9 A;  4GYI A;  4N4O B;  1P7I A;  5E3O A;  1X1B A;  2VB6 A;  3SHF A;  4G8X A;  3E6M A;  2KIF A;  4XID A;  3CUO A;  4OAZ A;  4DZP A;  4UHT A;  4YEL A;  5H2F C;  2CUF A;  2RKH A;  1XG1 A;  3ZR8 X;  3CCV I;  2P5L C;  4QPO A;  4RB3 C;  3UNG C;  2LF8 A;  4IPA A;  4AYB N;  3KP7 A;  3WE2 A;  4UY8 I;  1R1T A;  4J01 A;  3E5U A;  3SEZ A;  3S16 J;  2LH9 A;  2V7F A;  1MBG A;  1I6H J;  1SFE A;  2JA7 J;  4CHU A;  3BQZ A;  4ZTF A;  2X48 A;  1IGN A;  2LY2 A;  3CLQ A;  2WAD A;  4UUT A;  3M1E A;  1W7P D;  5JVT A;  2XRO A;  4FET A;  4M6Y A;  4LD5 A;  1ETK A;  3FIW A;  2HDW A;  2KZG A;  5CKT A;  2L7Z A;  2VC1 A;  3E6D A;  2EK5 A;  3HTU A;  2VXD A;  3NRV A;  1FT9 A;  2EIJ H;  3WGG A;  4OMY A;  3VFZ A;  3RZO J;  5CVU A;  2Y0S N;  2ELJ A;  4F92 B;  5E3N A;  1F43 A;  4F93 B;  5CVV A;  4L9N A;  2X1E A;  1G2H A;  3ASO H;  2DOE A;  2ZSH B;  1YG2 A;  1PP8 F;  4HOB A;  2R7U A;  1G8X A;  1X1C A;  3K4J A;  3MZH A;  1JKQ C;  5CQG A;  1EJ9 A;  5L3F A;  1YI2 I;  3GTK J;  2EZH A;  3WHC A;  4E4H A;  4OIQ F;  4EVI A;  2VJ5 A;  4HV5 A;  1QHH D;  2ZCW A;  3RKX A;  1AHD P;  1K79 A;  2V1U A;  1LEB A;  2HTJ A;  3DU6 A;  4IXA A;  4RS8 A;  3ZQ7 A;  3QRF F;  1AA7 A;  4A69 C;  3CDI A;  4M6X A;  1YTY A;  2VE8 A;  2WC2 A;  1A6I A;  3GLL A;  5DM7 F;  3MKW B;  2LFB A;  4GCV A;  2L0K A;  4Y17 A;  2R7S A;  1E17 A;  4LK1 F;  2CFX A;  3CCY A;  3DFG A;  2IAI A;  5CPR B;  4QPQ A;  3P9I A;  3G1O A;  1R5I D;  3DEU A;  3M1C A;  5B66 C;  2EFQ A;  1R5H A;  2ESN A;  3TO6 A;  4ASN A;  5JHU A;  3A01 A;  2L7F P;  1IXR C;  3LSP A;  3DPT A;  5ICF A;  5B5E C;  4IKF A;  2DJI A;  5GAE J;  3HOY J;  2DFF A;  1XMX A;  3HKZ A;  1XD7 A;  2JSP A;  4XBF A;  4ZZL A;  1YX3 A;  2IW5 A;  1P92 A;  3HXL A;  3KZZ A;  3S14 J;  3V8K A;  3FXQ A;  1D0X A;  5E18 F;  2VKV A;  1KU3 A;  2LKS A;  4I76 A;  4DIQ A;  2LNB A;  3FBN B;  3QPT A;  1DUX C;  1TWF J;  2A69 F;  2HPI A;  3B6A A;  4A93 J;  2ESH A;  2KQR A;  1CGP A;  2DFH A;  2FNP A;  2L01 A;  1VQL I;  4O6J A;  1D1B A;  4EJW A;  1S3J A;  2RV8 A;  4BH9 A;  2E36 A;  4C3I J;  4IJA A;  1FYL A;  1HW2 A;  1RRJ A;  1ZRE A;  1JKR C;  2JVH A;  3FXM A;  4B43 A;  1G3Y A;  1BA5 A;  2ZNY A;  5D8L B;  1JT0 A;  2STW A;  4MEX F;  1J59 A;  1XGS A;  2BYV E;  2F4O B;  2HYG D;  2IBD A;  5ILS A;  5DUI A;  3MN2 A;  3J81 K;  3S2H J;  5LFA A;  2YU9 J;  4EQQ A;  2HVQ A;  3CUQ B;  2L54 A;  3OOP A;  1R22 A;  3DBR B;  1OIS A;  3VOE A;  4BQQ A;  5J6X A;  2WY8 Q;  2P8T A;  4Q47 A;  2PQ8 A;  3VYU B;  3CC7 I;  1JE8 A;  3NWS A;  1OCO H;  1ZR2 A;  2MFZ A;  2BY2 A;  1KU9 A;  3NQO A;  2LR8 A;  4YEJ A;  3EUK L;  2GM4 A;  2D1H A;  1QVT A;  4KYW A;  3LL7 A;  4CCL A;  1KGS A;  3CJN A;  1O7L A;  4N0B A;  4RM2 A;  1O3T A;  4HRI A; 
#chains in the Genus database with same CATH homology
 1WI9 A;  1ULY A;  4LB5 A;  2VON A;  1T38 A;  1R7J A;  1H9T A;  4Y13 A;  2PEX A;  1R5G A;  3FF5 A;  3ECO A;  4GYG A;  5E1Z B;  2L3D A;  5HDN A;  2V6C A;  1QBJ A;  5FFZ A;  1IZ1 A;  1FYK A;  3PFI A;  1BIA A;  1P4X A;  1IUY A;  4NQW A;  5A2Q Z;  4PDK A;  4LG0 A;  2XAG A;  2LF7 A;  2XRN A;  4JK1 X;  4RGU A;  1DDN A;  5D6E A;  1BBY A;  3KLN A;  2M1B A;  1YO5 C;  1Z05 A;  2RN7 A;  5H6R A;  5HS9 A;  1GHC A;  1HW5 A;  5LEJ A;  4I0A A;  2G7H A;  1P2F A;  3GF2 A;  1BI1 A;  5BS6 A;  3G73 A;  5F64 A;  3TOB A;  3JAM K;  4N9H A;  3ELK A;  3HRU A;  1ZHF A;  5J8C A;  4U0Y A;  1BI0 A;  4M71 A;  1TTY A;  5L3B A;  1YIO A;  4BHC A;  4A12 A;  3K1P A;  1YS6 A;  1HST A;  2RVC A;  4YIF A;  3BPV A;  3JTH A;  1WKM A;  5LEK A;  4R8H A;  5IT9 Z;  1D3Y A;  3QU3 A;  1ZRF A;  1ON2 A;  5FO5 A;  3T8T A;  1RUN A;  2E7X A;  3IRQ A;  3WTV C;  2DTR A;  4P5O A;  2WWY A;  1IXC A;  2KJB A;  3RIR A;  5E8I A;  3L2C A;  1EV7 A;  1MJB A;  2VT2 A;  2QBY B;  4LLG F;  3RYR A;  2O6G E;  2FXA A;  2UZK A;  1F5T A;  2HOE A;  2FBI A;  3JW4 A;  5FFX A;  4UUV A;  1HKQ A;  3LA2 A;  3TDZ C;  4G7Z F;  4A5M A;  3ZMZ A;  1KQ8 A;  1SD7 A;  5ICE A;  1ZG5 A;  5EEG A;  3T8R A;  4AIJ A;  2F5D A;  3I4P A;  5JI6 A;  4LG0 B;  1IN4 A;  1G4D A;  1UCR A;  3M9A A;  1FY7 A;  4WF2 A;  2Q0O A;  3KP4 A;  3F6O A;  1J9I A;  3F6V A;  5CLS A;  3FZV A;  2MH9 A;  3LAP A;  2GA2 A;  4U88 A;  3NEU A;  3BRO A;  5BMZ A;  2E7W A;  2C6Y A;  1UFM A;  3GZ5 A;  5TRD A;  2K27 A;  3R6S A;  1PDN C;  3VOD A;  4GXO A;  2MLG A;  3ULQ B;  2PG4 A;  3DV8 A;  4H0E A;  5D8K B;  4B09 A;  2OQG A;  2LKP A;  3V7R A;  4U0W A;  5LBQ A;  2IP2 A;  3N97 A;  2FSW A;  3L09 A;  3TQN A;  3P9C A;  2Z3Y A;  2QLZ A;  3T0Y A;  3GFL A;  4A5N A;  1FSE A;  3KEO A;  4QLC U;  2DBB A;  3KP3 A;  4A0Y A;  3QPH A;  2FMY A;  3LFK A;  4R79 A;  3V8J A;  2DW4 A;  1LNW A;  1ZN2 A;  4N9I A;  3FWE A;  1T39 A;  1E2X A;  4KIG A;  2BEO A;  2NNN A;  5DCM B;  4JBA A;  1ZG1 A;  1OR7 A;  1OPC A;  2D1V A;  1P4A A;  2YU3 A;  3V8L A;  4ZH4 F;  1MJ9 A;  4WXH A;  4M74 A;  4L5I A;  5CVI A;  2Z9O A;  2L4M A;  2DU9 A;  2J5P A;  2V1D A;  5E1X A;  2L4A A;  5DCF A;  5LGT A;  3JSO A;  1B6A A;  2PBI A;  1TQP A;  2F5E A;  4U7D A;  1HQC A;  5L3D A;  3HSE A;  1I5Z A;  2H94 A;  3BP8 A;  4EM2 A;  2Z5U A;  1QO0 D;  1YYV A;  2ISY A;  4IHT A;  2R7F A;  2VC0 A;  4I01 A;  4WWC A;  1IW7 F;  3GUD A;  1MD0 A;  3H3Z A;  1KYZ A;  1J2X A;  1XGN A;  1I1G A;  4IRG A;  2Y75 A;  3J81 Z;  4P55 A;  2O61 A;  2F5F A;  1IRF A;  3R60 A;  1KYW A;  2ZNZ A;  3GFM A;  2W84 A;  2RQP A;  3Q9S A;  1XSD A;  2YPR A;  1ZGJ A;  3SZT A;  2XHK A;  5HS8 A;  4Q5S F;  4G6Q A;  2RC4 A;  5CVJ A;  1OYI A;  3GO5 A;  4ZYE A;  1O3Q A;  3K1N A;  5HVQ C;  2O3F A;  2BGC A;  4RGS A;  2QYO A;  2FML A;  3MCZ A;  1PUE E;  2FA5 A;  1O7F A;  1UHM A;  1J7K A;  2IA1 A;  3QAH A;  4ESF A;  1FBS A;  1BJA A;  2P5K A;  1T6S A;  1JHF A;  1BIB A;  2CO5 A;  2FBH A;  3WTW C;  1K78 A;  3BPX A;  4IRH A;  4A0Z A;  3ZMD A;  4ZYH A;  4QWQ A;  2A3S A;  2H6B A;  3HRT A;  1ZRC A;  5LRR A;  3CUQ A;  2STT A;  5D6F A;  4LGW A;  2DPD A;  1MDM B;  1T2K A;  5D5V B;  2QM3 A;  1XN7 A;  1BI2 A;  4LMY A;  3R61 A;  3KP2 A;  3WTX C;  3RI4 A;  3ABU A;  4UXN A;  5LGN A;  4M9S A;  2P5V A;  4MQV A;  2EA2 A;  4CXF A;  4O3M A;  1XB4 A;  1Q1H A;  3WOD F;  5FD6 A;  1LDJ A;  3J80 K;  4HYE A;  1FX7 A;  2IPQ X;  4G7O F;  2ZFW A;  2V79 A;  2JPC A;  3P9K A;  4BYY A;  3JSP A;  3C18 A;  2LDU A;  2KIM A;  2VBY A;  1G6N A;  4HV6 A;  3FXU A;  2NYX A;  1LJ9 A;  2FRH A;  5FLX K;  2EFO A;  1J75 A;  2MC3 A;  2CSO A;  4UVC A;  1FPQ A;  1XGO A;  2OZ6 A;  2GIV A;  2HQR A;  4L5J A;  4KN7 X;  3I53 A;  3FM5 A;  1HXD A;  5KVR A;  2FF4 A;  1BM9 A;  3RDI A;  1NHA A;  3IWZ A;  3GZ6 A;  4I0B A;  3K2Z A;  2FEZ A;  4L9V A;  3IL2 A;  3IHU A;  3KP5 A;  1USS A;  4G6D A;  5K1Y A;  1O57 A;  3PQK A;  3DKW A;  3AAF A;  1K7A A;  4ENK A;  3L7W A;  3PQJ A;  1ON1 A;  1LDD A;  3K1M A;  2RDP A;  4JQF A;  5LRS A;  3Q9V A;  5DD4 A;  4B8X A;  2E1C A;  2EJR A;  1FC3 A;  2KJC A;  4ENM A;  1QZY A;  5L3E A;  1OKR A;  5E20 A;  1U8R A;  3CO6 C;  5HDK A;  3BOQ A;  2ACJ A;  3HSF A;  3B73 A;  3MQ0 A;  1QPM A;  5EEH A;  3I58 A;  2JSC A;  1VTN C;  1O3R A;  2E1N A;  2ELH A;  2IT0 A;  4IF4 A;  3HHG A;  2QZ8 A;  5L3G A;  1XMK A;  1FZP B;  2DQR A;  2UXN A;  2Z99 A;  4WCG A;  2ADU A;  2UXX A;  2A6E F;  1IRG A;  3D0S A;  1L0O C;  4EGY A;  3J7A O;  2AS5 F;  1U5T C;  2ZXJ A;  1EH7 A;  1SD5 A;  3KP6 A;  1S29 A;  2B0L A;  1IXS B;  2OA4 A;  3ML6 A;  2GAU A;  3J80 Z;  4ZZD A;  5D5U B;  3M7G A;  4MTE A;  1F1Z A;  4UVA A;  3FMS A;  4CZZ A;  1PP7 U;  5TJJ A;  5CYV A;  1X3U A;  2A6H F;  2F2E A;  4AVP A;  4IRI A;  5BQT A;  2A5Y B;  3KET A;  4MHG A;  4ZYD A;  1W4M A;  2OQR A;  2FU4 A;  2XGX A;  4HQM A;  2HR3 A;  3LA7 A;  3MFK A;  3RTR A;  2ETH A;  3GFI A;  3ZMT A;  4A2U A;  1I27 A;  2HYF A;  2ISZ A;  4UNO A;  2OU2 A;  3V7C A;  1UST A;  3HIF A;  1T98 A;  2EWN A;  3COA C;  4KUM A;  3RYP A;  3M8F A;  4HLX A;  3MWM A;  4I2O A;  1ZLK A;  1XDS A;  1SD6 A;  4MNU A;  4YFK F;  3ZMS A;  5LHG A;  3ZPL A;  1V4R A;  4K2E A;  4LLN A;  3E3V A;  4RB2 C;  2W24 A;  2JZY A;  1P6R A;  3DP7 A;  3O6B B;  2LSO A;  3DPL C;  1TQI A;  3P7N A;  3F8N A;  3TDU C;  1CF7 B;  4HX8 A;  4EJU A;  3H92 A;  3U9G A;  1B9M A;  3BJ6 A;  3REO A;  2JT1 A;  3QP5 A;  3RKY A;  1LEA A;  3EUH A;  2K86 A;  5DDG A;  3CLO A;  4AIH A;  2YR2 A;  2QBY A;  3BJO A;  2R7D A;  1XDU A;  2QQ9 A;  4XRF A;  1R23 A;  3RJP A;  4U7B A;  3R0A A;  3E5X A;  1WRJ A;  2MH2 A;  1EH8 A;  2CG4 A;  3RPU A;  2H27 A;  5ICC A;  1GXQ A;  2HFH A;  2COM A;  2DAO A;  2DO7 A;  2DI3 A;  4M9X A;  4BHP A;  2ZBK A;  1SMY F;  4LK0 F;  2WTE A;  1D5V A;  4F7Z A;  2HTS A;  2IA2 A;  2W25 A;  2Q8K A;  4HDU A;  2XKO A;  3GWZ A;  4Z2Y A;  1OYY A;  2M30 A;  2X0L A;  3JAM Z;  4LB6 B;  5ILV A;  4E70 A;  2KIU A;  2DK8 A;  5D5W B;  2M8E A;  1V3F A;  3C3W A;  1B9N A;  5D4R A;  1GVJ A;  2BV6 A;  4P9F A;  4BQA A;  1R1V A;  3ISP A;  4HAM A;  2PMH A;  1DPR A;  2EB7 A;  3KZY A;  1IN7 A;  3Q5F A;  2EFP A;  4HLY A;  4A6D A;  4EMS A;  2P7V B;  1FBU A;  4ESJ A;  1U5T A;  5LLQ A;  1U78 A;  2FNA A;  4CIC A;  5JR3 A;  3WU0 A;  1I6X A;  4OU0 A;  3E97 A;  4KFC A;  4EGZ A;  2OBP A;  4HX4 A;  5FGM A;  3T5X A;  1YW9 A;  4XSX F;  5LHI A;  3CDH A;  2IRF G;  3TOA A;  3WTU C;  2Q2E A;  1B4A A;  1U5T B;  4O5V A;  4PGG A;  2EFW A;  1MZB A;  1Z7U A;  1REP C;  1ZGA A;  4MEY F;  3FHZ A;  2H09 A;  1YW7 A;  2A68 F;  4RGR A;  4TV7 A;  3RKW A;  2O03 A;  4IHS A;  2ZME B;  1S7O A;  5BPI A;  2Y0M A;  2DPU A;  3HUG A;  1YS7 A;  3VEP A;  5F6F A;  3WTT C;  2QWW A;  1ZAO A;  3O2P E;  5E1W A;  1YLF A;  2XAJ A;  3FMQ A;  3F23 A;  4ZYG A;  3CTA A;  2A61 A;  5K5R A;  2XV4 S;  4OOI A;  4OIR F;  1WSU A;  3SZP A;  1A04 A;  4FHT A;  4FX4 A;  1QGP A;  5HS7 A;  2GXB A;  4I98 B;  4EJT A;  3F22 A;  5IT9 K;  2NAZ A;  4UV8 A;  2VT3 A;  3KLO A;  4HF1 A;  5DD8 A;  5HLH A;  4RGX A;  1EH6 A;  1T0F A;  5LHH A;  1BN5 A;  4YII A;  1IN8 A;  3F8F A;  4KMF A;  3EET A;  4IVN A;  1QQI A;  5D4S A;  5ED4 A;  4L18 B;  3ERE D;  3G3Z A;  4CO8 A;  2V1X A;  2W85 A;  3I59 B;  1LQ1 A;  4KIB A;  2HZT A;  4XLN F;  2VBZ A;  4S05 A;  1YFH A;  1AOY A;  3I64 A;  3KFW X;  5AON A;  3LAJ A;  3EDP A;  3TKY A;  4HQE A;  4U0V A;  2FQ3 A;  4ETS A;  5H20 A;  1DP7 P;  3K0L A;  5FB2 A;  1BI3 A;  1GXP A;  3HHH A;  3BY6 A;  4EV0 A;  1HW1 A;  3HRS A;  3B02 A;  1BOA A;  3TO7 A;  3H3U A;  4Q4Z F;  3ZMU A;  1TBX A;  3MAJ A;  2AXL A;  1W5T A;  4HDV A;  1IN6 A;  3ABT A;  2PLY A;  1KU2 A;  1QZZ A;  3V4G A;  1QNT A;  2DFI A;  3HOT A;  1DPU A;  1XSV A;  2EV0 A;  2M5W A;  2JPB A;  2VXZ A;  3ZP5 A;  2P4W A;  3KCC A;  1G3T A;  3L9F A;  5AIP A;  3WGH A;  4ESB A;  2IJL A;  1TW2 A;  3HTS B;  5ICG A;  1OMI A;  3BJA A;  2NNY A;  5K5Q A;  1JGS A;  2VBX A;  1FYM A;  1ZH5 A;  3F72 A;  5FLX Z;  1RI7 A;  4EJO A;  1G3S A;  5JFR A;  4RB0 A;  4HF0 A;  3IC7 A;  1FP1 D;  1IN5 A;  4WXC A;  1XCB A;  2VOD A;  3ZN1 A;  3N4M A;  2HS5 A;  1I1S A;  1ONV A;  2K4J A;  2OAZ A;  2V9V A;  2K02 A;  4RAZ A;  4LLL A;  1MGT A;  3DQV C;  3F3X A;  2ZME A;  4ENN A;  2HWV A;  2K7L A;  1FOK A;  2FE3 A;  2FOK A;  2MD5 A;  1BC8 C;  4GGG A;  1S8N A;  1G3W A;  3ROU A;  2OZU A;  3L00 A;  1FLI A;  1JHH A;  4FT8 A;  4M72 A;  1LDK B;  4HA8 A;  4ENJ A;  1TQM A;  4BNC A;  1XGM A;  2DLL A;  3EYI A;  3WTZ A;  2IVM A;  3E6C C;  2VOP A;  4PCQ A;  2GWR A;  3U1D A;  2KRF A;  2XKP A;  1FBQ A;  5KK1 A;  1AWC A;  4YFX F;  2JRT A;  3BDD A;  3CO7 C;  3IKT A;  2X4H A;  4D0P A;  3I71 A;  1TNS A;  1HKT A;  1O3S A;  2D2W A;  2XAH A;  3DF8 A;  2ZO4 A;  4AWX B;  1YQA A;  3U2R A;  3V7S A;  3GLX A;  1J0R A;  1UHW A;  2G9W A;  1RZ4 A;  2RGV A;  3W6J B;  1HBX G;  5BPD A;  4PZJ A;  3GFJ A;  1MKM A;  2IA0 A;  4ON0 A;  5DEQ A;  1XMA A;  4GO1 A;  5DUK A;  1XSX A;  4G9Y A;  4KIF A;  4KDP A;  1Z1D A;  2A07 F;  2HKX A;  3I54 A;  5J8F A;  2ZJ2 A;  1K78 B;  1D8J A;  3C1D A;  4EM1 A;  1KU7 A;  1W7P A;  1Z91 A;  1FP2 A;  3QOP A;  3LST A;  2BE5 F;  4WX9 A;  1ZAR A;  3ECH A;  2VOO A;  1R00 A;  1L3L A;  2MA3 A;  1SAX A;  2HKO A;  4LFU A;  5HLI A;  3DXJ F;  3E5Q A;  2OD5 A;  2TDX A;  3F21 A;  3ZMV A;  2DK5 A;  2EV6 A;  2J5O A;  4KT5 C;  1HKS A;  1R58 A;  4UVB A;  5K5O A;  3HYI A;  1C0W A;  3GXO A;  3SFZ A;  4CGZ A;  1WQ2 A;  1OYW A;  4L9J A;  2CWE A;  4L9T A;  1SFU A;  1F4K A;  3QP6 A;  2QEN A;  4EM0 B;  4OMZ A;  2XAF A;  1KQ9 A;  4M9Z A;  2PJP A;  3WGI A;  2HEO A;  3R0J A;  1B1B A;  2QUF A;  1LVA A;  3RPQ A;  2K4B A;  5E17 F;  2H6C A;  3GW2 A;  2PMU A;  2M45 A;  4HW0 A;  3GVA A;  3LQR A;  1S7A A;  2VE9 A;  4MGR A;  4BXU A;  3D5L A;  4I7H A;  1H0M A;  3MEX A;  2XAQ A;  4M73 A;  1MJA A;  2P7C B;  1R1U A;  1P4W A;  3FX3 A;  2DQL A;  2XIG A;  4DNC A;  4P9U A;  3HRM A;  2YX4 A;  1RNL A;  2KKO A;  4KMU X;  4NB5 A;  2Y48 A;  2CQK A;  3F8B A;  2CW0 F;  3R4K A;  2PI0 A;  5H6Q A;  1RUO A;  5F1R A;  3WTS C;  5CVR A;  1F9N A;  2NRA C;  3LQQ A;  3KEQ A;  1MDM A;  1W7P B;  2XAS A;  3S2W A;  2O0Y A;  4R1H A;  2MLK A;  4BHB A;  4HZF A;  1ZG3 A;  2G7U A;  3WTY C;  2PN6 A;  2QQA A;  1SFX A;  4OIN F;  4A0X A;  2YSR A;  5D5X B;  2VN2 A;  3GX4 X;  3KE2 A;  4I09 A;  2XVC A;  4RB1 A;  1ZLJ A;  3C7J A;  3TGN A;  3JTG A;  5A2Q K;  3MZY A;  1YW8 A;  2CGP A;  3T1B A;  2FBK A;  4P96 A;  1ODD A;  4YG2 F;  4AIK A;  3BZ6 A;  3I5U A;  1UB9 A;  1TLH B;  2GA1 A;  3BWG A;  3FM3 A;  1HSJ A;  2CYY A;  4Q48 A;  4FX0 A;  2R3S A;  4NHJ A;  3M8E A;  1BC7 C;  3EYY A;  4CYD A;  1D8K A;  3FXR A;  5L3C A;  1IF1 A;  4LJZ F;  6PAX A;  1SD4 A;  2GZW A;  1TNT A;  4OIP F;  1S6L A;  5HLG A;  3K9T A;  3WU1 B;  1U2W A;  4Y15 A;  2D45 A;  3TO9 A;  5LGU A;  3IKV A;  1J5Y A;  1KA8 A;  1CF7 A;  3QU6 A;  4KIC A;  3IRR A;  2HGC A;  5HOO A;  1RIO H;  3I59 A;  3LWF A;  3EQL F;  2W57 A;  2RNJ A;  2GQQ A;  5DV5 A;  1Y0U A;  3I0T A;  2UWM A;  4HBL A;  5AIQ A;  4YFN F;  2O8X A;  2HQN A;  4L0Y B;  2QVO A;  4G94 A;  5E8G A;  4XSZ F;  5DCM A;  2P6S A;  3E6B A;  5FD5 A;  4CDG A;  4HF2 A;  1ZYR F;  2P6T A;  3HSR A;  1Z6R A;  4L0Z B;  3K69 A;  2DT5 A;  3LA3 A;  1W5S A;  4I02 A;  2WV0 A;  3FMR A;  2M87 A;  4WXD A;  1Z6T A;  4HX7 A;  4KN4 X;  5HDG A;  2HDC A;  4EJV A;  5ILU A;  2JTV A;  4DQ2 A;  2QQB A;  4BAY A;  3F8C A;  1SMT A;  2PFB A;  1R36 A;  3SXY A;  3WE3 A;  5IT3 A;  3CUQ C;  5DYM A;  4OIO F;  2VBW A;  3GYH X;  1XCV A;  3OV8 A;  3SQN A;  2XUB A;  1STZ A;  1U3E M;  1JXS A;  2BBY A;  2NS0 A;  2EA4 A;  2F5C A;  4G7H F;  2ZKZ A;  1WWX A;  2EV5 A;  3O3K A;  3GEZ A;  1FSH A;  4KA4 A;  2MBF A;  4A6E A;  4KNY A;  5CJ9 A;  1U6G A;  1Z9C A;  3ZN0 A;  4UV9 A;  1TW3 A;  1IAW A;  4XLP F;  4AD9 A;  4S04 A;  4RAY A;  3W6K B;  2Z33 A;  1B59 A;  1LB2 A;  1K6O A;  3F8M A;  2GXG A;  4WK8 F;  1KQ0 A;  5BOX A;  2L02 A;  4MQ9 F;  3IWF A;  3VB2 A;  2YX7 A;  1H9G A;  1FWZ A;  5ERI A;  2EFN A;  1FNN A;  1ZRD A;  4PGH A;  3WG9 A;  3HOS A;  4GYI A;  3SHF A;  4G8X A;  3E6M A;  2KIF A;  3CUO A;  4UHT A;  2RKH A;  2P5L C;  4RB3 C;  2LF8 A;  4IPA A;  3KP7 A;  3WE2 A;  1R1T A;  3E5U A;  1SFE A;  4CHU A;  3M1E A;  1W7P D;  5JVT A;  2XRO A;  4M6Y A;  4LD5 A;  2VC1 A;  3E6D A;  2EK5 A;  3HTU A;  3NRV A;  1FT9 A;  3WGG A;  4OMY A;  3VFZ A;  5CVU A;  5CVV A;  4L9N A;  1YG2 A;  1PP8 F;  4HOB A;  3MZH A;  5L3F A;  4OIQ F;  4EVI A;  4HV5 A;  2ZCW A;  3RKX A;  1K79 A;  2V1U A;  1LEB A;  2HTJ A;  4IXA A;  4RS8 A;  3ZQ7 A;  3QRF F;  4M6X A;  1YTY A;  2VE8 A;  2WC2 A;  4GCV A;  4Y17 A;  1E17 A;  4LK1 F;  2CFX A;  3DFG A;  3P9I A;  3DEU A;  2EFQ A;  1R5H A;  2ESN A;  3TO6 A;  4ASN A;  5JHU A;  1IXR C;  3DPT A;  5ICF A;  1XD7 A;  4XBF A;  4ZZL A;  2IW5 A;  1P92 A;  3KZZ A;  3V8K A;  3FXQ A;  5E18 F;  1KU3 A;  2LNB A;  3QPT A;  1DUX C;  2A69 F;  2ESH A;  1CGP A;  2FNP A;  2L01 A;  4O6J A;  4EJW A;  1S3J A;  2RV8 A;  4BH9 A;  1FYL A;  1HW2 A;  4IJA A;  1ZRE A;  1G3Y A;  2ZNY A;  5D8L B;  2STW A;  4MEX F;  1J59 A;  1XGS A;  2BYV E;  2HYG D;  5ILS A;  5DUI A;  3J81 K;  4EQQ A;  3CUQ B;  2L54 A;  3OOP A;  1R22 A;  3VOE A;  5J6X A;  2P8T A;  4Q47 A;  2PQ8 A;  1JE8 A;  1KU9 A;  3CJN A;  3NQO A;  2D1H A;  4KYW A;  1KGS A;  4MTD A;  1O7L A;  4N0B A;  1O3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...