5F6KC

Crystal structure of the mll3-ash2l-rbbp5 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
150
Chain Sequence
PLGSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFIPCHCGAVNCRKWMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
molecule keywords Set1/Ash2 histone methyltransferase complex subunit ASH2,Set
total genus 34
structure length 150
sequence length 158
chains with identical sequence E
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f6kC00
3OOIA 3CBPA 4MI5A 3BO5A 2F69A 5EX3A 1MVHA 5JINA 4YNDA 5AYFA 3K5KA 5TH7A 3KMAA 5EG2A 1H3IA 4Z4PA 3KMJA 5T0KA 3VV0A 4BUPA 3S7FA 5F59A 3KMTA 3RU0A 3IHXA 4RZ0A 4YPEA 3S8PA 4WUYA 4J7FA 3VUZA 3TG4A 4QENA 2W5ZA 4FMUA 4E47A 4YPAA 1MVXA 4QEOA 4C1QA 3M54A 5TEGA 3SW9A 3QWWA 3F9XA 2BQZA 3HNAA 3SWCA 1MT6A 2G46A 3EP0A 3CBOA 5F5EA 5JIYA 1ZKKA 2O8JA 1MUFA 1N3JA 5HI7A 5KJKA 5KJNA 3OXGA 3DALA 4MI0A 3RJWA 5CCLA 3F9YA 3M5AA 5ARGA 4J8OA 5LSXA 5CPRB 3M57A 1ML9A 3RIBA 4YPUA 5T5GA 5F6LA 1N6AA 3TG5A 2W5YA 3MO0A 4I51A 3OPEA 3M58A 3FPDA 4H12A 4IJ8A 3CBMA 5EX0A 4QEPA 5KJMA 2JV0A 5KJLA 3M55A 1O9SA 4J7IA 3S7BA 5LSZA 4J83A 3OS5A 3MEKA 3QWVA 3S7JA 1N6CA 5TTFA 5CCMA 3QWPA 3M59A 4NVQA 3F9ZA 5JHNA 5T0MA 5HQ8A 4NJ5A 3MO5A 4O30A 5F6KC 2RFIA 3OXFA 2IGQA 3MO2A 3S7DA 3PDNA 5JJ0A 2QPWA 4JLGA 4LDGA 3OXLA 5ARFA 3RQ4A 1PEGA 1XQHA 3M53A 4YNMA 3F9WA 3DB5A 3M56A 3RAYA 2R3AA 4O6FA 3N71A 4IJDA 4JDSA 4AU7A 4YNPA
chains in the Genus database with same CATH superfamily
3OOIA 3CBPA 4MI5A 3BO5A 2F69A 5EX3A 1MVHA 5JINA 4YNDA 5AYFA 3K5KA 5TH7A 3KMAA 5EG2A 1H3IA 4Z4PA 3KMJA 5T0KA 3VV0A 4BUPA 3S7FA 5F59A 3KMTA 3RU0A 3IHXA 4RZ0A 4YPEA 3S8PA 4WUYA 4J7FA 3VUZA 3TG4A 4QENA 2W5ZA 4FMUA 4E47A 4YPAA 1MVXA 4QEOA 4C1QA 3M54A 5TEGA 3SW9A 3QWWA 3F9XA 2BQZA 3HNAA 3SWCA 1MT6A 2G46A 3EP0A 3CBOA 5F5EA 5JIYA 1ZKKA 2O8JA 1MUFA 1N3JA 5HI7A 5KJKA 5KJNA 3OXGA 3DALA 4MI0A 3RJWA 5CCLA 3F9YA 3M5AA 5ARGA 4J8OA 5LSXA 5CPRB 3M57A 1ML9A 3RIBA 4YPUA 5T5GA 5F6LA 1N6AA 3TG5A 2W5YA 3MO0A 4I51A 3OPEA 3M58A 3FPDA 4H12A 4IJ8A 3CBMA 5EX0A 4QEPA 5KJMA 2JV0A 5KJLA 3M55A 1O9SA 4J7IA 3S7BA 5LSZA 4J83A 3OS5A 3MEKA 3QWVA 3S7JA 1N6CA 5TTFA 5CCMA 3QWPA 3M59A 4NVQA 3F9ZA 5JHNA 5T0MA 5HQ8A 4NJ5A 3MO5A 4O30A 5F6KC 2RFIA 3OXFA 2IGQA 3MO2A 3S7DA 3PDNA 5JJ0A 2QPWA 4JLGA 4LDGA 3OXLA 5ARFA 3RQ4A 1PEGA 1XQHA 3M53A 4YNMA 3F9WA 3DB5A 3M56A 3RAYA 2R3AA 4O6FA 3N71A 4IJDA 4JDSA 4AU7A 4YNPA
chains in the Genus database with same CATH topology
3OOIA 3CBPA 4MI5A 3BO5A 2F69A 5EX3A 1MVHA 5JINA 4YNDA 5AYFA 3K5KA 5TH7A 3KMAA 5EG2A 1H3IA 4Z4PA 3KMJA 5T0KA 3VV0A 4BUPA 3S7FA 5F59A 3KMTA 3RU0A 3IHXA 4RZ0A 4YPEA 3S8PA 4WUYA 4J7FA 3VUZA 3TG4A 4QENA 2W5ZA 4FMUA 4E47A 4YPAA 1MVXA 4QEOA 4C1QA 3M54A 5TEGA 3SW9A 3QWWA 3F9XA 2BQZA 3HNAA 3SWCA 1MT6A 2G46A 3EP0A 3CBOA 5F5EA 5JIYA 1ZKKA 2O8JA 1MUFA 1N3JA 5HI7A 5KJKA 5KJNA 3OXGA 3DALA 4MI0A 3RJWA 5CCLA 3F9YA 3M5AA 5ARGA 4J8OA 5LSXA 5CPRB 3M57A 1ML9A 3RIBA 4YPUA 5T5GA 5F6LA 1N6AA 3TG5A 2W5YA 3MO0A 4I51A 3OPEA 3M58A 3FPDA 4H12A 4IJ8A 3CBMA 5EX0A 4QEPA 5KJMA 2JV0A 5KJLA 3M55A 1O9SA 4J7IA 3S7BA 5LSZA 4J83A 3OS5A 3MEKA 3QWVA 3S7JA 1N6CA 5TTFA 5CCMA 3QWPA 3M59A 4NVQA 3F9ZA 5JHNA 5T0MA 5HQ8A 4NJ5A 3MO5A 4O30A 5F6KC 2RFIA 3OXFA 2IGQA 3MO2A 3S7DA 3PDNA 5JJ0A 2QPWA 4JLGA 4LDGA 3OXLA 5ARFA 3RQ4A 1PEGA 1XQHA 3M53A 4YNMA 3F9WA 3DB5A 3M56A 3RAYA 2R3AA 4O6FA 3N71A 4IJDA 4JDSA 4AU7A 4YNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOI A;  3CBP A;  4MI5 A;  3BO5 A;  2F69 A;  5EX3 A;  1MVH A;  5JIN A;  4YND A;  5AYF A;  3K5K A;  5TH7 A;  3KMA A;  5EG2 A;  1H3I A;  4Z4P A;  3KMJ A;  5T0K A;  3VV0 A;  4BUP A;  3S7F A;  5F59 A;  3KMT A;  3RU0 A;  3IHX A;  4RZ0 A;  4YPE A;  3S8P A;  4WUY A;  4J7F A;  3VUZ A;  3TG4 A;  4QEN A;  2W5Z A;  4FMU A;  4E47 A;  4YPA A;  1MVX A;  4QEO A;  4C1Q A;  3M54 A;  5TEG A;  3SW9 A;  3QWW A;  3F9X A;  2BQZ A;  3HNA A;  3SWC A;  1MT6 A;  2G46 A;  3EP0 A;  3CBO A;  5F5E A;  5JIY A;  1ZKK A;  2O8J A;  1MUF A;  1N3J A;  5HI7 A;  5KJK A;  5KJN A;  3OXG A;  3DAL A;  4MI0 A;  3RJW A;  5CCL A;  3F9Y A;  3M5A A;  5ARG A;  4J8O A;  5LSX A;  5CPR B;  3M57 A;  1ML9 A;  3RIB A;  4YPU A;  5T5G A;  5F6L A;  1N6A A;  3TG5 A;  2W5Y A;  3MO0 A;  4I51 A;  3OPE A;  3M58 A;  3FPD A;  4H12 A;  4IJ8 A;  3CBM A;  5EX0 A;  4QEP A;  5KJM A;  2JV0 A;  5KJL A;  3M55 A;  1O9S A;  4J7I A;  3S7B A;  5LSZ A;  4J83 A;  3OS5 A;  3MEK A;  3QWV A;  3S7J A;  1N6C A;  5TTF A;  5CCM A;  3QWP A;  3M59 A;  4NVQ A;  3F9Z A;  5JHN A;  5T0M A;  5HQ8 A;  4NJ5 A;  3MO5 A;  4O30 A;  5F6K C;  2RFI A;  3OXF A;  2IGQ A;  3MO2 A;  3S7D A;  3PDN A;  5JJ0 A;  2QPW A;  4JLG A;  4LDG A;  3OXL A;  5ARF A;  3RQ4 A;  1PEG A;  1XQH A;  3M53 A;  4YNM A;  3F9W A;  3DB5 A;  3M56 A;  3RAY A;  2R3A A;  4O6F A;  3N71 A;  4IJD A;  4JDS A;  4AU7 A;  4YNP A; 
#chains in the Genus database with same CATH topology
 3OOI A;  3CBP A;  4MI5 A;  3BO5 A;  2F69 A;  5EX3 A;  1MVH A;  5JIN A;  4YND A;  5AYF A;  3K5K A;  5TH7 A;  3KMA A;  5EG2 A;  1H3I A;  4Z4P A;  3KMJ A;  5T0K A;  3VV0 A;  4BUP A;  3S7F A;  5F59 A;  3KMT A;  3RU0 A;  3IHX A;  4RZ0 A;  4YPE A;  3S8P A;  4WUY A;  4J7F A;  3VUZ A;  3TG4 A;  4QEN A;  2W5Z A;  4FMU A;  4E47 A;  4YPA A;  1MVX A;  4QEO A;  4C1Q A;  3M54 A;  5TEG A;  3SW9 A;  3QWW A;  3F9X A;  2BQZ A;  3HNA A;  3SWC A;  1MT6 A;  2G46 A;  3EP0 A;  3CBO A;  5F5E A;  5JIY A;  1ZKK A;  2O8J A;  1MUF A;  1N3J A;  5HI7 A;  5KJK A;  5KJN A;  3OXG A;  3DAL A;  4MI0 A;  3RJW A;  5CCL A;  3F9Y A;  3M5A A;  5ARG A;  4J8O A;  5LSX A;  5CPR B;  3M57 A;  1ML9 A;  3RIB A;  4YPU A;  5T5G A;  5F6L A;  1N6A A;  3TG5 A;  2W5Y A;  3MO0 A;  4I51 A;  3OPE A;  3M58 A;  3FPD A;  4H12 A;  4IJ8 A;  3CBM A;  5EX0 A;  4QEP A;  5KJM A;  2JV0 A;  5KJL A;  3M55 A;  1O9S A;  4J7I A;  3S7B A;  5LSZ A;  4J83 A;  3OS5 A;  3MEK A;  3QWV A;  3S7J A;  1N6C A;  5TTF A;  5CCM A;  3QWP A;  3M59 A;  4NVQ A;  3F9Z A;  5JHN A;  5T0M A;  5HQ8 A;  4NJ5 A;  3MO5 A;  4O30 A;  5F6K C;  2RFI A;  3OXF A;  2IGQ A;  3MO2 A;  3S7D A;  3PDN A;  5JJ0 A;  2QPW A;  4JLG A;  4LDG A;  3OXL A;  5ARF A;  3RQ4 A;  1PEG A;  1XQH A;  3M53 A;  4YNM A;  3F9W A;  3DB5 A;  3M56 A;  3RAY A;  2R3A A;  4O6F A;  3N71 A;  4IJD A;  4JDS A;  4AU7 A;  4YNP A; 
#chains in the Genus database with same CATH homology
 3OOI A;  3CBP A;  4MI5 A;  3BO5 A;  2F69 A;  5EX3 A;  1MVH A;  5JIN A;  4YND A;  5AYF A;  3K5K A;  5TH7 A;  3KMA A;  5EG2 A;  1H3I A;  4Z4P A;  3KMJ A;  5T0K A;  3VV0 A;  4BUP A;  3S7F A;  5F59 A;  3KMT A;  3RU0 A;  3IHX A;  4RZ0 A;  4YPE A;  3S8P A;  4WUY A;  4J7F A;  3VUZ A;  3TG4 A;  4QEN A;  2W5Z A;  4FMU A;  4E47 A;  4YPA A;  1MVX A;  4QEO A;  4C1Q A;  3M54 A;  5TEG A;  3SW9 A;  3QWW A;  3F9X A;  2BQZ A;  3HNA A;  3SWC A;  1MT6 A;  2G46 A;  3EP0 A;  3CBO A;  5F5E A;  5JIY A;  1ZKK A;  2O8J A;  1MUF A;  1N3J A;  5HI7 A;  5KJK A;  5KJN A;  3OXG A;  3DAL A;  4MI0 A;  3RJW A;  5CCL A;  3F9Y A;  3M5A A;  5ARG A;  4J8O A;  5LSX A;  5CPR B;  3M57 A;  1ML9 A;  3RIB A;  4YPU A;  5T5G A;  5F6L A;  1N6A A;  3TG5 A;  2W5Y A;  3MO0 A;  4I51 A;  3OPE A;  3M58 A;  3FPD A;  4H12 A;  4IJ8 A;  3CBM A;  5EX0 A;  4QEP A;  5KJM A;  2JV0 A;  5KJL A;  3M55 A;  1O9S A;  4J7I A;  3S7B A;  5LSZ A;  4J83 A;  3OS5 A;  3MEK A;  3QWV A;  3S7J A;  1N6C A;  5TTF A;  5CCM A;  3QWP A;  3M59 A;  4NVQ A;  3F9Z A;  5JHN A;  5T0M A;  5HQ8 A;  4NJ5 A;  3MO5 A;  4O30 A;  5F6K C;  2RFI A;  3OXF A;  2IGQ A;  3MO2 A;  3S7D A;  3PDN A;  5JJ0 A;  2QPW A;  4JLG A;  4LDG A;  3OXL A;  5ARF A;  3RQ4 A;  1PEG A;  1XQH A;  3M53 A;  4YNM A;  3F9W A;  3DB5 A;  3M56 A;  3RAY A;  2R3A A;  4O6F A;  3N71 A;  4IJD A;  4JDS A;  4AU7 A;  4YNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...