5F6KC

Crystal structure of the mll3-ash2l-rbbp5 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
150
Chain Sequence
PLGSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFIPCHCGAVNCRKWMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
molecule keywords Set1/Ash2 histone methyltransferase complex subunit ASH2,Set
total genus 34
structure length 150
sequence length 158
chains with identical sequence E
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f6kC00
3OXLA 1PEGA 3RU0A 3OXFA 3VV0A 4WUYA 5T5GA 1ZKKA 3OOIA 3PDNA 4YNPA 4MI0A 3QWWA 3HNAA 5KJMA 4YPEA 3VUZA 4O30A 5EX3A 3N71A 5ARGA 3MO0A 4QEOA 4YNMA 4QEPA 5KJLA 3S7BA 3KMTA 3OS5A 3QWVA 5JHNA 2W5ZA 3OXGA 4RZ0A 4E47A 3DALA 5HI7A 3RAYA 1MUFA 3K5KA 5CCMA 3S8PA 2G46A 4Z4PA 3CBPA 4IJ8A 5CCLA 3S7DA 3S7JA 3F9WA 3M55A 1H3IA 5F6KC 2O8JA 5KJNA 3BO5A 2QPWA 3MO5A 3CBOA 3TG4A 1O9SA 4AU7A 5LSXA 1N6AA 3RIBA 4J83A 3F9ZA 5F59A 4JLGA 5F6LA 3F9XA 4NVQA 4LDGA 3SW9A 5TH7A 5KJKA 3RQ4A 3CBMA 3FPDA 2W5YA 4I51A 5HQ8A 2F69A 3EP0A 1MT6A 3QWPA 5JIYA 2IGQA 3MEKA 3MO2A 4C1QA 3KMAA 5CPRB 3M59A 1XQHA 4J7FA 1MVHA 1N3JA 5T0MA 2R3AA 4QENA 5F5EA 5EX0A 4O6FA 3M56A 3KMJA 5JJ0A 5JINA 3M5AA 4IJDA 4YPAA 2BQZA 4J7IA 4NJ5A 5EG2A 3S7FA 3OPEA 4YNDA 2JV0A 5ARFA 4YPUA 4FMUA 4J8OA 5TEGA 1ML9A 3IHXA 2RFIA 1N6CA 4JDSA 3SWCA 3M53A 3RJWA 3M57A 1MVXA 5LSZA 3TG5A 5AYFA 4H12A 3F9YA 4MI5A 3M54A 4BUPA 3DB5A 5TTFA 3M58A 5T0KA
chains in the Genus database with same CATH superfamily
3OXLA 1PEGA 3RU0A 3OXFA 3VV0A 4WUYA 5T5GA 1ZKKA 3OOIA 3PDNA 4YNPA 4MI0A 3QWWA 3HNAA 5KJMA 4YPEA 3VUZA 4O30A 5EX3A 3N71A 5ARGA 3MO0A 4QEOA 4YNMA 4QEPA 5KJLA 3S7BA 3KMTA 3OS5A 3QWVA 5JHNA 2W5ZA 3OXGA 4RZ0A 4E47A 3DALA 5HI7A 3RAYA 1MUFA 3K5KA 5CCMA 3S8PA 2G46A 4Z4PA 3CBPA 4IJ8A 5CCLA 3S7DA 3S7JA 3F9WA 3M55A 1H3IA 5F6KC 2O8JA 5KJNA 3BO5A 2QPWA 3MO5A 3CBOA 3TG4A 1O9SA 4AU7A 5LSXA 1N6AA 3RIBA 4J83A 3F9ZA 5F59A 4JLGA 5F6LA 3F9XA 4NVQA 4LDGA 3SW9A 5TH7A 5KJKA 3RQ4A 3CBMA 3FPDA 2W5YA 4I51A 5HQ8A 2F69A 3EP0A 1MT6A 3QWPA 5JIYA 2IGQA 3MEKA 3MO2A 4C1QA 3KMAA 5CPRB 3M59A 1XQHA 4J7FA 1MVHA 1N3JA 5T0MA 2R3AA 4QENA 5F5EA 5EX0A 4O6FA 3M56A 3KMJA 5JJ0A 5JINA 3M5AA 4IJDA 4YPAA 2BQZA 4J7IA 4NJ5A 5EG2A 3S7FA 3OPEA 4YNDA 2JV0A 5ARFA 4YPUA 4FMUA 4J8OA 5TEGA 1ML9A 3IHXA 2RFIA 1N6CA 4JDSA 3SWCA 3M53A 3RJWA 3M57A 1MVXA 5LSZA 3TG5A 5AYFA 4H12A 3F9YA 4MI5A 3M54A 4BUPA 3DB5A 5TTFA 3M58A 5T0KA
chains in the Genus database with same CATH topology
3OXLA 1PEGA 3RU0A 3OXFA 3VV0A 4WUYA 5T5GA 1ZKKA 3OOIA 3PDNA 4YNPA 4MI0A 3QWWA 3HNAA 5KJMA 4YPEA 3VUZA 4O30A 5EX3A 3N71A 5ARGA 3MO0A 4QEOA 4YNMA 4QEPA 5KJLA 3S7BA 3KMTA 3OS5A 3QWVA 5JHNA 2W5ZA 3OXGA 4RZ0A 4E47A 3DALA 5HI7A 3RAYA 1MUFA 3K5KA 5CCMA 3S8PA 2G46A 4Z4PA 3CBPA 4IJ8A 5CCLA 3S7DA 3S7JA 3F9WA 3M55A 1H3IA 5F6KC 2O8JA 5KJNA 3BO5A 2QPWA 3MO5A 3CBOA 3TG4A 1O9SA 4AU7A 5LSXA 1N6AA 3RIBA 4J83A 3F9ZA 5F59A 4JLGA 5F6LA 3F9XA 4NVQA 4LDGA 3SW9A 5TH7A 5KJKA 3RQ4A 3CBMA 3FPDA 2W5YA 4I51A 5HQ8A 2F69A 3EP0A 1MT6A 3QWPA 5JIYA 2IGQA 3MEKA 3MO2A 4C1QA 3KMAA 5CPRB 3M59A 1XQHA 4J7FA 1MVHA 1N3JA 5T0MA 2R3AA 4QENA 5F5EA 5EX0A 4O6FA 3M56A 3KMJA 5JJ0A 5JINA 3M5AA 4IJDA 4YPAA 2BQZA 4J7IA 4NJ5A 5EG2A 3S7FA 3OPEA 4YNDA 2JV0A 5ARFA 4YPUA 4FMUA 4J8OA 5TEGA 1ML9A 3IHXA 2RFIA 1N6CA 4JDSA 3SWCA 3M53A 3RJWA 3M57A 1MVXA 5LSZA 3TG5A 5AYFA 4H12A 3F9YA 4MI5A 3M54A 4BUPA 3DB5A 5TTFA 3M58A 5T0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXL A;  1PEG A;  3RU0 A;  3OXF A;  3VV0 A;  4WUY A;  5T5G A;  1ZKK A;  3OOI A;  3PDN A;  4YNP A;  4MI0 A;  3QWW A;  3HNA A;  5KJM A;  4YPE A;  3VUZ A;  4O30 A;  5EX3 A;  3N71 A;  5ARG A;  3MO0 A;  4QEO A;  4YNM A;  4QEP A;  5KJL A;  3S7B A;  3KMT A;  3OS5 A;  3QWV A;  5JHN A;  2W5Z A;  3OXG A;  4RZ0 A;  4E47 A;  3DAL A;  5HI7 A;  3RAY A;  1MUF A;  3K5K A;  5CCM A;  3S8P A;  2G46 A;  4Z4P A;  3CBP A;  4IJ8 A;  5CCL A;  3S7D A;  3S7J A;  3F9W A;  3M55 A;  1H3I A;  5F6K C;  2O8J A;  5KJN A;  3BO5 A;  2QPW A;  3MO5 A;  3CBO A;  3TG4 A;  1O9S A;  4AU7 A;  5LSX A;  1N6A A;  3RIB A;  4J83 A;  3F9Z A;  5F59 A;  4JLG A;  5F6L A;  3F9X A;  4NVQ A;  4LDG A;  3SW9 A;  5TH7 A;  5KJK A;  3RQ4 A;  3CBM A;  3FPD A;  2W5Y A;  4I51 A;  5HQ8 A;  2F69 A;  3EP0 A;  1MT6 A;  3QWP A;  5JIY A;  2IGQ A;  3MEK A;  3MO2 A;  4C1Q A;  3KMA A;  5CPR B;  3M59 A;  1XQH A;  4J7F A;  1MVH A;  1N3J A;  5T0M A;  2R3A A;  4QEN A;  5F5E A;  5EX0 A;  4O6F A;  3M56 A;  3KMJ A;  5JJ0 A;  5JIN A;  3M5A A;  4IJD A;  4YPA A;  2BQZ A;  4J7I A;  4NJ5 A;  5EG2 A;  3S7F A;  3OPE A;  4YND A;  2JV0 A;  5ARF A;  4YPU A;  4FMU A;  4J8O A;  5TEG A;  1ML9 A;  3IHX A;  2RFI A;  1N6C A;  4JDS A;  3SWC A;  3M53 A;  3RJW A;  3M57 A;  1MVX A;  5LSZ A;  3TG5 A;  5AYF A;  4H12 A;  3F9Y A;  4MI5 A;  3M54 A;  4BUP A;  3DB5 A;  5TTF A;  3M58 A;  5T0K A; 
#chains in the Genus database with same CATH topology
 3OXL A;  1PEG A;  3RU0 A;  3OXF A;  3VV0 A;  4WUY A;  5T5G A;  1ZKK A;  3OOI A;  3PDN A;  4YNP A;  4MI0 A;  3QWW A;  3HNA A;  5KJM A;  4YPE A;  3VUZ A;  4O30 A;  5EX3 A;  3N71 A;  5ARG A;  3MO0 A;  4QEO A;  4YNM A;  4QEP A;  5KJL A;  3S7B A;  3KMT A;  3OS5 A;  3QWV A;  5JHN A;  2W5Z A;  3OXG A;  4RZ0 A;  4E47 A;  3DAL A;  5HI7 A;  3RAY A;  1MUF A;  3K5K A;  5CCM A;  3S8P A;  2G46 A;  4Z4P A;  3CBP A;  4IJ8 A;  5CCL A;  3S7D A;  3S7J A;  3F9W A;  3M55 A;  1H3I A;  5F6K C;  2O8J A;  5KJN A;  3BO5 A;  2QPW A;  3MO5 A;  3CBO A;  3TG4 A;  1O9S A;  4AU7 A;  5LSX A;  1N6A A;  3RIB A;  4J83 A;  3F9Z A;  5F59 A;  4JLG A;  5F6L A;  3F9X A;  4NVQ A;  4LDG A;  3SW9 A;  5TH7 A;  5KJK A;  3RQ4 A;  3CBM A;  3FPD A;  2W5Y A;  4I51 A;  5HQ8 A;  2F69 A;  3EP0 A;  1MT6 A;  3QWP A;  5JIY A;  2IGQ A;  3MEK A;  3MO2 A;  4C1Q A;  3KMA A;  5CPR B;  3M59 A;  1XQH A;  4J7F A;  1MVH A;  1N3J A;  5T0M A;  2R3A A;  4QEN A;  5F5E A;  5EX0 A;  4O6F A;  3M56 A;  3KMJ A;  5JJ0 A;  5JIN A;  3M5A A;  4IJD A;  4YPA A;  2BQZ A;  4J7I A;  4NJ5 A;  5EG2 A;  3S7F A;  3OPE A;  4YND A;  2JV0 A;  5ARF A;  4YPU A;  4FMU A;  4J8O A;  5TEG A;  1ML9 A;  3IHX A;  2RFI A;  1N6C A;  4JDS A;  3SWC A;  3M53 A;  3RJW A;  3M57 A;  1MVX A;  5LSZ A;  3TG5 A;  5AYF A;  4H12 A;  3F9Y A;  4MI5 A;  3M54 A;  4BUP A;  3DB5 A;  5TTF A;  3M58 A;  5T0K A; 
#chains in the Genus database with same CATH homology
 3OXL A;  1PEG A;  3RU0 A;  3OXF A;  3VV0 A;  4WUY A;  5T5G A;  1ZKK A;  3OOI A;  3PDN A;  4YNP A;  4MI0 A;  3QWW A;  3HNA A;  5KJM A;  4YPE A;  3VUZ A;  4O30 A;  5EX3 A;  3N71 A;  5ARG A;  3MO0 A;  4QEO A;  4YNM A;  4QEP A;  5KJL A;  3S7B A;  3KMT A;  3OS5 A;  3QWV A;  5JHN A;  2W5Z A;  3OXG A;  4RZ0 A;  4E47 A;  3DAL A;  5HI7 A;  3RAY A;  1MUF A;  3K5K A;  5CCM A;  3S8P A;  2G46 A;  4Z4P A;  3CBP A;  4IJ8 A;  5CCL A;  3S7D A;  3S7J A;  3F9W A;  3M55 A;  1H3I A;  5F6K C;  2O8J A;  5KJN A;  3BO5 A;  2QPW A;  3MO5 A;  3CBO A;  3TG4 A;  1O9S A;  4AU7 A;  5LSX A;  1N6A A;  3RIB A;  4J83 A;  3F9Z A;  5F59 A;  4JLG A;  5F6L A;  3F9X A;  4NVQ A;  4LDG A;  3SW9 A;  5TH7 A;  5KJK A;  3RQ4 A;  3CBM A;  3FPD A;  2W5Y A;  4I51 A;  5HQ8 A;  2F69 A;  3EP0 A;  1MT6 A;  3QWP A;  5JIY A;  2IGQ A;  3MEK A;  3MO2 A;  4C1Q A;  3KMA A;  5CPR B;  3M59 A;  1XQH A;  4J7F A;  1MVH A;  1N3J A;  5T0M A;  2R3A A;  4QEN A;  5F5E A;  5EX0 A;  4O6F A;  3M56 A;  3KMJ A;  5JJ0 A;  5JIN A;  3M5A A;  4IJD A;  4YPA A;  2BQZ A;  4J7I A;  4NJ5 A;  5EG2 A;  3S7F A;  3OPE A;  4YND A;  2JV0 A;  5ARF A;  4YPU A;  4FMU A;  4J8O A;  5TEG A;  1ML9 A;  3IHX A;  2RFI A;  1N6C A;  4JDS A;  3SWC A;  3M53 A;  3RJW A;  3M57 A;  1MVX A;  5LSZ A;  3TG5 A;  5AYF A;  4H12 A;  3F9Y A;  4MI5 A;  3M54 A;  4BUP A;  3DB5 A;  5TTF A;  3M58 A;  5T0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...