5F72S

De novo design and crystallographic validation of antibodies targeting a pre-selected epitope
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
226
Chain Sequence
QLVESGGGLVQPGGSLRLSCAASGFAISASSIHWVRQAPGKCLEWVASIDPETGETLYAKSVAGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARAYAGDGVYYADVWGQGTLVTVSGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYSFPSTFGCGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De novo design and crystallographic validation of antibodies targeting a pre-selected epitope
rcsb
source organism Homo sapiens
molecule tags De novo protein
molecule keywords Kelch-like ECH-associated protein 1
total genus 57
structure length 226
sequence length 245
chains with identical sequence T
ec nomenclature
pdb deposition date 2015-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f72S02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f72S01
3GRWA 4NWUL 1J8KA 5L7XL 4G6MH 4ENED 3RL2A 3SE3A 4RRPA 1I1FA 5BRZE 1DR9A 12E8H 4ZNEA 1LEKA 3TBYB 3G5VA 2MHAA 4Z7UF 2VLRE 1DL7H 4HUXA 2LAAA 1MCOH 1RMFL 1EVUA 5IVXF 4JM2A 4MMZC 3V6OC 2IFFH 1M6OB 3S37L 2JIXA 3V2AR 3VXRA 2W65A 1T0NB 1CD9B 1NGYB 1KT2A 4FQXD 2VXSL 2VR5A 1AR1D 1NDGA 3U1SH 5HGBA 3PHQA 4F33B 4Z7VA 4HIXL 1I8LA 1WZMA 3H7BA 2BNQB 4GAJH 3I3EA 4TUOB 1J18A 3SDDB 4YBQD 5EBMB 4IRZH 4PJIB 2OK0L 4IRJD 4M5ZH 5CJXA 3RPIB 1SVZA 1J1OH 2H3NA 1IAOB 1KSRA 1NDGB 1BFSA 5HGBB 1IAIH 4BH7A 4PJ8D 4AEEA 2H3NB 4UTBH 4XNZC 5I66B 5J6HA 2UYLB 4NT6A 2MKLC 4KRNA 3V7MA 5E6ID 3CIQA 4XP1L 4EJ1C 2IBZX 1UWXH 1C12B 4WV1B 4XBPB 1IQWH 2FSEA 1NLBH 2FBJL 2DLFH 3TBWA 4JGJA 2YPLB 5IB3B 2UY6A 4WI5A 3MJ7B 1TVDA 3OSKA 2JIXB 1TQBB 5FHBL 4O9HL 4Q6IC 3IDGB 4GH7B 2XNAB 4YHMH 3ULVE 4JFFA 4H8WL 1TLKA 5DRWA 3SOBH 1N6QL 4RFOH 5ITFA 2P44B 4DAGL 3RAJL 4ZPTA 1A6UH 4LGPB 5SX5H 1AR1C 5DK3A 5HHOA 1ADQH 5C0CE 2XKNB 4U3XA 1FE8L 2APXA 4U0RC 5ESAA 2N7AA 2IPKB 2ATPA 4OCSH 3MV8E 4OLUH 2HKHL 4TSBL 4B5EA 2R69L 2DTMH 1JP5A 5JW4M 4X6CB 2YOCA 4CVUA 5GJSH 2FL5B 4PLJD 2HWZH 4HC1A 2AQ3A 2O26U 2DQJL 4PTTA 1LK2A 3GMRA 4AEHH 1S7XA 3RWIA 1NMBL 5E8DL 4KGJA 3MLSL 4IDJH 1R3JA 3C5JA 4AY0A 5ISZD 3TIEB 4D9QE 5HHNB 4L3EB 5DVLA 4NKOA 3KXFB 4K23H 5C6TH 3UJJL 7CGTA 2X1WL 1KUMA 5HHQB 1DN0B 3F7YA 1LE9B 4A6YH 3E1F1 3W82A 3OAZK 1YQ2A 1NGZA 3ECBB 5EG6C 1CDBA 3CU7A 1GGBL 5BV7B 1J1PH 2RHEA 3GIVB 4ZS6C 3TO2B 3PHSA 4FZ8L 5CKGA 3DIFA 2NY1D 1SYSB 5GGVL 4B7IA 3MNZB 1S7UB 2JJTA 3MOAL 43C9B 4Q9CA 4HHAB 1YJDH 4NWUH 3CLFL 3HLAB 4X6FA 5BVPH 5FKPB 4OQ1A 3WFZA 4DGIH 3AS0A 1MCHA 5DD6A 5DGQA 1FBIL 4KKCD 5H35B 1SJVA 2YD5A 5E6IA 3ARGA 4HS8L 3UP1A 2DKMA 4JY6A 1PLGL 1CFQB 4G8IB 2BVPA 3MRQB 3Q5TA 1KIPB 1TZGH 4K9EC 5BZDA 1BREA 1QG3A 3HB3C 5DJ2A 5JW4Q 1EEYA 3Q5OA 5FDWA 4HBCL 4Q7DA 1PFCA 2LTQC 2Z31D 4HPOL 2XIDA 4YX2H 5EFIA 4OZIE 1EMTL 1INEH 4HIEB 1B90A 4WUUA 1HXMB 3BHBB 4E41D 5B38G 5GGTA 1MFNA 4XP6H 5IFJB 2H41A 3HG1B 4UBDD 5T1MB 1LDPH 3OX8B 3WD5H 4Z95L 3WNNA 2VLKB 3KYAA 3H2WA 3SDYH 4P9HL 1QHOA 4C83A 4N5EC 3FQRA 3OAYH 5TH2B 5EA0L 2I25N 3RY6C 3ZT5A 4I18A 1UM5H 1A7RH 4NO3A 5DJCB 4NN7C 5JDJA 1XGUB 1IC7L 1YDPA 4HG4K 3V0WL 3UJIH 3RY6A 5C2BL 4WWKA 2BDNL 4Y2DD 5DT1L 2YD4A 3I6GB 3DV4B 3LN9A 5K9KB 3BGAA 4NN6B 3EOAA 4XP9H 2X4SA 3L7FA 5E2VH 3X3GL 4HGKC 2VO5A 3QUML 4OIBA 3S88H 3BPCB 4PRNB 5J13B 1AXIB 3OAUH 1ZT4B 5F7KC 3PGDB 3OV6A 5IB4B 4JO3L 4EUPB 3PV7A 5IT2H 1NFDE 3GSRB 1KJ2A 2UYLA 4NT6B 2DIAA 1I8LC 3PG2A 4YXKH 1FZOA 3QFJA 4WFED 1FFOB 1MI5D 3SDAB 1CI5A 3EYFA 1QLRB 3GSNH 3GSUA 4V1DA 5B38A 3NGBB 5EBWB 5TF1H 1QEWB 4ETQB 4H88L 2JELL 4JM2C 2X4TA 4XNYH 5C0FB 4HJ0D 3E2HB 3KPSA 3L5WB 4WFGD 5L0QC 3Q0HA 5J12C 1OARH 1SBBA 2OLDA 1U3HB 2WV3A 1FAIL 3OJDA 3L3DA 4GS7C 3QZWA 4G7YL 2P8MB 5E9DE 5IOPA 5TDNB 4XWOC 4ZTPH 3UYOD 2Y5TA 4LSRL 1OAQL 4LLMA 3W0WA 3TJEH 4DUVA 1G9NC 1G7QA 3MBEC 1NCAH 4YO0A 4OZHA 4MQSB 5IW3A 2IBBA 3BZFB 4TRPL 1HILB 2NY6D 5GISL 1ZLSL 4GKSB 4R7DA 5H8DA 1QFOA 2I07A 1RZFL 1UJ3B 2BMKA 4LDLB 5D1QD 4BFGA 4JZJC 4BH8B 3GNMH 1RZ8B 3VFVA 2FDBP 4OSUL 4UIKH 5EU4B 3P2TA 1CGWA 3AREA 5EULV 4LSVL 3CCHA 3ZDXF 3MRIB 1NCTA 1INQA 2FIKA 3T65B 1A1NB 3PWNB 4XTRC 3P4OA 4PYHA 4IOIA 1NUFA 4PJ7F 1XGYL 3GGWA 3NAAH 2JELH 3P4MA 3CNKA 2LABA 4EZMA 1G6RH 4WFHD 2Z4QA 4KVCH 3P4OB 1LNUB 5D5ME 2HYMA 4GKOA 2ZUSA 4XPAH 4S1DC 3D85D 4AM0A 3BAEL 2J88H 3KPTA 2R4RH 1OM3L 4G6JH 2GT9B 2Q76B 5GGRA 4PD4K 3TT1H 1MIEH 1Q0YH 1IE5A 4JO3H 4MLIA 1MJ7H 4NFDA 4ZD3L 4P48A 2A77L 4P2RA 1CFNA 5SWSD 2ENSA 3ARBB 3P0GB 5IK3B 2YUWA 4NC1E 2PYED 4LIQH 2QADB 3SDXB 5L8KB 4N0UE 5J56B 1FYTE 2R1YB 1GYAA 1L6XA 3G5ZB 4ZDHB 5JIPA 3SE4C 1KCRH 1U2CA 3P30L 2R2EA 3UTOA 5A40E 3SJVE 5IWLC 4WEMB 5H37G 3NIFE 4L4VB 2G2RB 3GMMA 1HKLH 3O9WC 1WWCA 1RULH 2G5RA 2FYYB 2DWDB 4FQJH 3IFLH 4XZUB 1KTDB 4NKIH 3X3FH 2VDKH 3MV9A 4QXTB 1AHWA 3TNMB 1R3LA 2IQAB 2OMNA 3OKDB 3SDCD 2HT3C 4AYFA 3BAEH 3H9HA 5DMYA 4GG6E 4NQXB 2DQIH 4X4XA 1FL6B 2EDKA 2X4UB 2YD9A 3D85A 2D0HA 1JGVH 4PREA 4ZQKB 1X6NA 3HN3A 4YHPB 1V05A 4XRCA 2WANA 4YXHH 4U6XB 3VD9A 2X5PA 3MLVL 1OAYH 2CO6B 1UEMA 4FQPA 1G9NH 4LLMB 5F7LB 3W0WB 3TH3T 2NY0D 2J8OA 4P4RA 3VCLB 4LU5L 3VFRA 3PP3K 2A9NL 3LPWA 4OKVB 5C0AA 4Z78B 5L9DL 3OPZH 5C0BD 4U3CA 1DTUA 3RGVC 2J4WL 1UQSB 2H2SD 3DSNA 3LKNB 5T1KB 4G5ZL 5IEHA 2V5RA 5BOZG 4KDTA 3FFCA 2F53B 3WL9A 1WISA 2XZAL 3TN0D 3JTTB 5J6GA 3VFSA 2Q7NA 2BOCA 2PKDA 4OFDA 3AREC 2OXHA 1EJOL 1YYLH 5FYLE 3UPRA 2X4NA 3LKRB 1L7IH 3V5DA 4LLWA 1J1XL 1CCZA 1TNMA 2QQKL 5HJ3A 1JZ5A 3ARDA 3BKJH 1B2WH 1LGVA 1CD1B 2A6DA 2HLAA 4LHUB 5IVNA 4X9BA 1IAKB 3DPBA 5ICZA 1MFAH 5IFAH 3F12A 1Q9OB 4G3YH 1AO7E 1IAKA 1MNUL 4PRAA 4LCUA 3EYSL 4G6KH 4HQQL 4XC3H 4BFEA 5KVFL 1O5DT 4PJGF 5AUMB 3LKOB 4NKDA 1LE5B 4PJXE 1UB5A 4RFNC 2D9QB 1M7IB 2JIXD 2B1AH 3KHQA 1NAKL 4AZ8A 4M7KL 5IBLD 1MAJA 4Z0BL 1T83A 43C9A 4I48A 2IAMD 4GKZB 5DEGA 1JHTA 3FTGB 3OKLA 2VAAB 3T0DA 4TSBH 5HI4C 2EDXA 4XCYA 3VXUB 1D9KB 2E5EA 3H9SE 3X13B 4WY7L 1RZJL 5DD0H 1SJXA 3DO7B 4JKPH 4FP8L 5D93B 1IILE 2OTUA 1KPUB 4LMQI 1N2RB 2HH0L 3GSXA 2V5YA 4H8WC 5T1DL 5T3XL 1XF5A 3U0PA 2AJUL 4RDQF 4ODTH 4MAYC 3UDWA 2GW5A 4N90D 4QCIA 2J6EH 2VXTL 4XP9L 4GKSA 4R7DB 1X5GA 4XVSL 5DT1H 1Q1JH 5FHBH 4UAOC 5LCVL 1E6JH 5JQ6L 1IKNA 5AG9A 4X7SH 1AKJD 2A6IA 5CD3B 2EC8A 4R0LB 4K3DH 2PR4H 1AXSA 1QFUL 3DMMA 2KDGA 4M6OL 4KK6D 5C08E 2C1PA 2NXZC 4NSKA 5EA0H 3ULUD 1FFOA 1IQDB 4FG6C 4X98A 3MODH 4O2FB 1U8HB 3N06B 4FQXB 2BY3A 5D70H 1DLFH 1QEWA 3RVWD 5LWYL 4XP6L 1U93B 4UNTA 3RX5A 4JRYA 3ARDC 1VADB 1K3ZA 1EMTH 1BZ9A 3ZSTA 4YBLC 5ICYB 2DBLL 3PDDA 1GC1C 1FNEA 4M6AA 4L8CA 5FO7A 5AD0A 1TZGL 2XYCA 2B4CC 2ICES 4F7PA 4LCCA 1IM9A 1KBGH 3OXSB 1PG7H 2OL3B 3PGFH 1PLGH 4QXGH 4G43A 1C1EL 3MXVL 5J0BA 1IM9B 1RJZA 5ELIA 5FM5O 3V6BR 2XOTA 2CIKB 2ESVA 5GRYA 3WYRA 5GJTL 5IB2A 1JUFA 3MPCA 4P23D 4Q0XL 3MLWH 2QHRL 3Q3GA 4DW2L 3UBXA 3Q5YA 4R8WL 5MEPA 1T04A 4F9PA 1V3MA 1H8NA 4ZO9A 3S35L 1I4FA 5IVOA 3EDJA 3PDOB 1INQB 2FIKB 3BMVA 2V17H 2FATH 4DGVH 5A43C 5IVZB 3VFPB 4Y1AD 1ZAGA 3C8KA 3X17A 3BWUC 3BO8A 2NTSP 4HC1L 4Y2OA 1K4CB 1KN2L 3UZEA 3U82B 4GRLC 2JK5B 1FH5H 4N8PA 4AJ0A 4CVZA 3ZDZF 4J23A 1IC4H 4X0KA 4PP2B 1G7LB 3DGCR 1ZLUH 5HI3D 1MJ8H 1MHPL 1V3JA 4TTDC 3VFVB 4LEXH 5CKAA 5HDLA 5C0CB 3RZCA 25C8H 3MV8D 3JTTA 3RNKA 4HEME 4FNLL 1OAUL 4K71C 4WIQA 1E28A 4M6OH 4AH2A 3UROR 4WO4B 3I75B 5IEHB 1ND0A 3KNBB 4L8BB 4UB0H 3CDYA 1AJ7H 3CFCH 1DBMH 1A1OA 4O4YL 4O2CA 3ARGB 2A73A 1S5IL 4LCWD 3V0AC 3PGCB 3UTTD 5I1DA 1A7PL 5EBLA 4GG6A 2HFFA 4Q74A 1T3FB 4H8WH 4KKCC 4N0RA 1L7TL 4QTIH 1Q72H 4I5BA 2C1PB 5F8RC 1T1ZB 1X4YA 5HHNA 4LKCA 1EHLL 2FECL 1II4E 3UAJC 3HMWL 1M7IA 4XCEB 1JNNL 5T5FL 5L2KE 4TPRH 2AI0L 4WWKC 3F7YB 3HI5H 4BZ2H 3FHQA 2EDLA 4YGVB 3IS1X 4JHBA 5AYQA 1S3KL 3RVTD 4NCC1 4LPTA 1JRHH 3IGAA 4QXUH 3T3MF 2DIJA 2EH8L 2ZCLH 5D6CA 1T03H 1GGTA 4M7KH 3LKPB 1A3LL 4ZG1A 4PTUB 3QQ3A 3I2CL 2MSPA 3O8XD 4PJ5A 3RWDA 1S7QA 3DURB 4EI5B 3GK8L 1UYWL 3S4SA 5BOPA 4QRSB 3L1OL 5JOPD 3MRHB 2IPUG 3MV7E 2FHCA 3D2UA 3IDNA 5ALCH 3OG4B 3MLTA 2NZ9C 4LQ1A 1MLBB 4PJ7A 4I5BB 3VGAB 3GRWL 1U3YA 3AS3A 2IFFL 1U8NB 3BKJL 3QCTH 1W0YT 2IH1B 4L3AA 3WS3A 2NR6C 3F7RA 4XB8A 2G60H 4ZUTB 1U8IB 5DF0A 5FA3B 3MC0A 4C55A 3DUSA 3LMJH 5EPMA 1R0AL 4XH2A 2UY7A 5B3JE 3DOSA 1HHHB 2A74B 2WZPD 2BZDA 3OKOA 4JO1H 3VG9B 5A16B 2LV4A 1OW0A 5DJ0B 3U36A 4QGTA 2XN9A 4QXWA 2Q8AH 4P5TC 1A22B 1AGBA 4R26L 4GG8B 4JQIH 3T2QA 5GS2H 1ZGLB 4HW6A 1P4LA 1ZT1A 2XN9E 1TTUA 4X6BB 1UCTA 3V4UL 1LHZA 1QRNE 1ADQA 3MRNA 1P5VA 4Y16A 3RVVC 4QRRA 3ROLB 5KTEL 4POZC 4F8TA 1YMMA 4MAYD 1TJGL 3AMKA 3IAPA 4Z76A 3Q1SL 5B4MC 4FOMA 4NHUB 2AJSH 3VE0B 4XMPL 1P2CB 4PGBA 1DE4A 1OGAE 3GMQA 4U1IB 2OZ4L 4MA3B 4TNWF 3QNXB 2WIMA 5TJWK 4LLWB 5HJ3B 3MRJA 1PSKL 4PBVC 1E4JA 1OGAB 4NUJA 3MOBH 4OCYH 2X4QA 1NJ9B 2GEEA 1NBYA 3MUHL 3P9MB 4A2LA 2HJFB 3B2VH 4KI5C 2NX5D 3LAFA 4HK0B 43CAA 1AIFA 2Y36L 4QHMA 3X3FL 4MZ3A 3KJ6H 5KVEH 2Y06H 1C16A 2I26N 1QRNB 3EOTL 4G8GB 2MWCA 2IG2H 5E1AA 3IU4L 5C8JA 1YNKL 3GSQB 2FCBA 2X89D 4QCIB 3K1DA 3ZYOA 2AKRA 1K85A 1BQLL 4L4VE 5J1AB 3KYNB 3O45B 1CTOA 3CXHJ 3LY6A 4Z7OF 3VI3E 5CILH 2DD8H 1JF1A 1MH5B 3VG0L 5GGQL 3A67L 2EDNA 3KJ4C 4ORZC 5KS9E 5FYKU 3DO7A 1E6OH 3SDXE 2HTKD 3HAEH 3BZ4B 1OT2A 1CICC 4I4WA 4PY8J 1BGXH 1QFWM 2ADGA 2YEZA 3QDJB 1QYGL 1CICB 1QR4A 2HVJB 3LS4L 3QFJD 3V4VL 3SE8H 1OB1A 2MKWA 3WXWL 1W72A 2CO7B 3UPCA 1ACYH 1I4FB 3SDXF 5CD5D 1LO4H 4FMKA 4TVPD 1G0DA 3BP5A 1K8DB 1MJJB 4R2GD 4Y4FB 1MCWW 4H1LA 4BFIB 3O6FD 1LP9F 4YDVB 4GG8A 3CFKA 4NYLA 4QRPA 4Z7QE 1FGNH 3NAAL 4OZ4A 5JXEA 4C56D 3LSOA 5EUOA 1F4HA 4ONHA 3DYOA 1MY5A 4NCDA 5JW4N 4K8RD 1GOFA 3QH3B 3F7QA 1A9EB 3IB4A 2XTJB 4Z7QF 2HKFL 3IVKA 1W72L 4P2OA 3QXDA 3F7PC 1D5XB 3DVGB 4OLWL 4KJWD 3U46B 3GMQB 3DV4A 1BOYA 5KVEL 3QEGH 4LLDB 2E7LC 4GQPH 4NQED 1KCLA 3QJFB 4GKNA 1PYWA 1U93A 4XVUC 5IG7B 4JR9H 4MDJB 1NBYB 4F2MA 2EYSB 1KTLB 1NCDL 4N9GB 4O2EB 4ZAKC 4PR5B 1NC2A 4UINH 5DLML 4AEIH 1P84K 1YY9D 4Y16C 4BK5A 5IKCB 4HUWA 4ONFL 5DEGB 3P0VH 4PJFB 1FZOB 1S7WA 5EU5A 2OSLB 2IMNA 3VD7A 5DVMA 2Z9TA 4U33A 1XR9B 4JM2F 4PBWD 4XNYL 4JZOA 3BVNB 1BF8A 5JXAL 5IFJA 1BFVL 4NRZA 5C0JA 1WAAE 4HUVA 2J8UB 2ZJSL 4TULL 3KYMB 1JYWA 1C5DB 2VLLA 1EZVX 4AMKL 2K1MA 3HUJB 5I2IB 1CLZH 4OLYH 3WL9B 5EOTB 1KCUH 5DJXA 4DZ8B 4JO1L 4Q9QH 4CMHB 1FORH 1U8MA 4XTRD 1HIML 1DZBA 1KIPA 5TE7L 1P4BL 4PJIF 1J8HD 2AP2A 1CL7I 4NZJA 3KYNA 3RZCD 3QULA 1A02N 1CXKA 4GXUM 4HUMB 2DI9A 1KF9B 2EIBA 5TDNA 5SWZD 3TNNB 4NN5C 4JM4H 4BUHA 2CMRL 1IGYB 1S7QB 3DURA 4YDIL 4JY5L 4KKBC 3O6FB 5E8PB 3H3PL 2FX9L 1F90H 1S7RA 1MJJA 4GW4A 2W9LA 3JV4B 1P53A 2EYRB 4PV9B 1BFOA 2ED9A 1FFPB 3NA4A 6FABL 1UWGH 4EDXA 1UH2A 4Z7WA 1Z9MA 2ZKHH 3C5JB 2AJZB 5FUCC 1JFQH 5TQ2L 2XA3A 5C2BH 4P57A 5I1GL 1RJYA 5C0CA 1F4YH 1XF1A 1FLRL 4AIZB 3W2DL 1KIQA 5E2JA 4CNIB 4A2MA 4NO0D 3AM8C 5DEFB 4EKXA 3TEUA 1YMMD 4MAYA 4MA3A 3WFBH 1EEZA 2EH8H 5FGBC 3GSVA 3I50L 1FVCA 3EYVA 5D4QA 4YFEA 5K59E 4KK8D 1JNJA 5CHNB 4QXUL 1G6RA 2IAMA 5J11B 1PEWA 2G75A 2DOCA 1AGCA 4PJCF 5DHYA 5E5UB 2CDFA 1Z0MA 4XNXH 3L95A 3WD5L 3IDUA 3WJJC 5HDQL 3PWPB 5DFTA 1CDIA 4OCNC 2R1XA 4RZCA 1VESA 1TITA 2IEPA 1X5KA 4QO1A 4TPRL 3FL7A 1U58B 4CVXA 3L3OA 1WV7T 4DCQA 3D69A 1AQKL 1SVCP 1EX0A 1UCBL 5DK2B 4GW4B 1EXUA 5FOBA 3BX7C 4PGJA 4HPYL 2BY1A 2X4PB 5FUZH 4LGRB 4Z7NE 3L3OB 1B0GB 1V5JA 4FXKB 2BY2A 2CIKA 2C1OA 5CEZD 3WS3B 4PJAE 1UZ6E 4PLJC 4I18B 5F1OB 3H42L 4N8VB 4WUUB 3BZFA 3VA6A 4JFHE 5TPWL 3ARTA 1URLA 1BBJB 5DC0A 1OF2B 3GKZA 1KB9J 3OKMA 3O0RL 1FV1A 4JFQA 1DBAL 4FFWC 3ZKXB 5DJYA 4HX1A 3ISWA 4QHUB 4WW2A 2VSDA 4PB9H 1IC4L 3IYLW 3TO4C 4FABH 3C6SB 3MRCA 4KMQA 2HT4D 3GI8L 2ICEA 3BKYH 3TNMA 1JPGA 1J05B 1FL3B 4WHYH 5DRNB 3P77A 4UT9L 4L5FH 4LAQH 3AU1B 3SKMA 3STZA 5JOFB 2X05A 1DVFC 1K5NA 3MGOB 1QLEL 4HC1H 3EJYD 3GHBL 4MQ7A 3BPNC 5HDBF 3N1FC 1GJIA 1QO3B 2DQJH 4OZHF 1BPVA 2FATL 4JRYE 5EC2B 4EQ3A 4H5SA 5D7IB 4GUPA 4XC1H 1RHHB 4PJ8A 5KN5A 2DTML 5JMOC 3LIZH 2R1WB 2ZZUT 3QQNA 4DW2H 1YA5A 2V9QA 3QEHA 3CX5K 4ZUUB 5K9OB 1J0HA 3UC0L 2X70B 2GJZB 5E1AB 5C8JB 1LO0L 3QEHB 2EC9T 1PX3A 3QNZA 3MCLL 3PGCA 1W8OA 1KENH 5EU6D 3ZE1F 4OF3A 1L6ZA 2Y6SD 4OT1L 3BE1H 3GBMH 1RIHH 2IPTL 4GBXA 3LB6C 3RL2B 4XHJC 2X9YA 3TZVA 4MJID 1TZIB 4HPYH 4QOKE 2NY1C 2JB6B 1IKNC 1I1AD 4JG0H 2OSLA 3V4PL 4NO0A 5D2NE 4NUJB 5F6HJ 2W0FA 4L4TA 5DC4B 3S37X 1T5WA 3ARWA 5KSBB 4M3KB 2N4IA 2QSVA 4WV1C 1AHWB 3CJJA 5CEZE 3V5HB 5HYSG 5F1IB 5CZVL 2V7HB 3QIUA 3CPLA 1JBJA 1E4XL 2J6EA 3PHQB 3HFMH 1WCBA 3RTQA 1RZ7L 4NZDA 4WENB 4Y4KC 4ZUVB 2DQHH 2V7HA 3QIUB 3PIQB 4KUCD 4P23C 4PJHB 3WUZA 2CRYA 1XF2B 2RQ8A 3U4AA 3MRRA 5KJRH 3JWDC 2ZOKB 1A6TB 4UDTB 3VH8G 3WFBL 5ERWA 3RIFK 4YFLF 3BP7A 4YPJA 1SBSL 3W2DH 3KPLB 4PS4H 4M02A 3NCJL 2NLJA 3LQMA 1HN1A 1P7HL 3AVEA 1FCGA 1NC4D 5CINH 5HGAB 1HNFA 1JWSA 3G6JB 5FUOH 3QUYB 5H2BB 2J6EL 2VXTH 5F3BB 5FGCE 3CFEB 4FRWA 3SKNA 4XPGL 3GZKA 4OFKA 5IROC 2Y5EA 1F90L 3ULUL 2WIIA 4ODTL 4AENB 2AJUH 3QO1B 5FK9B 3PUCA 1UXSB 5ACZA 1XGRA 2VQTA 4XNQB 5KOMC 5DXWA 1D9KC 4ELMF 1CE1H 5J3HD 3VDBA 1X4XA 3U4BH 1S78C 3VFWA 2FO4A 5F3HA 5L7XH 2VXVH 5LBSL 2DWEB 3VFOA 4MXWL 4CN6A 3O4LD 5AWNH 1XF2A 2W38A 1IGFH 1NGXB 4MQ7B 4WFGE 3OXRA 4MD5A 2ED7A 2YKLL 5FB8B 1EZVY 4M48L 1H15A 1G7MB 4MXQC 3VU2A 1MQ8A 1U58A 4R4FL 3PL6A 4CVXB 2UZXB 3B2UC 4XPHL 3CXDH 4GW5A 5AYUH 2E9BA 2BSED 1S9VA 2NW3A 3LRHA 4JG1L 3NCMA 1I7RB 4YFLI 1GGCL 3P0VL 2VABA 1X9QA 2B4CH 5EUOE 1R3LB 1QA9B 1MNUH 4ELMB 1RY7B 2PTTA 3SEPA 1MFAL 1MCLA 5C08B 4RBPH 4N8VA 3FMGH 2VL5B 2PN5A 1AIFB 4XVJH 3HE6B 4MDIB 3DXAE 2HT4C 4ZUTA 4NQVA 4PRPA 3ULUC 2MPAL 1YYLL 3BH8B 4I0PC 4PRIA 4P4RB 3GSQA 2DICA 4UT6L 3JUYA 2D3VA 4XAKE 3VGGA 2H6PB 5HHVH 1VKXA 4D9LH 1MREH 5E9DB 4X7TA 2HKFH 4CU8A 2P8PA 5MENA 3O6LH 4NBYB 1X6LA 1FHGA 2NY3C 5F7MC 1FO0H 4DZ8A 5FKAB 3GIVA 4N8CL 1UXWA 2HFGL 4PREB 4YHOH 1MHCA 1JPGB 3QUZA 4LSDA 1SY6A 4B53A 4ENEC 4K55A 5IF0B 2BVYA 4QRRD 1BEYH 3MCKB 4LNRB 4HUUA 1K5NB 4JRXE 4MNGA 4F7TA 5SX4I 4IMLA 4JHWL 3DMMB 4LSUH 5LGJA 1MEXL 4HUNB 3S36L 4M1DL 1GZQA 4P59H 4IMLB 1AKJB 5IMLA 3MBED 1JPST 2X09A 4EUPA 4F3FA 1CT8B 1JV5A 2R29L 2PO6D 2UZYB 1OD7A 2X4OA 4NM4H 1JN6B 1N7ML 1IKFL 4MNGB 4QT5A 5GS1C 2GUOB 4J2XA 1QOKA 3V8OA 1JGDA 4LBEB 3T1WA 1T1WB 4JFZH 1J8HA 3SDDA 4CN1A 5ENWB 2ARJB 2WMPA 4XBGB 4NQEE 2H6PA 3UTSD 2VDQH 4YHZL 5SX4H 5EO1B 1JTOA 1S9XB 4P23B 4MD4A 5B8CA 1OT1A 1J8HB 2VLMD 4S1RH 4X9FA 1IGCH 4NWTH 2XKUA 3QWRD 3ZHDA 5DJCA 2HT3D 2E7HA 3L3KA 4L8BA 1ROWA 5C0DA 4HWBL 1C12A 4I0PB 1T89C 1QSVA 2CRZA 3B9KD 3V6FA 4OD3L 5I1EH 2APVA 5C07D 1FVEA 2IQ9H 2WUCL 1GZQB 5I0DA 3RWJA 1NCNA 3RUGE 1BQHB 5FO8A 1WWBX 1MJ7L 3HNSL 5IJKA 3HZYA 4HJGA 5HYQA 3TT1L 2XWBB 4XMLL 1S7XB 4EN3B 1X44A 4JDZB 4EDWH 1G0XA 3L5IA 2CKBL 4BQ9A 4U0QB 3RQ3A 1S9VB 2NW3B 4GAGH 3W11D 2VN7A 4LF3B 4WI7A 1DBBL 3UMTA 3B5HA 1NAML 3HMXH 4PJBE 4PRPD 3O9WD 2FX8H 5DHVA 2H32B 3W0WE 4RFEB 5IQ9A 5E9DA 4YE4L 2AJSL 5HHMD 4H25A 3U6RA 4JHZA 3VMOA 2ILLA 2W0FB 1JMXA 4LRNH 3K4ZA 3HZMA 4HMEA 5JXEC 1ONQB 1MFDL 3OG6B 4JPIB 3S4SG 2F8OA 4KPHL 1IBGH 3C5ZD 3V5HA 1IGTB 3PNWA 3TESA 4U1GC 3UBXB 4YHYC 4UIMB 3O2WL 3PWPE 1ACZA 1BBDH 1UXSA 3JWOL 4P2OB 3BPOC 2FGWH 4CGTA 4OZGB 1CXLA 1RVFH 1KULA 3RX8A 4H20L 3F58H 2B20A 3DWTA 2FH8A 3QFJE 4FZEH 4P4KB 4ZSOB 3CMOL 1JWUB 2RIKA 4U1MA 5TE4H 3S36X 1OAQH 1CWVA 1XIWA 4GSDH 2B0SH 4MA8L 3SDAC 3LEVL 3IDIA 1AGFA 5E5RB 4TN9A 2CGRL 4NIKB 4NRXA 2DQCL 3QIBA 1VADA 1BOGA 4PP1D 4Y4KB 2WWKO 4AT6A 3T3ME 4ZFOL 3A6BH 5GGUA 1J10A 3MMEB 5J9PB 1MRFL 1BJ8A 1CYGA 2QR0A 1CE6A 4KUZH 2VDOH 4X6EA 2ORBL 4ODUB 4K71B 3ZL4L 1OAKH 5FGBA 3QIWC 3IFPA 3PL6D 1MFEL 1AGDB 1N3NB 1U91A 2DWDA 2ID5A 1YMMB 1B0RA 4Z8FH 1ZWIA 3ULSB 4M8QA 3STLA 1DLHA 5BQ7B 5DQDH 2R56H 4JFFE 4PJEA 5CWSB 2A83B 1FNGA 1RK1B 1HH9B 3RVUC 5FDWB 4IRJA 4JN2A 1NCBH 3RI5K 2AK4B 1TZIA 4LSTH 1FZMB 4G9FA 4E41A 2XQBH 2MJWA 2AK4A 3DGGB 3QPXH 5HGHB 4M6NL 4M1CC 4Q97A 4U6YA 4JJ5B 5J11C 1BMGA 2VDLH 2VKXA 5H2BA 3WHE1 1VFAB 1L7TH 1YEDA 4YJZL 4F7MB 4OFVA 4WTXA 2AJXH 1VEOA 2Y6SC 2DYPA 4NGHL 4X5XB 2R2CA 3LKNA 4DKEL 1H5BA 3V0WH 1O0VA 2YR3A 4PP1C 3V52H 2HN7A 3QCVL 1ZGLM 3O6KL 5IJKC 1AGEA 3B8YA 1DANU 3B9AA 4U7SA 1DSFL 1JHLH 1U8LB 1ZLVH 1R6VA 3G6DL 1U8JA 3O6ML 5DQ9A 2HP4A 2G9HB 3ARUA 3F8UB 1H0DB 4GRMB 1OPGH 1JHLL 3KR3L 4LEOB 2ADIB 1E4WH 2Y72A 4JFDD 5T3ZD 4E9LA 5ANMA 1LDPL 4X9IA 5DRNA 5IMMA 3V5KB 1CFQA 4P4KA 4GRWE 4JDTH 5JZ7D 3V52L 2XZCL 2VLRA 3U0WL 4NQCD 4LLYB 1FNLA 4JZJA 4NDMB 2YZ8A 4OAWA 5I18L 2O61B 2YC1B 2VYRE 1S8DA 3LN5B 1QACA 3NCCB 5E4EC 1ERNA 2YSSB 3G9AB 4OLZL 5MHSE 2QQLH 5E00A 3KPOA 4NNYB 5EOCH 4OZHB 1MQKH 4XNZB 2FJHB 3TPKA 3OMZA 1IC1A 1SMAA 5KN5B 1AE6H 3LS5L 3TN0B 5C0NC 4M4RA 1KIQB 3ET9F 1FBIH 4B50A 1BJ1H 2JTDA 5FCUH 4LSTL 5T1KD 5HHXH 4CDHA 3DX6B 3QDGA 4P46D 1WTGT 4S1QL 4FQHA 4XVTL 3DX6A 3QDGB 4G6AD 2A6JB 3MXVH 4XNUH 5HHOD 5JNYB 3FFCD 2NY0B 5BO1L 1P7KA 1CDGA 4MSWA 3FN0H 5EN2A 4PTUA 3T1FA 3VXOA 4MJ2A 4RGOH 5I75C 1BLNB 1XGPB 2COQA 4OCWL 4TOYL 3RKPA 3U7YL 1CTNA 3IETB 3PWUB 3VRIA 3KYKH 2ZUXA 3GJFK 2L0DA 5B8CC 5ESQB 2A74A 3NCBB 2YA2A 4KMTL 3HNTH 2CRIA 5IV2B 2B0SL 4MA8H 1W0WA 3O3AB 3BSZL 4K94H 3DSFL 2YMXL 2Y07H 4RAUA 4AIOA 4JZOB 5TE6L 2IH1A 4J8RB 5EBGA 3WJLC 2MCG1 3BUTA 4MJIB 1YNLH 3UTZB 4OLUL 3TCLA 1FV1B 4JFQB 5GGTH 4RMTA 1X5ZA 2IFGA 3MREB 5CCKL 5ADOL 4OB5L 2X44D 3RBGA 4D3CL 1HHHA 4K3DL 1BP3B 2V2WB 1FZJA 3S96A 2XQYK 4KTEH 1KYOJ 3F6LA 3OZ9H 4L8SC 4WU7A 1T7XA 4KK5C 4M4PA 4UBDC 1A6UL 3G5XB 1YYML 5HI3C 4MMXC 2V2XB 3ZE2F 5EH1A 5SWSB 5KSBE 1LEIB 1BZQK 3U9PH 3EBAA 4DWHA 3TA3C 2AGJH 3C6LD 4F3FB 4DQOL 2NCMA 4QRPD 4XNMB 2KBGA 3LHPH 3HC0A 4PGDA 4G8EA 4S1SH 4HD9A 1R5IB 3MJ9A 2WBJB 3DRTA 1JGDB 1T7WA 1B4JL 1BIHA 2BVUA 1IEAA 4LBEA 1XMWA 4HAGA 3MR9A 5LG1A 4KJQD 5KSBF 2X2YA 1FG2A 2Q7YA 1VFUA 2EIZB 5L2JA 3HPJA 1HHKB 4XWGL 3C60D 1ZLWH 3FT4B 4P57B 3TM6A 2Z31B 1JWMB 3GMPA 4X4MA 4GAYB 2O93L 4RISL 1IGIH 1EUUA 4B7LA 1HH9A 1ZHNA 2XG4A 4PJGE 3DVNB 4Y5YC 2BVPB 4W70A 4FFVC 4NRXB 3HI6L 2AERT 2Z35A 5HI5C 2B2XH 4LRIC 4OD3H 1MHEB 4ZUSB 2AXGB 4C56A 1PZUB 1M1SA 4X6DF 1A7BA 4X6DB 4G6KL 4GXVH 1F11A 5DC9B 4RGMC 4GW1A 2PYEA 4G3YL 3EJZC 4K7FA 2JB5H 3QWRA 3SKOB 1UENA 4KQ4L 1ZVYA 3U9UA 4F7MA 5IFAL 1BD2D 4KAQH 1KCSL 4LARH 1KPRA 1VGKA 2QQNL 1KJ2L 3NFSH 4X6DE 2Y9RT 4R90L 3WNMA 4YHYB 3QULB 4JRXD 1Z0NA 4TUJB 5L0QB 2P42B 5F93C 3QUYD 3BN3B 1CGTA 3CAFA 3HC4H 4XCFH 3VXSE 1OY3B 3PWJB 2XZAH 1MI5E 2OCFD 2RFXB 1QRKA 1CFTB 3UJTH 1CFSB 4YBHA 4P2RB 3MRKB 2R8SL 3DNKA 4K9EH 3ILPB 4DZBB 5KG9B 3BGMB 4JJ5A 3THML 3GMOB 1T22B 5HGGS 3C9NA 5K59F 3V6ZA 2QADC 1HOCB 3ARSA 1S9YB 4JHWH 4CU6A 4PRBA 5F7NC 1RK0A 4KJPD 5TDPA 1BX2A 4J8RA 1HSBA 4P46C 3REWB 3FQNB 2GJ6E 4KVNL 4N0UA 3PP4L 4DKFH 3BW9A 2O5ZH 4LVOB 3STLB 1BOGB 4AT6B 4RSVA 3MV7D 4PGDB 2R8SH 1IM3A 1I7UA 5GRVK 4PJ9A 3U83A 3RZCC 3BWAA 1KPVB 2YWZA 3P11H 3JBG7 5SWSA 4Z7NF 5C70A 3KPMA 1P7QB 4LNVA 1I8KB 2ZWLT 4IJ3C 4PJAF 1M71A 2E27L 5I9QB 1V7NH 3NZHL 1FDLH 2RJMA 1IL1A 5L8LB 3HC0B 3TA3A 4NN7B 2YPLD 1KCSH 1PDKA 4U05A 4JGMA 3EYQD 1I1AA 4KQ4H 2Y1VA 4OUUB 2ZCKH 4HCRL 5T3ZL 5DMIL 3SGKA 5C3LD 2HT2D 4FXLA 1PQZA 4I13B 4M62H 3TBYA 1D7FA 4IIQB 1D9KD 2P7TA 5CEZH 3TGXA 5DMKA 2BXZA 5D6DC 3C8DA 3WEXB 4F9LA 3GIZL 1A0QH 4N0YL 1JYNA 2B2XL 2AK1L 3D6GA 3QI9B 5F6IB 1IQDA 1YNTA 4M48H 5TH2A 1Q9KB 2XXMB 4NNXA 4MB5A 2A77H 2DL2A 2YUXA 2R0LH 4P2QB 4J1UB 3WFHB 1T0MA 3WSQH 2P5EB 5IFHL 4NC1C 1IGIL 3LQAH 1A6WL 4KI5D 3WV0A 1FPTH 4IIQC 2CDGA 2GSIA 4FFZH 1MF2H 2N56A 3HI1A 2X4RA 3DXAA 4U1KA 4ZXBD 2NY2D 2VB5A 3GJFA 4MX7B 4OZHE 4JFPB 2VLRB 1M05A 2VDMH 4P5TB 3UTPE 1IAIM 4NBZB 4WI3A 4GT7A 2AV1A 2XZQH 3DUUB 4R0LA 2GY7B 5JDSA 3T2PA 4JFEB 3NGBC 5EB9A 3DJ9A 3IXTA 4JHAL 1ES0A 3RHWF 1BBJA 4I1NB 3KPSE 3LD8C 2JJTC 3O4LA 2F53D 4KHXH 4UMGA 5JORA 2KQMA 3MRJB 3GNML 5EOQL 1TVBA 2IAMC 1NBQA 1NFIA 1QFWL 3KPRD 3VD4A 5MEQA 2B5IC 1VGEL 1TVBB 3MNVB 3VI4F 5D2LA 2NYYD 2MTPA 4KRPD 1GC1L 1OWWA 1NEUA 1KB5L 2YD2A 5GHWL 1NLDL 3ALXA 3TJHD 5TE6H 3IJHA 3G5XA 5CSZB 2CLVB 4RX4D 4G7YH 1LP9B 4HIEA 5DD1H 3DECA 2AVGA 5ID1B 1FAIH 2OQJB 1R24A 1OAXH 5EO9A 3B5GA 2CR6A 1LO5B 3CVHL 3IRPX 1NAMA 2VN4A 2VDPL 3OKOB 3D39E 4OGZA 5CGYD 4PGEB 4LMQE 5CWSA 4D0DA 3RWFB 4RWYL 5FYLL 2AJYL 2YPVH 3J8F7 4IRSC 5TF1L 3RIAK 1YC8A 4M8VA 3PL6B 3BE1L 3T65A 2NY3D 1AY1H 5KANI 2UZIH 4HK3J 4M93C 1JNHA 2ATPB 5IVXE 1FVEB 3G5YB 1RJCA 3NABH 4CKVX 3C5ZC 5E8NA 3FO9B 1LD9B 5MEQB 3P4MB 3H9YA 3NH7L 2DAVA 3TWCH 5CEYA 4QYOA 3TBWB 1T3FA 4MZ2A 5DMKB 3LIZL 1VFBA 2XXCB 3CX2A 1QBBA 3BXNA 2GI7A 3PWVB 4HIHB 5I1JL 4Z5RA 2XNAA 3OB0H 5IHBA 5JQHC 4JVWA 4OZIA 4MA7L 1FNAA 4WUKH 4BELD 2DQDL 1TETH 1QSFA 3LPGA 3MNWB 4KKNA 1CFNB 2VJXA 4P3CL 1MVFA 1KPRB 1NUDA 5I18H 1A9EA 1LK3L 5KZCD 3VXUD 1BIIA 4MNHA 2CK2A 4Y5YB 4MX7A 5GGRB 3HUJF 4OD2B 4M6ML 1DQDH 4QXTA 2I5YH 5B39A 1A1MB 2ADJB 5KANG 4WHYG 1IM3B 3QIUC 1H0DA 1PY4A 3MSPA 4G8FA 4IBLT 3FT2A 4HFUH 3SDYL 1NBVH 1BD2E 2OJZH 2ZPKL 2B1HL 5FM5M 5H35A 1TENA 5DUPL 4IMKA 4LAJH 1JZ4A 3G04B 3TFKC 3NIDE 3QNYA 2UVEA 1BM3H 3VFPA 2E6PA 3GBNL 3VW3H 2DLEA 5I1IH 1Q9LB 2Z31A 1OW0C 2WSKA 2VDRL 5E2TH 4NGHH 4M5YH 3LZFH 4JFFD 1BAFL 1NBZA 2NZIA 3WIFB 5J57B 4OUUA 2ADFL 3BJLA 4WGWB 1CQKA 3JWDL 3LKQA 4EIZC 3DTXA 3L3HA 3HC3H 4QRQA 4POYA 3ZKND 5CFHA 4X4ME 4PGCB 5IB3A 2DMBA 4OF5A 4DN4H 2C4XA 4M5YL 3VXRD 1QNZH 1GPOL 1G7LA 1H5BB 4JM2D 3SKJL 2VIRB 1DEEB 1DQJB 4ZO6A 2ZG2A 5DJXB 3MOAH 4JQXC 3WIHA 4MVBC 3L3KB 4NC2B 2FHBA 2CKNA 4PJCB 5DR5L 4FZ8H 4F7EB 4NO3B 2ITDB 3NN8A 4MJIE 4ODWB 1MRCH 3GSNA 3MXWH 5HGAA 3BKCL 3I50H 2GT9A 2W1NA 3QFDB 1CZ8L 4I77H 1T2JA 3MREA 4KY1H 4N0CC 3G04A 3SE4A 5D7IF 3H7BB 3GSOB 1PYWB 2IADB 2IANA 1KTRL 4M43H 4MJ6B 4ZOAA 2VLJD 5K9JL 5D71L 3WKNA 4P3CH 1FYTB 1C5CH 4GRWH 3TBSA 1I1AC 2ZKHL 3QI9A 4Z0XA 5E8DH 1NMBH 2NY0C 2NQCA 5CZXC 4GKZA 2VISB 4GBXD 2BK8A 3U36B 4NQDD 4Y2DC 5HD8D 2FD6L 3CVHB 3DX8B 1CXEA 5ACMA 5I1JH 4RX4A 4HWZA 3SE9L 1EEZB 4MS8D 3GSRA 3CMOH 4H0HB 2AXFB 2R0KL 3KPQB 1LE5A 4QRRB 1I9EA 3BRGC 2OTWA 1T22A 3TWCL 3VFTB 2X6MA 1DUYB 1M71B 3C6LB 3RZWA 5C0GB 1X5IA 1QR1B 1EEYB 1UWEL 5F71A 4P5KA 4J3SA 4NZTL 4K8RL 2NY7L 3LOWA 2VE6B 3D39B 2LE9A 4MAUH 4YXLH 2AJYH 2YPVL 1FO0A 4NQDE 4U1GB 1D5ZB 3W9DB 1YPZB 3HE6D 1N64H 4PV8A 3BEWB 3VXUA 1LP9E 3K8LA 4YHIA 4NKOB 3M8OH 3BPOB 1HH6A 2LU7A 2ZG3A 4GW1B 3I84A 2UVFA 1T66C 1CGSH 4YFDB 2VLKA 5I1LB 5F6IC 3KG5A 1H3WM 5DZNA 2QLVB 3EFDL 4G7VL 4B41A 2ZCHL 2FGZA 4X98B 1JPTL 1NGYA 1S78D 1RJYB 3ULVD 3O6FC 4X80H 3QAZC 4BQ8A 4PPTA 2X41A 4HX1B 3VRLE 4H1LG 4Y1AB 1J12A 5F9JB 1VEPA 5ID1A 1KB5B 5DTFA 1J1OL 2FECI 1FSKB 5C0AD 1I1YB 5A2KH 3C2AH 5C2UB 1QFHA 3U7WH 1NAMB 1KNOB 1CFBA 1DBKL 3K8MA 1F13A 5F8QC 5LAXA 1CD1A 4FXGA 4MCYA 3MRMA 4PTTB 5HHOB 3GJFB 5IIEB 3DRQB 4K3JH 1CN4A 3QUZB 1TTFA 1F3JA 5CP7A 2WWMD 1ZS8A 1PKQB 1UADC 4N90E 1QSFB 4QHLA 1U8KB 4GMTL 1H3PL 1OGTA 2GFBA 3N1MC 2LFGA 4CUCA 4LDEB 3WFEL 5D7IA 5L6YL 1IFHL 2W0PA 2ARJA 1PW3A 1F3JB 2MMXA 4DUWA 1UA6L 4KWUA 3P9MA 5HI5D 4OQTH 1B4RA 1XAUA 12E8L 2D03L 4WW2C 1ZHBB 3OKNA 1NGZB 4I9WE 4H25B 3KPQA 4Y5VB 4YEEA 2ITCB 1MF2L 4NM4L 3V6OE 5GS0H 3RFZC 4XCYB 1G7IA 3GJFH 4PYGA 4JFFB 1CK0H 1KEML 2R4SH 3OJMB 4LLUB 1MPAH 1RQ5A 2VR4A 3QHFH 5TGBB 1IC5H 2VZOA 5ENWA 5DJ2B 2PUQT 4JPVL 1E6OL 4LLVB 5DWUL 1C5DA 3GEWB 1HEZA 1QBML 3OKDA 3GBLA 1RPQA 3QHZH 5IHUL 1FJ1B 1JNLL 5CEZL 1U91B 1T2QH 3PDOA 3MJ9H 1AO7D 3GUTA 5DRXA 1XF4B 3MACL 1AI1H 1HXYA 2YHGA 2Z4QB 4PJCE 4YUEH 4PJ9B 3EOYG 1LO5A 4G42B 4MGXA 4XZUA 5IB1B 5DD5H 1UVQB 3NA9H 1MREL 3EDEA 1KXQE 4ZTOH 5DJ8B 4DK6A 1H9VA 5FYLD 2B7DT 5H94A 3WFDH 3VFNA 3MRIA 1FP5A 3RTQC 4ODBD 1A7NL 3E3QC 1EO7A 1QBAA 2IWGA 3U30B 5JW3L 3SDXA 1WITA 1VFAA 1YEDB 3RZCB 2BSTB 1F2QA 1LO2H 3HE6C 1CVSC 3NACL 3QXWA 4ZUUA 5K9OA 1ETZB 1I85C 3M1BA 2MQ3A 4Y7MA 4MCYB 3QHZL 2C3VA 5IHUH 4Z9KB 3C8HA 2IMMA 2F8XC 2JJSA 5E5MB 2LU4A 4XCEA 3KXFA 2VZUA 1G6RB 2IAMB 3C60C 1OCWL 3WHE0 5HSFA 3R0MA 2DTSA 3FCTA 1IC5L 5F9JA 4H26A 2SEBB 5F9OH 4K2UL 3BW9B 4BYHA 1IGFL 3U4EB 1ORQA 4DTGH 4KJWC 1S7TA 4U7MA 4WI8A 3KLHC 4MXWH 4L3CB 4TNVF 3WIIH 4NO0B 4JRYB 2VXQH 4UZGA 7FABH 4PJDF 3O8XC 1A7OL 4QLRA 2EZ0D 3S6CA 1R0AH 3CFJA 4N9GA 1A7QH 4LCCC 1EFXD 4Y4KD 4JB9H 2PW2B 5J9PA 1SEBA 4L9LA 4JFOB 4MJ5B 4WU5B 3QCTL 3T0EE 3ROLA 3L3GB 3EKCA 5E7BA 3QB7C 4PJDE 3GRWH 4ZAKB 5BJTA 2EKSA 2IPUK 3SJVD 1NGWB 3VXQA 2JB5L 3HE7D 4F58L 1RUML 5B39B 1B88A 4LK4A 3LRSA 3ROOB 5CJQH 3ZTNL 1CFVH 1OF2A 1YC7A 2JCCA 4QF1B 1JE6A 5ICXA 2Y5TB 4JPWH 4YWGL 5CZXD 2XTJD 3RUGA 2YA0A 4AG4H 2V2XA 2XV6B 2BRQA 4DK3A 2VSCA 4OM0H 4KI5F 2DQUH 4OFYA 1N8ZB 3S9DB 5FIEA 2DBJA 4M8QB 3RL1A 4DEPB 2EDYA 1YEKH 1JRHL 1EHAA 5HDBE 4NNPL 3GMLA 3P77B 2HG5A 2M8XA 1SM3H 2I9TB 4OI9A 1CLOH 4NRYB 4ZYKB 3VFNB 5CZVH 4JFYA 3T2NL 5K9QI 1CG9B 4BZ2L 3B4NA 1XCTA 3BT2H 4K7PL 5KVDL 5HYIA 4K2UH 5F9OL 3L6FB 4IJ3B 5AZEH 1B4JH 1YN6A 2PW1A 4YHLL 4XXDA 5K93A 2J8HA 4HT1H 4PJFF 2EE3A 3L6FA 2HN7B 3O3EA 4R3SA 3HPLA 4ZXBB 3QDJD 1AHWC 1JGLH 1FFQA 5SWSE 4JRYD 5DS8B 4LVNB 3Q6GL 5DMGD 4L8SA 5LGJB 4UOW1 4KRMB 4ZFZA 5FF6B 4QHUA 2HRPL 3QUXA 4WW2B 2NY5C 2X4NB 3LKRA 3EDKA 4L4VD 4HS3B 1RUAL 1F45A 3QNZB 4BSJA 2BOCB 1I8IB 1AGBB 1NCCH 3R8QA 3T4AB 1IARB 2NY2B 3D9AH 4P5MB 2Q3AA 1JHKL 2FLRT 2BSSA 1C16B 2VNCA 2AJVL 3KPSB 5T1KA 3SKUD 5IGXL 3RVUD 1ZK9A 4HZAA 4CMMA 1OD9A 1I3RA 4OBSA 1LEIA 4NYLB 2Q3ZA 4RMVA 5J1TC 3ZKMD 2ERJC 2BNQE 1U95A 4UT7L 3JVGC 5ESVB 4ELME 2P5WA 2HTKC 2GCYB 2EDOA 3MJ9L 4I48B 1UM6H 4ALAH 4MNQB 4KZEL 4EI5C 3QXVA 4N0CD 3U7YH 4TOYH 1NGPL 4UV7H 5C0IA 1S7SA 4RGOL 4W4NA 5E4IA 4KZDL 4NZRH 5DRXB 4KKBD 4YHKL 3ZTJG 4V1DB 1HINH 1DUYA 4NOFA 3CGTA 2ADGB 5E8OA 1HHJB 5F6HI 1K2DB 4F37F 2CD0A 4KK9C 2CRMA 3LKPA 3QUXB 5CUSH 3MXWL 3EO0A 2YUVA 1I3GH 5BRZB 5EFIB 5IBTH 4XBEL 2DQGH 3WLWC 4CVZB 2YK1L 4LF3A 5FCSH 5KVGH 3DBXA 1ZMYA 5F7DA 3RWIB 4DOHE 4OV5B 4KHTL 1GZPA 1UKTA 3BO8B 3ARGC 3OR7A 1T83C 2Q6WA 3T3PE 1T1XB 4JJHA 1CG9A 2BSTA 1P4LB 1ZT1B 4HF5H 3OGOE 2X4SB 1N6UA 2NY4C 1MVUB 3JWDH 4NHCH 3QBTB 5EOCL 4HUKB 3E6HB 2P5WB 1RZGB 1MVUA 1YECH 5HPOA 4WI6A 3LDBB 5I1IL 3ZHKA 5EZOL 1KFAL 3U79A 5I16A 5JZ7C 1ZA3A 5FF6A 5ILTH 4GLRI 4HKXA 3FN3A 4YHPA 3FTGA 1MIML 5EO0B 5I71B 5DQJB 3UTZA 4DJMA 4ERSL 2Q8BL 5CLWA 2KPNA 3UZVB 1FZKB 5IHZB 2DM3A 4PJAA 4J6RH 2ZCHH 3BGFB 3LV3A 4LPCA 5ETUA 5JHDD 3O6KH 3QCVH 4MAYB 4CN4A 1RHFA 2Y23A 1P9MA 4ZFZB 1FLRH 3VA2C 1CL7L 1J0YA 4HWZB 1V7ML 2YRZA 2H2SC 4YNYB 3NPSC 4FQXA 4OI7A 1W0VA 1FNHA 1CDHA 3FZUC 3CFDB 2XT1B 4LCWA 1AXTL 1KJ3L 4QNPF 2DIBA 2G2RA 3GMMB 3BIKA 4FQCL 1CFSA 1VFMA 4NPYB 2IAND 1YJDC 4PJIA 4M6NH 5C09E 2D0GA 4FQLH 4JFDA 3S3JA 3WNPA 5FXCH 3QG7H 3NH7H 3TPUB 2YD8A 1HIMH 4JKPL 4X8XA 2YBRB 3PXJA 1MHHA 4NN5B 4JEGB 1G9ML 4BH8A 2P8MA 4ODWA 3HRZB 3KDMA 1WWAX 4OLYL 1KXTB 4IRSD 3VGFA 2GTWB 1AY1L 3D0LA 1T7YA 3TVMC 4ODHL 5I1DB 4D0CB 4MQTB 5MP6H 2C4FU 1AXTH 1KJ3H 1A5FH 2NLJB 2A1WL 4LLQA 4OV5A 3TF7C 3TJHC 2YBRA 4LL9A 5I0ZA 1WZKA 4RWYH 3JWNC 2X9XA 3NVQA 5FYJH 4C59B 5ISZE 4MA1C 3BQUA 2VZVA 4BSVB 5EOCJ 4YR6A 2VDPH 5BCAA 5DS8A 3S35X 3GSWB 4QRQB 2DYPD 2GITA 1I8MB 5F44A 3U9UB 4GSDL 1A1NA 3PWNA 3T4YB 3TZVD 3VXMB 3MBXL 1ZSDA 4Y5XB 1ZEAL 1MHCB 2EICA 5F9DC 5E5MA 1U8HA 1EO8H 4OI8A 4ZYKA 3VWJB 3WFCH 4PRBB 4H20H 3ALPA 4JO4L 5ILTL 4KTYA 1VGEH 5AUMA 4HKBA 3FRUA 1X5FA 4NQSA 3KHOA 2FGWL 4MB3A 3QDMD 2F15A 5ANME 3V6FB 4LSQH 1X5LA 5HPMB 1UACL 1EDQA 2MHAB 2X89A 3DVIA 3EZ8A 3RWGB 3HC3L 2EXWD 4D9RE 2HTLC 3MFFA 1A6VL 4LQFH 2ADFH 3NPZB 3PHOB 4PLNC 1BAFH 4LKXA 5I73C 2V5MA 3MRFA 2GK2A 4ZAKA 1OTSD 3FB7A 1JTPA 4KHTH 1WBYA 2K3TA 1QQDB 2YK1H 1ZANH 2Y7QA 2YPKB 4TSCH 3VJ6B 2B1HH 3PABB 3WLBB 1QYGH 3ARBC 4OV6F 1KTKE 3VXQB 5ICYA 4WTZG 4LLAA 3KPRB 1TQBC 2EEDA 1N6VA 5MHSD 2FHFA 2R39A 4KI1A 5DJAA 4IOIB 1BVZA 3FT2B 4ZUVA 2JB6A 4ODSL 2NTFB 4UV7L 2VH5H 4LASH 2Z92A 2EE6A 3PGDA 5D7JC 5LXGH 2HLFD 5D9SB 1F58H 2XWBA 4EN3A 4CMHC 1U8IA 1JGEB 5B21A 2BERA 4I3SL 3RIFF 5IOPB 4Y4HC 4MD0A 1RZJC 5E8OB 2D7TH 3OBAA 1T0NA 3WXVL 2J2ZA 1PAMA 2UWEF 3O9WA 3GSWA 5C0EA 5A16A 5EZJA 5LGHL 2A6IB 2VLRD 4XGZB 4P2QA 4OJFH 1F4WL 3D18B 1OLLA 1BWMA 1MCPL 1JHKH 2X4TB 1RZKC 1ZHBA 3OKNB 4XPTH 2YD1A 4YGAB 4GAFB 4FQ1H 3MO1A 4ONGL 2EDQA 3LEYL 5TF0A 2C26A 3AB0C 3QYCA 3D3VE 4NKQB 2CXGA 2DRUA 4QTHB 3ULVL 5CIPH 2OZ4H 3MGOA 3E6FB 1CLYH 1I1YA 4WO4D 1WCQA 1D6VH 3F7VA 2O5XL 5B3JF 2XFXA 3KVQA 4HJJH 3DLQR 1ZSDB 4Y5XA 5EC2A 5FYKD 1JGLL 5DO2D 5IIEA 1TJGH 5FHAL 4EQ2A 3CDGA 3QUKB 4PJDA 3NIGF 4PJ9C 1AGCB 5DHYB 1OOAA 3L9RB 5KVDH 4N1EA 3QT2A 4BQBA 4YHOL 1A2YB 4RMSA 1CS6A 4MNQA 3JSSA 4GRWF 1KGCE 5JLZA 2AK4D 5D96C 1A6PA 1FL6A 3ZE0E 1ZLSH 5GISH 3MA7B 3MROB 5D5MA 4K7PX 5D1ZC 4QGYA 5IMKB 4FQQB 3MCG1 1BZ7B 3EDDA 3JZ7A 4XVJL 4LSRH 4JAMA 2D7NA 3OF6D 5C9JB 4S11A 5HTSA 1WFNA 5ESAB 5IEKA 1T80A 3O2DA 2W91A 1OARL 5I9QC 4HWUA 5D7JA 3BDYL 4JVUA 4NQTA 2XY1A 5CJOL 4JRWA 1LILA 2OM5A 2NY2C 2Z8WC 1EAPB 4XAWH 1MRDL 1JZ7A 3CXDL 1KELL 1HCFX 4G9FB 3I02A 4WO4A 3FJTA 3ZYJA 3GSNL 5D6CB 5HHME 5EIIA 1OSPH 4JB9L 3ARBA 1RFDH 3UEZA 4L3EA 1A2YA 2EEBA 3W0WD 1N0XL 3TA3D 3VI3F 1CDJA 2L4OA 4P2QE 4R7NA 3N1GC 1T1XA 2VXVL 2NXYD 4XWGH 5C6WH 4R97B 4CNIA 1DBJH 4K3EH 1JZ8A 5T5FH 5I1CH 2H1PH 4U7KA 1S9YA 4Z7WB 1KC5L 3S88L 2A6DB 3B9EA 1GGIL 4XAWL 3VFOB 2H2PD 3RWCA 4Y1AA 1GIGL 4N0FB 1TCRB 4EBQL 1ZA3B 3QDAA 3JXAA 3N0PB 4EN3D 4UOW0 3BDYH 2Z8RA 4M62L 1A7PH 1I75A 5I1HL 1LO2L 1IRAY 4JO2H 1BFTA 4G43B 3NCJH 5IG7A 4HXAH 4RAHA 1FC2D 4O2CB 3X14A 5JPMB 3MLUL 3SHSA 8FABB 4LLDA 4YIQB 4CAGA 4I0CC 3FB7B 4X7DC 1UEYA 4XPBH 3FB6A 1DQML 5GZOC 5I8CB 3MGAA 3NCYS 1A4JB 4FNLH 1OSZA 4WFFE 2QQQA 1WEJL 4G8GA 5INDB 1WT5C 4TSCL 2Y07L 4YH6A 4KJPC 3EYUL 1TIUA 1N2RA 1QSED 2WBJD 5DUBA 4Y4FD 1DFBL 4Y5XC 4KVNH 3KLAB 1UB6A 2WM0A 2EKJA 3HE7C 3O3EB 1FNSH 1YEGH 2XKNA 4R3SB 2Z8SA 1DANT 1R3KB 4WHDA 3BN9D 3RWCB 1TQCC 3DV6A 3S98A 2ZSWA 4JPVH 3KYOA 4D0BA 5ITFB 1CLYL 3H9SB 4P49A 3HRPA 4TVSa 3OWEA 4HS8H 1P1ZB 3MX0A 1CD0A 4K9EL 4WDIB 3ULVH 5AZ2H 4D0BB 2BRRL 3C08L 5BVPL 1SJHA 2R2BA 4Z7UB 3WO4B 4PJ8C 4KK5D 2D7QA 2FB4H 3QUMA 4U1JA 5D1ZA 4XCFL 4Q2ZA 1F4WH 4DUXA 5I30L 1X5YA 4PG9B 3QIWD 2YRLA 2PO6A 2W60A 4P3DA 2AEQL 1AE6L 5HPMA 3PF2A 3VXUE 3AY4A 1NMAH 4JPKL 4NQDA 5BW7C 5IMOA 4LPUA 3QEUA 3L3JA 3VXTB 3BKML 3OJVC 2R0ZL 3UTTA 3WLWD 3ZKQD 2PNDA 4HIJB 4LASL 4H5SB 5KOVC 4JDTL 1VERA 1HQ4A 5DUML 1JYXA 3KR3H 1BVKA 1F6AB 1G9MH 4O2FA 3JTSA 5I8OL 1WTLA 3MRMB 3L3DB 1KYOK 4YBLB 2ZNWA 3QA3A 3IFPB 4K3GA 4F57H 2DI7A 1I7ZA 1ADQL 1N59A 5C0FA 4OKDA 1HHIA 1JPFA 1U41A 3ZKMC 3I3BA 4YQXH 2BSRA 3BHBA 2P5WD 2QKIA 1FG9C 3RGVD 3ARQA 5BV7C 3HPJB 1D5XA 4LQFL 5DVNA 5SV3A 2ESVB 5BMFH 4MAUL 1N5AA 5JUEL 3ARFC 1JF1B 4NQCB 2APTA 3DX9B 4HUUB 2NY4B 5FA3A 3SY0A 4ELKA 1HHJA 2KZWA 2X9WA 4UV4H 1ONQA 1J87A 1T5XB 3WMSA 1NCBL 4Y19B 4YDVA 4EXPX 3MRPB 1QLFA 5ADOH 2GJZA 4FXGB 1B0GA 1YEHL 4JN1L 1QBLL 4ZUWA 5EZIH 4YHNA 3AAZB 2PYEB 1U8MB 4K7FB 5E24E 3RWHA 5LQBL 1U8KA 2J7LA 2VOTA 1Z3GL 2YMXH 4EI5D 1FL3A 1OAKL 1N4XL 3BEVB 3GI9L 2D9CA 2R0ZH 3QDJA 4M5ZL 5F1NA 2PCPA 3A0OA 5LAXB 5BXFB 2BSRB 3GMNB 1JFQL 1T89A 5TQ2H 5F72S 1MSPA 5EIQA 2D4FA 2X4OB 1DE4B 5FYJL 1W0VB 3SGKC 4O02L 3TVMA 2AEQH 5IW1A 4RWHA 3QRGL 1QSEA 2A1WH 3FN0L 1NC4A 5EO9B 3G6JF 4LLUA 4NO5A 5DZOA 3S37H 2HLAB 4NDMA 4HWBA 5LQBH 2BC4B 3S5LB 1S7VB 4XNUL 2W9EL 5DEFA 1DL7L 5KS9B 3C8KB 5GGVY 2DMCA 3F58L 2DQGL 3MZTA 4AEFA 3OR6A 1TNNA 4MD4B 4HLZH 5B8CB 3K81A 2BRRH 3C08H 3VJ6A 1I3GL 1FRGH 3IDYC 4UV4L 5CP3H 3G6JE 5DQJA 5IWLA 4GBXC 2R2HA 3QG7L 3UTTB 1CLZL 5I75B 5JA9A 4DN4L 3FQTA 3D2UB 3LS5H 4QOKD 5DD3H 4NQVB 1FQ9C 5ITBH 3OKEB 2A9NH 5IMKA 1WJ3A 4PRIB 3L5HA 3TO4B 5MERB 4E0RB 4MDJA 2XACC 5I71C 4HUXB 4OLZH 1CR9L 1EXUB 4AIXA 4YE4H 5C0CD 4YXHL 5E2TL 4J4PA 5GSRA 2ESVE 2VLLB 4H0IA 3UTQA 3IFOA 4F57L 4FQQA 5DLMH 4FTVB 1CGVA 3A6CH 5C92A 1FIEA 2JLLA 3L3GA 5IF0A 4Y1AE 5A2IH 3S5LA 2K7QA 1CF8H 1IT9H 2Z92B 3KLSA 4MQXD 2J1KA 4NRZB 5C0JB 1F02I 3OXRB 4IRSA 2EE9A 3PE9A 3KYOB 1M4KA 4PG2C 5A2LH 4PB0H 1H15B 2EYTA 2DKUA 3OB0K 2YEZB 3R1GL 3C9NB 5J8OA 4KJQC 4O5LH 3VI4E 1KN4L 5DJ6A 4DKEH 2R9HD 1OP5K 4RGND 2D2OA 1GIGH 3P30H 4NWTL 4IHOA 3CU1A 5IJVB 1WF5A 1G6VK 4UILH 1J11A 1NMAL 4HT1L 4JPKH 3MMEA 5C08A 3H0TA 3SN6N 5DK0A 4XNQA 2VDQL 3DVGA 5AZEL 4YHNB 1Y18B 2I9TA 2V9RA 1UKSA 3BT2L 4K7PH 2GITB 3G6AB 1NFDB 4UUJB 1JZ2A 1JK8A 5KVGL 1OM3H 2C3WA 2DJ4A 3KGRA 5T3XE 3WCYA 3X14B 5JPMA 3NABL 3B5TA 1FNEB 5AZ2L 4P5KB 1RJLB 1A3RH 4AH2B 4XP4L 3OHXA 2RCSL 3QA3B 1T6VN 3VGBA 4HUWB 5MEOB 1OL0A 5ERWB 1D9KA 3X13A 1OLZA 5FV2A 2BVQB 2IF7A 5F7WC 2ORBH 1XGYH 4Z7UE 8FABA 2FSEB 4PJ8B 1FNSL 4X6CA 3G5YA 3MV9B 2VZ1A 1I7ZB 4ZODA 1HH6B 5AAMA 1YN7A 3CPLB 2HG5B 2Z35B 5DD1L 4NJ9L 1CICA 4L4TB 2BVOB 3O6LL 1U6AH 3AREB 3HZYB 2WINA 4IOFD 2I9LB 1HWGB 5HGDB 4LOUC 3ESVF 3T04D 4HBQA 1EEUA 5GSVB 2OR9H 4HV8B 1A7OH 4HJ0C 4N5UA 5J1AA 2HFTA 4QWWC 3D9AL 3FT3B 4XH2B 2PO6B 2W60B 2A38A 1QFWH 4F33A 5C1MB 5DDHB 2F9BT 3JWOH 3LSOB 4RGNC 1WT5A 3RNQA 1MCEA 3UBXG 3BDXA 1ZGLA 3OQ3B 5IMOB 4U1JB 3E8UL 2ATKA 4XNMA 5EIIB 3QRFM 4RDQG 2VMFA 3MNZA 4N9OB 2F53A 1RHHA 2FJFA 4P9ML 4I0PA 5AYUL 4G9DB 3VXNB 1X7QB 1GGIH 1LEKB 3HAEG 5EUOB 1U3HC 1KC5H 1SYVB 4WJ5B 5IJVA 3BJ91 2DKSA 3FQWB 1U0QA 4ZO8A 3D25B 1TJIL 1QO3A 5E95B 5C71A 5T1LA 1QZ1A 3P0YH 4JQIL 3BD4A 2PTVA 3T8XB 2BVOA 3OKKB 5GRXG 3SKMB 2G75B 4YDJB 1CGUA 2HFEB 2EDHA 4RQQA 3MUJA 2GK0A 5C0AE 3SDDD 3O11B 1KLGB 1YEKL 3OR6B 4XMLH 1T4KA 1RV6X 3HR5A 3H6JA 4QNPE 4QRPE 4ZS6D 3LKOA 4L3EE 1KCVH 5F1NB 2IQ9L 4LLVA 2H26A 3QIBB 5IB2B 1DDHB 1H3UA 3X3GH 5ICZB 1F58L 3V6OA 1GGYA 4XX1E 1UXWB 5DUBB 4I0KA 2QTEA 1DQJA 5CJQL 3ZTNH 2X7LB 2OL3A 5B4MD 3RUGF 4CU7A 3CZFA 4NQEB 5HHMB 4X4YB 3JV6B 1MWAA 3RVVD 1UYWH 3CDGB 3CVIL 2WUBH 1HI6A 3N1QC 1NCUA 2DWEA 4YHZH 2V5SA 1NFKA 4PRPB 1V7NL 2E27H 3IKKA 4XP4H 3MJ6A 1Z2KA 5GRJL 5HYJD 1TMCB 5I74C 3FQUA 1MI5A 1T1YB 5GS0C 1J9CT 1NPUA 3GM8A 1MCRA 1LQSR 3IDMB 2UUDH 5I19L 4CBPA 1NC2D 3LD8B 1A3QA 2QHLA 5FGRA 2A0LD 4KJYB 5E8PA 2AXGA 4C56B 3I9GH 3TA3B 3WIIL 3C6SA 3MRCB 2OTUB 5ADPL 3HZMB 5F7EL 4FTVD 3C09C 3WFEH 3QI9D 4R4ND 5BV7L 3DO3A 3B9KB 3U6RB 1TCMA 3X11A 4D8PB 1W0WB 3O3AA 2OBGA 4GOSA 5EZLA 3S3SA 4F7CB 3W9EB 4MVBD 2PYEE 2YN3A 2BY0A 4U31A 5GZOD 2E3VA 3QCUH 3WJLA 4PJBF 1QD0A 1TZHB 1NANI 1H3XA 2O5XH 5D1ZB 2ZG1A 3MBEB 2XTLA 3JUZA 2LTQB 3GBML 3SCMA 3EHBC 1EAPA 4CDGC 3D2UD 4O5LL 4QOKB 4OF6A 2CSPA 2J12B 5BXFA 3JWOC 1SYVA 3SCMB 3SGEH 4BSWA 3EOBA 5FKPA 4PJGA 1JTTA 1L0XA 3BZDA 3SQBA 3CSBA 5JO5A 1NCWL 5I76B 4OJFL 3MBXH 2WIIB 4AENA 3TBSB 1IL1B 1CICD 1P5UA 3VXTA 4Y4KA 5LGHH 3A6CL 3GMNA 4LEXL 1CD8A 1WUNT 1XGQB 4PJ9D 3PQYA 1QHPA 5INCA 1GOGA 4U6YB 3SGJC 4O2EA 3IDIB 4A6YL 4L4TD 3M8OL 3TZVB 3VXMD 1R3IH 3FAXA 1NMCB 1KEGL 2EDRA 4I3SH 3EZJB 1N26A 3SE3C 2FJHA 5IR1B 1GL4B 4I8DA 2EIDA 4DCQB 5LXGL 1F8TL 1UH4A 4JFDE 1TPXB 4R4NC 4IDJL 3VFMA 4UT9H 5JPNB 3BQUC 3MQIA 4PJIE 2BOBA 5DD3L 4NZTH 3QH3A 3BFOA 3PV6A 3QZWG 1MWAB 3I6KA 3G9VA 4M1GL 3TN0C 3HI1B 1N0LA 4X5WB 1T20B 4A6YA 1XH3A 3QWQB 5DHXB 1CGYA 1DBAH 3QUMB 4Q0XH 3RIAF 4BKLA 5DJAB 1ZANL 4LHJB 4HGWB 4BZ1H 1SEQH 3LQAC 3RKDD 3U4EA 4QRUB 1ZGLP 5FGCB 4M00A 2GY5A 5L6YH 4DAGH 2FD6H 3P4NA 2YUZA 3P4LA 4FS0A 5J06A 4ZFFB 2IANB 4KGLA 3K0WA 3QO0A 2XI9A 4S1DD 1A6VH 5E6IC 1I1FB 2XWJA 3ARRA 4PV9A 1QSZA 1RZ8A 1BECA 1G7JB 1YEJH 2OMBA 2Q86A 4LSQL 1U8LA 3VFUA 2AQ1A 1NFDA 3CUPA 1JZ3A 2EDDA 3AFLA 3GM0A 5LVEA 3VFMB 1N4XH 4HWNA 3CSYA 3FO2A 3FQWA 1DBKH 2GTZB 3RY4A 3KYMA 1NLBL 3TH4T 4KTEL 4RFNB 3O45A 4JANA 3HZKA 2V7NA 3N1PC 5CCKH 3MV8A 4WWKB 1MIMH 3AUVA 3EAKA 5ICXB 5EOTA 3JV5A 4YDKL 1XGTB 4HKJB 2DLTA 4E5XA 5CBEB 3BRFA 32C2A 3R8BB 4KROB 3C60A 3QNXA 1KFAH 5GXBB 5CGYC 1E4XH 4G7VH 1C7SA 2PR4L 2W59A 3B9VA 1YECL 2R2HB 1AFVH 4D2NA 1MCNA 1CGSL 1HHIB 3MUZ1 2HVJA 4P3DB 3VXME 3DI3B 3ZE0F 5JUEH 4ODUA 3WO4C 1GGUA 3RVXD 3C5SA 5E2UL 1QQDA 5LCVH 1RSFA 4H1LH 3TYFA 1ZKAA 2QSCH 1XFPA 5A2JH 4KKAC 4YQXL 4M7JH 3K2MC 3TYFB 4W6YB 4PR5A 2QL1A 2VKWA 1A1MA 2ADJA 4ODHH 3WEXA 3WN5B 3BPLC 5C9KA 4G8FB 2YD3A 1HQ4B 1EVTC 4I18C 3PWPD 4YZFE 4XMKH 5E99H 4QHKJ 1I1AB 4O58L 1ZHKA 4HFUL 3ULVC 2JJWA 3T1FB 4WY7H 4L4JA 4Y2DB 3FQTB 3ALWA 4CJ1A 2OP4H 5EIVA 3FRPG 3MJ8B 4U2YA 1XIWC 2HJKB 4KU1A 1NDMA 1HINL 2BNUA 3NCYP 5D5MF 4FQCH 3KPNA 4MS8C 1MELA 5I8CA 4XB7A 3QUXD 1HSAB 4YZFF 1Z5LB 1KB9K 3MUGA 1OTTC 2M1KA 4LCWE 5FGSA 3BZEA 5KSAC 1RZKH 4GUPB 1QLEH 4EUPH 3BKMH 3S4SB 5GQBA 5EU6E 1RZIA 5CBAA 3BXNB 2J8UE 4UT7H 3ETBF 1KEGH 2A83A 3Q48A 5D71H 1QP1A 4L5FL 4LAQL 1J7VR 4GQ9H 5D1QC 1IAOA 3B83A 2APWA 4GG6F 2Q86B 4UTAH 1QSEB 1E27A 5E1HB 4NQCA 4UINL 4G9FE 3N85L 4PB9L 1LO3L 5AAWA 4P4KD 5EZJB 3O3DB 2Q8BH 4IRSB 4LNRA 2D0FA 2I27N 3G6DH 3MBEA 5DVKA 2APBA 1Q0XH 4JKKA 5IVXA 5D7LD 5DJ6B 3U7AA 5IMLB 1XGTA 2YPLE 5DJ0A 1XZ0B 5TPWH 1TVHB 4GRMA 1L4IA 3K4AA 4ISVB 4EXKA 4V2CB 4LCYA 4M7JL 4YBQC 3E6FA 3V5DB 5L9DH 2W9DL 5FA4B 4X7EC 1YEGL 4UUJA 5E2UH 4JE4B 2Q7YB 1KPUA 3TV3L 1NJ9A 4FQXC 5ABDE 1OP5H 1DCLA 1RD6A 1DFBH 4R7NB 2GSGA 3F62A 5KSUA 5JPNA 4LP5A 1AFVL 3Q2CA 2DJSA 1EO5A 4D9QD 3EYUH 1YMHB 4LGSB 1BM3L 3QJHA 1E4KA 3TC9A 3I9GL 1CLOL 5JO5B 1T21B 5JHDB 4UNVA 1YMHA 3BMWA 1ACYL 4BA8A 2BJML 2CUHA 3ELAT 5C0DB 4IS6A 3IAGC 3FB5B 4LLYA 2BX5A 3EUUA 5KSUB 1HI6B 3MRHA 3MLXL 4L3ED 3PXHA 4DOHB 1JF5A 4XCNB 1DQMH 1HXMA 5HDOA 4BKLB 4D0DB 4P4KC 2IH3B 5DJZB 2I5YL 2EYTB 3LN4B 3MLUH 2WUBL 3CVIH 4YWGH 4U1HA 5A3ID 2PTTB 1MAMH 2X42A 1AD9A 2HJKA 3GMPB 2A9ML 1I85A 2P1YA 3LN4A 4ISVA 1SMOA 2VABB 5SV4A 1C08A 1YEJL 3JV0A 4Z0XB 2PETA 4HS3A 4KZEH 1VDGA 4PIRF 4N0UB 5C0ND 5EU7C 1BJMA 5ETUB 4OCLC 3QPQD 4WDIA 1Y6NR 3DYPA 2F58H 1W72B 2X1OA 3C2SA 4U1LA 3IKCB 2BNQA 4MB4A 5CIPB 3EOTH 4NUGH 1N5YH 4P9HC 2MQCA 1AR2A 1HZHL 5SWQA 1QKZH 1E27B 5CEXA 4PJXA 2P5EE 5HYJA 3T3PF 5KG9A 3IDJA 4G8GE 1K6QL 1P84J 3VXOB 5JOPE 1J0ZA 1U95B 2EDBA 4FXKA 3LQAL 3GSOA 4GXUN 1QSFE 1NCCL 1LE9A 4JLRB 2FEEI 4G9DA 5TDPB 3HCVB 1PSKH 3QQ4B 3VXSD 2OJEB 3SDCA 3H9SD 4R97C 4TUJA 3W39B 3J7HA 3DIFB 1G6RL 3E0GA 3PJSA 2ZJSH 3IVKB 4XMPH 1PKQA 3Q6GH 1WIUA 1F8TH 1EGJL 5C0GA 3ARXA 5CBEA 1DDHA 1CFTA 3MFFB 4C58B 3KDMB 3HRZA 2R1XB 1VSCA 2AXFA 1QFPA 1JN6A 4YHLH 3V0VB 1U8PA 1I7TA 1U36A 2MOVA 4HH9A 4JQVA 4P2RD 2XN9D 5E9DD 1DQLH 2RBLA 1WWWX 4G8GD 2Q8AL 1X3DA 1TVHA 1Y0LB 5MI0B 2LVCA 1EFXA 1WVZA 3BEWA 4KDTC 4HGWA 3WS6C 4X9GA 1NCWH 2ICCA 4FFWD 2H32A 1JGUH 2ARJQ 4I3RL 5J3HC 3D39A 4XPFH 5EWIH 4UQ2A 4S0TD 1U6AL 5C7XH 3WNKA 4LVNC 4ZFFA 2P7TB 4ZUSA 1I1RA 1BD2B 4YUEL 5EOQH 2F19H 2P8PB 1U3ZA 3ILPA 4HMDA 5MEPB 1TJHL 3MR9B 1NKOA 1KG0B 2NY5L 5E8EA 2OYPA 1AXSB 2EXYC 1QBMH 4Y2DA 3L1OH 4YAQA 2ZSVB 4C4KO 3MV9E 4GAYA 1A14L 3GDBA 1FGNL 5EO0A 4H88H 1E4XI 5BV7H 2ZSVA 4HCRA 1KLUA 5DJDB 3GSXB 3MUGB 4KK8C 5HVHB 2V7NB 3TO4A 1KG0A 2I24N 5H94B 2CLZA 2VDML 2ZP0T 1VGKB 3LEYH 4OQTA 4LVHB 3DVFA 5I8EB 3ABZA 4PRPE 2QKIB 4M03A 4FFZL 3LQZB 4U6TA 4GS7B 4X0KB 1U2HA 4X6DA 5D72H 4KRPB 3EGSA 1F97A 4R90H 2BCKB 5EBWA 5FM8A 3ES6B 1KJ2H 3CFIC 1T7ZA 3HTLX 4L3CA 4RIRA 1OCWH 1FJ1A 4Q58C 1NL0L 3QFJB 2A2QT 3RWFA 3UDWC 1P6FA 3MRRB 3OGCA 2Q87A 5F3HB 1NC4B 1GRWA 5TGBA 1B0RB 5DMIH 5TQ0H 4OD2A 3LH2H 1IMHC 4PJGB 3U7WL 1XCQA 1U92B 4N8CH 3EYQC 3RVWC 5E0QA 3O8XB 1DBML 4F7TB 5D7KE 4HIJA 2XZZA 3UJIL 4HGMA 4XPFL 5EWIL 2EH7H 3V0VA 1YZZA 4PRHA 3RU8H 1MWAL 1UKQA 3ZTJH 3WJJA 1CF8L 4QHNB 2MPAH 2FEEL 5JW4R 3B2VL 4HSQA 4PRID 1YY8A 4OGYL 1DQLL 2HA1A 3OAYK 4D94A 4GBXB 3MOBL 4LPXA 1G7QB 1LDSA 3IF1A 4P2QD 4FTVE 4PLKD 2V5TA 2G5BB 1FYTD 3MACH 3S34L 3PP4H 1A4KB 4HAFA 2R0WH 1YDPB 4UU9B 3BOVA 1YUHB 3Q1SH 3UYRH 1MHHB 1ZVHA 1ODAA 2X40A 3FO9A 1JCKA 3P40A 4OZFB 5FYJE 1YYMH 1GVIA 3V4UH 1T2XA 2NW2A 2YKLH 3RWEB 4X5WA 4QRSA 4RAUB 5CS7A 4U1LB 1YY9C 1AD0A 2H45A 3UTPD 3AXLB 5IBUG 4PJBB 4D3CH 5CSGA 3ZLQC 5EU6A 3CLFH 2GJ6A 1FFRA 2IANE 5IMMB 4KRLB 1QKZL 4N8VG 3FCTB 3STZB 5JOFA 4WRLA 2AV1B 1N5YL 5K9KA 2Y4SA 2ITCA 1IFHH 2GAZB 4EVNB 5IBLC 2NY4D 2YC1A 3U48A 4QXGL 3BSZH 2V2TA 4U1NA 4V1DE 5F88A 3QQ4A 3UBXI 4O02H 3VMNA 2QQNH 4MNHB 3MV7B 4TTDD 1ZT4A 2CJUH 3BEVA 2E9IA 5HI4D 1H3PH 4W4OA 3MNWA 2DBLH 3EJZD 3AB0B 2JKXA 1KLFA 4GRLA 4WWKD 4R0LC 4X7TB 3U0TB 5ACZB 1YUHA 4OLXH 1E28B 4R6UA 2FR4A 4Z5RB 3QJHB 1U8OA 2N7BA 2VITB 4I77L 3MLYL 3WNLA 4ACPA 3TBVA 3U2SA 3NCFB 4JFDB 3O4LB 1DLFL 5CGTA 1U42A 5D70L 3HKFA 1XGUA 1M7XA 1MRCL 4F80A 4XVTH 5JIKA 1D5IL 4I2XE 2E7LA 4LCYB 3BUYB 4H0GA 5IW6A 4RISH 5F9WB 5L2KB 5E4EB 1WBZA 3FQXA 1ES0B 2YSSA 2CK0H 1AKJA 1FE8H 2CIIA 3GUTB 4U0RB 5KZCB 3NIGE 3HG1A 5T1MA 4LFHD 5C0RL 3F5WB 4GLRH 2HVKA 2IQAA 3DROA 3SDAD 3VWKA 2GUOA 5JQ6H 4XCCH 4S1SL 4UILL 4RFOL 3T08A 2AW2A 1BQHA 4WW2F 1YN7B 5DI8A 4HIIA 1I9JH 2CIIB 4QY8A 4K7PY 4YXLL 3RJQB 4CW1B 5D2LB 1YPZE 1CL7H 4J7RA 3FFDA 1JMZA 2YS4A 4LIQE 2MNUA 4O9HH 5FKAA 3V7AG 1GH7A 1KN4H 2FIRT 4DFHA 5E70A 1KT2B 3GSNB 4DKDC 2BMKB 3WE6A 2C5DC 4JFXA 4MWFB 2D7OA 5DUPH 4WTWA 1P6AB 2W0KA 4PB0L 3OZ9L 1E4WL 5AEAA 3CH1B 2H2PC 2Z8VC 4H26B 4KUCF 2VTFA 5CAYB 2XG5A 5DRWB 4LHUG 4TUOA 2FZ3A 1RZJH 3JV6A 5DD0L 5CLTA 4KQ3H 3AGVA 1YNLL 4FMFA 2BHYA 3N85H 1DUZB 3WHXB 3K7UA 3MLTB 4KDWA 3SCMD 4RA0C 3QXDB 1NEZG 1B9ZA 3O4OB 1RIUH 1AC6A 2NXYC 2DQEH 3QZWB 1NAKH 4RMQA 3BQUD 3DRQA 1A4JA 3DGGA 2IBZY 2ZOLA 3GHBH 1DUZA 2DQDH 3LB6D 5E08H 2E6QA 4CMMB 4MA7H 4I9WD 4NHCL 1Q8MA 2DLIA 3P9LB 4PJEE 3KYKL 4HKZB 3IXAA 2VISA 3O2DL 4IHOB 3RX7A 3M07A 1KV3A 3EW3B 4WFFD 4YDJA 1I7UB 3OKYA 1CZ8H 5D1ZD 1BX2B 2OTPA 4ODVH 4O58H 1S7SB 3AM8A 4XMKL 5M95B 2OR8A 5KS9F 4XBEH 1I7TB 3QNYB 2QHRH 2R1YA 4Y19D 5F89A 3WN5C 5DMJB 5DQDL 5GJTH 3I6LE 2QSQA 1T5WB 2VAJA 3AMLA 4OGXL 4UNUA 1ZE3C 1T7VA 3TZVC 1C1EH 3C5ZB 4JY4B 3QRGH 1R5IA 4WW1B 5D93C 5FYLH 4KZDH 4OZFG 1I9IL 5F7HA 2EYSA 3S3PA 4CRPA 3BZEB 1BQUA 5DA0B 4LU5H 3A6BL 1KCKA 2K9UA 1UCBH 1YY8B 1G9NL 4RAVA 4AL8H 3IDGA 3QIBD 2V9TA 3EFFA 5I16B 1FLTX 3O9WB 1O7VA 1VA9A 4ONOA 5C6PB 4PGCA 2WP3T 4IS6B 3ZKSD 2EDFA 4WHTB 5HYFA 3REVB 1EERB 3HG1E 3ARFA 2P4AB 5CD5C 4XNXL 5JIHA 2E8YA 4XHJD 1GC1H 2AJVH 4XX1G 4FZEL 3FFCB 4KQ3L 5I6XB 4PJHE 1JIBA 1KJVB 2XRAL 4XPBL 4NZUH 2QV2A 1QLRA 1RAMA 3OJ2C 4QYOB 4OM1L 5B38B 3DI2B 3GHEL 3T4YA 4L29A 1WBXB 3K1KC 1HEZB 2ICWA 3CLEH 4KHXL 2NY6C 2YXFA 4MYWB 2C7UB 2HRPH