5F72S

De novo design and crystallographic validation of antibodies targeting a pre-selected epitope
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
226
Chain Sequence
b'QLVESGGGLVQPGGSLRLSCAASGFAISASSIHWVRQAPGKCLEWVASIDPETGETLYAKSVAGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARAYAGDGVYYADVWGQGTLVTVSGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYSFPSTFGCGTKVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kelch-like ECH-associated protein 1
publication title De novo design and crystallographic validation of antibodies targeting a pre-selected epitope
rcsb
source organism Homo sapiens
molecule tags De novo protein
total genus 57
structure length 226
sequence length 245
chains with identical sequence T
ec nomenclature
pdb deposition date 2015-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f72S02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f72S01
2R69H 4OB5H 5HI5C 4WGWB 2DQIL 4L9DA 3M8OL 1V7MH 5EU7E 3KDMB 3WFCH 3IAPA 2FLBT 4RAHA 3S97C 3ZE0F 1CFSB 2F53E 5HY9A 3V0VA 3EYUH 3VXNA 1YEEL 3BWAA 4H20H 4LDOB 1QVOB 4MA1C 1JHKL 1P7QD 5KS9E 4G8FB 1QG3A 3TESA 2YN3A 3WSQL 1F90L 2Z31C 4KMTH 3GSOA 1V3KA 3OB8A 5JDSA 1DBBH 2VAJA 4IHOB 1D9KA 4LLVB 3B3IB 2ADGA 2CK0L 4JG0H 5KW9L 3KJ6H 4Z0BL 3BXNB 2X4RB 5BZWA 3BH9B 4ZTPH 4LSQH 1OTTD 4OCSL 3BO8A 3MLUL 1V7ML 5BZDA 1IGJB 2XWBB 3MJGX 4GW4A 3OXSB 3L7FB 3G5VB 5D71H 3EYUL 4XX1E 5JNYA 1JGVH 4JFEE 3BH8B 4LLDA 5KVFL 4N8VA 3CC5A 3ZDXF 1XF3B 2JIXA 3L3KA 1CXKA 3U83A 4OFDA 1KB5H 5B38B 5D2LF 4DAGL 4QHKJ 4LSVL 1XGRB 5DD6A 1MFEL 2NX5B 3TO4C 3ALXA 1H8NA 2EH8H 4ZTPL 3RWCA 1IJ9A 4ODXA 4YBHA 3MOAL 1J87A 5IBUB 3MYJB 1CDIA 2GUOA 5D71L 3SO3B 1TZHA 2V2TB 3C6SB 4K3JH 3CK0H 4HV8B 1A02N 4WHTB 5C71A 1NCWH 3G5ZB 1ZGLP 1EDQA 4FTVA 3MACL 3O3EB 4WO4A 2BNRA 4Y16B 1Z6JT 2AJXH 1KB5L 1INQB 3HE6C 3VFVA 3U0TB 1EAJA 4Y5VB 4J3SA 4XPHL 1RUKH 5JPNA 4P9ML 3K8LA 1NAMH 5MI0B 3ZT6A 2EH8L 2Q8AL 1TZGH 4I0KA 1G7PB 1BEYH 4MAYB 5D7JA 1D6VH 1E6JH 3MJ8A 5J8OA 1KN2L 5L88H 5I66B 1T03H 2ITDA 5ELIA 2HT4D 4ELKA 3O3BB 4Z7VF 3QUZA 1NCWL 4JGJA 5DI8B 1YPZE 4LGPB 3WDIA 1S9XA 2EKSA 5CGYD 3CFJB 3G6JA 5CZXD 5EO1A 1MF2L 1BIHA 4H1LH 1QRNA 4ZDHA 3JWDL 4ZUUA 1YJDC 3R8QA 1ZHBA 3RZCD 2IH1A 1NAML 3MXVL 4G5ZH 3LKPB 1TZGL 1BEYL 1D6VL 1T0NA 5L88L 5IW3A 1T03L 4YK4B 1AKJD 2GCYA 5T5NG 2ENSA 1S7QB 4ZFFB 2FJFB 3TGXA 4PJ7B 1F4AA 2VLRA 1A6PA 5J89A 2W1NA 1CXEA 4CRPA 3MRKB 5CEYB 2FX9H 5FYJE 3RZCC 3AS3A 3BUTA 4IMLB 4KKLD 3N1GC 1KTDB 4JRXA 4OZHA 2V7NB 1A14L 2DL2A 1OSPH 2GJ6A 4G5ZL 2CMRH 2XA3A 2X7LB 5T3XD 3ZKXC 3UCRA 1OTSD 4X5XA 3CFDA 4NNXA 4KTDH 3TEUA 4GRWF 4W6WB 2O5XH 4JFPA 4NIKB 5HYFA 4ZOBA 3TIDB 3LZFH 1GGCH 4WRLA 5C8JB 4G7YL 1ORSB 5I8EB 2BOCA 1S7SB 3PQYA 4P4RA 4KKLC 4NNYA 4OIIH 5LG1A 3DVIA 3OKLA 1N6QL 4GW5A 4YPGB 4C56D 4MS8D 2G75A 3WS6A 4CNIB 4LPWA 1PY4A 5GGUB 1CGSH 1QEWA 3EOTH 4Y1AB 5HHOB 5EH1A 2XFXA 5HHNA 4X9IA 5IKCB 1D5BA 1MNUH 2EYSA 5GGTL 3SOBL 3VD5A 3GSNB 4OLUH 5GS3A 3QZWB 2O5XL 4NM4H 4YHYB 3LPGA 5BV7L 1F4XH 1GAFH 3BPCB 1CFVH 2HKHH 4NKDB 5D7LE 1B0RA 5GJSH 5IIEA 3KNBB 2AABL 3DX8B 4XP5L 2J88H 4IMKA 4BQBA 3RTQD 3CMGA 2DQDH 2V2XA 1EK3A 3ILQD 4L29B 1BF8A 4P23B 4W4NA 3VXUB 2IMNA 3MJ9A 4NT6A 1G7QB 4QF1A 1TPXB 1RZGB 4V2BA 2V7HA 5IROA 3C5SA 3EOTL 2P5WD 5ID0A 5IB2A 5DVLA 3PHQA 3SDXF 1J88A 3WYRA 1PX4A 5BVPH 5ETUB 3MJ6A 3D1MC 5GRZA 3V5KA 1HCVA 1GAFL 3MUGA 3OF6A 1CFVL 2DIAA 3R4DA 1CFQB 3RTQC 4OZIF 4JRYE 4R2GB 4F9PC 4YHPA 3QNXA 1HHHB 2DQDL 2W0KA 1QLFB 1IEAA 1GC1L 4GAJH 3BX7C 3L3OA 1KG0B 5DEGB 5ENWB 1UEYA 3FFDB 5SWQA 4NCDA 5T1KA 4H5SB 3FB6A 4APQC 3FN3A 3N85H 3FOLA 4Y5VC 5FOBB 1R3LB 3BE1H 4KI5D 5CEZE 3K2UL 2R0ZH 5EU6A 4FS0A 4E5XB 4LHUB 4YAQA 4KKCC 4G80A 5BVPL 4MAYC 2K7QA 4GAYA 1MH5A 2LAGB 3O6KH 2KH2B 3HAEG 5HVFB 1BVLA 3O3AB 1OAQH 5D9SA 1P84J 1FGVL 4X8JB 3MRBB 4YXKL 4ODUB 1J18A 4GAJL 3H9YA 3S5LA 1T0MA 1WGOA 4YZFF 4N68A 2NXZD 4DGYL 4XP4L 3N85L 5L2KE 1SYSA 3VXRB 4I48B 3VCLB 2X10A 4YDKH 3U4AA 5DSCB 4KH2A 3STZB 4WJ5A 3NFNA 3U6RB 1U92A 2VN4A 3ZSSA 3QUKB 3FONA 1H3XA 4TTDC 3D0VA 2XYCA 3AXLA 5B4MC 3FZUD 3C8DA 1XF4A 1OAQL 4IS6B 3MX0A 4OTXH 1KBGH 2H2SC 1SJHB 2WANA 2EZ0D 4HS3B 3QB7C 4LEOA 1H0DB 1NGQH 4WTZG 1D5MA 1DQQA 4HIJA 2Y4SA 2R0WL 4QRUA 3O4LE 5C0CB 4WU7B 1XCQB 4HUWA 5E8EB 1S7XA 25C8H 4P2QD 3AREC 3RWEB 4YGVA 4XPAL 2R2BA 2AI0H 4TNWK 1P6AB 4M43H 3GIVB 2B4CL 3D0LA 3GUTB 3OBAA 4ZODA 5C09A 1J0YA 4KTEH 1PW3A 3MLVH 2FH8A 1K8DA 3QUYC 2JJWA 3MRGB 1NCNA 1X5AA 5FM5M 5K9KA 1NGWA 3DGGB 1QOKA 5HVWA 2HN7A 2A74B 3PABA 2MWCA 4V1DA 3D85D 2K7PA 5JHLH 3FFCE 3O9WA 2IWGA 4P5TD 1IFHL 4R96A 3UBXG 3ARDA 3AU1B 3RVVD 6CGTA 1V3JA 3RDTB 5MEND 1QRKA 3H3BC 1VKXB 5JTWA 4FQIH 1D5ZA 5TF1L 4BH7B 3KLSA 1U8HB 4ACPA 1J7VR 2KDGA 4P23C 1T5XA 3BVNB 1BOGA 5JQ6H 3O6ML 1MCCA 4BYHA 4MZ3A 5CSZB 2Y36H 3D2UD 1CXIA 5JHLL 1JPSH 3NA4A 3DJ9A 2DJSA 4OKDA 1NGPH 1CDGA 4M93C 3KPLB 3UDWC 1LE9A 3VXSE 1LEKB 5C0BA 2FO1A 2A6IA 2Y5TB 4R7DB 4X7TB 4OI9A 1F11B 4JFFE 5EBMA 5AG9A 3PWNA 2V17H 1LQSR 1K2DB 1FORH 2ARJB 3T3MF 5E1AB 1VERA 4N8VG 5F6HJ 1N5YH 4XP9H 3HNSH 4PRIE 4B53A 5KZCD 5JQ6L 4QHUA 2IANE 1HHKA 1K4DB 2YKLL 3RWJB 5JIIA 2IQAB 1S5HA 1TVDA 3VFOB 4X6DA 2PKDA 4BSWB 2JB5H 2DIJA 5BRZE 1JYXA 1AIFA 3VGDA 4PV9B 1CD1A 4MJ4A 3P9LB 3KPRB 1AGEB 4FQXB 1WEJH 4HHAB 4MZ2A 4OLVL 1TJGH 4OZGA 1IGYB 5IOPB 4MD4A 3F5WA 1FORL 5DMJB 2X4UA 5CUSH 2H45A 3I50H 4P5KA 2XN9E 4JN1H 4XP9L 5D2NA 2BVOA 5SX5H 2VO5A 5J1TC 4Q2ZB 1Q9LA 1RIHH 5GXBB 3QG7H 2A83B 3D3VA 2C1OB 4POYA 3CPLB 3VI4F 4HKJB 5T33L 3QDMB 5JIHA 3UTTA 3HI5L 4GBXA 4L4VA 4W6XB 4ZQKA 1N5AB 4AEHH 1B90A 4PJXA 5A2LH 3TH3T 4KDTA 1YEFL 1HKFA 1H8SA 5DYOB 5DK3A 3TCXA 5FYJH 5DEFB 3DX6A 5GHWH 4QOKD 3O2VL 4YFLF 3MUY1 2ERJB 4L4TD 3L95B 3P77B 1KT2A 2W65A 3JV6A 3C8HA 4Q9CA 5HSFA 2CH8A 2R2CA 2BRRL 1HDMA 2R1WB 1F4WH 2PF6A 3Q1SH 1FYTE 4NGHH 3V6BR 1RIHL 5GSVA 4PJAE 3HUJE 4HWZB 1IAKA 1AO7D 1FZOA 4G9DB 5TDPA 2G2RA 1C16B 5F96H 4JFZH 5HXMA 3PGFH 4G6KH 3IYLW 3O8XB 4MDJA 2QQNH 4DGVL 1MJJB 5I1CL 5GS0C 4HUXA 4NC2B 5GHWL 4M6MH 1A6TA 4JO3L 4OIBA 4XMKH 3EO9H 1A6AB 3HZMB 3QEHA 3SDAD 4X6CF 4I0PB 1M4KA 3SDYH 4WI6A 2H3NB 1R5VB 5DJ2A 4XHJC 4WUUD 3GGWA 2WSKA 3KXFE 2DRUA 4JPVL 1U3ZA 4OD3L 3GSUA 3UTSB 3OKKA 4D0DA 3MBXH 4LSRH 4M7JH 2NY7H 2ZCHL 3RDTC 4Z7OF 4XTRD 3TBYA 4J4PD 1U41A 3EYVB 2P48B 4HGWA 1G7IB 4M6ML 2DL9A 1RHFA 3FQNA 1JHTA 2AXHA 4KRPD 2BMKB 1EHLH 4EOWH 4XPGH 1M1SA 2LAAA 3IF1A 5KG9B 3CX5J 1P7KB 5IB3B 1YN7A 2XZCH 3VH8B 4JGUA 3IDYB 1PSKL 4N5UA 3SDYL 2JCCE 5INDA 4NM8H 4EUPA 1CK0H 4OKVA 5EFIA 3SE4C 5GGVY 3H6JA 1DQLH 2H6PA 1A6WH 3MBXL 1I8IA 4J4PC 2RIKA 4Y4HB 4M7JL 5DC4B 2NY7L 2CIKB 4JFDE 2ATKB 3NCMA 1FFNA 4MD0A 3RHWF 5IESL 5IJVB 3MRFA 4Z7UE 1AR2A 4NQEB 1YN6A 2AJYL 4XPGL 4D8PA 1JGUL 5TE4H 4IRJB 1WBXB 5IHZB 2D2OA 1PG7H 5CEZH 1Z2KA 1HE7A 1Z5LA 1CBVH 4G6ML 2COQA 5J6GA 4NM8L 2QLVB 4JFHD 1F42A 4LCWA 3KLHC 5DQ9A 3V6OE 1MIML 4LHJB 2W38A 3BYYA 2GSGA 1A6WL 1MWAA 4CW1B 3RWDB 3EFDH 43C9A 3DV4B 3RWHB 3UTOA 4N0CD 2QQLL 4FQXC 4HIEB 3S36L 4LP4A 3IJYB 4PJ7F 2R15A 1CGTA 2QADD 4NKOA 4N5EC 2EE9A 2M8XA 4MNGB 5CEZL 1N0XH 1BJ1J 5E70A 4ZSOA 1CBVL 3SDCC 1IC5L 2ORBH 5DO2D 2NNAA 3QJHB 2BVUA 3RUGE 3I3EA 1FRGH 4JVWA 4M8QA 4GMSH 4NKQB 1LK3H 2IALA 2VDKH 1U3YA 2LVEA 1A6VH 1JUFB 2WUCL 4NZRH 3T2NL 2MKWA 5DJ8A 4PJ8D 3ZLQC 2QADC 1U8IB 5KTEL 4FFVD 2FLRT 2ZP0T 5BXFA 4RISH 4ZPTB 1G84A 3UO1H 5DRNA 5CLTA 1L9NA 3A67H 3N06B 4RWYL 3DUHA 2HG5A 3MRMA 3V9FA 2PW2A 1D5XB 3DI3B 2CO6B 4MAUL 2IMMA 1N0XL 5LAXB 2EC8A 2HH0L 3V8CA 1IM9D 1RIVL 3E1F1 1UXWA 1K8IA 1U8JB 1DFBH 1FQ9C 5F88A 1FRGL 1MCJA 1M6OB 4PJ5A 1ZVYA 1F02I 4P3CH 1KEGH 3KYMB 5DMKA 4ZUTA 3VXQB 3C5ZD 1JYVA 1CGYA 1XGUB 5SX5K 5KSAA 3AB0B 3WE6B 5F9JA 2BP3A 5BOZG 1HINH 4UI2A 1WBZA 2KZWA 5JXEC 2XZAL 2X89A 5D8JH 5KVEL 2DLEA 2N1KA 3Q3GB 1LNUA 1JZ2A 4WNQB 4I0PC 2HJKB 1UB6A 2RAMA 1AE6H 3OKNB 5FCSH 4F37K 3G5XB 4FQ1L 1DFBL 2MMXA 3K3QA 2ZSWA 1GGUA 1U58B 4LSPH 3KPSD 1PKQB 1G9MH 3LN4A 1KEGL 1YDPA 3QIUB 4PLKC 4XVSH 1J1XH 4BK5A 4ZS7H 1AGBA 2VAAB 4RZCA 1EXUA 2Q7YB 1HINL 3U0WH 3QQ9D 4K94C 4UIMB 3WFHB 3PWLB 4R90H 5ESAA 3TPKA 5I1GL 1OAYL 4K7FA 1OLZA 4W4OA 3T0EA 2GAZA 3NCFB 3WFBH 5GGRA 1AE6L 4X6FB 4QRPA 5TFSH 4Z7WE 5EULV 4XAKD 1BFTA 2APXA 4LSPL 1I7RA 5IHUH 1YNTA 2PCPB 4PLJD 3ULSA 4Y4HC 1J1XL 4HK0A 4XT1C 4RDQG 3FKUS 5CZVH 4JFXA 5DUBB 3QR2A 2QSTA 1U8NA 1S7VA 2EYTB 4FXKB 5JOEA 3U0WL 2CLRB 2X4NA 4F33B 1II4E 4I4WB 3EYQD 4R90L 4X4XB 5MHSD 5EU4B 3FQTA 4EI6A 2R29L 3GKWH 4XC1H 1AHWB 3LKNA 1WITA 1L9MA 1S9WA 5F7UA 3DO7A 3GJFB 1DVFA 2HYMA 4OD2B 2VZOA 5TFSL 2ZPKH 1MUJA 1WQVT 1OWWA 1N59B 4KDWA 3PGDA 1HSAA 3ET9F 1ZMYA 2BNUB 4Z7NF 3PWVA 3W9DA 4JY4B 4IRSA 5E6YA 4MVBD 2G60H 4F7TA 3FQWB 4YC2C 2BCKA 4EIZC 1KCVL 1PG7W 4QHKI 5KSVB 1U95B 4KVNH 2CRYA 2VITB 1ZVSB 3DXAB 1BM3L 4G43A 4UT7H 3X11B 5SWSB 2IAMD 1NEZA 5I76B 5GGSA 1XGTA 4HWBH 4XCNA 4RGND 4KMLB 2J2ZA 2HLFC 3VFRB 4MVBC 1HK6A 2UZYB 4NQDD 4DN4H 2HJFB 4LQ1A 1ZLWH 4Y5YA 2QKIA 2EXYC 4QXGL 1MEXH 4G8GE 1MAMH 3R06B 5HJ3B 4EXPX 4JM4H 4MJ5A 1NKOA 1VGEH 5KSBA 3TNNB 1A4KA 4NQTA 3PHOB 1PEWA 4MYWB 1C12A 2NQCA 4H8WC 4UOJA 1NCTA 4ONOA 4UT7L 2D9CA 2R23B 1QA9B 3P11H 4G8IB 4BUHA 1A6ZA 1LD9B 4MNQA 4JDZB 4HWBL 5E4EB 5T3XE 5DLML 3MRIB 3ARBA 1HHJA 1FNFA 1YEDA 5DZNA 1E4XI 4HS6B 3CMOL 1MAML 1XIWA 2DTML 2EDLA 5C0JB 3IFPB 2XQBH 4C4KT 1A9BB 3CFKB 4E42B 1ZE3C 1K3IA 3TWCH 3QFDA 1BFSA 1KELH 2D7TL 1ZK9A 4KTYA 2VXQH 3VXOA 4C56E 5F89A 1G7JA 3L9RB 5AWNL 3F65A 1RVFL 3P11L 2FSEB 5FGCB 1JGDA 3O3DB 3X13B 2RHEA 3L3HA 3LKRB 1U3HB 4XPBH 5GGVL 2UUDH 7FABL 4L8SA 4MJ6A 4Q6IB 1NCAH 1XGYH 4JFQA 5E2VH 4UQ2A 4LKXA 3DMMB 3RU8L 2B5IC 4Z77B 3HE7A 1KSRA 2AXGB 3ZTNH 1MY5A 1N2RB 2I07B 4LBEA 4KVCH 2XXCB 5C08B 1A1NA 2JLLA 5EO9A 3W11C 4GFTB 3Q5OA 4ONGH 4LAJH 2A73B 3WKMH 4JFEA 2QHRL 2HP4A 1B6DA 3NN8A 1JWMB 1KULA 4LRNL 2P5WE 3LQZB 4OFYD 2WLZA 5I8KH 5C0FA 4XPBL 3BP7A 4F7EA 1RULH 5DHXB 5HDQH 5B39G 3MROA 2C3VB 4FZ8L 1I1AD 5IT2H 1BVKB 2BC4B 3EYFA 3LQAH 1XF2B 2YSSA 2SEBB 2JE8A 1W0VB 1WWAX 4HXAH 2VR9A 2LU4A 3FMGH 4KGLA 5T3ZD 2D7OA 3O81A 3LKSA 3U7WL 5FDWB 5EBGA 4MLSA 1OGAD 4FFWC 2VLKA 5CWSA 3NOIA 4KI5E 3F7QA 4Y4KD 5JHDB 3U9UB 2VJXA 1ETZB 1RULL 1T3FA 4LLQA 4DEPC 1OP3H 1BWMA 5HDQL 3QXDB 3B9KB 1FVCB 1CT8A 1FO0A 5T1DH 4D0BB 3HLAA 2AK4A 4MCYB 1P6FA 3HR5A 1W8NA 3LQAL 4YR6A 3BIKB 3TVMD 3VWJA 2J12B 5E00A 3RPIA 4M61A 4N0UE 1T1ZA 1TDQA 1DBJH 3IDIA 1OPGL 3EOYG 4ERSL 3MRCA 4Y8AA 1JGEA 5EN2A 1ES0B 3ARGB 3MBEC 1HXMB 5C0AA 4ALAH 1I1FB 3L5WA 4JFOB 4Q0XL 3NPSC 3MV9D 3G6DH 4P2OA 3NTCL 5T1DL 4D9QD 1LP9A 2YRZA 3EOBA 5ANME 3ARFB 1UZ6F 1PGRB 2NPLX 3C87A 3HAEB 4ZTOH 4QCIA 3CFBA 2WBWB 1XT5A 7CGTA 3L5HA 4JVPA 4HDIB 3KPOB 5DK0B 5FGRA 5HHXL 3LN9A 3MA7B 4LU5H 3I3DA 4EN3B 6FABL 5C6TH 5JXAH 1LK2B 4PG9B 3BPNB 3SCMD 5H94B 4P2QE 3HS0A 4PJDB 1MFNA 3BDBA 3O11B 3U1SH 4I5BA 3UXFA 3G6DL 4IIQA 1HYSC 5EZIL 3VGBA 1G6VK 1H3UA 4OF8A 1V3MA 3D39D 3VXMA 1EAPA 4H1LG 3QI9A 1BZ9B 3QAZC 3TZVD 1SMOA 4NNPH 4DKFH 5DDHB 1SY6L 1ZLWK 3MO1A 1RK0B 3MCKB 5C6TL 5D7SH 4RNRA 4OBSA 2X70A 1KPUB 4U1IB 4M6NL 1MSPA 1N8ZA 3HN3A 3SKMB 4AM0B 5ITBL 1U3HC 2W9DL 4DCQB 5DJZA 4S1SH 5IR1B 5MENE 5J3HD 4LOUD 1G1YA 1I3VA 4EDWL 1BECA 1A1OB 3DMMC 5IVXB 1ZA6B 5K9OA 3BRGC 4UV7H 4PJ9B 1LO2H 1M7IB 4JQVC 4ONHA 5GIRB 3W0WE 2BVTA 4NNPL 3ROOA 4DKFL 5TGBB 1PLGL 3CVHH 3VRJA 3OJVC 4NUJB 2VABA 5DJXB 5IFAL 2CK2A 1I1YB 5DJDB 1J0KA 4EDXA 5FO9B 4S1SL 5F8QC 3GMLB 3KPMA 3UBXB 3QO0B 2VQ1A 3C60A 4FQLL 3LSOA 5TQ2L 3T3PF 5GS1A 5EO0B 4YJZL 4X0KB 2EIEA 1J9CT 4DTGH 1IGIL 2GFBB 3RL2A 4RGMB 3U7AA 1DN0B 1QKZH 5D72H 1KTRL 2DBLH 2UUDK 3BWAB 4ZFGH 5IMLB 4POZC 1YNKL 3HNVH 5A2JH 1H5BB 4L3ED 3WIIH 3RZWA 4XNUH 2UV3A 2F74A 2VLLA 4PRHD 5DC0A 3BPLB 3R8BB 1NMBH 4GKNB 1WT5C 4FFYH 3ILPB 5HPMA 4YDVA 3EDJA 4XNQA 1BHGA 4YHOL 5CAYB 4CU7A 4WY7H 4WENB 3FQRA 4DTGL 3BO8B 5GZOD 5HYJB 2IBZX 4NP4L 4HJJL 5DJAB 4OIAA 3V79C 4TSAH 4X7EC 1VFAB 4XXDA 1JV5A 4LLUB 5TH2B 2DBLL 4JN2A 4OAWB 3MLZH 1QNZH 2JIXB 5J4MA 2J7LA 4JRWA 4ODSH 5IV2A 4BUGA 2VLJD 5EBLB 4XNUL 3K1KC 3ARGC 5EU3B 3IETA 2FJHA 1BPVA 3NCCB 2Y07L 1C5DA 5F6HI 1U3JA 2IPKA 4QOKE 5JW5A 2X1QA 4RQQA 4L4TE 1F45A 3QXVA 1F4YH 2APWA 1RJZA 4TSAL 1JCKA 1VA9A 2XOTA 3MRQB 3F7VA 5DMIL 5T3XH 2OK0H 3KPQB 3MLZL 3FT4A 5DD5H 4JZNA 1GOHA 3BUYA 4PJEE 2EE6A 5J13B 8FABB 3O0RH 2E9BA 4EN3C 1AO7E 2C4XA 1JF1B 5IVZB 1NEZG 1ZT4A 4PRBA 3BPNC 2RCSH 5IM7B 3RJDA 3TPUA 3BHBA 3PL6D 4PBXA 5CP3A 2C3WA 2H1PH 1J12A 2R8SH 1RSFA 1JE6A 4HWNA 2OBGA 1RZ8A 1IEBB 1ED3B 4ESKA 4XBGB 2UYLA 1S9VB 5IQ7L 1D5IH 1ONQA 3MNVA 1T83A 5T3XL 4PJIE 1WCBB 4J3OC 2EDBA 4KHTL 3B2VH 5E2UH 4WUUE 3OX8A 3O0RL 3RAJL 3SGEI 4WW2C 1KIUA 1JMZA 1IC1A 4JKKA 3G6JB 4BQCA 5BS0D 4ZUUB 5T1MA 1ADQH 3KLDA 4ZO8A 5T1LB 4RX4D 1I9IL 2R8SL 1QFPA 2BNQD 2P5EB 5CJXA 3A6BL 2R1YA 1YYLH 4GRLC 1EH9A 2GW5A 1YY8A 3NCBB 1U8MB 1UEMA 3TV3H 1D5IL 1FIGL 2Z8VC 4PJ9C 1FG2A 4YO0B 2P24A 5IB4A 4UNVA 3DV6A 4EI5A 1TCRB 1EZVY 1SQ2N 1Q38A 2F54B 4WV1B 1KYOJ 4U3CA 1IM3A 1AGDA 2AEIT 5FUOL 1CICB 5GRUH 4JHZA 4HIXL 4F3FB 1LWRA 4NO3A 1AQKH 1I85A 4XBEL 1F2XK 4PTUB 1YYLL 1NCDH 3MMEB 4EZMA 3MRHA 4WI9A 5C2BL 1A2YA 1VCAA 2UWEE 2VDQH 2X5PA 3E0GA 1UXSB 3RX8A 3RVXD 4PR5A 3OKDB 1OTUD 2P8PB 4ZXBA 2JJVA 3UPRB 4DKDC 5JZ7D 4P4RB 4XX1G 5I1LB 1H5BC 1ZLUH 1AFVH 1KGCD 3L7EA 3HA0A 1FAIL 1D9KC 1AQKL 1FBIH 2IANA 3CUPA 2F5AH 4KHXL 5J12B 3GHEH 4HH9A 1NCDL 2CUMA 2G9HB 2CLZA 1I8LA 1SM3L 3MV7B 2W60B 3QNYA 1FC1A 2GIYA 2FR4B 3FQXB 1QLRB 1I1RA 5JZ7C 2FEEI 4ODVL 5GS2D 4FA8A 2ZOLA 3VE0A 3ZDZE 2V2XB 4WI8A 3QDGB 2P42B 2WBKA 2BSSA 1JHLH 3PV6A 3OHXB 4OF3A 2D7NA 3QEGH 3EAKA 4PGBB 4IBLT 2EE3A 4FTVD 1FBIL 1IGCH 4WO4D 3QFJB 4Y16D 5DVNA 5E8PA 1KEML 2BNRD 3EHBC 4ZUWA 1H15B 4YUEH 5DQJB 1HCFX 5IB2B 3D69B 4FMFA 5C6PB 4ZS6D 2DI9A 3RWIA 5I73C 2W59A 4QRRB 3OKEA 3LMJL 2K1MA 4N9OB 4Y5XB 3VFMB 5K9JL 2B1HH 4LLYA 5DJ6A 2VXTH 5HGHA 3HCVA 3ZTJH 1R5IA 4I2XA 1FYTA 1CXFA 4KZDH 5DHVH 4NPYB 2VL5A 2J8UE 3WV0A 3L3IA 3MNZB 1SVCP 5H35B 1QRND 2XKNB 1ACZA 2VB5A 1VFBA 4MNHB 5D7JC 2GHWB 3T08A 5IW1A 4LDEB 2AXFA 3U46B 1J0JA 3GM0A 1C08A 3IGAB 4G9FB 4O5LL 3LRSB 4M5ZL 2ICEB 5HHPA 4LEXH 3ZKMD 4Z18A 2P49B 3QUZC 3OKOB 4NWTH 5MEPA 1U93A 2E5EA 3KPSE 3T65A 3AM8A 1Q9KA 4M7LL 1SBSH 2VLRD 5GISL 1G9EA 4MX7A 4MHHI 1Y0LB 3KXFA 5FDYA 3H7BA 4WJ5B 4Y7MA 1DL7H 5HHME 3ALWA 1JP5A 2GY5A 1RZJC 3MLWH 2GJ6D 4LPVA 1I7ZA 4CMMB 3P2TA 4M7ZC 2ZUSA 4ZOEA 3ZKMC 2Q3AA 1X5ZA 4WU5A 2VWEC 4KRMB 4LEXL 2Q6WA 4NWTL 3RJQB 4XAKE 5H8DA 3PJSA 3I84A 4WV1C 4M02A 3HRZA 5CMAA 1RAMA 1SBSL 3BD5A 1CICC 1XZ0A 4MDIB 4CVZB 3MNWA 4K9EC 1CGUA 1DL7L 3SQOH 1E27A 1P7HL 3GBMH 4PRNA 1AY1H 4K8RD 4JFDA 4KKBD 1QSFB 2BXZA 3ULVC 3EO0A 5F3BB 1Q72H 5MHSE 3I6LD 5F93C 4TPRH 2EDNA 5C09B 5SV4A 1RJCA 3T77B 3V95A 4PJBE 4ZFOA 4A6YH 4ZAKB 5C07B 3GK8H 4U1HA 3TLRA 4Z5RB 2VDPL 1BJ8A 3BKJH 5EUKB 3VXUD 4ZYKA 1G0YR 4HGMA 1KNOB 1ZEAL 4MCZA 1IVLA 5I19H 1Q1JH 4U1JB 3GB7A 4WFEE 3GBML 3N9GL 3SKNB 2VQTA 1S7WA 4LLAA 4PTTB 1VFMA 5I16B 1ZTXH 3RWGA 4OCRH 1S7RA 5D7IF 2H26A 3DECA 3QUMB 4RA0C 2OTUA 1Q8MA 5HYSB 3OF6D 4IMKC 3MRRA 5J1AB 5ERWB 4R2GD 4RGNE 1A7RH 4PJDF 1UM4L 3DARA 3T0BA 1TJIH 3WLBA 1VENA 4GQ9H 1WZ1L 3WCYA 1PBYA 2E6PA 5TDOA 3ZDXE 1QSZA 4G6FB 4CADB 2MQ3A 5IROC 1Q1JL 4F8TA 4FQ2L 3T09A 3DRQB 5D2LE 3RUGA 1T04A 3IRZA 3ZMRA 4HUUB 4HXBH 4K3GA 1I8KB 2E6QA 4UUJA 5EC1B 4M9PA 4OCRL 4CVUA 4GKSB 3C08L 4CMHB 4OV5A 5EU6D 2GTWA 4Y5XC 4ELMB 1N7ML 5LXGH 1ZS8B 5KOMC 1EO8H 5T5FL 1A7RL 4LLMB 1HI6B 2XNAA 1TJIL 4GQ9L 2FJGB 5EIQA 2V5YA 3OJ2C 3TT3H 1VADA 4I77H 3X14B 3DUUB 1CYGA 2XRAL 4U6TA 2NY6B 5IVXF 3TYGH 1O5DT 5I1JH 4QXTA 4KK6C 1JTPA 1DUZB 3RA7H 3S8WA 2DKSA 3BT2L 3QULA 4HMDA 4W6YB 4HEME 1IGMH 4F2MA 1XR9B 2HRLA 5EWIH 5LXGL 1CE6A 2DQGH 4DZBA 3RY5A 3ZE1F 4BH8A 3DYOA 4Z7VE 3P73B 1E4XH 1NFKA 3O45B 2H9GA 2C1PA 1FLRL 5BMFL 4JJ5B 2AV1B 3TT3L 1UM6L 3SE3A 5I1EH 1MRDL 5FYLD 1MIEL 4XNZC 2VL4A 1DTUA 5FK9A 5HI3C 2UVFA 1U8OA 2WWMC 4PB9H 5E9DB 4JB9H 5DTFA 4PJFE 1RUQH 2WQ8A 5D6DA 4DJMA 3N1PC 5FXCH 3LY6A 3BDYH 1XGPA 4UV4H 1WAAA 1KTKE 3IJSB 4LNRA 5IMKA 2IADA 2GKIA 4KI1A 3MPCA 4XC3H 3TBWA 1M71A 3U4EB 2FBOJ 3NAAH 4KQ3H 2NZIA 5TPWL 5FFLA 2H41A 1YEKH 1IAKB 4F9LA 4MQXD 5I1EL 4F7MB 1DCLA 2XZZA 2HTLD 1FGNL 4OZFH 4PJCA 2OLDA 4PP1D 5IB1A 5FHAH 4PB9L 1PD6A 3O9WD 3CVHA 1UG9A 5DQDH 4QT5B 4QY8B 3E3QC 3RNQA 3ARDD 5BJTA 4JQXA 1ZHLB 1T21A 4LDLB 4GRWE 3BDYL 1MVUA 5T3ZE 4UV4L 1KLUB 4LNVA 3DVNB 1G6RH 3OR7A 3BN9D 4G6AC 2EDOA 4KUCD 1FV1B 4XC3L 5HYQB 5SWZA 3RNKB 2BHYA 4K3DH 3TBSA 3RP1A 3GGWB 1YEKL 4PP1C 3WNPA 3PIQB 5DHYA 1TVHA 2X40A 5B39B 3HNTH 1EFQA 5FHAL 3RIAK 3SE8H 1TZIB 3TYFB 4JQIH 1OAUH 4PD4J 4AH2B 1TJHL 3REVA 5C0BD 3UYPA 1A9EB 3W82A 1NGYA 2APTA 2CDFA 2IBGA 4J8RB 4XCFH 1XAUA 2E27L 2XWTA 2YPKB 2H32A 3OKMA 5DMGD 3GO1L 4K3DL 4NQSB 3QDJB 3X3FH 2BSRB 1ITBB 1OSZA 3V2AR 2ICWB 3FT3A 4D9QE 1KPRB 3F12A 3G08A 4I3RL 4O02H 3FHAA 1UACH 1N4XH 4KZEH 4F57H 1V7NL 4R3SB 2A9NL 3SDXE 3ULUD 4G8GA 4CMHC 5E6ZA 1KB5B 3KPRD 1KJ2H 2JK5A 4U1LA 5DS8A 2R9HC 2YD1A 5ISZB 4XCFL 3VRIA 2CKBH 4OZIE 1FNEA 2FD6H 2FBJH 5DUPH 4AT6B 4S1DC 3X3FL 1I7TB 1AXSB 3QQ3A 1N6UA 1U8LA 2VIRB 2Q76A 5C0DB 4WWKA 3S37L 5E56A 4J3UA 1TENA 3AY4C 4HCRH 3MV8B 3LN5B 5FB8B 1CGWA 2DYPB 3D3VD 1UACL 1T7WA 3K1DA 5EZLA 3UTTD 4GBXD 4L4VD 4LRIC 3IXAA 5AAWA 1KACB 5MERB 1KJ2L 3GSQA 1CU4H 2FD6L 3S36X 2XA8H 5DUPL 5LGHH 2F5BH 1NAMB 5ALBH 2X05A 4FN0A 5I8CB 1LE5A 1BJMA 1KJVB 5ADOH 1JZ6A 2EO1A 3GMMA 1JWSA 2Z93A 4YZFE 2A6KA 4K94L 4M03A 4BSVA 4N0RA 4Y0GA 3ULVF 3SBWA 5I1DB 3GMRB 1TETH 1FDLH 3GNMH 4P3WA 5KSUB 5F9DC 5E8OB 1A7NH 5DD3H 4KROB 1E28A 3O8XD 2MKLC 5IEHA 3CFCL 3PNWB 4H1LB 4JVUA 3SJVB 2XTJD 1BD2B 1CU4L 4PJHB 5D5ME 3V6ZA 4BFEA 3K2MC 2X4QA 4OFPA 1NANH 5EOQL 2F5BL 3SE9H 3GRWH 4NKIL 3MRJB 5J0BA 4FXLA 5IB5A 1QSEA 5ADOL 1UXWB 1HOCA 5F7NC 2DBJA 4YHKL 1UJ3A 5ALCL 5IFJB 2FL5B 5D4QA 4PJGA 5EU5B 3D9AL 2X4SB 2P5WA 4MXWL 4D0CA 9CGTA 2NXYB 4E9LA 2R2HA 3CSYA 1TETL 1FDLL 3RY4A 4LHQB 2XTJC 3UTZB 3I6KA 3L3GB 5IQ9A 4PPTA 5TE7H 4J7RA 2DQFB 3BEVA 5E0QA 4WI5A 3PGCB 3WUZA 4LFHG 2NTFA 3CLEH 1KCRL 1Z0NA 4GMTH 4PRHE 4M7LT 1DQDH 3WIFA 5BV7B 3MGTA 2ZOKA 3P4NA 3K8KA 1CTOA 3B6SA 3IXTB 4JCLA 3HC0A 1ZT7A 3EYOB 5EUOB 3PWJB 4JZJB 2BY3A 2WK2A 4OQTH 4HJ0C 4PY7B 4I3GA 5MEOB 1SJEB 4O2CA 5F7HA 3MFFA 3FOMB 5TE7L 3VD3A 4DZ8B 1IC7L 3AAZA 1WWWX 5IFHL 2VLJE 2VXSL 4NQED 4YIQB 1HIML 3CLEL 4N0UA 1N64H 4IRZH 5GZND 1DQDL 4IRJD 4JM2A 4LIQE 4LAQH 4QRPB 1T6WA 1L6XA 5E1HB 3JTSB 5D1ZB 2C7UB 2E9IA 3G6AA 3NACL 2XKSA 3K4ZA 4RAUB 3RIFK 4LCWD 3A0OA 5I74C 2WIIB 2ADJB 4H8WL 1QLEH 3FO1B 2B8OT 3VFPA 5FEBA 5C0IB 4OQTL 1HH6A 2ZUVA 4RRPG 3QXUA 2DD8H 2B2XH 1MLBA 3SDDA 4E41B 1SYVA 3NCYP 3DO7B 1J8HB 3BJ91 3T04D 4I18B 3H9HB 4PRPB 5ID1B 1BIIA 2OL3H 3SEPA 3X17A 2EYRB 5JMOC 3AUVA 1UM5H 5HDLA 4ODBD 2X9XA 4P2QA 1H3PH 4J6RL 1BAFH 5E6IB 3VFWA 4HKBB 1MFCL 4KK8C 2DI8A 1B6UA 3KYOA 5E8NA 3T8XA 1YZZA 4GG6E 5JW4Q 3MUJA 4O2EB 1NFIB 5FO7B 2CDEB 4O00A 3ARQA 5DHVA 1YUHB 1FH5H 1W0WA 2B2XL 2G5BB 3CZJA 4RIRA 3JV4B 1SEBA 2IC2A 3LEXB 2CIIB 4U3XA 4LSTH 4EKXA 5BS0E 4TRPL 3MCLL 3CDGB 4UU9B 4GS7B 2H2PC 2OL3L 2AQ2A 2Z35A 2BNQE 4KJQC 3KWWA 1UM5L 1JVKA 4O2FB 1MFBL 1RURH 1RQ5A 3V6FA 1H3PL 5GRXG 1E6OH 3VI4E 4Z6AT 1DLFH 3CH1A 5MENA 3GI8H 4PJ5D 4JO1H 1MELA 4KROC 2ESVA 2GY7B 2YPLB 4BZ1H 1NQBA 3SGEH 4P4KB 3QUXA 1FH5L 4G3YH 1YEHH 5KSAD 4Z7QE 4LASL 3PP4L 4LSTL 3W0WA 3DTXB 5GGQL 3MV01 1EMTL 3OQ3B 3QQ4A 2X89D 4TVPD 1SBBA 1XF5B 3OXRB 3K46A 3AS0A 4HIHA 1B88A 3U79A 5JW3L 4RDQF 3W39B 2ATPB 2B39A 2GK2A 4GRWH 3SY0B 5T3ZH 5MEQA 5BO1L 3QIBB 4PV8A 2RFXB 4Z78B 4HLZH 4R0LA 1MCQA 2F19L 4JKMA 5IG7B 5D93C 3V4VL 1BQHA 1JPGB 2EIZB 1DSFL 2V2WB 4JR9L 4MGXA 4BZ1L 2PYFB 4O51A 1FN4A 2CR3A 2MQCA 1MREH 4NO2B 2F53B 1KGCE 2ZNXA 5FKAA 4NFCA 4M48H 4PRDA 3VWKB 2W0LA 3LD8B 1OP5K 4Q58C 3V5DB 5L2JB 5KS9B 4X6CE 4OD1H 1BLNB 3V5HB 2F58H 3CZFB 4YX2L 1MQKH 3CFEB 2VISB 4AEIL 2HWZH 2J5LB 2NX5E 3NCYS 4POUB 1P1ZA 5B8CB 4HGKC 2B0SL 4JZJC 2ICES 4A6YA 3IDUA 4OF6A 4NJ9H 4ELMF 2A38A 2ZUUA 1ND0B 1EEZA 4Z7OE 4AL8L 1N6VA 1UKSA 2FH6A 1MREL 5EC2B 4MQ7B 4KK9C 4E0RA 4MA3B 5DWUH 5M7QA 1R5WA 4WI3A 4JPKH 4W4OC 4FTVE 3T0EC 3TBVB 1QQDB 2BNRE 5FA4A 1HSBB 2ZJSH 3IFOA 5D1ZC 4P2RB 1B3JA 1WZLA 1DVFD 1K5NA 3B83A 4M6OH 5D1XB 1RI8A 3NFSH 1RZIB 4WCYH 2E7HA 4M6AA 1QBMH 3MGAA 5KVMC 4QOKA 4IRSD 1J1OH 1G9NH 4P46B 3WUWA 1CE1L 4H26B 2BVPA 1P2CA 4XAWL 1J05B 4JPKL 2PXYA 2ZSVA 3JV5A 4XMLH 1DVFC 2NY4B 5ESVB 3EFFB 1K85A 4B41A 2ZJSL 5DJCA 1QRNE 4LCUA 4YDIH 4MMZC 5EBWB 5F1NB 3WO4C 4WCYL 1YNLL 3OZ9L 2FEEL 2A77L 1MJ8L 2UY7A 3MRNA 2F8XC 1EX0A 4X4ME 5LGKA 3M17B 3VRLF 4M4PA 2Y7QB 4XI5D 3DX9A 5CBAA 4MMXC 5FM4A 3QIWB 4RBPH 3SDAA 4PJ7E 4QHLB 4YHNB 3FB5B 4Z76B 4PJIA 1AGCA 2E7MA 4MSWA 2VLRE 3WN5B 5IBLD 3GI9L 1PY9A 4XMLL 4WUUA 3H9SA 4GS7C 1HH9A 1YPZB 2AJZA 3I02A 1JWUB 3UX9B 3P0VL 1X5FA 2P43B 2GJ6E 4Y2DA 4MNQD 5DA4A 1ERNA 4ETQB 1AP2B 2HRPH 3ARBD 1IGFH 4RMTA 2E8ZA 3LPWA 2FO4A 2VDOL 3EO1B 3OAYH 2EECA 4MJIA 2A9MH 3L3DA 3CJJA 4P4KC 2YUVA 4J1UB 1XIWD 3NA9H 1DQTA 1I8MB 3NZ8A 1FNGA 3GIZH 4XCEA 4QYOB 5EOCJ 2R0LL 5CFHA 3RL1A 4GG8B 2R4RH 1U6AL 3VFSB 2UY6A 4W68A 1C5CL 2RQ8A 4Y4FB 3WNKA 4JDVA 5CJBA 2CDGB 2P7TB 3BQUA 1LO5B 3TN0B 4CGTA 5KVDH 4U6XB 3QIBC 4AIOA 1IGFL 3I6LE 3QA3A 1CFNA 2WM0A 4HAFA 5DRWB 4MWFA 4JZOB 1JL8A 1T1WA 1NC2A 3UJTL 3DRTB 2YOCA 5EU7C 2IG2H 2I5YH 3GIZL 4N8PA 3IS0X 2LE9A 3S34H 1DBAH 3VXUE 3FTGB 3LD8C 4FQHA 4NSKB 1OAKL 2Z91B 1GIGL 3IS1X 1HHGB 3EDEA 2DMKA 3LH2H 4JFED 1CG9A 3U9PH 2GT9A 1OARH 3GMOA 4L8SC 2BVQA 5KVDL 1XFPA 2J5LC 2P8LB 4ZFZB 3KJ4B 1G6RA 3B2UD 5B8CC 1XH3A 4S1QH 5IMMB 3K4AA 2A6JA 4LIQH 1ZHNA 2E7BA 1KFAH 3HE7C 1OQXA 5BVJB 1ACYH 1X7QA 4HULB 3FL7A 4DOHB 1T66D 3QHFL 4S0SD 5D7LB 3NBNA 2Y5EA 2YUZA 2AQ1A 2DWDB 3CVIH 3HPLB 3QCTH 1Q9WB 1W72H 1FVEA 4FG6C 3O2DA 3LH2L 5CJ8A 1YQ2A 3OB0K 3ESVF 1Z9OA 1J1PH 5D1XC 3T0VA 3TCLB 5CHNB 2VLKD 5JLZB 5A2FA 4GXVL 3TA3B 2FWOA 5EU6E 3EZ8A 2V5TA 4PGZA 2MHAA 2AK1H 1U2HA 3B9KD 2D03H 1ACYL 4RMWA 1ZA3A 2HLAB 4P59H 2AK4D 4HC1H 4XZUB 3K4DA 4ODHH 1J86A 4JRYB 1Z0MA 3VWJD 2P8MA 1EFXB 1IM9A 5I8OH 3EGSA 3UZQA 1TMCB 4RSVA 2NLJA 1QBBA 2VE6B 5D6CA 1FFPA 2A1WL 2UVEA 3WIHL 3VXRE 2VRAA 4U6VH 3STLA 1GSMA 4TNWF 2CKBA 4R97C 1QR1B 1YQVH 4FP8L 32C2A 5C0AD 4Z7NE 3I9GL 3L5XH 3ARUA 4Z9KB 1XMWA 4PJHF 2YD5A 2IPTL 3VWJC 4HC1L 4U6YA 4I13B 3ECBB 3QIWC 5IMOB 1FL6B 4HCRA 4JPWH 1J11A 4UILH 3WN5C 2JELL 1IQDA 5DT1L 3MXWH 3MRLA 5FYLE 1DUYA 2PO6B 4X7CC 3SGKA 4HUVB 1DEEB 5FHBH 5F1IA 4YHIB 5L2KB 4P2OC 5KVGH 3IU4H 2R0KH 3BKCH 2DTSA 1RMFH 1G7MA 1F00I 1Q94B 5DVOA 4L5FH 1JYWA 4F8QA 3ZTJG 4R26H 5L8JB 1KV3A 4R4BA 3VXMD 3NFPA 4UILL 2Y06H 2X1PA 3HI1B 3C5JA 4EJ1C 3QEUA 1F13A 4LVOB 5I0ZA 1JZ4A 1JN6A 2V9QA 2H8PA 1CR9L 3KPNB 5EUOF 4Y4FC 5D1QA 3PDOA 2XICA 3O4LB 4F15C 1AQDB 3TN0C 2GSIB 5KVGL 3IU4L 5F7MC 3GRWA 3MR9A 2MCPH 5A16A 1NC4A 5EORL 4DVBB 3AVEA 2FIKA 1I3GH 5FYKH 1R0AL 4Y88A 1JYNA 4DUXA 1X5GA 3QI9C 4NRZA 1FJ1B 4LSDA 1F3RB 2L7UA 3L5JA 4G6JH 5CIPB 4QRSB 2WBJB 3R0NA 4ZG1A 4QTIH 4LQFL 4QRTA 5GS2H 1T1XB 3MSPA 1MCWM 2AP2A 1F6AB 3MYZA 3FFCB 1MJUH 3VD7A 1NDMA 4JPIB 3MUHL 5HGBA 2YK1L 3KJ4C 3NIDE 5J06A 1CF8H 4WW1A 2HVJB 1MHEA 1BQHG 3BGMB 3C60D 3LKQB 4OGYL 3TJHC 5CD3A 1NSNH 1QFUL 2HT2D 3VFNB 2EDDA 2O61B 2YWZA 3FN9A 4G6JL 4CU6A 1G7LA 1T22A 3Q2CA 4NO0B 1CZ8H 4KXZH 2IAMA 2QQKL 1A7OH 2DWEA 4QTIL 4DW2L 4EBQL 2CD0A 2Y9RT 5HGAB 5C0EA 1XF1A 5BOPA 3I75B 1F3JA 1HEZA 3RWFA 1YY9D 1UKTA 3DBXB 3I6GA 3ULUE 1JNHB 3TA3C 5D2LA 3VXSB 4LCYA 4K7PH 3KPRE 5SV3A 3QG6A 4N0FA 2XWJB 4PGCA 4OZGE 2O5ZH 4JFFB 4PR5B 4AENB 1ZGLA 1GOGA 2Y6SC 5D2NE 5I17B 2VDMH 3FCTB 1AXTH 5ACZB 4YNYB 1UZ8B 3QXAB 3KS0J 4PRIB 1HKLH 3TBTB 2I9TB 1X9QA 2VR4A 1RHHA 3IDGB 3D3VE 3RX5A 1C5BH 3QDME 3RKPA 1FNSH 2Q8BL 1YMMA 3VGGA 3UTTE 4L4VE 5KAQF 4LVNB 3VFUA 3D18A 2Q86B 4JJHA 4KKAC 5DVKA 1YC8A 1X6LA 5I18L 5BRZB 3HI6H 3HMXL 5ACMA 5AZ2H 4JFYA 2WLYA 1FL5A 2O5ZL 4KK5D 4PGEB 1LEIB 1INDH 4MXQC 2JJSC 5I15H 2CGRH 3ZKNC 1AXTL 1R3IL 4JAMB 4XVUD 3M45A 1RZJL 2XN9B 2YD2A 1HKLL 3BRDA 4Z7VA 2PO6C 3TC9A 5E94A 1TNMA 5CP7A 2XZQH 4NQCA 1U8QA 3CFIC 2QL1A 4PP2B 2JB6A 4KJPC 1NUNB 1HXYB 4G7VH 4RFNC 5FCUL 1BX2A 1T20B 2OI9B 2PYEA 5D70H 2NZ9D 1U91B 2NW2B 4RMQA 1BQLH 3HI6L 5DRXA 1CIUA 3UP1A 1UWXH 1RJYA 3RGVA 3GSWA 1UZ6E 3GMNA 3S4SG 1ZSDB 5EPMB 2OJEB 1INDL 3NH7H 4K8RH 5I15L 3CLFH 4P5MA 5KS9F 2EH7L 3FRUB 2R56H 5BCAA 2W9EL 5J9PA 2AEPL 2CQVA 4HQQH 3EDDA 5LGJA 4LVOC 2XZQL 5F7KC 3PHSA 1A3QA 4MB3A 4F7PA 4PJAB 2DQTL 3VJ6A 1NAKH 3HUJB 3WEXB 4AIZB 5L6YH 3QJFA 5GSRA 5T1LD 5HHVH 3W9EA 3BZ4A 3L1OL 2P5ED 5D70L 3BRFA 4U1GB 3OJDB 5CBEA 1BQLL 4YHZL 2QTEA 1O7SA 3NCJH 1ODAA 3MJ9H 3PV7A 1NGXA 3L6FA 1B9ZA 2FZ3B 4HUNB 3QXTA 5IHLB 5J1SC 2BZDA 3NH7L 3SKOA 2Q1EA 2R56L 1I3RB 1R3KA 4HIIB 4L3CA 2WBJC 3BP4A 1S7UB 2HMIC 4EI5D 1NDGA 1NGZA 1S8DB 2YZ1A 1JPFA 2NY1B 4QWWD 4PFEA 1WFUA 3IVKB 2Y25A 3DIFB 2CRZA 5L6YL 5DJ0A 5AD0A 4AY0A 1CIDA 3OAUH 1S7TA 3QPXH 2ADFH 4XWOD 4X6BB 1GYAA 2BFVH 4NQEE 1PZUB 2FECI 4LLWA 3IDNB 3ROLB 4EVNA 3H3KA 3ES6A 1G9MC 4XBPA 4OZFG 3RY6A 3BZEA 2X42A 4JLRB 3TFKC 2ZNWA 4AQOA 4ZXBD 5IWLA 4LCWE 4WEUD 5FF6B 5L9DL 2JCCB 1PYWB 1OB1B 2GITB 2HT3D 1CLYH 2K3TA 3MLYH 3WNMA 1I85C 4GJTB 4XWOC 1JGLL 2NY3D 2FEDC 4LCIH 3JXAA 2BFVL 1IL1A 4M1CC 5FYKU 1H9VA 1GCFA 4AG4L 4Z7UB 2P1YA 5HHQB 4YXLL 4FXGA 1YPZF 3O6FB 1JNNL 2J6EA 3EYSH 4CVXA 4JG1L 3DHMA 4OZIA 4DFHA 4ZSOE 5DF0A 2BJMH 4ONFH 3QDGD 3JUZA 5IF0A 5F3HB 3M1BA 4AQ1B 5TJWK 1CLYL 3MLYL 2R2EB 3HPJA 2NY3C 1UYWH 3SPVA 4XGZA 3EDKA 4S2SA 4Y19A 4CL7A 1CDUA 1RIUH 1MHHA 4OCWH 4B50A 3QNZA 3VXTA 5FYLH 2X4PB 3KLAB 3TZVA 3HG1A 4NBZB 4F37F 3VXPB 2C4FT 2BJML 4R7NA 2AEQH 5E5MA 3HMWH 2NR6C 2GTZA 5F9OH 4HMEA 1M7DB 4PJ5E 2GEEA 43CAB 1CFTB 1A7PH 1FYTD 3F58H 4TUOB 2VDNH 1XCTB 2OI9C 3WXVH 3Q6FA 1RIUL 1A4JB 3AROA 1ORQA 2OXGA 1WWBX 4HKZB 1B2WH 1HHIB 4U1MB 4KUZH 4X4YB 1EGJL 1B0GB 4OLYL 4FQJL 3PWPA 4U1SA 1A7QL 2HFFB 4UZGA 4TVPE 3UC0L 1J10A 1OAXH 3IFLH 4G9FD 4OJFL 2HTKD 3IDJB 4MA1B 2JJUA 1KIRB 1MLCA 4XHQA 4QHNB 4QKXB 5F9OL 1JPTH 2Z31A 1LHZA 5LBSL 4ZNEA 5KJRH 2YC1A 1A7PL 1FVDA 3O41B 5A40E 4HK3N 3BAEL 3KXFD 1HNGA 3BIBX 1YMHB 3H9ZA 1B2WL 4KUZL 3QPQC 3S35L 3WMSA 4LL9A 3IKCA 1LMKA 3MRDB 1P7QB 1OAXL 3HZVA 4AIXA 3WXWH 5DJYA 4OUUB 1R3JB 2HKFL 3AM8C 2OZ4A 4OGXH 1EZVX 4OFIA 2DM2A 5KJRL 1IBGL 3QUML 1INEH 4O58L 5GRVK 4UT9H 5ESQB 3QDHA 3TO4A 3C6LD 1W8OA 1OT2A 4NDMB 3JVGC 3IAQA 4PB0H 1GZPA 3H3PH 4JFDD 1PQZB 5INCB 3VFTB 3GSVB 4IOFC 4F7CB 3T4YA 3ULUH 1H3WM 2ARJQ 1NBVH 2BHUA 4Z8FH 4HJGB 1ZLVK 4AYFA 4K3EL 4Q74A 3HE6B 4Z7WB 1G7HB 4I3SH 1IT9H 4H25A 1QFWH 5JORA 1W72A 3F7RA 5C0RH 4C83A 3MOBH 4YXHH 4PB0L 5F1SA 2D31A 3VDCA 3DXAE 4N1CA 2CPCA 2CSPA 4GW1A 3ULUL 3OR6A 4Z8FL 2WWKO 1GJIA 2FB4H 5HPOA 3HC4H 5CEXB 4X98A 1NFDB 1KIPA 4H0GA 3LQAC 3V6OC 1S5IH 5DHYB 3GHBL 4WI7A 4I3SL 5HGDA 5ICYA 1NLBL 3V4PH 1NBYA 3GMQB 1ZVHA 3HZKB 5JW4N 1WZMA 3KAAA 5IEKB 1HNFA 4NRXA 1EUTA 2FB4L 2HJLA 1CLZL 3HC4L 2FATL 4X7SH 4KY1H 4MNQE 3B9VA 2Z8SA 3B9DA 1YEIH 4XWGH 1PJ9A 1BBJA 3RZCB 1S5IL 2BNQA 4X83A 3VG9C 4P57A 3FAWA 3FB8A 3VI3F 3G08B 1GGIH 4GO6B 4I8DA 2WQRA 4HFWB 3ZKXB 5HI4C 4I1NB 1AKJB 4OCXL 2XY1A 4OGAC 4DKEL 1Z9LA 3KDMA 3VRIB 1IAII 1CFSA 4BFIB 1TTFA 15C8L 2GJZB 1HZHH 1QVOA 5FGCE 3ZHDA 4G8FA 4QXUH 5JO5B 4UQ3A 4BQ6A 3NABH 3HRPA 4LLVA 4IHOA 3DUSB 4PYGA 3B3IA 1SJVA 4UTBL 5C9JB 4KFZC 3S37X 3V0AC 1NMAH 4DGIL 4LKCB 3BXNA 2X4RA 2R69L 3BH9A 4OB5L 2OYPA 3DVFA 2XPGB 1KF9B 1DQJB 1IGJA 1TQBB 4PS4H 4EUPH 1JZ3A 2NY5C 2XWBA 4UB0H 3WFCL 3OXSA 3L7FA 1CWVA 3G5VA 1NCBH 2FX7H 2Z92B 2X1XR 3C9NB 4OF7A 4XRCB 2ICCA 4H20L 1HZHL 4M1DH 3BH8A 4M5YH 4C56B 1XF3A 4JDTH 1KENH 3NABL 4X6CA 3MRPB 3WS3B 4KMTL 5B38A 1DBBL 1T2XA 2X6MA 1XGRA 2DOCA 4JG0L 2NW3B 2NX5A 1OTTC 3KJ6L 3PDDA 2AV7B 3VW3H 2ITCB 4LSQL 4PS4L 4QRQB 4UB0L 3TIEB 3RTQB 3MYJA 5F7DB 3F62A 4GXUN 1NCBL 1MWAH 3GMPB 3C6SA 4HX1B 2V2TA 4HV8A 4M1DL 1JGVL 4HLZG 4WHTA 3G5ZA 4PG2A 3ETBF 4LP5A 1QSVA 1E4JA 2AXJA 4G8EB 3O3EA 2VLKE 35C8H 3ABZA 4Y16A 5SWZD 1INQA 4D3CH 3U0TA 4FZEH 4APQB 4Y5VA 1BZ7B 4MB4A 4HMCA 4RWHA 5C1MB 3BZFB 1R3HB 4RGOH 2AK4E 4LCCB 4MAYA 1G7PA 2DJUA 1NL0H 2X9YA 1WC7B 1ZHKB 4JQXC 1AD9B 4G42B 5I66A 5IQ9B 2CRIA 3O3BA 4L1HA 1EVTC 4K3JL 3CK0L 5DI8A 2UZIH 1X5HA 4NKMB 3BMWA 3DETD 35C8L 3CFJA 4U49A 5GRJH 4S11A 2AJXL 2ZOKB 2I24N 4WFHD 5C0AE 3JWOH 2I9LB 3HC0B 1RUKL 3UYOD 3K0WA 4XNXH 3LKPA 1X5IA 1LP9E 1QFHA 4TTGA 1NL0L 3LEYH 4X4MA 1E6JL 5L7XH 2HT4C 2DQEH 3C09B 1KYOK 2BOBB 2YXMA 5D7IE 3DOSA 4G8GD 1I4FB 1S7QA 5MP6H 4ZFFA 2FJFA 5ISZD 4PJ7A 4X9BA 2NXZB 5CGYC 5B22A 5CZXC 4YDJB 3VGAB 4PJAF 3C8KB 3MRKA 3HUJF 5CEYA 2W91A 5GRJL 4PJDE 2YRLA 4IMLA 3WFDH 1YC7A 1KTDA 1BBDH 3S3JA 1U9KA 2V7NA 1HQ4B 4WWKD 5GRWA 4XNXL 4TVPH 2X7LA 3P4MB 3AREB 4K71B 3VXME 5LWYH 4URTB 4KJWD 3CX2A 5EDXA 2DQEL 2FYYB 5ANMB 5I1AB 4ZPVB 3TIDA 3H8NA 5C8JA 3RX7A 1ORSA 5I8EA 3BGAA 1S7SA 3QUYB 4U0RB 1UQSB 1T7ZA 5J56B 2FX9L 4YPGA 1OD7A 1FCCA 5J7CC 4HBQA 5H2BB 1T1YB 4WDIB 4CNIA 1OTSC 5GGUA 1OSPL 1T4KB 4CU8A 5HHOA 2CMRL 3VGHA 5IKCA 5LJYH 1YEGH 5A43C 3QCUH 1UWEH 3GSNA 3HB3D 3BZDA 3QZWA 1PZ5B 4KTDL 5C86A 2QSCH 3ZL4H 3BPCA 1RZFH 1TQBC 1MOEA 4NKDA 4WUKH 3LZFL 1GGCL 1MFAH 2EC9U 3KNBA 3DX8A 2JCCF 1AJ7H 4L29A 3ZE1E 4P23A 3VXUA 3D85B 1Y6KR 4MS8C 1R6VA 4OIIL 5AUMB 3RI5K 3TNMB 1G7QA 4P5TB 1QSED 2QSVA 1S78D 1RZGA 4XCYB 3LRGA 2EDYA 5FGBA 1TQCB 2QR0B 5DK2B 4L4JA 4M93B 4MHHG 1CGSL 1CLOH 1WISA 2NXYD 5FGSA 3VMOA 3QCUL 1UWEL 1MNUL 2LV4A 3MLRH 4Z7UF 4OLUL 5ETUA 2QSCL 4NM4L 1F4XL 1CFQA 2HKHL 2VN7A 1TVBB 1QFOA 5GJSL 3ILQC 2YXFA 2I25N 1HHHA 2J88L 1DLHB 5F72S 2O26U 1QLFA 5JDJA 2OJZH 3D2UB 1KG0A 5DEGA 5ENWA 3FFDA 1UJ3C 1DQMH 4H5SA 3PWUB 3S88H 3THMH 5FOBA 1CDJA 1R3LA 2QBWA 3WJLC 2EDRA 3MLRL 4LHUA 4LCCC 5HGGS 5IW6B 1FPTH 4YDLB 3N1QC 3O3AA 1KTLB 4TOYH 4DK3A 3OJMB 4X8JA 3MRBA 4OM0H 2IF7A 4KRNA 5B3NA 4GLRI 4ODUA 4XVTH 3VMNA 3CD4A 3K7UA 3BFOA 2WINB 4J12A 4X5WB 1DQML 1OGTB 4JM2D 2JJTC 4KI5C 4XP6H 5IK3B 3VXRA 4I48A 3VCLA 3EJZD 3FQUB 5DSCA 2YD6A 3STZA 3U6RA 3BE1L 2ED8A 2R0ZL 3QUKA 5FUZH 4HK3J 4GUPB 1KLGB 1DP0A 3O6KL 3C09C 4L8CB 4IS6A 4OM0L 1SJHA 3S7GA 3KR3H 4HS3A 3F7YB 2NXZC 2YD9A 3SDDD 1H0DA 3VGAC 1J8HD 1EVUA 1UCBH 3IB4A 4PRPD 4XP6L 5FOJA 4F80A 4TYUA 5C0CA 4WU7A 1XCQA 3PE9A 4YDKL 3X12B 1EO5A 5E8EA 3RWEA 1P4IH 2IQ9H 2B7DT 4K71C 2NY0D 3FZUC 3D48R 3OGOE 4LGSB 3UJJH 1BFOB 4L4TB 3DROB 4RFEB 3GIVA 3WD5H 3GUTA 2EZ0C 1W2KT 3SDDC 3IFNH 4OTXL 3KR3L 1KBGL 2X1OA 4U0RC 3MRGA 4WGVB 4TNVK 4PJEB 1FHGA 1TTGA 1I75A 1NGQL 4JHWH 1AO7B 5HD8D 5E2TH 4FQQB 4M9OA 3G9VA 2P5EE 5CILH 5I1HH 3MGOB 3P4OB 4K23H 3ZYZA 1M05B 5TF0A 3AU1A 2APBA 5DD1H 25C8L 3RDTA 3GSXB 4KWUA 3UJJL 2R4SH 2AI0L 3ARSA 3ZDYE 3P0YH 4NZUH 1VKXA 4M43L 1U8KB 4GAGH 3VFGH 3S4SB 2ESVD 2D0HA 4KTEL 3QUXD 3MLVL 4BH7A 1U8HA 5KANI 4WUUB 4Z7WF 1QUNA 3BVNA 4TUKH 4JHWL 3W0WD 3DGCR 1PX3A 4P5TC 5CSZA 1MHCB 3SE4A 1P4LB 5H37H 5I1HL 5HYIA 1UB5B 3RVVC 3GZKA 4K23L 4OUOA 2CLVB 1TQCC 3KPLA 1LEKA 4OF5A 5HVGB 2Y5TA 4KRPB 4R7DA 1LGVA 4X7TA 1F11A 4NHUB 4NZUL 1TLKA 3QUXC 4L8BB 3V7AE 1V3LA 2C3XA 4FQIL 1UADC 1K2DA 2ARJA 5E1AA 3TJEH 1NFDF 4ISVB 1FO0H 2J8HA 2VLMD 1OAZH 3VWKD 5JQHC 5B38G 1K4DA 5FM5O 3RWJA 2Y36L 1O7VA 1JPSL 2IQAA 5I1IH 3VFOA 2MTPA 1NGPL 4HS8H 3QA3B 5CJOH 4ODTH 4KRLB 3VU2A 4BQ9A 4PV9A 4IDJH 3P9LA 3KPRA 1AGEA 4OLWH 4FQXA 4YDLC 2UWEB 3WFZA 4HHAA 1IGYA 5IOPA 4PBVC 4ORGB 4MA8H 3QDGE 1KJMB 2V17L 4OZFB 3DI2B 4FQHB 2MQ0A 1FO0L 1N5YL 3HNSL 1OAZL 4S1RH 3SDCB 1ZT1B 4PYHA 1ZV5A 4Q2ZA 1A7BA 1P9MA 2AJSH 3QFJE 1K6QH 4D9RD 5F9WB 3GSRB 4FQPA 2A83A 2C1OA 2Z9TA 3CPLA 3L5IA 4HKJA 1EBAA 4P49A 4P2RD 3QDMA 4Z0XB 5A3ID 1WBYB 2FECL 5JPMB 1N5AA 2E6JA 1GOFA 4ZOCA 1DDHB 1OW0C 2JB5L 4QRRE 1FFOB 3IDMB 5DYOA 2FCBA 1QTYT 2QADB 5DEFA 1WEJL 4MA8L 1TJGL 4P46D 5ITFB 3X3GH 3L95A 3P77A 1A6UH 1TIUA 2Q87A 5FUCE 2YMXH 1AGFB 1GVIA 2R1WA 5CUSL 3I50L 4JN1L 4S1RL 2PTTB 2A6DB 4I2XE 4JGMA 4FFZH 2VZSA 4JY6B 5A3IC 1K6QL 2PXYD 5BQ7B 3BEWB 3ALPA 2NY4D 3H7LA 3UEZA 3DVGB 3QG7L 4HWZA 2LVCA 3G5YB 2WV3A 4G9DA 3K74B 3MLTB 3O3UN 4PJ8B 1AR1D 3O8XA 4FQCH 4AEHL 1WSST 3WHXB 1MJJA 2VKXA 4NO5B 5FYJL 4G9FE 5JXEA 3BISA 3RVTD 2R1XB 3NMEA 3X3GL 4EIGB 4NQVB 3GFUA 2YMXL 1A6AA 3HZMA 1MI5B 4PGDB 4X80H 2IH3B 4I0PA 2LTQB 1F4WL 1FZMB 2H3NA 3Q1SL 1R5VA 4FFZL 4NGHL 2I26N 3H9SD 1KJ2B 1AR1C 3P30H 4GKZB 3UTSA 2J8UB 3C5ZB 4PREB 2HVKB 4JFZL 5F96L 3PGFL 4FQCL 4Y2DD 4G6KL 2QQNL 4TSCH 3EYVA 3C2AH 1G7IA 2BMKA 4NC1E 1KJ3H 4MJID 3SDAC 4XMKL 4Q9RH 4TUJB 5KG9A 1P7KA 3EO9L 1VHPA 4X80L 5IB3A 3AS2A 3VH8A 5FKPB 5FV1L 4LARH 3KPSB 4NQUA 1N26A 2DQCH 3P40A 2ZUYA 1UVQB 3E6FB 3P30L 3OGCB 5F7YC 4J23A 4U1NB 2APFA 4Y4HA 4XTRC 4LSRL 2CIKA 5ICXB 3U36B 1VEPA 3MREB 3BQUD 2ZUQB 2ATKA 3NPZB 2W0FB 4KRPC 2AS5M 5IJVA 4NQEA 1EHLL 1NC2D 4EOWL 1GPOH 1IILE 4IRJA 5M94B 1WBXA 5IHZA 4O4YH 4CUCA 2WZPD 1VB9A 3DSFH 1CN4A 2OSLB 2XZCL 1IAMA 4KI5F 2NYYD 1JN6B 4MQSB 4LARL 3G04B 1RK1B 4H88H 5J6HB 1CK0L 4HZLB 4ORZC 4NJAH 1DQLL 3QCVH 3LHPH 2ZCLH 4NCC1 4CW1A 3P9MB 3RWDA 1NJ9B 3TF7C 3DV4A 1HILB 3ARWA 3STBA 4UTAH 2FX8H 3RWHA 5DA0B 4HIEA 3IJYA 4YC2B 2DS4A 5B3JF 1JTTA 1JF6A 1WCQA 3IJHB 2WNGA 4LSSH 5TE4L 4O4YL 4PJBB 3ARXA 4O9HH 1PG7L 5F6IC 3RFZC 1NUDA 1Y18B 3N0PB 3QJHA 5F9WC 1MHPH 1FCGA 3CIQA 2KQMA 3EFDL 1JUFA 4N0CC 3FO2B 1FFQA 1FE8H 1U8IA 1V8HA 2YEZB 4ELME 2A2QT 4ZPTA 3WL9B 4ODWB 5CP3H 3BP5B 1D5XA 4LSSL 5LCVH 2GYSA 2VC2H 5LAXA 1IC4H 1SMAA 5DO2C 1QHPA 4RGNB 1EFXD 3S5LG 3UTQB 2X4TA 2F8OA 3LKOB 1IKFH 1U8JA 2ORBL 3JTTB 1MHPL 3I2CH 4NQDB 1M6OA 4GMSL 3KYMA 1LK3L 1JZ5A 1FC2D 2VDKL 4PJ8C 3VXQA 1A6VL 2L0DA 3J8F7 4FFVC 4NZRL 1XGUA 3Q6GH 2PN5A 3WE6A 4U6HB 4U7KA 4RISL 3UO1L 3WBDA 3A67L 2RB8A 5LCVL 2XKUA 3Q3GA 2HFEB 4WNQA 4HWUA 4UDTA 4ZUSB 2HJKA 2LTQC 2AKRB 4LF3B 4LVHB 1XGQB 3OKNA 4FABH 3G5XA 4OV6F 4LPCA 2BVEA 1ZLSH 1BQUA 1U58A 1ZXQA 1PKQA 2YD3A 4OCNC 2LU7A 3C5ZC 3QIUA 3ARRA 3D18B 4P3CL 2ADIB 1IAIH 3S3SA 3HTLX 5C3LD 3EOAB 4X99B 1NCUA 2VAAA 2B5IB 2OL3B 4GT7A 2Q7YA 3VRLE 5HHMD 3TO2B 4UIMA 4WHYH 3WFHA 3PWLA 1WAAE 3U30C 4R4FH 5D8JL 3IU3B 5JIKA 4OCYH 5I1KH 4UINH 2ZG2A 2AGJH 3O6LH 1EEYB 3DNKA 3FRPA 2GK0B 4X6FA 4FABL 1NBZB 2C26A 4X9HA 3RIAF 3SGKC 1ZLSL 2I60H 4PJCE 2PCPA 1G9ML 4QTHB 1IAIL 4XMPH 5D1QD 2AVGA 4XVSL 5K9QG 5DD0H 5FO8B 2ZUQC 3KPPB 5DUBA 4ZS7L 1L0XA 3QQ9C 4PJFB 2EYTA 4FXKA 1NC4D 2CLRA 4F33A 4I4WA 1BREA 1VACA 1OL0A 1MCOH 1CGXA 4X4XA 2J1KA 5EU4A 5SWZE 1AHWA 2AGJL 3O6LL 3R1GH 2OTWB 3P3YA 1Q9OB 3GJFA 5EOCH 5FECB 4OD2A 3WFBL 3GJEB 1C7TA 3FT2B 4GSDH 1DN2A 2DQJH 4PLJC 1N59A 3T1FB 2R39A 5IHUL 4UDUB 2BNUA 4DEPB 4JY4A 1I1AB 4R4ND 5K59F 3S96B 1IAOB 1RFDH 5CZVL 1FZKB 4CN4A 3EYQC 4WFED 5KSVA 4CBPA 1PAMA 1U95A 2ZKHH 2VITA 3DXAA 1ZVSA 1OGAB 3R1GL 4NRYB 3GKWL 4WFHE 4XC1L 4BSJA 4DN3H 3X11A 4Y4KB 5SWSA 5I76A 2ZPKL 3WHE1 3MBEB 5TDNB 3QEQB 4R4NC 3RRQA 4L3AA 5JUEH 5AD0B 3NPSB 4PBWD 3VFRA 5JOFB 3FB7B 2HJFA 2QEJA 3H42H 4XNMB 5DURD 3TVMB 5HJ3A 3R06A 5IJKA 3I3BA 2G60L 1D6EB 5ISZE 3TNNA 2DLFH 1WTLA 3PHOA 4PJEF 4TVSa 5EZJB 1RV6X 2DICA 4KVNL 4YBLB 3HZYB 2IAMC 1E4WH 4RGNC 2R23A 1QA9A 4G8IA 2D0GA 2B1AH 2AJ3B 1LD9A 4JDZA 1JPST 3MV9B 1QBAA 4HKXB 4RFOH 1BVZA 3MRIA 3SQBA 1K4CB 5CKGA 4BKLB 4P3DB 4HS6A 4DN4L 1YMMD 1MEXL 4JANB 5C0JA 3IFPA 1CDHA 1A9BA 2YWYA 3CFKA 4JM4L 3SDXB 3UPAA 2DLFL 1VGEL 5A2IH 3QAZB 1A1MB 1JBJA 5IBTH 2X44D 5CINH 4YHLH 4X6EB 3L9RA 1E4WL 3SCMB 2FSEA 2PNDA 3O3DA 4LVHC 3X13A 4UBDD 1RJLB 3WFEH 3LKRA 1U3HA 2QQQA 4KJYB 1T7YA 3B9AA 4NCC2 4Q6IA 2VZUA 4NQCD 3D39B 3AFLA 1T5WB 1AI1H 5EZOH 4KC3B 2YBRB 3DMMA 5DFTA 2PYED 4NN5B 4Z77A 2XQBL 3QH3B 2AXGA 1N2RA 4PRAB 2I07A 4ZUVB 1ZWIB 3TWCL 1CVSC 1KIQB 2NY2D 5C08A 1I9JH 2PUQT 1KC5H 3T1WA 4BK4A 1KELL 3RGVD 2Y72A 5D7KE 5DFVD 5IBTL 5CINL 4YHLL 3KYNB 2VXQL 2WW8A 2A73A 1QSEE 2VOTA 3WDHA 1KPVB 2DB8A 2VTFA 1JWMA 3WFEL 4PJGE 3LQZA 5CCKH 8CGTA 1NCAL 1CCZA 2N56A 2LU3A 1XGYL 2UWEF 4IOIB 1C1EH 1F8TH 5E2VL 2C3VA 1E4KA 2X4OB 1KCSH 1U8PB 1ROWA 1BVKA 2BC4A 5I30H 4N9GB 3ZTNL 1JNLH 1XF2A 5DFVC 2WWKT 3F6IA 2SEBA 4QHMB 3BW9B 4KVCL 1W0VA 4TN9A 3A6OA 3BWUC 3O2WH 5D5MB 2IFGA 3L3JB 3QWOB 2MSPA 4ONGL 5DRZB 3EZJB 1X5KA 3RIFF 3WKML 2EXWD 2RR3A 1LEGB 2XQYG 5FDWA 2YUWA 2AW2A 1F3DJ 3BP6B 4Y2OA 1Y6NR 3OPZH 4EUPG 5I8KL 1WT5A 3U9UA 5JHDA 1ETZA 1OVZA 5CD5D 3LV3B 5EUOE 4ZFOL 1S9YB 3QXDA 1I1AC 1F8TL 3B9KA 1FVCA 4EXKA 4D0BA 3DHJA 5E24E 2MFNA 2D7QA 4MCYA 3SGJC 1WWCA 5IT2L 1JNLL 3BIKA 1IGTB 3T2OA 5E2JA 4D9LH 2PW1B 2GJJA 4L3EB 3S35X 4KGJA 4HXAL 3QWQB 4RAVB 4UIKH 3FMGL 3DURB 1WFOA 4PRHB 5A1AA 4MXVE 3WLWD 4Y4KC 4NQXB 1ES0A 3E6HB 1HXMA 1MCFA 1T89C 3NZHH 1HQRB 1SEQH 4P2CG 1I1FA 4JFOA 3T0AA 4XH2B 3QRGH 1QO3B 3T0XA 4XNYH 2EDQA 3U0PB 2E7LC 1AC0A 1V05A 1WK0A 2XACC 3TVMC 3ARFA 3MJ7B 4GLRH 3HAEA 1NLDH 4D9LL 5C0GB 3H0TB 4MD5B 5D7IA 4NUGH 1J8HE 3WLWC 4HDIA 3RY6C 2VLJB 5B21A 2YD8A 5DK0A 2Z4QB 1DBJL 2IBBA 4PRPE 4YBLC 3O6FD 3MA7A 5IWLC 4EN3A 1LK2A 2J8UF 4PG9A 5H94A 3MV11 2NY5H 4PJDA 1OF2B 4JHAH 4FHBD 3O11A 4ALAL 4RCAA 4XNYL 1SHMA 2BY1A 4YWGH 4XCCH 5C7XH 4M3JA 4Y19D 3DPBA 3PDGA 1NLDL 1MFDH 4ZTOL 5BW7A 1BZ9A 3DX7B 1RZKH 2WP3O 3ISWA 4M4RA 3HG1D 5DDHA 5F9AC 4GRMB 2DMBA 3T4AB 1RK0A 4LU5L 4NYLB 4WW2B 3SCMC 3PL6B 5JXAL 1KPUA 4U1IA 1G9NC 4U1KB 3KS0H 3SKMA 4AM0A 2NY5L 3QO1B 4JHAL 1NANI 4DCQA 2WUBH 3U1SL 4L9LB 1N3NB 5IR1A 4YWGL 5HDBE 2EO9A 1GGBH 1A1OA 3ARTA 4GRLB 1DE4B 2ESVE 4GG6B 5IVXA 4N8CH 1FL3B 1ZA6A 2DQIH 2CR6A 4NN5C 4I0CC 4DWHA 3TZVC 1QPPA 1MFDL 4PJ9A 3QWRA 5GIRA 1M7IA 1AD0B 1WJ3A 1YEEH 5TGBA 1G0DA 3INUH 3PWPD 1JHKH 5BS0B 4NUJA 5DJXA 3CSGA 3WSQH 1F90H 5D7SL 1I1YA 5DJDA 3FO9B 1VGKB 3D25B 3AC0A 5FO9A 5J3HC 2WUBL 4LOUC 2CK0H 2Z31D 3GMLA 4GOSA 3UBXA 5KW9H 4H0IA 3QO0A 1GGBL 4L8DB 4Z0BH 1JK8B 2YR3A 5EO0A 3CDCA 4X0KA 4N8CL 1HN1A 4OCSH 2GFBA 3MLUH 4PJBF 1DN0A 3ZYIA 4UV7L 1LO2L 5HY9B 3V0VB 2VLME 3VXNB 5IMLA 2DKUA 3INUL 3CVHL 5KVFH 1H5BA 3FRPG 4PLNC 1CDBA 4UQ3B 3Q48A 3GSOB 5JDSB 4GKNA 1D9KB 3ILPA 2ADGB 4DAGH 4LSVH 2H32H 5CSGA 4BQ8A 1MFEH 5BZWB 2VQUA 5HYJA 3TO4D 2OX5A 3MOAH 5DJAA 5BZDB 4GW4B 1QKZL 1BMGA 5D72L 1VFAA 5TH2A 4LLUA 4OAWA 4ZFGL 5JNYB 4D9RE 5L8KB 2D7PA 3HNVL 4LLDB 1QBLH 4N8VB 1WFTA 5F71A 1IZJA 3CC5B 3WIIL 3MACH 5EBLA 3L3KB 4P2RE 4X6CB 3T2QA 5EU3A 4GAFB 2VH5H 2V5MA 1NMBL 2VZVA 3FHQA 4WIQA 5AAMA 4XPHH 2O93L 3HE6D 4FFYL 4P9MH 3E2HB 2EEBA 5DD6B 5GZOC 1SVZA 2Q8AH 1JK8A 3RWCB 4WY7L 4I9WD 1KN2H 4ODXB 5I73B 4QNPF 3MRQA 2GUOB 2PTVA 3KPQA 3CSBA 1TZHB 1RD6A 1QNZL 1OP3K 8FABA 1QBLL 4ODSL 4FTVB 1JF1A 4WO4B 5IVZA 2BNRB 1MF2H 2X1WL 5IM7A 2VH5L 3JWDH 3VFVB 1IAIM 5JPNB 3MXVH 4U0QB 3CDYA 1IEBA 2XT1B 1ED3A 4XBGA 5D7JB 3MJ8B 1S9VA 3Q5TA 1F4YL 1KB9J 2ITDB 1WCBA 2OK0L 4ELKB 4MA7H 2DM7A 5DD5L 1PDKA 3QUZB 5JR1H 3H9SE 1EERB 3HMXA 1S9XB 2EKSB 3PL6C 4AEEA 5EO1B 4OGZA 2BSTA 2RCSL 4ZDHB 1QRNB 5T1LA 3LDBB 1A14H 2H1PL 1ZHBB 2P5EA 4L9LC 5AYQA 4PJFF 2IH1B 1DR9A 3ZE2E 4EQ2A 2X41A 3BGFC 4MJIE 1U8MA 1T0NB 2VZTA 2EKJA 4M7ZB 4BZ2H 4YO0A 2GCYB 4MA7L 4G7YH 1TCRA 2VZ1A 4HZAA 5JR1L 3B2VL 5E2UL 2F54A 2VLRB 4WV1A 1MQ8A 3QHTC 1N6QH 4ETYA 1CICA 4F3FA 4HG4K 4JRXB 4OZHB 1ADQL 3ARYA 4PTUA 2GJ6B 3MMEA 5GGTH 3SOBH 4X5XB 3CFDB 3LOWA 4NNXB 1A5FH 3UJIH 5BV7H 3TV3L 3OL2A 4JFPB 2LQRA 1UXSA 4BZ2L 5E8DH 2AABH 3UPCA 3OKDA 4XP5H 2P8PA 4YLQT 2N7BA 5C0ND 3UPRA 2BOCB 4NWUH 3PQYB 2Y1VA 5I1LA 4NNYB 1UJTA 3OKLB 3ME0A 4GW5B 1P69B 5GRUL 1X5JA 1LO0H 2G75B 5FYKD 1U2CA 1QEWB 1OY3B 2XFXB 2G9HA 5HHNB 1D5BB 2EYSB 1A5FL 1P5UA 3UJIL 3MV7A 2W60A 3RVXC 4DOHE 2NX5D 2VDQL 2FR4A 4PGJA 3FQXA 1QLRA 1EV2E 1OTUC 5C0NC 2XV6B 2Q7NA 5E8DL 1CLCA 1B0RB 5H37G 5IIEB 4NWUL 3QDGA 2OQJA 5E4IA 1GC1H 3CSPA 3OHXA 4X7DC 1AFVL 4NT6B 4PGBA 3DO3A 4QF1B 1LO0L 3QFJA 2V7HB 2YA2A 1H15A 5DQJA 3C5SB 4APQD 2F5AL 3E2HC 5ID0B 4KMQA 3K2UH 3GHEL 3D69A 3PHQB 4KV5E 5T5NF 3V5KB 4QRRA 3MUGB 4KKCD 4U7SA 4MAYD 4Y5XA 2RGSA 3SO3C 1FGVH 3VFMA 4YHPB 3QNXB 4YXKH 4PG2C 5E7FA 1IEAB 1JHLL 4QO1A 2W9LA 3L3OB 4WO4C 4Y16C 4DGYH 5C70A 3QEGL 4YHMH 4XP4H 5SWQB 5T1KB 2IPUG 4NPYA 3CU1A 3FB6B 1IGCL 3FOLB 4ZS6C 3MNZA 4YUEL 5H35A 2XKNA 1JJUA 5A2KH 5MI0C 5HBBA 5EU6B 4MNHA 4YAQB 4G80B 4GAYB 1MH5B 5J11B 5SX4I 4TTDD 1BVLB 3U46A 4DKAA 5D9SB 5B4MD 5DXWA 3IGAA 4G9FA 5D96B 3LRSA 1VEOA 4PY8J 2ICEA 2B1HL 3OKOA 5JA9A 3SKJH 2VXTL 2H2SD 3S5LB 1T0MB 1IKNA 4YHML 2R0WH 2ZG3A 4KZDL 4IM8A 1KCUH 1Y0LA 3LDBC 1SYSB 3CXHK 2AJUH 4XNZB 3NFNB 1U92B 4FOMA 4XPAH 3FONB 1D3CA 2ZZUT 3D0VB 3ARED 5D5MF 3AXLB 4CMMA 2AQ3A 1MCBA 2B4CH 4YK4C 4OM1H 1XF4B 3ELAT 2CJUH 3KGRA 4HAGA 3SKJL 2FDBP 4LEOB 3CDFA 3QUYD 4JE4B 1L0QA 1EGJA 3MOQA 4LPXA 1D5MB 1DQQB 4HIJB 4MDIA 4QRUB 3BIAX 1KCUL 4LPYA 2FNBA 2O5YH 1IFHH 3C6LA 4HUWB 4CVZA 2AJUL 1S7XB 3VI3E 4YGVB 3F6LA 1QSFA 3MLWL 3ZT5A 2R2BB 4Y1AD 5F3BA 5HHOD 1I7UA 2D7MA 5KBNC 4U3HA 4OM1L 3D0LB 3PXJA 2DLGA 4OSUH 3T77A 2CJUL 5TF1H 1K8DB 3ZE0E 2MNUA 3ZSTA 4ZAKA 5K9KB 1NGWB 5C07A 4Z5RA 3W5NA 2HN7B 3PABB 3O6MH 5EUKA 4P23D 4V1DB 1KNOA 2O5YL 3O9WB 4ZNCD 4U1JA 3WS6C 4R96B 4HBCH 3K8MA 4K8RC 4KKBC 3ARDB 4OCLC 3SKNA 3SQOL 4PTTA 3NCEB 1AY1L 5C9KA 4X5LA 5I16A 4YHYC 1Q72L 4UOW0 3QUMA 4CJ0A 5HYSA 4TPRL 4OSUL 4PUBH 1D5ZB 5J1AA 5ERWA 4JY5H 4A6YL 1T5XB 3GK8L 1BOGB 3BKJL 1O0VA 1TPXC 2YKLH 4CADA 5FGBC 1URLA 3DRQA 5I19L 4HBCL 3CU7A 1LE9B 4HUUA 1I8KA 5C0BB 2DM4A 2A6IB 5EC1A 1ZTXL 4GKSA 1ZLUK 4OLVH 4LHUD 2DF3A 5EBMB 4ELMA 4LSUH 4R2GC 4PUBL 3PWNB 4WW2F 1ZS8A 2DN7A 4JY5L 4LLMA 1HI6A 3UROR 4R9HA 2FJGA 4QHUB 2MJWA 1HHKB 2Z8WC 3X14A 3BJLA 1EHNA 3DUUA 3AY4A 1YMME 5T33H 1S5HB 4GG6F 3HI5H 4X6DB 1MCHA 4HXBL 3VXRD 3W5MA 1U42A 1DUZA 1AIFB 1YEFH 4LRIA 1CD1B 2OR7A 5J11C 1WLHA 3O2VH 1XR9A 4OZGB 1VFOA 4LSUL 4MD4B 4YFLI 5D96C 2QSQA 3F5WB 3NGBB 2X4UB 2BRRH 1EO8L 5D2NB 4P5KB 3P73A 2BVOB 3O45A 5HDOA 4NQCE 1Q9LB 2AV1A 4JJ5A 3VA2C 4I77L 4CKVX 3D3VB 4OT1H 2PYEE 4GBXB 4WFFD 3TYGL 1X3DA 4L4VB 3UTTB 5C0CD 5I1JL 4ZQKB 1WV7T 4PJXB 5E9DA 3RA7L 4DGVH 5I1CH 4Z7QF 1IGML 3DX6B 4JO3H 2ZUTA 5EWIL 5GS0D 1KT2B 2W65B 2DQGL 3JV6B