5F72S

De novo design and crystallographic validation of antibodies targeting a pre-selected epitope
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
226
Chain Sequence
QLVESGGGLVQPGGSLRLSCAASGFAISASSIHWVRQAPGKCLEWVASIDPETGETLYAKSVAGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARAYAGDGVYYADVWGQGTLVTVSGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYSFPSTFGCGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kelch-like ECH-associated protein 1
publication title De novo design and crystallographic validation of antibodies targeting a pre-selected epitope
rcsb
source organism Homo sapiens
molecule tags De novo protein
total genus 57
structure length 226
sequence length 245
chains with identical sequence T
ec nomenclature
pdb deposition date 2015-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f72S02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f72S01
4XNZB 4M3KB 2AJXH 1FFNB 4NKMB 1JMZA 4KPHL 5D8JH 3QUZA 2GKIA 3GRWH 1QVOA 2H8PA 1NLBL 1WZLA 3IAGC 3MCG1 2OL3A 4UIMB 1PSKH 3HAEA 5IG7A 1U8OB 3MACL 5HYJA 4YDVB 3MRLA 3H6JA 2IH1A 3GJFH 2X7LA 4U3HA 2MQ3A 4R7DA 1KYOJ 4WFGE 4GMSH 5HVGB 3QG7L 1JV5B 3F5WA 3KR3L 5TQ2H 3QDMD 3LS4H 3O6FB 2V17H 2AJXL 4YHLL 5D8JL 3EBAA 4JY6B 4N0YL 3LDBC 5JORA 3GRWL 3O4LB 5ALBH 3QUXC 1MFEH 4UILL 1GC1C 2ED9A 5CWSA 5HDOA 1OP9A 1I85C 1PZUB 5SX5K 1T4KB 3W2DH 4KGJA 4FQ2L 3CFJB 2GW5A 3TN0D 4K2UL 5CEXA 1UM6L 5I30H 3PABA 4P2OB 5KVFH 4PRPD 3OAZH 1FVDA 1YYML 3SN6N 4LLWA 2A38A 1N5AB 4PGZA 1LQSR 5EU6E 4PYHA 2FO4B 3BP6A 3QIBD 3DUUA 1WBZB 3PV7A 3EZJB 2VRAA 4F8TA 2OCFD 1WF5A 1D5ZB 4N0UB 4P2RD 4P5KB 2ZG3A 4UT7H 2AEQH 3DSNA 3E6FA 5ALBL 4DQOL 1HOCB 1RHFA 1B4RA 3W2DL 5T3XD 5I30L 4IBLT 1U8MB 5D1XC 2J88H 3V8CA 5KVFL 3QXAB 3B9VA 2NCMA 2W9LA 1ZEAH 4MSWB 2P47B 1VKXB 2K9UA 3H2WA 5C0JB 2MOVA 1F58H 1MVUA 1INQB 3MOQA 1NLDL 1QRNB 4JFPA 3TBWA 1P7QA 2EDYA 3A6BH 4ELKB 1OARL 2AEQL 2QBWA 4MB4A 5I75C 4JLRA 3QZWG 4Q6IA 1NGWA 1D9KC 4I2XB 2F54B 2HFTA 4PRHA 2Y36H 5F7LB 5FM8A 2ZP0T 1IQDB 4QCIB 4XNUH 2IH3B 4GSDH 2R1WB 3BZFB 1I8IA 4WDIA 2J88L 1JF1A 5C0ND 5ITBH 3EYOB 4G8GD 3OZ9H 1KCKA 5I74B 4EI5A 2NY7L 2AAVA 2WLYA 1CE6A 4U2ZA 1QBBA 4KKNA 1IGJB 5ADPH 5JDSB 3VFTB 1FDLL 3BQUB 4RDQF 4FZ8L 2ICWJ 4TUKH 1QO3A 1F4YL 3CPLA 4I5BA 4JFDD 12E8H 2CRIA 3A6BL 5D2NA 5E8EB 4O2CA 1B3JA 4IHOB 4F7CA 1OAYL 3GMNA 3HUJF 2Y36L 3MNWA 2ED8A 3WSQH 1KGCE 1RJZB 4LMQE 3AU1A 4XNUL 4ZNEA 3ARED 2VLME 1KB9J 3BZEA 2F8VA 3JV0A 5D7IE 1RUQH 3FRPA 5ITBL 3LQMA 3OAYK 3BO8B 4HD9A 1YZZA 2YUWA 3MLTA 4L9LC 4V1DB 4Z0XA 2C9AA 5ADPL 1NC4D 4EIGB 5EBMB 2UWEB 1NBVH 4CU7A 4TUKL 1N5YH 5LCVL 3RWHB 3VDAA 12E8L 4Y4KC 3MV7B 4FOMA 5KS9E 4LBEB 3S5LB 2H26A 5MENE 3X3FL 5KVEH 2ZUQC 3WSQL 3FQXA 5D1QD 3NZ8B 3R1GH 4R3SB 1WWBX 3C8KB 2W0LA 1RUQL 3ARGA 4LNVA 4DZ8A 3JTSB 1VSCA 1XR9B 4MB3A 1KTLA 1BP3B 2BVEA 2CH8A 2N1KA 5H8DA 3WBDA 1NMAH 5T3XH 2ITCA 1FZKB 4BK4A 1QA9B 3LN5B 3M8OH 3QCUH 4X4ME 1FL3A 4OB5L 3QO1A 4DGYH 5I1EH 1BWMA 4L3AA 4HK0B 3KJ4C 3IVKA 5KVEL 4YGAB 5E6IA 3O9WD 4Z7QE 3CFEA 5HGAA 2V2TB 5F1NB 3VXRA 5BVPH 3R1GL 5AYQA 3BZ4A 4OBRA 4HWBH 3QO0A 1M1SA 5I9QC 4CN4A 3ULUD 3DX7A 3C6SB 3UZVB 4MXQD 1VACA 4PLJC 3VFWB 2CJUH 1TPXB 3SDXF 3ULVF 5EZLA 1LO3H 2NY4B 1EH9A 5TF0A 2YC1A 2A73A 2ESVD 2QADB 3V6BR 5T3XL 4K71C 5D7LB 3OG6B 5T5NF 3IGAB 3RBSA 1HYSC 4M43H 1UT9A 1IKFL 4DGYL 5I1EL 2BSSB 3GSXB 4IM8A 2I9TA 2CR6A 3BE1H 3WMSA 1CD9B 2AK4A 4WFEE 4XPHH 1ND0B 5ACZB 5JOPE 2VQUA 1CLZH 3B43A 3MCKB 4I3SL 4M8VA 1QPXA 5AYUH 4XNZC 1N3NA 3FN0H 2CJUL 1CIDA 4FQIH 1LO3L 2EDRA 32C2A 4A6YA 5D2LE 1KPRB 1IC1A 4MQXC 4PP2A 1ZWIB 4M43L 2X05A 2Z8WC 4BH8B 4TNWF 1SJXA 3AB0B 1QLRB 3MRMA 5B4MC 3UYRL 3OG4B 1KIQB 3FQWB 2F58H 3BPNB 3X13B 3PP4H 4XPHL 4D0DA 1UB5A 4PUBL 5FYKE 3CSYA 1H8NA 2B1HH 3VFVB 4X4XA 5I71B 3NIDE 3WFZA 1JWUB 3ZKMC 2FEDC 3EO1A 3FFDA 4D0CB 4C4KO 1DJSA 3HE6B 5FOBB 5AYUL 3FN0L 1OAKL 2VLRD 3O6FC 3CCHA 4JFEA 4FQIL 2EDLA 5CFHA 1NKRA 5CZXD 3MLRH 5DJ0B 4K3DH 4LKXA 1K85A 3GSOA 4YXKH 3UDWA 3MRNA 3SCMA 2D4DA 1TQCB 3RVWC 3SGKC 4KUCD 1JPFA 2W9DH 3O3DB 4P2OC 2GJ6B 2F58L 3PP4L 2FECI 3GM0A 4G80B 4NM8L 1V7MH 4CJ0A 2B1HL 2HFEB 4JDZB 1DBKH 1YEGH 4LVNB 5I1GH 3DECA 3QZWA 5TDOB 2IFFH 1S7SB 3NIFE 4WTZG 4R7NA 2GSIB 2EZ0D 1AXTL 2JJUA 1HINL 2LU3A 4OF8A 3MLRL 1RK1A 4K3DL 5E9DD 2P48B 3U82B 1S5HB 4PY8I 1UG9A 4RGOL 2BJMH 4YBLB 5CEYA 5MHSE 4YXKL 3JWOH 2RIKA 2QQLH 2BOCA 4GUPB 3FKUS 3MTRA 3ARBB 5F44A 4DKFH 2H2PD 4LNRA 2W9DL 5JHDA 1OAQL 4RQQB 3I3EA 2N56A 2A83B 5KZCB 4LIQE 1AD0A 4WI3A 1T03H 2H41A 3PL6D 5I1GL 1DBKL 4OLZH 1NC2B 2IFFL 5DJAA 3QULB 4BQ9A 4XCYA 1CK0H 4EN3A 5KN5B 5JLZA 5FUCC 1K2DA 3LKPB 4G43A 3SE8H 4MJIE 1CICA 4JFFD 2P5EB 3WIIH 3ULUL 3JWOL 2EYRB 3IDJA 4RISH 1OQXA 5MEND 1WBYA 1K8IA 5ITFA 4DKFL 4Z5RA 5F7EH 1CFSB 2Z35B 5HJ3A 4K07A 3MLYH 5H35A 4L8BB 4LSPH 5D6CB 5I74C 3BESR 2IF7A 1T03L 4OLZL 4QRUB 3BQUC 5FO9A 2H6PA 4HAFA 4YGVB 4PRIB 3C60D 3G6AA 1NCUA 3MLSH 4JFOB 5DMKA 1JK8B 1HWHB 4NC1C 4JY4B 3WIHH 1G7JB 4HXAL 5GGTA 4J6RL 3SE9H 1I4FB 4H20L 5F97E 2VL4A 5GRJH 5DGQA 3V6ZA 5IF0A 3MLYL 3RVVC 3VG9B 4JKKA 1FNAA 1CDIA 1BBJB 2YPKB 5DJCA 4MVBC 1CFNA 3LD8B 4HIEA 2DOCA 2YN5A 5E00A 4NZDA 3T0AA 1ZA3A 3WIHL 3T08A 3ILPB 3I6LE 4R4BB 3OKMB 1KTRL 4NQVB 4YEFA 5D72H 3SE9L 5HYEA 3CFDA 2EDWA 5GRJL 2DJ4A 2UY7A 2B7DT 2HLFD 4HX1B 4PLOB 4PJFF 3MR9A 2DWEB 3BN9C 3HZMA 1F3JB 1R24B 1A5FH 2BXZA 5E1AA 3AY4C 1EJOH 4Y5VB 5FA3B 4HBCH 3DYMA 5HBBA 4ELMA 1KCUH 4BQ6A 4RAUB 2VITB 4CNIA 1FLTX 4JVWA 4NHUA 2HRPH 4BSWB 2K3TA 4KRMB 5D2NE 2ICCA 1JYNA 5EIIB 4XMPH 4WUUB 1T2JA 5C09B 5F1IB 1N59B 4HSQA 1Q9LB 4AENA 3QJHB 4E41A 4N1EA 4X9GA 5DF0A 4F8QA 1GGTA 1TPXC 1YMMD 4Q0XL 5F7MC 1NBYB 2NY4C 2QADC 3QI9A 1RFDL 4S0TD 2GK0A 3MRDB 5HI5C 3V5HA 2ITDA 1BM3L 1ZVSA 4JZOA 3T0EA 1TJIH 2HRPL 3D85A 4UDTA 2E27H 1QFHA 2HVJA 1NGPH 5C08A 5TJWK 4TTDD 4WI5A 5H2BB 1N26A 4C58B 4XWGH 1A7QH 4I9WE 4TYUA 4JO2H 4Z7VF 3UZEA 4QXWA 2ICWB 1NGYB 2OR7A 4AEIL 4P3DA 2Q86B 4ZUSA 5L9DL 2GJJA 1PAMA 4OLWH 5CLTA 3O45B 1TJIL 3AB0C 5F7KC 4WTZA 1CE1H 4OZFB 5EO1B 3QUZD 3AMLA 3U4BH 3WV0A 3BPNC 5L8KB 3MYZA 1OSPH 3C2AL 1AD9A 3PWVA 4HC1H 4UAOB 1NGPL 4WU7A 4XC1H 3GJEA 3VXRE 2WP3O 5DJZB 5I71C 4OZIB 3ZE1F 5HYJD 4WGVB 4R0LB 1A7QL 3HE6C 4JRYE 1U8HA 3IS0X 1M71B 1QFPA 5ESVA 1O7VA 1ZSDB 2KBGA 3TIEA 3D25B 3P9MB 3K1DA 4JO4H 3ULSB 3TH2T 4Y0GA 4BZ2H 4OLWL 3DNKA 1TQCC 4PR5B 1I1CA 4GAYA 2F53B 3U4BL 5FYJD 1K9TA 4XXDA 1OSPL 5KSUB 4J4PD 1RJYB 4N5ED 3RWEA 4MMZC 4CW1B 4XC1L 1KENL 2AK4E 4JPVL 5T1KD 4LVNC 5CIPA 1FO0H 5D5MB 4GMTH 3INUH 4R96B 5SWZB 3CXHK 2CKBL 4NQUA 1EFXB 2H32A 4JO4L 4GRWB 4LP5A 4H26B 2GY5A 4OD2A 1IGIH 4OLVH 4YBLC 4BZ2L 4Z77B 5CD5D 4KKLC 4OLXH 1RZGA 4PJDB 1J0JA 3VJ6A 2VISB 1XF5A 4ZS6C 3ARBC 4LPUA 3VGHA 4JHZA 4MJ2A 2R39A 1GL4B 3FO1A 5LQBH 1JZ3A 4L5FL 4XZUA 3REWB 4XHQA 3MUGA 4TVPE 2QR0A 3OV6A 4R8WH 3N1PC 3U6RB 5EIQA 3UPRA 1QSFD 1Q9OB 3PUCA 5JXEC 3I6KB 3PHQA 2HVKA 3INUL 1NKOA 3O3EA 3CVIH 1KG0B 4K3GA 4XP5H 3QUML 3TVMA 4YR6A 4JFEE 4UMGA 2FJGA 4OLVL 1LO5B 3D69A 5GZOC 4OLXL 4G42B 5HHPA 3EO0A 1AO7B 3I2CL 2P5WD 2NX5E 4QEGA 2RR3A 4HWUA 4PRHD 1MLBB 3NCCB 1X5GA 5HYQA 2N7BA 5KSBE 4R8WL 1ZTXL 1SYVA 2R0KL 5BO1H 1URLA 4H1LG 4EI5D 1E4KC 1QEWB 3CVIL 4U1HB 5DK2A 2YOCA 4XP5L 5GGRB 5IEHB 5CBAB 2OL3H 4X6CA 1RIUH 2F5AH 3IJYB 3HAEH 4K7PH 4RBPK 2HN7A 4LIQH 3RVTD 3MFFA 1CT8A 1TZGH 3FT3A 4KRPD 1L7IH 1CFTB 3DJ9A 1U58A 4PBWD 5JA8B 3SE4A 3BGFB 4LCUA 4Z7WA 1YPZA 3AC0A 3VG9C 4AJ0A 1Z5LA 3DYOA 1MRFH 5JHDE 1TTGA 1K5NB 2G60H 1I9IH 4JG1L 3KPLB 4EOWH 1J0YA 4RZCA 3VFMB 2X10A 3D3VE 5BO1L 4KROB 3B9KA 1BVKB 1VENA 2W60B 3LD8C 5HD8D 3FB7A 2OL3L 3HMWH 1RIUL 2DRUA 2F5AL 4HBQA 5DJ6B 2UV3A 4K7PL 1OGAD 3UO1H 4ZFOA 1B6DA 2JF1A 3SY0A 1JMXA 5IVXF 2Q8AH 3MRRA 4PJ7A 1L7IL 5A1AA 2K1MA 5L88H 4OBSA 2VR4A 3EJYC 1A6ZB 3IU4H 1DP0A 3ZHDA 1MRFL 4L8CB 2G60L 2DMCA 4JDTH 1P2CB 2OZ4L 4GKNB 5GRWA 3ARGD 2C3HA 5IB1A 3UJIH 4Y5VC 1UKTA 2UUDH 5FYJL 1UM5L 1S78C 2E7BA 1OD7A 1WEJH 3C6LA 3HMWL 4Q9BA 3MRBA 4QF1A 1HXMB 4PY7B 3NPSB 3EOYG 3UO1L 4GXUN 1MCCA 3MV8D 3WXVH 2NR6D 2Q8AL 1XF4B 1BJMA 2B0SL 2J8UB 2XWTA 4BELD 3ABZA 5L88L 5IVZB 5E6ID 3LKNA 3IU4L 5K9QI 5EOTB 3T0WA 4JDTL 5EA0L 5IJVA 4GBXA 3QDGE 4L4VE 5BMFH 3QIUB 3BH9A 1G6RA 2DLIA 3HC3L 3L9RA 1HDMA 1EUTA 4CRPA 1WIOA 3FONB 4K9EH 1S7VB 2AV1B 3K46A 2AJZB 4ZDHB 1WEJL 2HLAB 1CQKA 5E99H 3QG6B 5F9WB 1J87A 2DLTA 2XPGA 4HIHA 4HUUB 3AXLB 4MX7B 4HT1L 4ENED 1GGCH 5DVMA 1A4JA 1JWMB 2FDBP 1NH6A 1MSPA 5FK9B 3PDDA 2AP2A 2K7PA 3RVXC 4FTVE 1FZJA 1UZ6F 1X3DA 1CGVA 1ORQA 1O7SA 3R8BB 4PRAA 1U8PA 5I1KL 2HFFA 2VQ1B 3WLWC 2VDMH 4GKZB 4F15B 4UAOC 1LD9A 1ZS8A 2EDDA 1ZT1A 3G6DH 3TBVA 1GGCL 2BVTA 3RWDA 4P5TA 5I1LB 4R0LC 6FABH 4E41E 5EO0B 1S9XB 3FQNA 3OJVC 3LKQB 4G7VH 1N2RA 2MQ0A 3TV3L 1HZHH 3NPZB 4C54A 4JFED 5ICZA 2D7TH 4IIQA 2Q3AA 1CL7H 3IFNL 5CD3B 3G04A 4W4OA 1MHEA 4FFWC 4OLYH 5EC1B 5FGSA 2WWMD 2CLRA 2A6KB 5AD0A 4Q2ZB 3H9ZA 1AIFB 4ZPTB 5C08E 3IRPX 4HKZB 6FABL 1Q0XH 3GJFB 1ZK9A 3VXSB 4GLRI 4DFIA 1WISA 1ZHLB 1OTTD 4G7VL 1HZHL 4PJHE 5C86A 2OSLA 2A9MH 4J8RA 1GXEA 2BVQA 1EHNA 2D7TL 4F7TA 4KI5C 1KPVB 1CL7L 4X4ZA 1TQBB 2BP3A 4DN3L 5I2IB 1GIGH 4H1LA 4PG2A 2HJKB 1W8OA 4WUKH 1NCBH 1F4WH 2QL1A 4I13B 1AI1H 1JIBA 2CIIB 4X7EC 1TVHA 2DLEA 3UJJH 5DUPH 4BFBD 1UXWA 1N8ZA 2NQCA 2H2SD 1RIHL 1RZKH 1I1AB 2FCBA 4EN3D 4PRBA 2A9ML 3S4SG 3BI9X 1CICD 4ESKA 2D31B 4W6YB 2NW3B 2V5RA 2O5ZH 1NCBL 4Y2DA 1F4WL 1IGYB 2ZUWA 3RGHA 4RMTA 3TNMA 3WJJA 4WW1A 3AGVA 1DQLH 1XIWC 4A6YH 2GTWB 4QOKB 5B39B 1RULL 1LMKA 4XBPB 2DQGH 4YXHL 5JPNB 5HPOA 3RL2B 4NO3B 3UJJL 5DUPL 2YN3A 1WWWX 4RIRB 5FKAB 2OX5A 5CHNA 3WD5H 1JNLL 5KAQF 1L0QA 4KV5F 4TVPH 2ICWI 5F71A 2A0LD 4ZUUA 2APBA 3PIQA 4XT1C 4LLQA 4BKLB 2WINA 5CBEB 1CGXA 3BGFC 5CMAB 2O5ZL 3JVGC 1FNHA 5FGBC 5ESAA 1E6JH 1ZLVK 3VXUA 1I3RB 5MEOA 3VCLA 3G6JE 3DGGA 4X9IA 4TVSa 2MJWA 4G8FB 3ZYIA 1NCAH 1CFQA 4FQHA 5ALCH 4A6YL 3UAJD 4KROC 1Q38A 4AQOA 5T5FH 4LSVL 1BPVA 3DI2B 3KS0H 2QSCH 3MLPA 3WD5L 1MJ8H 3CMGA 2Y25A 4S10A 4DTGH 1IILE 3IDXL 4XP4L 4X6DB 3ETBF 3OB0H 4YDJB 1U8IA 5T3ZD 2VWEC 4YBHA 4KDWA 2D0FA 3QDMB 1E6JL 1KCSL 4RMQA 3HI1A 3HRZA 3QQ4A 2UYLB 2DD8H 5ALCL 4TPRH 4IDJL 4BFIA 5T5FL 3TBYA 4RRPG 1VA9A 5DHVA 2QSCL 3NPSC 2DQTH 1QFWI 1WIUA 5E8PB 4X6CE 3O3AA 2A9NH 4DTGL 5EG6C 1J1PH 4D8PB 4M8QB 3OKNA 4OT1L 4U6YB 2C5DC 1CLYH 3MRCA 4XHJC 3D2UA 2LU4A 3QIBB 4FMFA 4LDEB 4Z7WE 1YPZE 2B2XH 4E41D 1P4BH 2D3VA 4OCYL 3UTSA 3HNSH 5JPMB 5TE7L 5MERB 3STZA 4UBDC 1UJ3B 4KDVA 2IQAA 1XGUA 4EEEA 3QFJB 4PJFA 5CZKA 3QI9D 3BWAB 2DQTL 1KXQE 5K93A 4JQIH 1LHZA 5FYLE 1B4JL 2DQHH 4GG8A 1TJHH 3T0ED 5E95B 3QEHB 2CUIA 1CLYL 2H9GA 3T0VA 1A9EB 1NQBA 4PJ7E 3KPPB 1ZANH 4HIIA 1CN4A 5C08D 2B2XL 1P4BL 2Z93A 3PGDB 2HT3C 3HNSL 2XZAH 5IB3B 5GGTH 3O6MH 2I5YL 3JTTB 2C3VA 4RAVB 5EPMA 1BREA 2QV2A 5C0DA 3CJJA 2DQHL 5IMKB 4NRXB 4HDIA 4F15C 1ED3A 4YHKH 1HSBA 4PLKC 1FP5A 1TJHL 1JFQH 3BP5B 4X7DC 1XF1A 3D5OF 3L6FB 1BQUA 4G5ZL 4QY8B 4YX2L 4K7PX 2HYMA 2DYPA 1RZIB 3HE7D 3QIWA 4U1IB 1ZANL 2VDQH 2A1WL 1DQJA 3NCYP 2HT2C 4IRZH 4NT6A 1J05A 3QHTC 2DQEH 5EU3B 1MCPH 1P5VA 4X80L 2NW2A 4JKLA 5FM5O 4UU9A 1RK0A 2XZAL 3IT8D 3KPQB 4YK4B 1I9JH 4R4ND 3O6ML 5DMYA 5C0CB 3AREB 1MWAA 1HKFA 3IB4A 3B8YA 1X7QB 4J1UA 3GSNA 1XCQA 2X4RA 4GW5A 3BHBB 3Q5OA 1FGVH 4YHKL 3WKNA 2ADJA 1A6AB 4JY5H 1S9KC 1NC4B 2DB8A 3V0VB 2VDQL 3IRZA 1HSAA 2LFGA 4NO0A 5JOEA 3S4SA 1XGTB 3RJQB 1MCPL 1Q0YL 5J9PB 5EH1A 2MNUA 3KNBB 4NJ9H 5T3ZL 4BH7B 4PJ5B 1XGYH 1I9JL 4LF3B 5DUMH 1JPST 1N4XH 2OTWB 1TQBC 4JB9H 5D70H 1TXKA 1LNUA 1TDQA 1CF8H 3VFRA 3NFNA 2V2WB 4JY5L 2D7PA 3V7AG 1ACZA 5JHLH 5HI3D 1ONQA 2XQYK 2HJFB 4NKOA 3RWGB 1R6VA 2HG5A 5DEFB 4OM1H 4CN1A 3OXSB 2ICEB 2X4OB 4NJ9L 1I1AC 3U7WL 1CXIA 4IOFC 5DUML 4LCYA 4TOYH 5F21B 1N4XL 1KIRB 4KKAC 1W8NA 4JB9L 3FQRA 3MRQA 3RU8L 1XF3B 1TENA 5D70L 4M61B 2AEPL 3FO2A 3QA3B 1OPGH 4KJWC 1C1EL 1IL1B 4YFDB 5JHLL 2WBKA 3BN3B 1T1WB 4Z9KB 3GI8L 3RVUC 3QNXB 1T22A 1IAII 1UXSB 4LAQL 4QT5B 2BNRA 1I7UA 4GW4B 2Q6WB 3FOMB 1I85A 3U7AA 1EERB 2LVCA 5KSAA 2Q1EA 2FH8A 1MY7A 3GSWA 1S7TA 2NY1B 2RFXA 2GIYA 3SKOB 4K7FA 4TUJA 3IFOB 4U1NA 4L4TA 1CS6A 2NY6D 3MCLH 2NZ9D 1CYGA 1JNHA 2EO9A 1DLHB 3I3BA 2ZG1A 2BSTB 3QEGL 4P2YA 3PHSA 2JJVA 2ZJSH 1OT2A 1TJGH 3B9KD 1UQSB 5J1AA 1SVCP 4R9HA 4Z7NE 1MNUH 3RUGB 4WIQA 4K3JH 5ANMB 5CIPH 2R1XA 1NJ9B 4NQTA 5FKPA 1BMGA 5BVJA 5DSCA 4ZFGH 1J11A 2VLRB 4KTDH 3MCLL 1T66C 4M6ML 4PJ8A 5BQ7A 1EHLL 1J0KA 2X9WA 2H32H 3BRDA 2ERJB 1EBPA 1S7QB 1I8KB 1EO5A 4YXLH 1JZ6A 4NUJA 2ZJSL 2DQIH 3IXAB 3GMPB 3N06B 3BVNA 3PGCA 5ETUA 2FB4H 2EDKA 3DX6B 1EZVX 2OYPA 2WW8A 2YS4A 1TVBB 4XNMA 3F7QA 2VABB 1JRHH 1I7ZB 1XFPA 4KTDL 3W5NA 3EKCA 3QIBC 1EJ6A 4EDXA 5E9DB 1KJ2B 4FN0A 4JCMA 2WUCH 4Y89A 3VXUE 2FZ3B 4S11A 4QO1A 4NCC1 3L5WA 4ODWB 4K55A 1GZPA 4K8RD 4YXLL 5DRXB 2JCCF 5J11B 1BECA 3P9LA 4GBXD 1UJ3C 2Z4QA 1JTTA 3QUKA 2DQIL 1SJHA 5J1TC 5IM7A 1CDYA 3EDKA 3VFUB 2JELL 5D7IB 3IDMA 3ZE2E 4QYOB 3BEVA 3WDHA 3REVB 1GGYA 1R5VA 3BZDA 4ZOCA 3HC0B 5TDNA 1MUJA 1QSVA 3FRUB 3T65A 4YZFE 2JJSA 2WUCL 2BZDA 4XAWH 5EUOA 1J86A 5A43C 4C56E 3GSUB 4HULB 1ZA6B 3EYQC 1T1ZA 4N0FA 5MENB 2AJVH 4M4RA 4LDOB 4TULH 1QHPA 3DX8A 3GNML 2IBZX 3T4AB 2ADGB 3K80A 4OV5A 5C0NC 4MNHB 4KI1A 3BISA 3QNZB 2VXTH 3FO9A 4EDWH 1MY5A 1P1ZB 4OAWB 2YA2A 5M94B 3M17B 2ATPA 1BBDL 2I26N 4N8VB 5E8DH 1FZOA 1PBYA 1WAAF 4X7FC 2DI9A 5JO5A 2GAZB 1XMWA 1JWSA 1DANT 3ECBB 4YK4C 3SGJA 2X70B 1DEEB 4TULL 3AREC 1R3JB 3CNKA 3KPOB 4M02A 4GKSB 1LK2B 3IFPB 4JEGB 2VLKA 2XKNA 4NRYB 5ICXA 5D1ZA 1QQDA 1KN2H 2VXTL 2Y7QA 2XY1A 3ZMRA 2VAJA 3VWJA 5DJYA 2EE2A 5I1HH 4NCC2 2FR4B 3MBEB 2GFBA 5E8DL 4OZIF 2YA0A 2MCG1 1EXUB 5T1LA 5B38G 3VW3H 4LPVA 2XNAB 1T7YA 4NIKB 3DETC 2EKSB 3KS0J 3LPGA 4XWOD 3DO3A 5EBWB 3RBGA 3L3IA 2EDJA 2JJTC 1G6RH 5I1HL 2CQVA 5GGSY 3RFZC 3C5JB 4HUMB 1PEZA 1FFNA 2OK0L 4OCRL 1ZVHA 3PWNB 4OCMC 1FO0B 4O2EA 1EEZB 4P9ML 2EC9T 5D5MF 1CD1A 4O58L 1T3FA 3MV11 1MCEA 4KY1H 3VXTB 4UQ2A 3VW3L 4ZPVB 3B6SA 1JGUH 4F80A 1LE5B 5FUOL 3MRKA 3RNKB 4GRWF 5TPWH 4AEHL 4IS6A 3LEVH 4PJDF 1T0MA 4FQJH 4K8RL 5DVNA 3L3GB 3MGTB 4LEXH 4U6HB 1FVEB 1YMMB 2FX9H 5I17B 1UVQA 4KI5F 3O6FA 5K9KA 1I8LA 1G6RL 1CLOH 2B4CL 2R8SH 1Z9SA 1P7KB 4JY6A 3BIKB 1LO2H 3ARPA 4WJ5B 4F3FB 4YAQA 3S36H 4KY1L 4NQDE 1FBIH 2AXFA 4NFBA 2AQ3A 4ZAKA 2NY1C 3MJ9A 4ODUA 4M48H 3FTGB 1YYLL 3ARVA 2I60H 4LEXL 2CRYA 1U9KA 2FX9L 4DEPB 2DLFH 1XEDA 4UT6H 4WU5B 1CLOL 3UBXI 1WBZA 5DZNA 4JVPA 2B5IB 3RWCA 4X5WB 4XB8A 4RMWA 4YFEA 5C9JA 2PYEE 1LO2L 2ZWLT 1H8SA 3VXNB 1QVOB 2H8PB 5GRYA 3OKLB 2OL3B 3HAEB 5IG7B 2ARJQ 3H42H 4I18B 4R26H 3KVQA 5HYJB 4MSWA 4LQFH 3JXAA 4Z8FH 2AGJH 1FIGH 2IH1B 2X7LB 5KSVA 4KK8D 4R7DB 2R56H 2DLFL 1QRNA 3WFBH 4UT6L 3F5WB 2ERJC 2XXMB 4ORGA 1ZMYA 4PJXA 4M1CC 5IVNA 3IU3A 1MLCA 4I2XA 4HJJH 1B90A 1NGZA 2D7OA 4QCIA 5HDBF 3OAUH 4H1LH 5I16A 5JORB 4ISVA 2BNRE 2R1WA 3F6LA 5CWSB 1F42A 2UZIH 3VFOA 5L2KA 5CEXB 1MFNA 3PABB 5F9OH 4KKCD 1WLHA 4LQFL 1EFQA 1FIGL 4HIXH 4AIOA 5JDSA 4LLWB 2CSPA 2R56L 3WFBL 3PWLA 3BP6B 3D2UD 2YUVA 5ADOH 3DUUB 5J11C 1S3KL 4JO3L 3BYTA 2VXUH 4HKJA 1KFAH 4HJJL 1JHLL 4JJ5A 3VRLE 5CJXC 2VKXA 3FFCD 1RJZA 3GSQB 3UTSD 1U3ZA 3E6FB 1FAKT 1MAJA 4HK3J 2IANA 4L8SA 5E2TL 1HHKA 2X4QA 5EU5A 2YMXH 5J57B 4P48A 1JZ5A 2C3GA 4LQ1A 5GRXG 5F9OL 1RZFH 4V1DA 4HIXL 5F7WC 5CJ5A 3IDNA 1I9RH 2WIIB 2UWEA 4LLUB 3VD9A 1JNJA 1F5WA 1MVUB 1X5HA 3CFBA 5ADOL 5F72S 3TBWB 3S5LA 1P7QB 4KMLB 4JZJB 3VI3F 4WTXA 1FFOA 1KFAL 3L5IA 1VDGA 3NZ8A 1MCLA 3FZUC 1YY8A 4HZLA 2W0FA 3C8KA 3U1SH 5IMMA 2YMXL 2VXSH 1MCHA 5I76A 3KLHD 1U8NA 3L1OH 5J56B 3JWDH 1I8IB 3JTSA 1JF1B 1RZFL 3V95A 5E7FA 3HPLA 4RSVA 1CGYA 3ZT7A 4RA3A 4MJ6A 5B38A 4ZODA 1CE6B 2GSGB 2DYPD 3QIWD 1OP5H 1IGML 1QO3B 2LTQB 3CPLB 3MXVL 4I5BB 4WO4D 1X9QA 3KLSA 1S7UA 4KRPB 1VEPA 5D2NB 1HXYA 4O2CB 4F7CB 2BNUA 4V2BA 3GMNB 3K2UH 2P24A 3MNWB 3U1SL 2UUDK 2VXSL 3AU1B 3OX8A 1NSNH 4HLJA 3L1OL 4HJGA 2E9JA 4PTTB 2VLLA 3JWDL 3BZEB 2EC8A 5FCSH 3TCXA 1J12A 2VC2L 2QSVA 5CJOH 3MLTB 3IGAA 3UTTD 4Z0XB 3MBEC 5DHVH 4ZXBA 1GJIA 1GOGA 4OKDA 5EUOE 1HQRB 4NO0D 1P4IH 3P77A 3A67L 3QHZL 5I1IH 1AH1A 4Z7OF 3BKMH 2H26B 3K2UL 2DN7A 1A8JH 2VQTA 3W11C 5C0EA 1IVLA 2HLFC 2VNCA 5IHZA 1V3KA 1VFUA 3FQXB 1NSNL 4XAKE 1N64H 3B5HA 4XTRC 4N0CD 1YDPA 2IPUK 3ARGB 4IOIB 3UMTA 2DIAA 2WBJA 3KPNB 4E5XA 3TLRA 4DZ8B 2EIBA 3U0TA 3NN8A 4UB0H 2X1PA 1KTLB 5CJOL 1A14L 1KPRA 3E1F1 2OTPA 3FN9A 4GG6A 2ZCLL 4JQVA 2WUBH 4HS3A 4XPAH 4BH8A 2W92A 5DT1L 2GCYA 1BGXL 2EO1A 4TSCH 3T2QA 3RPKA 1FL3B 3QO1B 4YHIA 2FGZA 3BKML 3SQBA 1ZT4A 1U95B 4Z0BL 2EYTA 3IVKB 5E6IB 5FF6A 1K4DA 3CFEB 3V7AE 4B50A 5HGAB 5C6TL 2PXYB 3VXRB 5F6IB 5FOBA 1N64L 3BZ4B 4HUNB 3QO0B 3RKDD 3DX7B 3P4OA 4UB0L 1VACB 2MPAH 3TT3H 5EZLB 2JJWA 1DTUA 2VJXA 2V9QA 2VERN 1OLLA 2DIBA 3W9DA 2A73B 4I48A 2D7MA 5JW3L 4TSCL 4PBXA 1BJ8A 1A6UH 2BNRD 3KYKH 2I9TB 4MQSB 1RU9L 2VIRA 1MFAH 2AK4B 3DSFH 2KQMA 4NNPH 5J12B 4R4FH 5TDOA 2G2RA 4DEPC 4PV9B 1ACYH 4WEMB 1D6VH 4L4TD 2MPAL 1N3NB 3CDCA 4AG4L 4U0RB 1C8PA 1S5HA 1LEKA 32C2B 2B5IC 5D71L 1YEEH 2W91A 2X42A 1SY6L 1HHHA 1MWAH 3HNVH 4A6YB 3GSNH 5C07A 3U9PL 3W82A 3ARBA 3B5GA 1UFUA 3PDGA 4A2LA 3QCTH 1WITA 1A6UL 3MRMB 2A83A 4I18C 3RHWK 3F58H 5HGHA 4NNPL 5ABDE 4D0DB 1UB5B 4R4FL 3QULA 4X4XB 5KN5A 4P49A 3EO1B 3HR5B 1ACYL 4NZRH 1D6VL 1OAXH 5FHAL 4JFEB 1YEEL 4OD3L 4LKXB 3DX9A 4HV8A 5TDPA 3HNVL 3O8XA 1H3GA 1HE7A 3OKOA 4XP6H 3GSNL 2AXJA 3GSOB 3MZGB 2O93L 1F6AA 3ESVF 3MRNB 3SCMB 4CVWA 3F12A 2NX5B 3QCTL 4N5EC 2G5BA 2FBJH 1JPFB 3QQ9C 5EOQH 5IW3A 1CDJA 1SEQH 4QRUA 3CSPA 4X6DF 3SDCA 1NAMA 2XOTA 1NAKH 8CGTA 4NZRL 3QZWB 4MD5A 4YGVA 5CCKH 4R7NB 3DXAA 1S9VA 1A3RH 1QRKA 5SWQA 5INCA 1RK1B 5DD5H 4XP6L 2DWDA 3LPWA 1TZHA 5KANG 4M5ZH 3HR6A 2D0GA 1KT2A 3ZKQD 4MA8L 5F7DA 3W0WA 3LH2H 2BOCB 4GRMB 1I1FA 5DEGA 2FBJL 5BOPA 4LNRB 1N0LA 1A7RH 3F7YB 5JHDB 4YPJA 3SDAB 4UIKH 5LGJA 1BBJA 2CR3A 5TFSH 1SEQL 3D3VB 2BY3A 4Z18A 1IC4L 25C8H 3IDIA 5DJAB 1PDKA 4XCYB 1UC6A 4EN3B 1A3RL 1QLFA 5JLZB 1A22B 1K2DB 4G43B 4JZJC 4PJXE 5DD5L 5C3LD 1UA6L 4JG0H 3AROA 2EYSA 4K9EC 4QGTA 4BZ1H 3LH2L 3IDJB 2VE6B 2XIDA 4CMMA 1WBYB 3TYGH 5ITFB 5BS0A 4Z5RB 1FC2D 4PD4K 2NXYD 2VYRE 4Y4HA 4MD4A 3MO1A 5I1DA 4QHLA 3NBNA 5HJ3B 1F3JA 1R24A 3EYSL 3S36X 5H35B 5TFSL 5L2KE 1G7LA 4XNXH 2NPLX 3N50A 1ZGLM 4I0PA 2LE9A 1GC1L 4CVUA 5KVMC 4L1HA 1O0VA 3GIVA 5FO9B 3R4DA 1BQHG 2DQJH 5ID0A 2H6PB 3OKEB 2LTQC 2E8ZA 5DFVD 3G6AB 5DMKB 4KRPC 1SQ2N 5D2NC 4JG0L 5C09A 5DC0A 5F1IA 1N59A 3ZO0A 3TH3T 3TGXA 4BZ1L 5GRVL 4LGPB 4WFHD 1KELL 4KTEH 3V6ZB 2VLKD 5IF0B 4OCWH 1A1MA 3IJHB 4XNXL 3QDGB 3MJ7A 4QRSA 3O6KH 1J0IA 3VWJD 4J3SA 1C7SA 5L6YH 1CFNB 1IM3A 1LDSA 2FATH 2QEJA 4HIEB 2DQUL 5CZVL 1PG7W 5E00B 1ZA3B 2D0HA 7FABL 2VXQH 4D0BA 5T1LD 3CFDB 4KTEL 4JHBA 3ARGC 4GQPH 5TH2A 3F7PC 5DK3A 4QRRD 4U7MA 1Z9OA 3HZMB 4FTVB 1OF2A 3O6KL 5E1AB 1G7HA 4KK9C 4MXVE 4XP9H 4Y88A 5E24E 2FATL 3O45A 4PJCA 1KCRH 4ELMB 1E4JA 2NR6C 5E2WL 3LS5H 3FL7A 4DOHE 4CNIB 3ARXA 1DANU 2A6JA 1J0ZA 4LSTH 3EDEA 3O4OB 2VXQL 3P4NB 1AFVL 3S37L 2OJEA 5B4MD 1P4LA 1A1OA 2BHZA 2PXYC 5DJZA 5E8OA 5L2JA 4HUKB 3MA7A 5F6IC 4E41B 4PJGA 1W72A 5MP6H 3PWUA 2JIXA 1H0DB 3E3QE 3O6FD 3L5XL 3VMPA 3QI9B 4XP9L 2XT1B 2GK0B 4AMKH 3V5HB 2ITDB 5DVLA 4LLYB 1X44A 3D1MC 1AY1H 1ZVSB 1G0XA 2XXCB 1Q1JH 3O4LD 2F53A 1SJEA 1RZKC 4LSTL 3D85B 4C55A 1RPQA 4UDTB 1BHGA 2XN9A 3RVWD 2R2EA 4OJFH 4ZQKB 3VA2C 2HVJB 15C8L 3QEUB 2CMRH 5C08B 5J12C 4ZAKD 3I02A 5D7JA 5MP6L 1MCJA 1C5CH 4MNQA 4ETYA 4U0RC 3Q48A 5F9JA 2ZUTA 4H26A 3VD5A 4BUHA 4S1DD 4HEME 4P3DB 4ZUSB 3BT2H 4AMKL 4GG6E 2FX8L 3CDGA 4XVTL 1AY1L 2EC9U 5C0BA 3DVGA 3S7GA 4RMVA 1Q1JL 4P0DA 1RIVL 3T3MF 4MQTB 3JUZA 2E7HA 3VI4E 4M6NL 1FVCA 4LSSH 4OJFL 4AQ1B 3GGWA 2H1PH 2OS7A 3PWVB 1U3YA 2YRZA 5F7FA 5L7XH 1LWRA 4WU7B 4Q74A 3GJEB 4UUJA 1C5CL 1U8HB 4Y4FA 4JR9L 3GDBA 1QRND 3TIEB 1JYXA 4WI8A 4YHOL 1CU4L 3ALXA 4XC3H 2XRAH 3UDWC 3SCMC 3V8OA 3P4LA 5HGGS 5FFLA 4GAYB 1A02N 2C4FT 2BDNH 2ZOLB 2H1PL 4XXDB 1XIWA 1XGRA 5L7XL 3BDBA 4JFHD 4WHDA 1CQYA 3RWEB 3RUGF 4DAGH 5L2KD 4S1SL 5CIPB 2YRLA 1F90H 1WZMA 4KJYB 3IJYA 4X6BA 1CFBA 3LMJL 1CL7I 4O9HH 4XNQB 2NY0C 3BQUD 1CGUA 2H32B 3NACL 4XPBH 1T04A 4OD2B 4U1JA 1RZGB 4XC3L 2XRAL 3BGMA 1AGBA 5C07E 1XF5B 1IAOA 4PGJA 3OSKA 2VZTA 3JVGA 3FO1B 4KUCF 4YHNA 1K5NA 2XTJE 2PNDA 3SDAC 4U4BA 2IAND 4NWUL 1BQHA 4XZUB 4KUZL 3RVVD 1RZ8B 2QR0B 4DAGL 3PV6A 3GMRA 2DTMH 2W38A 1F90L 3UPRB 4FZEH 4HCRA 4V1DD 3PHQB 3U36A 1PZ5A 4EN3C 4O9HL 3O3EB 2AXHA 5KVDH 4MVBD 3TVMB 4YR6B 3MJ9H 3HZKA 4XPBL 2RCSL 1S7RA 3D69B 3VGGA 5HHPB 1U8JA 4LASL 1A6ZA 2VDLH 2BSED 5C0AA 5HYQB 4JO1L 5D7IF 1OQOA 2DL9A 1SYVB 1SVZA 5F93C 4FZEL 3CXDH 3ET9F 5DK2B 2A0LC 5KVDL 1I3UA 4Y5YA 3DXAE 4X6CB 3LKOA 3K74B 4TUOA 3SDYH 2HN7B 2FX7H 2J8UA 3NCYS 3UXFA 3MFFB 1KXTB 4YUEL 4EVNA 4M1DH 2NY6B 5IVZA 3VGDA 3W0WE 1U58B 1BZ9A 1WICA 4Z7WB 3ESUF 3UAJC 5FECA 1YPZB 4I8DA 4Q6YA 1MI5A 4HGMA 4W6XB 2E9IA 4RZCB 3QP3A 2AV1A 2I24N 4ZDHA 3B9KB 2PTTB 1A7PL 3T0XA 4ZO8A 5I19H 3CXDL 2QADD 1WWCA 1FIEA 4XCCH 2E7LA 3FB7B 5HI5D 4ZFZB 1MCWW 4ZXBD 3SDYL 1F4XH 4ONOA 4ZFOB 2Y5TB 3MRRB 4ZUVA 4PJ7B 1M7DA 4QHUA 4N1CA 2X4SB 4I4WA 4JFYA 1AJ7L 3FT2B 3LN4B 1GZQA 4NOBA 5BS0E 4DUWA 5GS1B 4ETQA 5IQ7H 5TGBA 1PKOA 4OFDA 3ZLQC 1P53A 3WEXB 2ATKB 1UEYA 5IB1B 1UJTA 2WBJD 2ZNWA 3P0YL 3RL1A 4TNVF 5I19L 4QNPE 3B9DA 3OJMB 1Y0LA 4W6WB 1OT1A 3C6LB 1RUML 1ZXQA 1G9NH 3MRBB 4QF1B 3HPJA 1F4XL 5I18L 3O4OC 3CVHA 3B83A 1F3RB 2P46B 3HI5H 5EO9A 2XWTB 2AJUL 2DTSA 5I1LA 3CC5A 4YHZH 3LKNB 3LVEA 3HI6L 1UKQA 3L5JA 4XVUC 5GJSH 2AV7B 4NUGL 5IJVB 2ZUXA 5IV2A 3ZDYF 3BH9B 3QI9C 4N68A 1HDMB 1LO4H 2GQHA 2G5RA 5C9KA 5E2UH 3TF7C 4G7YH 2XPGB 4OCXH 3HI5L 1A3LH 3PDOA 4KWUA 4YHZL 1A4JB 1INDL 4H5SA 1ORSB 2A74B 1NDMA 2P42B 3NIDF 1ZLUK 5ACLA 3HMXA 3GKWH 1MHHA 3ZYJA 1LO4L 1EDQA 4J12A 4X83A 3MV01 4PRAB 1KPVA 1CDCA 3SOBH 1U8PB 3AAZA 2HFFB 4F7MA 1UENA 5DXWA 4K3EL 1RI8A 2XZZA 1LILA 5C07D 5BRZA 4OCXL 4ZS6D 3ARBD 5HDQH 2F5BH 1LD9B 1ZS8B 4HS6A 3T2PA 4PREA 1B2WH 1KLUA 2Q3ZA 4WV1A 4XX1E 5ISZA 1ZT1B 3TBVB 5J6GB 5KZCD 4NO5A 3RWDB 1A7NH 4P5TB 4QHMA 3LRSB 4PJGE 1NC2D 5JXED 4KZEH 1I1AA 1ZHNB 3NIFF 1U6AH 2J4WH 3GKWL 2Y72A 4WCYL 3H7LA 1N2RB 1LE9A 4XNYH 2OJZH 3C8DA 2MKLC 5ICZB 1MJJA 2D31A 4IIQB 3SOBL 5GZOD 1BOYA 5EFIA 2Q20A 2FLRT 3MV9A 3G04B 2F5BL 2XN9E 1U93A 2X41A 4LCIH 2CLRB 1MFBL 5AD0B 3G5VA 4U6XA 5JPNA 4QGYA 1SMAA 1A7NL 1TNMA 1DBAL 4RIRA 2IALA 4KZEL 5JIHA 2J4WL 4MNQE 3EUUA 4LVHB 1BF8A 4OIBA 3HG1A 3BYYA 4P9HH 4JDVA 3DXAD 2OSLB 4XNYL 2OJZL 4HFUH 4J8RB 2BVQB 3BMVA 2G9HA 4F7TB 1WSST 5C0BE 5HHOE 4H1LB 2WIMA 1I3RA 3WKML 4M1GH 4LGRB 4G8FA 5HI3C 2NY3B 3KJ6H 3MOBL 3ELAT 4TSBH 5EC2B 1TVHB 1ODAA 1UXWB 1N8ZB 4PJIA 4H88H 1CVSC 2AXGA 3TVMC 4NPYB 5FGCE 4X6DA 2CXKA 2AJYH 4LLMA 4HWEH 4HFUL 1B88A 1Z9LA 4JHWH 4HPYL 4M1GL 4ZSOA 1BD2A 1UCBH 4Y2DB 2EXYC 4CUCA 3CGTA 1A6VL 3P9WB 3TJEL 4WW1B 4Y4HD 3OR6B 1JZ8A 2VDOH 1EAJA 4RAHA 2VUYA 3ALWA 4I0PD 4H88L 3I75A 1HH9A 5CHNB 1DLFH 1S78D 1JGEA 2AJYL 3PIQB 4YQXL 4JKPH 2NY6C 4LLQB 4JHWL 4YHMH 2WINB 2VB5A 5C09D 3BIAX 2XFXA 4FA8A 5A2LH 2PO6A 1QKZL 2CUMA 4P4KB 1CVRA 5F3HA 5JIPA 1UCBL 3VXUB 5MEOB 3P73A 2OI9B 3VCLB 3DGGB 2G75A 2VDPL 4OM0H 4TRPL 1CFQB 4FQHB 4HUXA 1IBGH 5MERA 3B9KC 3QEQA 1YEJH 1UJ3A 1BEYH 3QFJA 2DLHA 3RKPA 5FM5M 1MAKA 1HNFA 3UTPE 3V4PH 1EHXA 2VZ3A 3OPZL 1MFDH 5HXMA 2KUTA 4WHCA 4B7IA 1J5OL 4HF5H 4GT7A 4HGWB 1KULA 3MLXH 1U8IB 3ARDA 1NAMH 3U0PA 1UZ8A 3PP3K 3NH7H 5GS1C 3VFSB 4HWBA 2BC4A 3HI1B 3GMQA 3HRZB 3QQ4B 4C56B 4G8IA 3C9NA 1MJ7H 4BFIB 1BEYL 3TBYB 5DRZB 5F6HJ 3C6LC 4FQLH 4S1QH 3V4PL 4PGBB 2AABH 5JIKA 3O3AB 3L3HB 3M07A 3WLWD 4HF5L 4APQA 5CKAA 1OGTB 1RZIA 2Z0BA 4OI9A 3OKNB 5TQ0H 4JRWA 3H7BB 2E3VA 3MRCB 3TNNB 2EEBA 3O0RL 3FHQA 1JGLL 3KPQA 5DC4B 1MI5E 5J6HA 3UTSB 2JIXD 5C8JA 5IQ9A 4ZG1A 4HJ0C 2QSQA 4CDHA 1X7QA 4KJQD 1B0RA 3STZB 4U6VH 1XGUB 3QNYA 4FQLL 4NSKA 4P5MA 4S1QL 4P46A 2AABL 5F70A 1F97A 4NP4H 5DMIL 3ZSSA 4O4YH 4GG8B 2F53D 1MFCH 5B3NA 4FFWD 5TQ0L 2I07B 1P7HL 2VDNH 1OM3L 2XN9D 4KJPC 1PD6A 1X5ZA 1XGTA 3MA9H 1QSZA 4HIIB 4NM4L 1HN1A 4OFYA 3QDJE 4BH7A 4PJ5A 4OIAA 2Z93B 4EBQH 1BX2A 5D7JD 5SWZD 4KVNH 5MI0B 4FP8L 2FJFA 2BVOB 5GS2D 1EFXD 4G8EA 3VGAB 4MNQD 1XZ0A 1IAKA 4MWFA 2PCPA 4N90E 2C3VB 5JMOC 4X5XA 5EPMB 3NCJL 4KXZH 3IKCA 1ZHKB 5C0DB 4NP4L 4KI5D 4HDIB 1RUAL 1Y6NR 1HSBB 4I3RH 5D93B 5AEAA 3DOSA 3O41B 3SGDH 1OHQA 2DYPB 3BUTA 3QIWB 5JR1H 3MA9L 4P5TC 4UV4H 2VXVH 1DQJB 3K4DA 3OXSA 4X0KB 4NT6B 1J05B 2X4OA 1HNGA 3QXDA 3RGVA 2E7MA 1G9EA 2NW2B 1BF2A 3QXWA 4Z7VE 4UU9B 1RK0B 2FLBT 4Y4FD 1A7BA 4IIQC 4U1KA 1MWAB 1TLKA 1XCQB 2X4RB 4W4OC 3DWTA 3IF1A 3I9GH 3QPQC 3LHPL 5F8RC 4I3RL 2ADJB 4IRSA 2AQ2A 3M45A 3QXUA 4IRJA 5JR1L 4S0SD 4L4JA 1AXSA 1XIWD 1HSAB 3S4SB 2C1PA 4A2MA 5GS0D 5KOVC 4LVHC 3S88H 4NQDB 1FH5L 2LAGB 3UTQA 4PJEA 3WFCH 3WFHA 7CGTA 3PWJA 1MAMH 5EU6A 1OD9A 1W72H 5ID1A 5DRNA 1IM9A 2CK0L 4PG2C 2HFGH 4WW2A 1LNUB 2CO7B 2BSTA 3ZKXB 2NY3C 5BRZE 5FEBA 1T7VA 1XGPA 3NFNB 1GGIH 2C1OA 4LFHG 1LEGA 1WTLA 4J3OC 1ONQB 5FDYA 4NKOB 2PYEB 2DQDH 1A6WH 3X12A 4D9QD 5DRWA 2HG5B 5IROA 3MRHA 5F7UA 1FNSL 1U2CA 1XAUA 3WFCL 4FQ1H 1NJ9A 5C0RH 4JPIA 1MAML 4R6UA 1NCDH 1W72L 3FQRB 3MRQB 1NUFA 4BYHA 4KMTH 5GS2H 3FO2B 4Y2DC 3VRJB 3DURA 1GGIL 3CFIC 4P59L 3WJJC 1KC5L 1RD6A 4KVCH 2B39A 2DQDL 5C0AD 1A6WL 4EUPG 3IXAA 4DUXA 2YUZA 4M62H 4WWKA 2BNRB 1I7UB 1DFBH 5F9DC 3UC0H 1OCWL 5KSAB 2NXZD 3OGOE 4U1LA 2X1QA 5C0RL 3GSWB 1S7TB 2RFXB 4ZYKB 1QFWL 1CBVH 2BVPA 4K7FB 4KTYA 4TUJB 4U1NB 4KMTL 5EULV 4L4TB 1KJ2A 4J2XA 4P4KC 1OVZA 4F9LC 5CEZE 1JNHB 2OI9C 4ODWA 3O2DL 4WWID 3JWDC 4KVCL 1V3JA 1W0VA 1MRCL 1U91A 5SX4I 5CJXA 4DWHA 1JPTL 3T77B 3L7FB 1CCZA 2XG4A 3TIDA 1QR1A 5J1AB 5BZDA 1DFBL 4PJIE 4I1NB 3WE6B 3MJGX 4PJ9B 2LU7A 3N9GH 3IAQA 1CBVL 5GS0H 2RJMA 2R1XB 3ZKSD 5FKPB 5BVJB 5DSCB 4PJ8B 4HG4J 5BQ7B 1BD2E 5KS9A 2EH7H 3F7VB 4LLVA 2HT3D 1IZKA 2JB5H 1TNNA 4NUJB 3CK0H 4MNHA 1XF2B 3X11A 2V7HA 4XPGL 5ETUB 4KKCC 4N90D 1FE8H 3N9GL 2FH6A 2H3NA 3KYMB 2YPLA 4OAWA 4XNMB 1TFHA 1T0NA 5JUEL 5CAYB 3HC4H 5GS0L 1HKLH 3M17A 1YEFH 4FFVC 3W39A 4HCRH 3DLQR 5GRVK 3C87A 4EDXB 5GSRA 4HFWA 4HUWA 3ECBA 3HCVA 4YE4H 2X70A 2EH7L 3DIFA 3L5WB 1GZPB 4HXBH 3VA6A 2JB5L 3QEQE 2DI7A 2X4NA 3QUKB 3CK0L 2FNBA 1SJHB 5DD3H 5IM7B 3ISWA 5KW9H 2V5MA 4ELMF 1FE8L 2D7NA 5HYSG 1M4KA 1N0XH 3IDMB 3BEVB 1U36A 3HC4L 1HKLL 1YEFL 1U8LA 5CSZA 4HCRL 5C3TA 5GZND 1R5VB 3VFPA 5D4QA 5IB4A 4RGNE 5TDNB 4Q97A 1H3TA 1MUJB 1I3GH 1Q94B 3T65B 3B2VH 3QPXH 1X5FA 1BOGA 1VFMA 4BSVA 5EUOB 5MI0C 3RY6A 4HXBL 3VGAC 1T1ZB 4I77L 4N0FB 4UOW0 3CZFA 2ZUQB 1JJUA 2NXYB 3DX8B 4MB5A 1JUFA 5KW9L 4OV5B 5EBWA 5IT2H 3Q0HA 1N0XL 3GBMH 3FO9B 5D93C 4JN1L 4U1SA 2W07A 4JZNB 4L29B 3QIWC 5D2LA 1JP5A 4S2SA 1FO0A 2QQKH 1I3GL 2ATPB 5I66A 5ISZD 3B2VL 3QPXL 1FZOB 4WFFE 5JO5B 1F13A 5C0GB 4ZPVA 1DVFA 4Q9RH 1ZE3C 1I1AD 2X5PA 1UZ6E 1EX0A 4LAJH 5GQBA 4U6HA 2B1AH 2YXFA 2XKNB 5ICXB 4P3CH 5D1ZB 4JGMA 5IT2L 1QQDB 3ARZA 3JZ7A 2Y7QB 1YY9C 3WHXA 1IMHC 3MV9D 2YXMA 4P2CG 3NCFB 3VWJB 1BFOA 2X2YA 5DJYB 4KJWD 5F1OB 2ARJB 2QQKL 2BX5A 4WJ5A 5H94A 2GFBB 3FO0H 4J7RA 4XPFH 1CD8A 3RVUD 1BZQK 3RY5A 4ODSL 3CVHH 1F8TL 4Q9RL 4CU6A 5T1LB 3GK8L 5A2FA 4NZJA 2NTSP 2EICA 3HG1D 4G9FA 3RJDA 1DUYA 1OLZA 5GRUL 2B1AL 4P3CL 1NL0H 3WFDL 3RRQA 9CGTA 4JPWH 3CLFH 4M93B 3I6GA 5J89A 3ZKXC 1NFDA 1U0QA 3OKDB 5MEQA 3L3IB 3MRFA 5IHUH 3U4EA 5EZIL 1NEUA 1MIML 4X5WA 3V6OA 3AFLA 1YMHA 4RGMC 4OGXH 3VXNA 4PRDA 3FO0L 3H9HA 4OUUB 4O2EB 3OBAA 3SHSA 3OKLA 1CD1B 1T3FB 3CVHL 4U49A 4ZFFA 4I18A 4UQ2B 3B6SB 5IOPA 43CAA 4KHXH 3MRKB 5E94A 3RKDC 1ITBB 4IS6B 1HILB 3KPSA 1T0MB 2E8YA 4JPWL 3WDIA 1NMCB 2GI7A 3HMXH 1UVQB 1Q9KA 2DM7A 5K9KB 1T66D 4MJIA 2HRLA 1BD2D 4X4YA 4OGXL 1DE4A 3TO4A 2GITA 4YAQB 3K1KC 1PSKL 3OF6A 3VXPB 2WWKT 1FNFA 5KSAC 2AXFB 4RFEB 1BIIA 35C8H 4ZAKB 4ODUB 4PJEE 1DN0A 3P11H 4KDTC 2W65A 4GMSL 3QYCA 3O3BA 1K8DA 4N0UE 1Z0NA 1WT5A 1V05A 5TQ2L 3TO2A 3LS4L 3N85H 2V17L 1QBMH 2YK1H 4E42B 5F3BA 1MOEA 2GY7B 2P8MA 3ZT5A 2PF6A 3GSQA 3RWCB 5C9JB 1MFEL 5ICYA 3ZSTA 5DHYB 3QFJD 3GMOA 4PJ9C 35C8L 1ULVA 4ZO9A 3CLEH 1E4WH 4X6CF 4F2MA 2WIIA 3HS0A 4QXGH 5C7XH 3BWUC 3EOAA 4LLUA 5KSVB 2K7QA 4PJ8C 3CIQA 3ARDD 3N85L 4FS0A 4RGND 1QBML 5DUBA 2YK1L 4WRLA 4JZJA 1TCRA 4Z7WF 1MVFA 4ORGB 1YPZF 1C7TA 3GIZH 3LY6A 2P49B 4UT7L 4PJXB 3MNZA 3IU3B 2EIEA 5J06A 3EYQD 4WHTA 1MLCB 2CDEA 4LSRH 3W9EB 1NGZB 3EOBA 5I16B 5TE6H 5CEZH 4ISVB 1H3UA 2AK1H 5FYJU 3VFOB 1DDHA 3CLEL 3K8MA 5F7HA 3E6HA 3ZKNC 5L2KB 4F33A 3CX5K 1EV2E 1ZEAL 4QXGL 3VWKB 1GAFH 5A16B 3RIFF 2GSGA 2CDFA 5I8EA 4MA3A 1F58L 4NC1E 3MMEA 4PJ7F 3OKYA 3PWLB 4K7PY 1BJ1H 4Y16A 2JB6B 4LPWA 3F6IA 3ZYOA 4HKJB 4JJ5B 5C0CD 5TE6L 4GSDL 2IANB 4L8SB 4PTTA 1HHKB 2X4QB 1VPOH 5EU5B 1ES0A 3OZ9L 2DBLH 4P46D 1GAFL 5I6XB 3WL9A 3IDNB 3MV7E 2E9BA 2JJSC 1HQRA 3AM8C 1WCBB 3CFBB 3O2WH 3VD4A 5DS8A 1JVKA 1HCVA 4OFYD 5FA4A 1QFUH 2R29H 1T89A 1AHWA 3C2SA 2C7UA 1FFOB 1DSFH 4PJ5D 2DQFA 3B5TA 3O11B 3EOTH 2CUHA 5ESQA 5JZ7D 2NXYC 3CU7A 1YY8B 4HZLB 4XBGA 3DETD 2W0FB 5D7KE 5IMMB 4IOIA 3KPNA 5I76B 2NNAA 1U8NB 2Q7YA 2KZ1B 2YPLE 5EU4A 3HPLB 4MJ6B 1Y6KR 5B38B 2MCPH 1NBVL 5DFVC 3S96A 2NLJB 1N5YL 3CD4A 4JM2A 3O2WL 4DOHB 5E6ZA 1QFUL 1U95A 3SGJC 2OLDA 2R29L 1S7UB 1DSFL 3RGVD 1HXYB 2BNUB 2PXYA 3FHAA 1I7RB 5E2JA 2P24B 1I9EA 5D1ZC 4K23H 4JRYA 3OX8B 4HJGB 1PY9A 2VLLB 4WFGD 2Z91A 3VWJC 3A0OA 2HT4C 1NMAL 3V0WH 1NCWH 4IRSD 1QFOA 1Z3GH 4ZXBB 2XZCH 3M8OL 3QCUL 4XCEA 4ZOEA 3VXMA 2L0DA 1G1YA 3P77B 1JTPA 1T1XA 5BVPL 5C0EB 2NY1D 5IHZB 3OGCA 5K33A 4HWBL 3QWRA 4PV9A 4M93C 1INEH 1YDPB 4YH6A 5I0ZA 5EU6D 2WBJB 4E5XB 1CDBA 1BIHA 1IM9D 2VZUA 5MEPB 3U0TB 3NN8B 3E8UH 3V0WL 1NCWL 3QBTB 5DC9B 1J8KA 1A4KA 4C59B 4GG6B 1WZKA 1Z3GL 2WK2A 5K9OB 4HS3B 3NVQA 1VGEH 1H3XA 2GCYB 1RZ7H 1VGKA 3BE1L 3IDYB 4KK5C 3LSOA 4YHIB 5SX5H 4X99A 4K94C 1CR9H 1ZT4B 5C6PB 2EYTB 5AWNH 5FF6B 1K4DB 2VDKH 1CLZL 3HR5A 1INEL 2LAAA 1NMCC 4LVEA 1A3QA 3OMZA 3QJFB 5BCAA 1I8LC 3P4OB 1FAIH 3E8UL 4BSJA 1J88A 5EZOH 3W9DB 4I48B 4M1CD 5F7YC 1VGEL 2DMBA 2NX5A 3LRGA 1HHIA 1D7FA 4OFKA 3SGEH 1D5BA 5IB5A 4WWKD 4ZAKC 1CR9L 5KSBA 5EU7C 2VIRB 2VDKL 2VMFA 5CGMA 4G9FE 4XCFH 3RX8A 4NWTH 4FQQB 3RIAF 1EZVY 3P0VH 2G2RB 4S1DC 1ADQA 4NQSA 2E7CA 5FCUH 1NFDE 3W81A 1FAIL 4OGZA 3GSRA 3TPUB 1K4CA 1LEKB 5EZOL 3MLUH 1MCSA 3V6OE 3RPIA 1HHHB 3QFDA 3B8SA 4GRMA 2ICES 5C07B 3M1BA 4ODHH 4OKVB 3F7YA 1KGCD 2XTJB 1NCNA 3SDAA 1R5IA 2VLMD 3SJVA 1JPGA 5F1SA 3D3VA 3RX5A 1V7ML 5HGHB 3LEXA 3DHJA 1YEGL 4XCFL 4NWTL 6CGTA 3KPSE 3QHFH 3NABH 3GI9H 5FCUL 2X44D 4RMRA 2OQJA 3QUYA 4JREB 2BJML 3MLUL 3DX9B 4HV8B 5TDPB 3O8XB 3OKOB 2QQLL 2VE6A 2OTUA 2CPCA 1RHHB 4ODHL 4NO2A 1F6AB 3S35H 3NIGF 3F12B 5HVFB 4OCLC 2G5BB 3FZUD 1FSKB 1QBAA 3S8WA 1JBJA 3PGFH 2IBZY 3HZYA 3VWKC 3OAYH 4HAGA 3SDCB 2VO5A 1G6VK 2YPLD 2FIKA 5BV7H 3QHFL 1CK0L 1NAMB 3GI9L 4MD5B 5EZJB 3OKEA 2HA1A 3SE8L 3DXAB 1S9VB 2ZUYA 4YZFF 1U3HC 5SWQB 5INCB 5ILTH 5GGVH 3O6LH 4DN4H 3WIIL 2ADFH 4FHBD 2VR9A 3FOLA 2DWDB 4RISL 1TZHB 1KT2B 5T1DH 5F7DB 5F7EL 3W0WB 4L8SC 3S35L 1F6FB 1G9NC 2IMNA 1I1FB 5DEGB 4LSPL 3IJHA 3QDGA 4L4VA 1RJLA 3U4AA 5LGJB 5C0IB 5I6XC 2LV4A 5FV1L 3T4YA 5BV7L 3V0AC 3IDIB 4BQBA 1MF2H 3MBED 3WDJA 4UV7H 1QLFB 3MLSL 2RAMA 5GGVL 3O6LL 1P84J 4DN4L 2ADFL 5HHQA 2EYSB 4NBXB 2JCCE 3DMMA 3CSGA 5HHVH 1R3HA 4WFED 1PYWA 1KJ2H 5DD1H 1G7MA 4XXCA 3W11D 4CMMB 1YNLH 5BS0B 3MUJA 1FYTA 3WFEH 5JOPD 4Y4HB 4MD4B 3MO1B 3WN5A 4FTVA 3BDXA 4QHLB 5I1DB 4XTRD 1NFKA 1G7LB 4Y19A 3WXWH 4I0PB 4NZUH 3JV6A 1MF2L 3GIVB 3MRGA 4UV7L 4WUUE 4UINH 5ID0B 3P4NA 1H3WM 5D72L 5B8CB 1P9MA 2DM4A 2FL5A 4U31A 1MEXH 1DVFD 5TF1H 5HHVL 2OBGA 3JSSA 1KJ2L 4MDIA 5FYKD 1T20A 1YNLL 4LFHD 1JYWA 4LRNH 3WFEL 4D9LH 4GAFB 1KYOK 1A5FL 2DDQH 4JFZH 1H0DA 1A1MB 4BUGA 3E3QC 1EJOL 3MJ7B 5FV2A 1G84A 4OCSH 4ZO7A 4JCLA 4QRSB 4HBCL 2OXGA 4LLYA 1KCUL 3BJLA 4ZXBC 5IFHH 3WNKA 1SYSA 3MRPB 1IM3B 4UINL 1WAAE 4ZQKA 4XMPL 1G0DA 3RTQA 3UBXG 3QEUA 2BERA 4D0BB 1MPAH 2BHYA 4GS7B 2OMNA 2XQYG 4CVXB 1JHTA 4YWGH 4LRNL 2X6MA 2Q8BH 4D9LL 3MRJB 4QXTA 3STBA 5TH2B 2WBJC 4HHAA 4JFZL 4PV8B 4PJHA 3AS3A 3ZE0F 4MAUH 4HEPG 1OF2B 3ROLA 1G7HB 1NEZG 1WC7B 5L0QB 5IFHL 4JQVC 4PJCB 5MHSD 4OIIH 5LBSH 3IDYC 3D87B 2E27L 4M9OA 2A6JB 4KQ4H 4P9HC 1HHJA 1IFHH 2OJEB 3SDDB 1P4LB 1A1OB 5L2JB 5E8OB 3ILQC 3RZCA 4XWGL 3WHE1 3MA7B 2Q8BL 4JO2L 4PJGB 1W72B 3PWUB 1H3PH 2JIXB 4D9RE 4MAUL 4DVBA 4J3UA 4BK5A 3OHXB 2HTKD 5HGBB 4MJID 3R06B 1U41A 2VDRH 4OIIL 4M7LH 1CE1L 5B22A 4RCAA 4O00A 1BJ1J 4PB0H 3VXME 4LHUG 1SJEB 2ZOLA 1T2QH 4HC1L 2XN9B 3OF6D 3MLWH 2R2EB 1IFHL 1MCWM 3QQ9D 2BVUA 1NDGA 3DVNB 4KJYA 3I02B 5D7JB 2D7QA 4XNQA 3RX7A 4PJDE 1CGWA 1MHPH 4MNQB 4JM4H 5F9JB 3N0PB 5FYKH 2P8PA 3CDGB 2VR5A 1KUMA 3LZFH 4M7LL 3CFCH 4M7JH 4NHCH 1JGDA 5C0BB 3DVGB 4PB0L 4YIQA 2XTJC 1E28A 1A21A 1AC0A 1T2QL 3G6JA 2DLGA 1KB9K 4W81A 2V5TA 1RZ8A 1FVCB 3GGWB 4OI7A 1FO0L 3WYRA 2FWOB 4GMTL 3KG5A 1KLGA 2VAAA 5JW4N 4UUJB 3JV4A 2IFGA 1MHPL 5FXCH 3D0VA 3QDAA 4JM4L 2IG2H 4Y4FB 3STLA 3K8LA 5T33H 4JREC 1IGIL 3TESA 5FYKL 1H5BA 3O8XC 1P7QD 3I6LD 3LZFL 3G5XA 5LQBL 1KIUA 3VRLF 5A40E 4NNYA 4F7EA 1FSKC 2R23A 4N5UA 3GHEH 3V6FA 3T09A 3NTCH 1XIWB 1XGRB 4N8PA 3L3KB 1ZLSH 3SDCC 2HTLD 5DJ2A 3GM8A 1Z6JT 4X6BB 2IG2L 2V5SA 3PE9A 2BMKA 1TZIB 3R0NA 2VSDA 5CILH 5DJDA 4XCNA 4Y16D 5CGYC 1T04B 4U1JB 3BGMB 5CP3A 1AGBB 4M7KH 1FV1B 1IAOB 5JXAH 5CKGA 1IQWH 3FB6A 3T2OA 2NTFB 5SWSE 3PNWA 4YHNB 4U7SA 2KH2B 1BQHB 3SJVE 3O2VH 3NTCL 3VE0B 3OL2A 2EDEA 3U9UA 2PTTA 3RI5F 3PV6B 3GMRB 3L3OA 4PLNC 2APFA 5CP7A 3QH3B 4U33A 4ZFZA 3U36B 1PZ5B 3S97C 1L0XA 4LRIA 4LIQL 4G6MH 2Y5TA 5CILL 3TFKC 4HKBB 3V2AR 1TZGL 3HZKB 4HK3N 1S7RB 5AZ2H 2X4SA 4M7KL 1U8JB 3FT2A 1FG9C 3LN4A 5JXAL 1T5WA 2AQ1A 1IQWL 5GS1A 5DLMH 1QSEE 4FFYH 4Y4HC 3VG0H 1I9IL 3WEXA 1YJDH 4EOWL 2X1XR 3O2VL 2R2HA 4I9WD 5C0AB 2ATKA 1LEIA 2CO6B 2ZSVB 1MCOH 4G8GA 5DQDH 4I0PC 3C5ZB 4MS8C 3WJLC 4OI8A 1QBLH 1XCTA 4CU8A 4KK9D 1UH2A 3RWFA 2NXZB 4G6ML 4Y5YB 1KCLA 1CG9A 3LKOB 3SKMB 3OJ2C 4TUOB 3T8XA 5EUOF 5B8CC 4DCQA 4JM2D 5AZ2L 3WS6A 4EVNB 3VI3E 1NEZA 1FFQA 4U3CA 1BZ9B 3VG0L 2PXYD 3VXRD 1KJVA 1KIPA 2AV7A 5FECB 5IBUG 4G6FD 2KL6A 4JRYD 2J6EA 4W70A 1MI5B 5KG9A 3ORJA 3UJIL 2DKSA 4EKXA 2X4TA 3ARTA 3TJHD 1T5XA 4ZOBA 1GYAA 4FXKB 3DVFA 4YEEA 2VZSA 4LCCA 3ES6A 3WXVL 1BZ7A 5LWYH 3C08H 2XQBH 4GW1A 3FN3A 4XVJH 4F9PA 3VXMD 2APTA 4LDLB 3WO4B 4GS7C 4ZUVB 4QHUB 1M7DB 4I4WB 2AK4D 1ORSA 4JFYB 3BMWA 2A74A 5D1QA 1AQKH 3H0TA 1GZQB 3P30H 2P8LB 4LK4A 3SBWA 1FYTE 4ETQB 1VFOA 5TGBB 5BMFL 3S35X 4RA0C 4LHUA 1G0YR 3C5SA 1SBSH 4K9EL 3IETB 3CU1A 5L0QC 4Y19E 5K59F 3RL1B 3LPFA 5E99L 4DGIH 1Y0LB 5FO8A 3GEWB 5GSVA 5LWYL 3HPJB 3C08L 3BXNA 4XVJL 3CVHB 3LRHA 5EO9B 3SDDC 5J6GA 1X5XA 1MCFA 4TVPD 3O9WA 4BJLA 2PTVA 3LRSA 3RA7H 3CC5B 3GO1H 3P30L 1ZHNA 4UNUA 1U3JA 3QISA 2IBGA 3VXQB 4KJQC 5IV2B 1SBSL 1QD0A 1VCAA 1O5DT 5IIEA 1KJ3H 1SJVA 2R2BA 3UCRA 2X1WL 1BVLA 2ESVA 4DGIL 1XT5A 2PN5A 4LVOB 5HGDB 2VDML 4MD0A 2V5YA 3QSKB 2BVYA 3LQZA 4PJBE 3SCMD 2NX5D 4WTWA 3G6DL 3PDOB 5EDXA 4XMKH 3RA7L 4WEBH 5D7JC 1N6QH 1C16A 5HDLA 2FRGP 4H5SB 1NDMB 3WLBA 1I1YA 3ARFA 3MREB 1A2YB 1MCKA 3LEYH 2NY0D 1KJ3L 1MHHB 2BOBA 4HW6A 3R0MA 4XGZA 3AAZB 2J7LA 4F7MB 2F19H 4JRXE 5IJKA 1QFWM 4OLYL 1GHFH 4KC3B 5INDA 3U79A 5BRZB 1AE6H 3SKNB 5I73C 1FL5B 4HS6B 5JHDD 3SDAD 4PREB 4WV1B 1KLUB 5ISZB 1Q0XL 3HB3D 5EC2A 1DUZA 4NO5B 5DVKA 4OZHA 3D3VD 4QHMB 4LHQB 4NPYA 2GHWB 4KXZI 4Y4FC 4KZDH 2FBOJ 2RQ8A 4WENB 3L5HA 3C09B 5HHNB 2FHCA 1LE9B 2QJDA 4RBPH 5FUZH 3SGDI 1MJJB 3LV3A 2R0WH 1GIGL 1MCIA 5EFIB 4P57A 1UH3A 4WUKL 4QOKE 1GHFL 1I7TA 3MV9B 2B20A 4GO6B 3V7MA 5KVGH 2CLVA 4XI5D 4R2GB 1AE6L 4BFEA 1PY4A 1AI1L 2A6DA 1U93B 3OR6A 5J3HC 5GS0C 3G5VB 1UACH 2X1OA 4U6XB 2NY2B 2EDNA 1M7XA 3GJFK 1G7IA 2Y07H 3FMGH 5FAAA 1RZKL 2IALB 4KZDL 4ALAH 2YD8A 3HG1B 4JDVB 5E0QA 2OR9H 2R0WL 4PJXF 2G9HB 5DD0H 1AGCA 4NC2B 4P4KA 4GXVH 4F9LA 4TN9A 3B3IA 2YHGA 4LSQH 1DQLL 1EO8H 1T7WA 1NCCH 1UACL 2DQGL 3TBSA 3QDGD 4L4VD 5IFJB 1KN4H 3OAZK 3PL6A 5D96B 3FMGL 1HHGA 4DKAA 4PJIB 4TVPL 2AXGB 4HGWA 3QQNA 4LLMB 3QDME 2DF3A 2OR9L 4JFFA 2IJ0C 3ZDZF 3NCMA 3EFFA 3VFSA 4HMEA 1ADQH 5DFWH 2XACC 2YSSB 4C56A 4ZSOB 1NCAL 1BD2B 4WY7H 1EO8L 4KGLA 5LGKA 1VESA 2WWKO 3HTLX 3A6OA 4FTVD 1IC7H 3C5ZC 5DRZA 4GKOA 4PRPE 1OL0A 4Y2OA 5EUKA 3UTZA 3EYVA 1MJ8L 3D39A 2NXZC 4PGBA 5DQ9B 4Y5YC 4U0QB 2UWEF 2EH8H 3I75B 1HH9B 3L3HA 1C08A 1JGEB 1EVTC 1OGTA 3GB7A 3TWCH 3NZHH 5ERWA 2J8OA 1IGFH 3H7BA 4Z6AT 1R3LA 4P2RE 3TNNA 5F89B 3SE3A 1ADQL 2XFXB 5E4IA 1II4E 2DD8L 1Y6MR 2PO6B 5F3HB 4TPRL 3P73B 5T3XE 5E08H 2G75B 4XVUD 4MDJA 1UWGH 4ODTH 1IC7L 4HUXB 1FNEB 3QEQB 1RUPH 1DR9A 2VZOA 2HP4A 2GT9B 4U05A 4MXVF 2E7LC 2A9NL 2Z31A 4ZS7H 5KANI 1J1PL 4KQ3H 3QCVH 3N1MC 1FL6A 3BOVA 3WO3B 3NZHL 1ZT7A 1NBZA 3BSZH 1TETH 3D18B 2I07A 3D85D 5DJ8B 3WO4C 5IW1A 3PJSA 1EMTH 1QHOA 3ARDB 2AS5M 4NOFA 4RGNB 3U0PB 4LOUD 3RNQA 1UZ8B 1N7MH 4NGHH 2BC4B 2DKMA 5DK0A 3ZZ1A 4F7PA 3GMQB 5LGHH 5E08L 2ZZUT 2BVOA 4I3GA 4G8IB 4XP1H 2P1YA 4ODTL 3C9NB 3V4UH 2CGRH 4G8GE 3BDYH 5CS7A 1ZHKA 4JQIL 1IAIM 4KQ3L 3KLAA 5E5RB 1D5MA 3AS2A 3O41A 4GRLA 3BSZL 3X3GH 4APQB 4JFDE 4DKEH 1X5IA 2ENSA 1GGBH 1EMTL 3NFSH 5IUSA 3QUMA 4X0KA 1LO0H 1N7ML 3TA3B 2DJUA 5A3IC 3V52H 4R97C 2O5YH 5GGTL 2ZPKH 3V4UL 1TMCB 5J6HB 3D48R 5C8JB 2CRMA 2DM2A 3BDYL 5IQ9B 4LVOC 1B0RB 4QWWC 3VFNA 1FC1A 4YC2B 1IEBA 3QNYB 2PW2A 4NSKB 4P5MB 3GKZA 4P46B 4RWYH 4GG6F 3VRIA 1JFQL 4KPHH 3X3GL 5GZNC 4Y1AA 1BFVH 4LARH 2A77H 1M05A 5F9AC 3AS0A 4IRZL 1LO0L 2DQEL 3MACH 1CWVA 3DBXA 4NQDA 3V52L 4CVZA 4MZ2A 1BX2B 1NBQA 2ZPKL 1KXVC 2FJFB 5E1HB 4G8EB 1EEYA 1XZ0B 1IAKB 4MWFB 1CTOA 1M7IA 8FABA 3KR3H 2PCPB 1T83A 1E4XH 1FGVL 3QB7C 4X5XB 4RWYL 3IKCB 4LPYA 4J3XA 4YHLH 1CXEA 1BFVL 4LARL 2A77L 4N0YH 2FJHA 4WV1C 3PG2A 3LB6C 4UILH 2AW2A 2PYEA 2Y6SC 3OJDA 2KDGA 2VSCA 4FQ2H 4K2UH 1UM6H 3GFUA 1GRWA 1XGYL 3QXDB 3MROA 3RGVB 1YYMH 1WCQA 3ULUE 3C09C 3MX0A 1OSZA 1OTUC 4PJAA 3TVMD 2PETA 2ID5A 4U1KB 1E4XL 1TCMA 2ESVE 1ZHBA 3TBTA 3U83A 1QNZH 3P0GB 2OZ4A 4NYLA 1CF8L 3IF1B 3VRJA 3CDFA 1CIUA 2J1KA 4R2GC 3DV6B 1BWWA 2BY0A 3T3ME 1ZLVH 4DQOH 4IRSB 2X9XA 4FQXB 2EXYD 1WTGT 2NY2C 4IRJB 2VLJA 1AXSB 4J4PA 4ONFH 3BPCA 5T1KA 4OM1L 4H25A 3B9EA 2BY2A 2C1PB 3ARWA 1J8HA 2R69H 1LP9A 4TOYL 4JN2B 2LVEA 3UTQB 4ZYKA 4PJEB 2GTZA 3WFHB 1NLDH 1CDGA 4KDTA 3PWJB 4RRPA 2DS4A 1QNZL 3GBLA 5EU6B 5ID1B 5DRNB 1OPGL 1IM9B 3LOWA 4WW2B 5EOCH 1OARH 3KPRA 2X4PA 3QAZB 1XGPB 4AIXA 4ONGH 2C1OB 4KRLB 43C9A 4ONFL 1LEGB 2J8HA 3S3SA 5D96C 3T77A 3L7FA 4ODVH 4OZHE 3BPOB 1QSFA 2APVA 5ELIA 3RUGE 3X12B 5BV7B 5DRWB 4ZO6A 5ANME 3H9YA 3WE6A 3SO3B 2NY7H 2R69L 4PJ9A 3MRHB 3BPLC 5FYLD 2VLRE 1FDLH 5AG8A 4FZ8H 3KLDA 1QG3A 3MOAH 4JPIB 1ZKAA 1F4YH 3PHOB 3QR2A 1ZGLA 2P5WA 5DMJB 5EOCL 1OAYH 4LEOA 1FG2A 3DURB 4ONGL 3F7VA 2BY1A 5BZWA 4ODVL 1TJGL 3FQUB 1XF2A 4WWKB 4JVUA 5DO2D 3C6LD 1MNUL 1JF6A 3KYMA 3CXHJ 4K3JL 5H37G 1JI1A 4U1LB 5E9DE 4KKBC 3MOAL 4BZYA 5IKCA 4ZFGL 5LCVH 2BVPB 2PO6C 2VZ1A 1X4XA 3X3FH 4NBYB 1UYWH 3OTTA 4YPGA 3SO5A 5I1CH 1S9WA 5GHWH 1QTYT 5IP4A 1KV3A 1W0VB 1U91B 4HJ0D 4KHTH 2FB4L 5EORH 3TIDB 3PQYA 4QNPF 1QR1B 4DZBA 5BZDB 4WGWB 5DMGC 3NMEA 1OGAA 2V6HA 4YJZL 5GGUA 1JRHL 4JFFE 4U1MB 3ARDC 3IXTA 4RGNC 1Q94A 5E5MA 4OB5H 5GRZA 5IHLB 5IFAH 1OY3B 2EXWD 1KTKE 4KJPD 3AM8A 3U30B 3MC0A 1UYWL 3P4MA 3MUY1 5SV4A 3OQ3B 5I1CL 4O51A 5GHWL 5KS9B 3WUWG 4B7LA 3HFMH 4NNXB 4LLVB 3KPMA 3VD7A 4LHUD 1LGVA 5CP3H 2V7NA 5KOMC 4KHTL 5EORL 3X11B 3D39E 3BUYA 2V7HB 2XWJA 4APQC 2H3NB 4JZNA 4L29A 2YPLB 3MV8A 1T0NB 1IKFH 5IFAL 3S34H 3JV5A 3W39B 1F3DJ 2C3WA 4UOJA 2MHAA 4QHKJ 5FYLH 4XAWL 3TA3C 4P5TD 2NMSA 5GSRB 5C0GA 4AH2A 4HFWB 4HUWB 1DL7H 3HCVB 5D7SH 3HFML 3DIFB 2YUXA 2AJVL 3L3JA 4I3SH 3GSVA 3G08A 1PLGH 1AGEA 2X4NB 1X6LA 1NPUA 5LG1A 4YC2C 3V5KA 4P46C 3U2SA 4POZD 1ZAGA 1UKSA 4EDWL 2YD4A 4PJCF 2NY5H 4FG6C 3QPQD 1Y18A 2ARJA 3GZKA 1U8LB 3S34L 5CSZB 3VDBA 3VFPB 5FYLL 5IB4B 3UYRH 4C83A 3BRGC 2ADIA 4ZFOL 1BOGB 4BSVB 1DL7L 4PUBH 5D7SL 3MQIA 4PJGF 1RAMA 3T1FA 3KYAA 2R2CA 5JZ7C 2FEEL 1J18A 3V4VH 3ZDYE 1PLGL 3ARFD 4EI6A 4NQCA 1B0WA 3CZFB 4IEFB 4P4RA 1OAKH 3ME0A 3Q5TA 1KN2L 1JUFB 3HN3A 2NY5L 1I1RA 3OKDA 4LLAA 2J6EH 5IMLA 4U1SB 1BAFH 2NY3D 3H3BC 1NFIA 5D2LB 4URTB 4UNVA 4S2SB 4OUUA 4R90H 5I66B 5CJ8A 4G9DA 1L4IA 1T7XA 2ED7A 3GUTB 2Z9TA 2D9QB 3RGVC 5IWLA 2UZXB 4NM8H 2J2ZA 1DVFB 3V4VL 1YMME 2BCKA 5DEZA 3MJ8A 1AXTH 4HLZG 1HINH 1HILA 1XR8A 2GK2A 4MAYA 1Q9WA 4RGOH 2J6EL 3WHXB 4IRSC 4Y1AE 1BAFL 2C26A 4FQXC 3Q2CA 4TNVK 4IRJC 4Y2DD 1BFOB 3HLAA 5KBNC 4R90L 1OAQH 2YD6A 5H94B 2Y23A 3RWJA 4OF3A 4G6JH 2FSEA 3K2MC 3F8UB 5E70A 3E0GA 3VXPA 2V2XA 5LAXA 1QUNA 4RFEA 1JGUL 3H3KA 2FIRT 5KTEH 5TPWL 2P4AB 2APXA 3CUPA 5B3JF 1P5UA 3LEVL 1JYVA 4FQJL 4G9FB 1DUYB 4NBZB 3A6CH 3RDTB 4CADA 4WW2C 4EUPB 2GEEA 3I6GB 3ULUH 1NFDB 4E42A 3QAZC 1DCLA 2R8SL 3FB5A 4P4KD 5MEQB 3MRFB 3U4EB 4YHYB 3VXUD 2FHFA 2R9HC 1XH3A 2IQ9H 3VMNA 4UTAH 1YMHB 3UYPA 5IMOB 3BPOC 4JGJA 5BV7C 4G6JL 3S36L 4PRDB 3H9HB 1OP3H 5DHYA 5IROC 5HYJE 1FBIL 5EWIH 3SO3C 2ZCKH 4ODXA 4OQTA 2ZCHH 4EQ2A 5KTEL 4ZFFB 4PJAE 4M48L 5IOPB 43CAB 4NZTH 2I60L 3BKJH 5E94B 1P6FA 3A6CL 4HQQH 3KPSB 4Z7UA 4HXAH 5GS3A 3EGSA 4J6RH 3BFOA 1Q9KB 4H20H 4JAMA 4MJIB 5FYJE 1U92A 1FCCA 4C56D 2IQ9L 4X4YB 4DGVH 4UTAL 4MMXC 1OW0A 2VLJE 5BJTB 3W9EA 1DE4B 4FFZH 3TO4B 1F11A 2GITB 4WWKC 5EWIL 2EDQA 2ZCKL 2ZCHL 1DBBH 1J8HE 3H42L 1LP9E 2ZNXA 3D39D 4Y5XA 4R26L 1BIIB 3PWPA 3VWKA 1BQLH 3VU2A 4Z8FL 2AGJL 4NZTL 1AGFA 3BKJL 4UOW1 5A16A 3EFDH 3WUWA 4OGAD 2WANA 1DN0B 3GMMA 4HQQL 2W65B 4IMKA 3O3BB 2IAMA 1K8DB 4FFVD 1FN4A 3FQTA 1VEMA 2JB6A 3TO2B 1U3HA 3KPRE 3SPVA 4RX4A 1HI6A 3SGEI 3IDGA 5F3BB 4DGVL 2P8MB 3OAUL 4FFZL 5ICYB 5E03A 1QSFE 2FO1A 4LSUH 2UZIL 3GMOB 1DBBL 4QRTA 4HUVB 3CDYA 2Z31D 1JCKA 1BQLL 4QTIH 3EFDL 4F2MB 1X6NA 3HS0B 5EBLA 3EOAB 2J8UF 3P40A 5IGXH 4MLSA 2P5WE 3UPCA 3ARSA 4TTGA 1WCBA 3U30C 1L9MA 3QT2A 1A0QH 5DUBB 3HKFA