5F7BA

Resting state structure of cunir form alcaligenes faecalis determined at 293 k
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
total genus 95
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5f7bA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5f7bA02
3FYIB 3AG1B 5I6OA 2EIKB 3MBWB 4YSRA 5D4IA 2CALA 4A2EA 4GXFA 2XVBA 4P5RA 1AZCA 2NRDA 2FQDA 2VN3A 1AIZA 4HCGA 2VW6A 3UAAA 2XUWA 3AG3B 2QDVA 1PNCA 3FSZA 4BWTA 3H56A 1WS7A 1RZQA 3CVCA 4KO9A 4YSPA 3FQ2A 1PLAA 4W9ZA 5I5IA 2BZ7A 5PAZA 4CSPA 1A4AA 2BHFA 2J57A 3S3DB 3ZX1A 3NSYA 2VM3A 5D4HA 1GW0A 1NPNA 5B1AB 5B1BB 3ABKB 2IH9A 2ZXWB 4YSUA 5I6MA 1W6LA 3PPSA 3GXUB 3WI9A 4Q8BA 1ILSA 3NP3A 4QLWA 3FSVA 2UXVA 4DP8X 2X88A 1SHWA 6PCYA 1PZCA 3PAUA 1JXFA 2QPEB 9PCYA 2ZONA 1L9OA 3AW5A 3QJSB 3FT0A 1B3IA 4M4RB 3T6VA 1XMEB 3X1EA 2GSMB 5I26A 3X1FA 3NJMA 4E9WA 1BQ5A 1J9RA 4F2EA 1J5CA 3CDZB 1JXGA 2Q9OA 2TSBA 1AQ8A 1NWOA 3CVDA 2VM4A 4DP5X 1CYWA 2FJSA 3NSDA 3UACA 3S3BB 2BWIA 2A3TA 2GB2A 3UAEA 2DYRB 3CVBA 1JZHA 1AS8A 2Q5BA 2B3IA 4K9JA 5PCYA 1PY0A 4G7RB 2OV0A 3SBQA 2PP8A 5AKRA 3HEIB 4TXVB 2H47C 3PXLA 2JFCA 1R1CA 2HRHA 2HZHA 1JZJA 4EF3A 2BWDA 3NSFA 1ZIBA 1SHXA 4E9VA 4A67A 4YSOA 1AACA 2EINB 5F7AA 3S3CB 1SNRA 3QJQB 2YAEA 4UANA 2JKWA 3KW8A 2WSDA 3NYKA 4HCFA 1OF0A 1BQRA 1F56A 2BP8B 4AZUA 2J55A 1TU2A 2CAKA 4YSAA 1L9SA 2DWSA 4YSTA 1NICA 4P5SA 3BQVA 3NJHA 5I6KA 4UF7C 1V54B 7PCYA 2J5WA 1AS6A 3QPKA 3CDZA 1L9QA 1ETJA 2VW7A 1W6WA 3TASA 4HHGA 2EILB 1OV8A 2W88A 3FQ1A 1A4BA 5I28A 2GBAA 1IBYA 4BWUA 4E9RA 3RYMA 4E9TA 1ZPUA 1NDTA 5AZUA 3JTBA 2UX7A 3ABMB 3JT2A 2ZOOA 1NPJA 2WO2B 4AKPA 5B7MA 2YAPA 4MFHA 2IDSA 4JHVA 3TA4D 1XB8A 3CZUB 3X1BA 4RH4A 3WNIA 1NIDA 4WTQA 1J9SA 2PPFA 1E65A 4DP6X 3NP4A 2XX0A 5B1JC 1OE3A 4GYBA 1E5YA 1OCRB 4CSZA 2IH8A 2TSAA 1CC3A 2CJ3A 2PCYA 3FU9A 2BP0A 2E86A 2XU9A 3FU7A 2GC7C 4KO7A 1NINA 2BP8A 4YL4A 1RZPA 1ILUA 1QLEB 3NJFA 2HLEB 1AG0A 2PPEA 4AX3A 3UABA 1JZIA 4AKQA 1IUZA 2FQGA 3X1GA 1L9RA 3EHBB 5D4JA 3FPYA 3ASOB 1OCZB 3N2JA 4F2FA 1IC0A 2IWKA 3DTUB 1HAWA 5LDUA 1A4CA 4HAKA 4DP1X 1NZRA 1JZGA 2I7OA 3IE9A 2FT8A 1KDJA 2PLTA 3ZIYA 3ASNB 4JKNA 4E9YA 3AG2B 2IDQA 2AFNA 1OCCB 1ZV2A 1J9QA 1KBVA 1ASPA 1SF3A 2VMJA 3BVDB 1BXUA 3FSWA 1M56B 4FA7B 3IN2A 4YSCA 1PZBA 1J9TA 1NIAA 1KV7A 2AZAA 4DPAX 2FTAA 3NJNA 4G72B 4G70B 1A3ZA 3PCYA 1BXAA 2PPAA 5B3SB 5FC9A 2PPCA 1NIEA 5I5MA 3GYRA 3T6WA 3QJVB 1DYZA 1GS8A 2BW5A 3FS9A 4GY4A 1ZIAA 2UX6A 1ASQA 3EH4B 4G7SB 1IBZA 2YAQA 1V55B 1ET5A 1DZ0A 2LLNA 1VLXA 3WG7B 3V9CA 1PCSA 3L45A 3WKQA 4YSSA 1E5ZA 1SFDA 1OCOB 2AVFA 1PLCA 1PZAA 8PAZA 2HX9A 1GYCA 2OJ1A 4YSDA 3T9WA 1L9TA 4DP2X 1GS6X 4GP4B 4L0PB 1AAJA 3CG8A 2FQFA 1NIFA 4QKTA 4JHUA 1V10A 3TBCA 1KDIA 3SBRA 1N68A 2MTAA 2YQBA 3T6XA 4E9XA 1AR1B 1SF5A 5I6PA 3S8GB 1MG3C 5B7FA 4HALA 1CURA 1JXDA 1ZDSA 3PLYA 1PMYA 4A2FA 3C75A 5F7BA 3KW7A 2VW4A 4G71B 4NAJA 5B1KA 1J5DA 4ZK8A 1RKRA 3X1NA 1E30A 1QNIA 3AY2A 3OQRA 2ZWNA 2FNWA 3H4HA 2B08A 2GIMA 1BQKA 2X87A 1SDDB 4BDVB 1FWXA 5A7EA 2PCFA 3DKHA 3EH3B 2AZUA 2BP0B 2CUAA 3NJIA 2PPDA 3FU7B 4N4YB 3N55A 2Y69B 1MDAA 1SJMA 1BEXA 4GP8B 4A68A 2VSMB 1OE2A 2HRGA 2UXTA 1KCBA 2DY2A 3IN0A 2IWEA 3FYEB 1I53A 2I85A 2XWZA 1BYOA 1NIBA 3NSCA 1M57B 1WAEA 2R7EA 4AKOA 4E9QA 4ENZA 1JZEA 3U25A 1UATA 3FSAA 4A66A 1GSKA 1PLBA 4DP4X 2WO3B 2YARA 1EHKB 4YSQA 2RACA 2YAOA 1FA4A 2FT6A 3H4FA 4DP7X 4UAHA 3SBPA 4DPBX 1ZDQA 5IY5B 4A2DA 1OE1A 4KNSA 1KBWA 2HX7A 3QJUB 2IDTA 4KO5A 1GS7A 1AZRA 1NTDA 4Q89A 3ABGA 2EIMB 2GC4C 2XV3A 1W8EA 1GY2A 1JVLA 4E9SA 3WNJA 1WA0X 2BZCA 2FQEA 2AANA 2CBPA 5AFAA 4DP0X 6PAZA 1SDDA 5TK2A 4BDVA 1PNDA 2N0MA 1ADWA 3TBBA 3OM3B 4DPCX 2DV6A 3OD3A 4BWWA 1N70A 2YAFA 3T71A 3EF4A 5B7EA 3EH5B 2VSKB 5I6NA 1BYPA 2W8CA 3AZUA 4M3HA 2PP9A 1CUOA 2FT7A 1PF3A 2QPDB 1JOIA 3GDCA 3OMAB 4BXSV 2GI0A 4A2GA 2DYSB 1A65A 3NJJA 2XYBA 4HIPA 3X2QB 3AG4B 2J56A 4GP5B 1XB6A 5ANHA 4HHWA 4BXVA 4DP9X 1KCWA 3T6ZA 4A2HA 2FWLB 1ID2A 1L9PA 1AOZA 2UXFA 2YAHA 2DWTA 1GR7A 1MZZA 1T5KA 2YXVA 4N8UA 2P80A 2YAMA 3IEAA 2YXWA 1HFUA 5EHFA 1BAWA 1ET7A 3IBOA 2PP7A 1AZNA 1WS8A 2UXGA 3NJLA 1HAUA 1GY1A 4NERA 4BK5C 1JERA 4WKXA 2CCWA 1JZFA 3UADA 1NWPA 1A8ZA 1BXVA 4G7QB 1QHQA 1PAZA 3TU6A 5I6LA 1MG2C 3ZBMA 1AG6A 4HZ1A 2EIJB 1FFTB 1E67A 4W1TA 2H3XC 2IAAC 3D12B 1ET8A 7PAZA 3QJTB 5TK4A 3V9EA 3PAVA 4KNUA 2IDFA 1EZLA 3FQYA 2H5UA 2BW4A 2QT6A 1WA2X 2HXAA 5I5JA 2IDUA 1CYXA 1AS7A 1TEGA 2QDWA 3QJRB 1XB3A 1YLBB 4YVNA 3OMNB 4KOCA 1MZYA 1WA1X 2R7EB 3NJKA 1AZUA 4FAAB 4PCYA 3FPXA 3S8FB 2I7SA 4F7KA 3ERXA 1KGYE 4YVUA 1URIA 1AZBA 2Y1AA 4KNTA 1TKWA 2OCCB 2XV2A 1IKOP 3HB3B 2JXMA 4NB7A 2IWFA 4X4KA 3DIVA 4HCIA 2XXFA 2MRYA 3NJGA 3FU8A 1X9RA 3MX0B 1TEFA 2BO0A 1X9UA 3ABLB 3QQXA 3WKPA 1M9WA 3G5WA 2XXGA 1JVOA 2GHZA 3OMIB 3UGEA 1ASOA 4KOBA 4AI7A 2XX1A 4PAZA 1SFHA 5E9NA 3ZDWA 5B1JA 1AANA 2XLLA 3NT0A 3WIAA 2HX8A 2P80D 1KYAA 4KO6A 3SQRA 4YSEA 1OOWA 1RCYA 2XV0A 3PAZA
chains in the Genus database with same CATH superfamily
4XVJH 1S7RB 4GG8A 4MASA 1B0IA 3SYQA 4HX1B 1KJ2H 2XZAL 3VWKB 5J4MA 4UQAA 4BA0A 1LO4H 2NZIA 5BZDA 3WFBL 2JQMA 3IM1A 4QYOA 3K6FA 5JIKA 2XUWA 2WQWA 2VZUA 1CIDA 3FK3A 4U33A 4EDXB 2GJ6A 5I71C 1BSIA 3QEQA 4HMCA 5TFSH 5L8LB 3WEXA 4OFIA 1TTRA 4NUJB 4DZBA 4KO9A 3WHXA 5BVPH 1NBYA 3F64A 2GTZA 2P5WB 3MOAL 4F93B 2I27N 1KIUB 2PTTA 1TOXA 3S35L 1P9MC 5C0GB 1R34A 2VM3A 3HS8A 5F3FA 4JHAH 1D5BA 1T6BX 5HP5A 2NOYA 1IAKA 1OGPA 5IMLB 1R46A 4AQAB 1YCSA 3DJSA 3H53A 3C6SB 2DEYX 1ZVHA 3HBPA 4ONFL 2WWMC 3VXNA 3QULA 5DMKB 1IT9H 3SPIA 4MCNA 3VVWA 1BMZA 1KB9J 2XWRA 1YN6B 3TIEB 5LBGA 3CDYA 4ZS6D 3RWJA 3CIQA 1JXFA 1P2CB 3QULB 3WIHL 3LN5A 5F7WC 2ZONA 1VACB 2QKSA 3QJSB 1WZ1L 3RFRA 1YN6A 1KWGA 4PS4H 3ATFA 1ZLVH 1JRHH 2ICES 4YHML 3UBHA 2Q3ZA 1QSED 3UZVA 3MUGA 1AQ8A 4OIAA 3OAUL 2LVCA 3Q1SL 1AXTL 4QI3A 3RVXD 1JZ4A 1RFDH 8CGTA 4NOBA 4DVBB 3GBLA 4XAWH 4JREB 4DO5A 4MA8H 1M6UA 4AE1A 4J3BA 3QORA 3ARSA 5KBNC 4O4YH 5AW9B 5FX3A 5F70A 3DVIA 3TH3T 1TTFA 5D2NB 3WFZA 3C5ZA 4LKXA 2HLFC 2PKDA 3ULAB 3MSPA 3ILQD 2J1XA 5BZWA 1LP9F 3BWAB 4GW4B 1G7PA 4R7NA 3OXSA 2YSSB 1CQYA 2ZWYA 3L8QA 1IVTA 3L13A 5FECB 4G82A 2NY6C 2EVIA 3KBEA 3VD2A 4Z7OF 2EINB 4P2QE 4X7TB 1JHTA 3DVGB 4XCEB 4E5XA 1G0DA 3EDKA 1L6ZA 1SOKA 1AZZC 1AO7B 2PCXA 3SJVA 1TZGL 4L4TE 1YO4A 4X8GA 1IM3A 1D2PA 3L5WB 4DGYH 4BFFA 2QTVA 3PL6D 3QIBB 4WWKA 4ZQKB 3UDWA 3RQ3A 3GMRA 5DRZB 1EZVX 1MI5D 3I9AA 3LXUX 4CVUA 4BFJA 5I6KA 1OKEA 2E4TA 3A67L 1WBXA 2ZICA 4D94A 3AB0B 1YUHB 2A9ML 9CGTA 1ZEAL 5DO2D 1T1WB 1FNGA 4L8DA 2RQEA 2K78A 1WV7T 4JFEE 3ELAT 4LVNC 5BW7A 3QDGE 5KN5A 5M94B 2VDML 3BHBB 3HG2A 1U8IA 2B1HH 4WSJA 4GMSH 3IE4A 5IQNA 5FYJL 2JE8A 3I2CH 4L2LA 4MJIE 3JTBA 5I73C 3U7YH 3BOVA 2P52A 1NPJA 2BNRD 4DUXA 4EE2A 3LQMA 5F1NA 5EEUA 5TF0A 4MAUL 4RFNB 3FRPG 4XN4A 3X1BA 2V8MA 5EFIA 2FO1A 4RMWA 3HA0A 1MFEL 4U1NA 3FT2B 2Y5TB 1DJIA 1SMAA 1GGBH 4NO3A 2D7OA 5HYSG 2OMVA 3NP4A 2J6EA 4FD0A 2KHAA 4KRNA 4WEEA 4WEUD 2C9RA 3P9MB 3QARA 1ORSB 4GYBA 3V0WH 4BJLA 3DSNB 1E6OH 4WUKL 2A73A 3QPXH 1U8MB 2WLMA 4EI5B 1S7SB 2F53A 1TT6A 1CDUA 1RJZA 2H1PH 1TU2B 1QPPA 1QFWM 1U2YA 3C8DA 3OKLB 4PWHA 2WCPA 3LDBC 3SBWC 1A2YB 2UYLA 1A6WL 1F4HA 1I3VA 3FFCB 3JZYA 1CL7H 5D7LB 3VFRA 2YMTA 5ELIA 3WLWC 3B7YA 3MLSH 2WXHA 4BK8A 1SLUA 1UWFA 2VN7A 3IFNL 2ZUYA 3NUKA 3MRRB 3GMNA 1BMWA 1ZVYA 4M3JA 3OBAA 2JB5L 1TJIL 5FYLE 4ONOA 2DEXX 2MOGA 4U4BA 2PWGA 3CHSA 1TQCC 3GF8A 4I2XE 4RMQA 4Z3IA 2C7FA 2NNCA 4APQD 3DI3B 4LCIL 1E8YA 1L4IA 5I8EA 1E6JL 4PRNA 3TGXA 2HJFB 1EEYB 2I9LA 4QO1B 2EIBA 4AGMA 1KBVA 2WLIA 3LV3A 4P2OB 2Q7AA 2VDNL 3MMEB 3GMPA 3KM1A 1EMTH 5ESAB 4ZTPL 4XOAA 3NCJL 3SGEI 1RIVL 3CHRA 5FCSH 2C9UA 1QZ1A 43C9A 2VLME 3D4CA 5FV1L 1WE5A 4NRZA 1MRFL 3PWLB 1AYOA 4X6EB 5GS2H 4Y5XC 4IBYA 2GITB 4YHMH 1LDPL 3K1DA 4UT9L 2GI7A 1JNLH 4TKWA 1U91A 5I5MA 4U0RB 1NDMB 5D7JC 1DYZA 5HY9A 1KIRB 2YRPA 4ALAC 4G7SB 1IBZA 1TR7A 4JANA 1Y18A 4TPRL 4IIQC 4XB8A 4TQEL 3QZPA 4HIEA 4IRSA 4QRQB 3O2WL 3F7VB 3OF6A 3DROB 1AE6H 1RULH 3G7TA 3GJFB 4G6FB 1N5YH 4I0CC 5D1QE 4LCWB 3SGDH 2ZYIA 1IQDA 1BAFH 1MIEL 4QRQA 4UOZA 3QUMB 3GDBA 1EXGA 1ESOA 4KZ0A 2NLJA 5I75B 4ZW5A 1FGVL 3RY6C 4JQVC 1H0DA 4MDJB 3K81A 4QKTA 4JHUA 1EO5A 3TBCA 1IQDB 1KG0A 1AH1A 3SBRA 1YAZA 2VITA 4MNGE 4YH6A 5E6ZA 5I8KL 3UBFA 1DN0B 4DFIA 4E9XA 3CFKB 4WY7L 2AK4B 3FBQA 3OKOB 1TJGH 3APNA 3BRFA 4Y1AE 2OI9C 4CU7A 1BF8A 1R0AL 1NM4A 5AW3B 5B1KA 3LHAA 4WU7B 2E0PA 1KYUA 4PW3A 3A67H 5F7DA 2Y25A 2AQ3A 3V4PB 5C0CD 1S9VB 4RAUB 2H6PA 5CKGA 3WTXA 3NZHH 5EBMA 5GSRB 1RIHL 3MAWA 5C0FB 1DLFL 2Q7YB 3NJIA 1VKXB 4F57L 3VI3F 2XZQL 1B0WA 2APSA 4BGDA 2JKRM 1BEXA 1NLDH 2XG5A 4U3SB 4OM1H 4HKBB 2UXTA 4I77L 1FZMB 2XFGB 4ODHL 4XVTL 1KCBA 4Q9CA 4GKLA 3GNML 4TNWK 5FB8B 1J1XH 1T4WA 5D7JB 2V5MA 4N1EA 1D5IL 3W0WA 1T5WA 4XCCH 4KKNA 3T0AA 3T2OA 5KS9F 1FSKC 1KZQA 2LU4A 3SPHA 5GS1A 3UIZA 1EZUA 2YC1A 5INDB 3FSAA 5DSCB 1OP5K 1TZIA 5JW5A 4M93C 1RZJL 3U1SH 2IGFL 4IK6A 1FVCA 2XDHA 3PQYB 3AXLB 2O6EA 4YSQA 5J11B 3O3DA 3GKWH 2YC1B 3QQ4B 4JN1L 5DZLA 1DQIA 2AMGA 1BCIA 2ADFL 5JW5B 3U79A 2EUZA 5BRZE 2EJ1A 5CP3H 3TBVA 4D3CL 2EIDA 5J1AB 1KBWA 2HX7A 5INCB 1YYCA 2E56A 3S8WA 2VKXA 5K39B 2D73A 2EIMB 2YRBA 1AR1C 2CUMA 1GY2A 4KBPA 2VLJB 3EGDB 2OX5B 2NR6A 1TQCB 3CX2A 4IBSA 2H32H 1SDDA 1NSNL 3H85A 5TK2A 4BDVA 1ZV5A 2EUVA 1T89C 1ACZA 5D7IE 2CO6A 2LFEA 3MA9H 5GJTL 3EGDA 1S6NA 3PHSA 1TZAA 4KZDH 1E42A 1AP2A 5EZJA 5ERWB 2YAFA 3QFJB 2V2WA 5E8NA 1ICTA 1A4JB 4WTZA 2NY3D 3JTTB 3ECWA 3MDJA 5KYUA 4X6CA 3T3ME 3N42F 1MIML 1RL1A 1U4FA 4JMNA 4X7FC 5JHDB 5ERWA 4Y8DC 4PWJA 1BPLB 4MVBD 2EH8H 1M6OB 5E8DH 3L5IA 2NDGA 2W60B 3IU4L 2IANB 4GO9A 4XAKE 4YDKL 5H94A 3CVHH 3APCA 3X17A 3UTZA 4MQXC 3MLSL 4PTTB 5AVYB 5TGBA 3ULVC 3MUY1 1IIIA 4YXKL 4FG4A 4Y5YB 4DKAA 4ZOCA 4DK5A 3H9SB 1ORQB 4IM8A 4JDVB 4MCZA 2R9HC 3L5XH 5H8DA 3BPCA 4ZPVB 1VFMA 3FRPA 4NUGH 3QDJB 1U33A 1ZA6A 3BE1L 4XMKL 1JMZA 1DDTA 3IMWA 5F72S 1SEBB 2FUQA 4KHXL 5IUSA 4JKPL 1OAJA 3O6KL 3WIIH 2MEJB 2W9EL 1QFUH 1FFPB 1NC2A 2E5EA 4HZLB 4WFGE 3DX7A 5I5RA 5AD0A 1DSFL 3W11D 4L2YA 2N59A 3IWVA 1FFTB 4LL9A 4UUJA 4HFUH 5ISZB 3LZRA 1TJHH 1YYML 1Q0XH 3KVPA 3NN8B 3O2VH 2R29A 5EU6E 5T1MB 4EUPA 4H1LH 5LWYL 4TTDC 5AYUL 3LIUA 1ZLUK 3ZZ1A 5GHWH 4NQED 5ITBH 3WS6C 3QJRB 1LWJA 4YVNA 1PZ3A 3DBXB 4XI5C 2YRLA 3QDME 3GSNL 1H3GA 3LDBB 1WFUA 4N8VG 4DCQB 4FAAB 2X6UA 4AEHL 3HE6C 1JXKA 5I19H 3NQKA 5J6HA 4NHUB 2EYTB 4Y5VB 2QSTA 4M62L 3ZMNA 2XKNA 5I6XB 5E51A 2CKNA 3AS2A 3HG3A 5F89B 4NKDA 3E6FA 3QHFH 1X9QA 5SX4I 3ABLB 2CKBA 1N9PA 4NHCH 4PJ5B 4L8SB 4F5CA 2DLEA 1WTGT 3LS5L 1MUJB 4PVBA 2VQ1B 4KOBA 3JUYA 4WWNA 3ZDWA 4HETA 1HXMA 2DQFA 1NSNH 1EO8L 1JNJA 1I7ZA 4H26B 2AABH 5FYJE 3T8MA 2VLJD 5G4OA 4YSEA 3LKQB 4NZTL 1WWBX 3O4OC 1UD2A 3ULVH 2XXCB 2OSXA 4HT1L 5TE6L 4BK4A 2X6VA 5D4IA 4PRAA 3KGRA 4OZGB 5DMIH 2YA2A 3NZUA 4KX9A 5JOEA 1MCOH 4O2CB 3EOTH 4MAZA 1YMHA 3HR5B 1HH9A 2AQRA 1V27A 4OM0L 3WL9B 5AAMA 4URTB 4JPKH 4ANUA 4J3VA 3V5DB 1DBJL 1RZQA 1BMGA 3Q48A 1SPDA 5DHYA 1NGQH 1NBZA 5I5IA 4J3OC 4YX2H 5TH2B 5JHDD 1EAPB 4CSPA 1QFHA 5FF6A 5DHXB 4L4VD 3DRTA 1BBDL 4LL4A 1LYQA 5CLZA 4BQ9A 4RSVA 2A6IB 2DQUL 3SIKA 2EDOA 3B9AA 1G7LA 4WWKC 2AQPA 3UDWC 3T0EA 2CSPA 2NY6B 3S3SA 1OSEA 2FDBP 4K71C 4FQQA 4MBRA 3EOBA 3HNVH 4P46B 1YYLL 4L3EB 4EUPG 3CFBB 1DVXA 4UQEA 4XNMA 3GBEA 3JV0A 1ILSA 1A6AA 4M7ZB 1JDDA 1T7VA 1VFUA 1W72A 1JV5B 4PVLA 5SV3A 2CHDA 3T77A 2F8XC 2EDWA 4GQPH 1I7TA 3ZHLA 1QSFB 3O4LE 4L1TA 3R7QA 5HHQB 1CIUA 2E9WA 1OP9A 4R9HA 3OHXA 1TMQA 5BS0E 4HJIA 4WHTB 2JCWA 4FEMA 2VM9A 1HXKA 5KW9H 5HHQA 1SXAA 2FO8A 2EEDA 5KVDH 5FA3A 1A1OA 2YD2A 3RWHB 1TVHB 1FCCA 2Q3XA 4IS6B 4NKMA 5FUZH 1BM3H 4PJXA 4WUUD 2H6UA 4P4KB 2ZCKL 1KFGA 2X4QB 1WEJL 3C8KB 3K80A 3UAEA 1WD8A 4NQCE 4UILL 3NZSA 3VD5A 1WAPA 5HJDA 1BXXA 2QFPA 5EIQA 1NBVL 4YL9A 3ZYOA 4WQOA 4Y19E 1NFDA 4UZSA 4Y4HD 5KVMC 2PWHA 1F3JB 4XRCB 4OVUA 2AJ3A 4GQZA 3TVMC 4Y7OC 2VQUA 4A67A 2HVJA 4LCCA 3VG9B 1VCAA 2J7LA 1IGIH 4UAOB 1M7IA 5I1DB 1S9WA 4DZBB 3HE7D 4LLMA 3UXFA 1OGAA 3S96B 3LKRB 3JWNG 2AXJA 1JI1A 3QCUH 1CLYH 5BRQA 2HUEA 1BZ7B 1L9SA 1S3RA 2JI1A 4C59B 3H8NA 2AERT 1E8XA 2BRRH 5DJ2A 3VXQB 2E6PA 4U3CA 3TT1L 2QVIA 1GJWA 3FXIC 1CFBA 1IGJB 4FFWC 4XMXA 1N8ZB 2FJFB 4OIFA 1XIWB 3HC0B 1H6EA 4ZJ9A 3ZTNL 1MCKA 2JMRA 2ZPKL 3VFPB 1TLMA 4KUZH 5FM4A 3NFSH 3TXAA 3CU1A 5E2WH 3CMGA 3MCLH 3V7AG 3L9RA 2O30A 4POYA 4Y9BA 4YO0A 3FT4B 1BBJB 3PY9A 4JQIL 2HVBA 1YC8A 3ABMB 4LOFA 4N3UA 1S9YA 4JUSA 3E2HC 1EDQA 4I5BB 1HINL 2NY5L 1N12A 2XWBB 1Q72L 1CFQA 4O58L 1WP6A 1RFDL 2Z9TA 4F9PC 2KS0A 3IU4H 1NIDA 1R33A 1KBBA 3K4AA 2VABA 3BWZA 3BISA 3IJYB 1A22B 4MD4A 4Z7VA 4CGUB 3VFUA 3D48R 4K7PX 4HUUA 4EN2A 4P2QA 2IAMB 1QASA 3SYPA 2MNWA 4S1SH 3WFEL 2DYPA 5JHBA 5CILH 2RGSA 4FQXA 3SJVE 4OV5B 4XNYH 1TZHB 3NJFA 3DX1A 5L2KD 1RJCA 3MUJA 4KMTH 3V0DA 4X6FA 3LXBA 4K8RD 4GMTH 2QELA 3CSGA 5KSAB 1RUQH 4V11A 4N0YL 4PY8I 3FHAA 4LAJH 4OV5A 5J1SC 2X4TA 2ED8A 2VH5H 1AKJA 3ZDZB 3T0EC 4NHCL 1WG3A 1HAWA 4WUUA 4X6FB 2CIKA 3DVNB 2ZIDA 2A7BA 1FYTA 1G94A 3ZL2A 2KQNA 2CBOA 4UNTA 3CHQA 1G9NL 5CEXA 3QDGA 1KTRL 5IR1A 4LDEB 3CVIL 4XPHH 3MUGB 4R90L 2XBZA 3G6JF 4OLUL 5I1HH 4PJ7E 2XJKA 4I18B 1S7XA 1SYVA 3HC3L 1RK0B 2K9FB 1USQA 4W6WB 5A43C 3GXNA 1SYSA 3ZE1E 1J8SA 4Y4KB 2ICEA 4N2BA 4XZUA 4BHUI 1KNOB 3DX2A 1H5BA 1M2OA 4ZO8A 1BD2E 4P49A 2ZUSA 4FG0A 2CXKA 1SXSA 3KG5A 4NO5A 4ZW7A 1D5IH 5BZWB 1UD3A 3PCYA 3VE0B 2ZX7A 2JIXA 3K6DA 2GK0B 4O9HL 2HN7A 4I48A 2YPVA 3VH8B 5CP3A 4QHKI 3GSNA 2VLKB 4KJQD 3E1ZA 4ZDHA 1EBPA 1PSKL 2ZCKH 5T1JA 4PJ8B 2OP4L 4JFPA 5I1GL 1BP3B 4GEJA 4L3AA 2C3VB 2HN7B 1HCFX 2X3BA 4QXUL 4HPOL 5IQOA 5SX5K 1YEGL 4IGBA 4CMHC 2AXFA 2JKLA 3ZKMD 3BEWB 5CM1A 4MA3A 4HGWA 1PZAA 2O5NA 1B4LA 1VDGA 4IGBB 1F3RB 1IBBA 2ZSWA 3ZQ9A 3FCBA 4DP2X 4TVSa 1EWHA 1C08B 3WN5B 1NBQA 4G8IA 1K5NB 5HGHB 5D8JL 1X5LA 2BHZA 4LEXH 3EGXA 4HSQA 2AJSL 4OD2A 4TTDD 3T6XA 1FNAA 5FHAL 2EDRA 5F9OL 1CGSL 2FHBA 3SKMB 2X0VA 4L4TB 3PGDB 5DLMH 3A4EA 4HIHA 5CEZL 3PWJB 3FO1B 5JO5B 1PMYA 1KCVH 2X2HA 3HBQA 3IAPA 2R0LH 1ZSDA 1IC5L 3GMQB 1Y6NR 1DL7L 2CBQA 3LEVL 2G5RA 1ZAGA 4RWYH 3OPZL 4TYUA 2MKWA 3OQRA 4TLTA 4RNRB 1AGCB 3U0WH 4MJIA 3QNFA 4JJ5A 5FW7A 4K15A 5LO7A 1G4MA 1U8MA 2J88L 5KVGE 2N0KA 5AOMA 3KPPA 4IDJL 4OZFG 3MRQA 3BP5A 4OB5H 5IMKB 2YS4A 2CMRH 3QUYB 4NZUH 5EU6D 4IBVA 4JFYA 4OD1H 2QSCL 2OL3B 3KPPB 4I0PD 4KV5E 2VR8A 4PLNC 1B4RA 4AGNA 2DIJA 5D1QA 4AQ1C 4RIRB 5MI0C 1VAHA 1UATA 2H1XA 1X5GA 2XTJC 5A2CA 5HYQA 3B2VH 1FFNB 4A66A 4O02H 4YLBA 4TNWF 1KIRA 2P5EE 2ZKXA 3QUML 7FABH 1QBAA 2OMZB 4Y7MA 3B2DC 1FA4A 3WFCH 2OXHA 5ITFB 2Z31D 5FK9B 2D7TL 3O9WD 2YFNA 4U31A 4N68A 3S36L 5IY5B 1GOFA 2IMNA 1OPOA 1A1NB 4BE5A 2E8ZA 5FO8B 5L2JA 4JRLA 1NJ9B 4J12A 3NG5A 2MPVA 3PUCA 1I8LA 3F5WB 1AQKL 3EYUH 5ESAA 3UJJH 5MHSE 1T89A 3MNWB 2EDJA 2BWQA 1A1NA 4GS7C 4NC2B 5KSVB 3V9FA 1LP9A 2NR6C 3M8OL 1J87A 3WBDA 2AQ2A 4PS3A 4OAWB 3EGSA 3L4UA 3VRLE 1PFOA 5E6RB 3DMMB 2V2TB 1MFBH 3OWRA 3QRBA 3FBKA 2DI9A 4FKEA 3B9VA 4ZFOA 4X5QA 5FWQA 5I23A 2HG5A 3BWUF 2QR0A 1JNNL 3QT2A 1P7QD 1CLOH 3EZJB 5DHEA 1KN2H 5FGSA 1DQQA 4Y2OA 3BP4A 4U1HB 3Q1EA 3DOSA 5HDBE 3MLTB 1KTDB 3GO1L 3P73A 2QR0B 2VDLB 2G5BB 3HRPA 1OAUH 4D8OA 2Y7OA 1RJYB 3O2VL 4LARH 2GJ6D 4KGLA 4AENA 4PGDB 4HHWA 4AK2A 2EXTA 1B2WL 3JV4A 5KUMA 3MLTA 3B34A 4LOUD 2Z0UA 5DQDL 2E4FA 2UXFA 4ZPTA 1G6RL 2DWTA 5SX4H 3U9PH 3GHBL 5IV2A 3U2SA 2DRUA 2FH8A 4PV1C 5F6HI 1E9OB 5C3IA 4P23A 2DN7A 5CBAA 5D55A 3DIDA 1KG0B 1BG1A 4EN3C 1XH2A 1WICA 3BKCL 4S2SA 2UXGA 5CJOL 4M6AA 5IV2B 1WC7A 4K8RH 3KGSA 4LCYB 1ECYA 4KC3B 1JZFA 4LKCA 1MJUL 1S9XA 2OK0L 4ETYA 4QCIB 4JO8A 4Z3JA 1F3DH 4W1TA 3EJYD 5D7IA 3VGAC 3GS7A 3ZRSA 4MNGA 3U83A 4K94H 3W39A 4PP2A 1CYGA 4JFDA 5G2NA 3ULVD 4Y1AA 2OX5A 1K4DB 3ZKQD 3OAZK 3Q2NA 4P4RB 2VUOA 2B14A 3MCLL 5CHNA 1MJ8L 2ZOKB 3REVB 3OMNB 4JQVA 4PREB 3DJ9A 3QAZC 4JKMA 2SEBB 3HG1A 3JWOL 2R7EB 4L3CA 1NOAA 3OAZH 2Z31A 5CHNB 2FJHA 3V0FA 1OP5H 1AKPA 2XV2A 4PREA 5E8NB 4KDVA 5GGSA 3IDJB 4B95C 1TFHA 1FVCB 4OCYL 4ZXBB 4WW2A 5GRUL 2K6ZA 3MX0B 1TEFA 3CFJB 2Z31B 5GIRA 3KR3H 2Y7LA 5AVVB 2EDQA 1F58L 1OP4A 4V1DB 3K6NA 1CD0A 3NCYS 3UAJC 2C3XA 3EJYC 4OZHB 5I1EL 2GYSA 2BSSB 4CDHA 4AE0A 3CH8A 1ZANH 3GS0A 1I1FA 3CNKA 5D7IF 2P80D 4H0LC 1ZOXA 3SDDD 1HEZA 2L4OA 2DM7A 4KVCL 1DBBL 4W68A 4Y5XA 2IFFL 1RCYA 3PAZA 5KYWB 5I8OH 3AJ7A 2BNRE 3OGOE 3QS3A 1MVUA 2BY0A 2WXJA 4G9DA 2FQDA 1CT8A 4GSXA 3LHPL 1F4AA 3LNIA 3OC5A 1AIZA 2H9GB 2IQ9H 1M2VA 4HXAL 4F57H 1WWWX 2N7SA 4JRFA 5IROA 1J18A 3VXTB 4QWWD 1EUUA 1NL0L 1SBBA 3NCEB 3TVMD 5IW1B 2ESVE 1E90A 3EJJX 4ICWA 4HIQA 5AD0B 3SYCA 4N6RB 5CJQL 5DK2B 4FQJL 1IBHA 2BZ7A 4PGCA 2BNUA 2MQ0A 4XOCA 5TE7H 5CS7A 3QW9A 2YPLD 3VDAA 3S3DB 3FTSA 2JCCF 3VFMB 3WJJA 3ZX1A 4FP8L 1CR9L 4M8RA 2Y4SA 2W60A 3EFFA 3SYOA 5FKPA 3MRNB 3ZL1A 5G4NA 4HUNB 5HI5D 5EORL 3MBEB 5F96H 5F7LB 2OLDA 5I16B 2GY7B 2A4ZA 3GXUB 1UADC 2K45A 3VX0A 5KVGH 4F5CE 3NP3A 1A6VH 1JFHA 5TFSL 2EXSA 4A6YA 3TWYA 3T65A 1AXSB 1DE4B 2D3VA 4MZIA 4W9GC 1PDKA 3TBWB 4LGRB 4HOMA 1AO7D 25C8H 3KCPA 3U4AA 2F0CA 4OGAC 5DUMH 4HISA 2AVGA 2HT2D 3PL6B 4QXUH 5F89A 1MCRA 3NJMA 5IFAL 1GGUA 2NSMA 3ARGB 3PV6B 3SGDI 3SQBB 1M05A 2Y5EA 3WE1A 1QA9B 1SDAB 3K5SA 5DK0B 4PGBB 5A3ID 3VGGA 5JHLL 1WZAA 5F0LB 2P47B 4PY8J 4UT9H 4EUPB 4IKLA 5KS9B 4PVNA 2JCCA 3CVBA 1T2JA 3ZZLA 1KTLB 2DIAA 5H35A 1QACA 1EGJL 2R0KL 3HAEH 2AQTA 2OV0A 3AS1A 4HIJB 1Q0EA 2AJZA 4FZ8H 3AMLA 2WQSA 1DQLH 2NY3B 1KELL 2ZKYA 3BAEH 3OKNB 4I0PA 4B5EA 1N8OE 2GUOB 3ARYA 1R5IB 3M17A 2CA4A 3P30L 4YPGB 3T0EE 2PW2B 3DDFA 4MQ7A 3F05A 2IBZX 4OGAD 4ZPVA 3VXSB 3H6AA 1DBML 3W9EA 3TBYA 2XKNB 5D7JD 3TYFA 4GKOA 4ISVA 4LOEA 5EOQL 3QUXB 2OJZH 2FYYA 2C4XA 5DJZB 1HSAA 4FOMA 3DO3A 2DQCL 3O4LA 3A4FA 3FH7A 2UZXA 1NMBH 4QLRA 3K72B 4M6NH 4ISVB 4UF7C 3FN0L 5FO7A 3TA3A 5CSBA 1H3XA 3QJFA 4O5LL 1K4CA 5BXFA 1U8CA 3N0AA 1A7RH 4BFOA 3BW9B 1ACYH 3BVNA 3RVUD 1FFRA 5DQ9A 2W88A 1NCCL 1R19A 3GSNH 3IKCA 2D0HA 1GGTA 2EDDA 3KPRA 4IOIB 4ZW8A 4JM0A 3ULSA 3C5ZC 3AGWA 4WW2F 5DZVA 4U6VH 3DPBB 1E4WH 4PJ9D 5BPPA 3BW9A 3D07A 3MRCB 4H0IA 3UTTA 5C0IA 1UA3A 2IADA 2ZOOA 3EYOA 2WP3T 2WO2B 5DD3L 1FIEA 1OHZA 1GC1L 5LXGL 5C8JB 3MNVB 4KH9A 5E94A 3MRKB 1RZKL 2DICA 1UOVA 5DEGA 4J2XA 3RVVC 1D5RA 3GI9L 5C8JA 2O61B 1JZ7A 4OI8A 1E4XL 1BZ9A 3ETSA 4UTAH 2YPKB 2QQQA 1S7WB 4XC1H 2X7LA 1VZIA 1MELA 1X5XA 2QADD 3QHFL 4QRSB 4U1IA 5D1XB 1U4EA 1ZT7A 4M8UA 5FLVA 4JE4B 1OGAE 2DL2A 1T66C 1AG0A 4GG8B 4PJEE 4MAUH 2Z92B 2ZOLA 3VG9C 4CU6A 2A9BA 4XPAH 3W2DL 4U1IB 5AKSA 2WJ5A 1QABA 4DEWA 3FAWA 1J5IA 4H7VA 1OCZB 3UBXA 4HPYL 3FQTA 3D85A 4BFGA 1MNUH 3QXDB 4TNVF 1PIGA 1XF3A 3KYMB 3FFCD 5D7LD 1YN7A 1RJLB 2BOLA 2VLRD 4R96B 5C2BH 5IVNA 4FFZL 3ZIYA 3EJPA 2OMUA 2Q6WA 4W4OC 1Y6MR 3ARFD 4PJDF 1BZ7A 4XB7A 1V3MA 2X9YA 5C0JA 1U8OA 3PF2A 2F74B 2AGJL 2ICWB 1CU4H 2EDXA 4DVRH 2Z7WA 1C7SA 4PWEA 1MW3A 3BVDB 1NCIA 5GRXG 1TTBA 5C07E 4O51A 3QO0B 3TNMA 3OX8B 1J8HE 4J7RA 3RIFF 5DEJA 1F6AB 1FVEB 3CC5B 3L54A 5IJDC 5ESQA 1T4KA 4UT7L 3FH5A 4XWGH 1F4YL 4HWEH 1P1ZB 4E0RB 1R6VA 2GHWB 4MGXA 1A6UH 3MGOB 3CJJA 3VI3E 3BWSA 4JRYE 3CC5A 1FGNL 5T5NG 1Y1UA 3ALPA 3GYRA 1A25A 4LGPB 5EOCL 5KJ4A 4JZNA 3AWEA 4GY4A 3JV5A 1ZIAA 4M7ZC 2HB0A 3MFGB 4TULL 2WB1A 2Y6TE 3MRDB 3WS3B 3PGFH 2LU5A 4D9QE 1MFNA 4WNQA 3BUQA 1G7HA 3TA3C 5FCUH 4HIXL 4Y4FD 1GGIH 5BZXA 2IOMA 4WUUE 3WIHH 3J7HA 4X4ME 1KCUL 1W72L 1RY7B 4LL1A 5T3ZH 4LSUL 3MXVH 3L5JA 3UAFA 1D7CA 1O7SA 4ZRGA 5DC2A 3JWOH 1YVLA 4JY4B 2WINA 5E8PA 5I18H 3TESA 1RVFL 3STZA 5BUAA 2A2QT 1T2QH 3BSZA 4PLJC 4J3OG 2YGOA 3Q6FA 4P05A 2R83A 5MENE 1VEPA 3F04A 1UWXH 1JWMB 4TPRH 4R7NB 5DMKA 4JFUA 3DYOA 4UU9B 3LNFA 4JE0A 3CH1A 3WNNA 4XPBH 2YBRA 4A2FA 1IC4L 4QTIL 5T3XH 3QNZA 1NUDA 5BV7L 3ZDZF 4QRTA 4XH2B 2B39A 4GG6A 3GTNA 2FD6L 1V3LA 3QUXC 4JPWL 1Z5LA 3MLZL 4A55A 1VADB 1KN4L 1SYVB 4OM0H 3FONB 1N0XH 2BY3A 3DKHA 5D2LE 4B53A 2R2EB 2W5PA 4MB4A 2FEEI 2A6DA 4HWNA 3N55A 4N4YB 5EUKA 3COOA 4WGKA 3L3DA 2EE6A 4ATWA 2D4DA 5JMRA 5J6GA 2G60H 3OPUA 3ARXA 4X7TA 3DJZA 1CZ8H 2JIXB 4R8WH 4Y2LA 2D4FA 3DTDA 5E2UH 1ZLDA 2WW8A 1X5MA 1T5XA 5EWIH 4G80B 2FWOA 4R4BB 4TQ8A 3IMVA 1INEL 2DWXA 4KDWA 4OGQC 4ODXB 4DP4X 5ILTH 1CU4L 5I1KL 4WV1C 3WTWA 5E5UB 3SZKC 2RACA 4OLWH 3ZDXB 2PABA 4IRJD 4Q14A 3WMPA 3IXTA 2YEQA 4CSSA 1DVQA 1BFOB 1V5JA 5L88H 3LN9A 4QF1B 5AW5B 1MHHB 4AEFA 3DI2B 3PL6C 4KNSA 1QYGH 2Q7NA 1ORSA 4PJ9B 5B22A 5K33A 4PJXF 1AZRA 1ETZB 3NCBB 1R5VA 2ZG2A 5DJAB 3WNJA 1FYTE 5ECJE 3OKLA 5MEOB 3K2KA 2XA8H 1NCAH 2NUPB 1RP9A 2COQA 1H6TA 5E2TL 5A16B 1GGBL 3VRIB 3L1FA 5IROC 5AB1A 2BPBA 5E9DB 3RA7H 4IBZA 3CFEA 4PRPB 3IDMA 3HMWL 4NO3B 1ADQL 4BWWA 4D0BA 3EFOB 3I84A 3EBIA 3ARQA 4OCYH 3GSQA 2K8MA 4ZTPH 1BYPA 3VG0H 1Y07A 1DDHB 2Y3NA 4FQCH 4IBLT 1OQXA 4PEEA 2MPAL 4KHXH 1V7NH 1N5AB 4D9LL 1JCVA 1QFWI 2FR4A 4LF3B 2AEQL 4RNRA 3GSQB 1QWUA 1I1RA 1P84K 4PG2C 1A9EA 4S10A 5ANHA 3LV3B 5LCVA 1N5AA 4R7LA 3I50L 3MMEA 1LD9A 3FB6A 5CN1A 5FOBA 1BJ8A 2RJMA 4D0DB 5JHLA 4P9HH 1RURL 1YEFH 1IBGL 1UQSB 2EO1A 1GR7A 3MXWL 4PRID 1ED3A 4MVBC 3TJHD 3H9HB 2JK5A 1LHZA 2K6WA 1G87A 3ASWA 1ET7A 5B39B 3ARTA 3MKGA 4HGKC 1NGXA 1UQSA 1SY6L 3L4CA 3PJSA 4JO3L 2EH8L 4YWGL 3HJEA 5H4ZA 4BK5C 4XXCA 4ABVA 3FULA 1DFXA 3GB7B 2F15A 4F20A 4OQTL 4QHPA 5KJ7E 3Q44A 1NGXB 4QNPF 3ZT5A 1AG6A 2FJGA 3QPXL 2A9DA 3F6LA 3QPQC 4BCYA 4XODA 1MAJA 4AJYV 2EXWD 4F9LA 1PU0A 5JOPE 3FN0H 4AV5A 4TSAH 3BUBA 4Z7OE 1ZT1A 4UINL 3MN8A 4NRZB 3FU0A 3RVWD 3V5HA 1FV1B 3Q05A 2QT6A 2VZVA 1MW1A 2DLTA 4WEBL 4L5FE 4ZFFA 2N7BA 1WK0A 4X9BA 1U91B 4LNVA 3S9DB 4OAWA 4DFHA 4EAEA 4LSTL 1JZ3A 1KIQB 1TCRA 4N86A 1I85A 4DN3L 4JANB 2UZIL 1VCBC 4NM8H 1FSKB 3TT1H 4LCWE 4RIRA 4PLKD 43C9B 2VC2H 5ICUA 4Z5RB 4KPHL 4LCUA 4P5MA 4AMKH 4K5LA 3TZVB 1D7DA 2V4LA 1TJXA 3DIVA 4QHNB 4F2MB 3GJFA 4K8RC 3V0VB 4U1HA 2BO0A 1QR1B 1A4KA 1JGEA 1E8WA 5KSBE 1KTDA 1FLRL 3KWVA 3P73B 4NWUL 1XR8B 1J1XL 3HAEA 4F37K 2C7UA 4YEFA 3IJHB 5FA4B 3LEVH 4WI4A 4ANWA 2YGVA 1QTPA 2F6AA 2SODB 2UV3A 4C8XA 3C6LA 1J5OL 4PJCE 3SGKC 1B0GA 3BAYA 4IHOB 5GGSY 4MXVE 1YEJH 3G6JE 4AL8L 3MBWB 3QZWA 3U0TB 4A2LA 1LP9B 5C7ZA 1GMIA 2IBBA 3GEWB 4P5RA 1YNLH 5JUEL 2H0EA 5DFTA 2VN3A 2BS8A 1RERA 4X6DB 2R2BA 25C8L 1TZ8A 2WKLA 4PRPD 4S2SB 3AG3B 2EO7A 5F7DB 4JFDE 1MREH 2XNAA 3FQRB 2EVJA 5GRJH 5FGRA 2YJLA 4ZUVA 4ELMA 4DOHB 5GSRA 2IG2H 2QGCA 4ZUUA 4GI6A 4P3CH 3RLSA 3ZLQC 2CG9X 2Q7YA 1RZ8B 5DQJA 4AIZB 2XN9E 4GLRI 4I13B 1I8LC 1U9KA 2J57A 4PJDA 4TUUA 1XF2A 3UBGA 1MIEH 4AH2B 5TD4A 1JZ8A 4TRPL 5BZZA 1NPNA 4XBEH 1IGCL 1I1YB 1XL4A 2E76C 4N24A 3QCVL 4WKZA 4X6CF 3RJDA 3DUSB 4LPTA 3FTUA 4YZWA 2DZEA 4Y2DD 5IGXH 1XXDC 2KZWA 4YZFF 1N7ML 2K7QA 4GRLA 4Q8BA 3EKCA 5BOJA 4M7JH 1F11A 3VU2A 1SJVA 4APQA 1R3KB 1AC0A 4ZODA 3AXLA 3IPFA 1FC1A 3K8MA 5TQ2H 2XG5B 1HKLL 3F58L 3CK0L 2WUBH 1KXVA 3NJVA 2D31B 2UVEA 1XVSA 3WGUB 4HWUA 5FB8A 1U92A 2GSMB 1J1PH 2XXMB 2V2WB 2VZSA 4MS8D 4FTVD 3MLZH 4IQHA 4JMXA 3TM6A 5DRNB 3MOAH 1N0XL 3CVDA 5E56A 3GZOA 4OFYD 2YD0A 1HCYA 2ENYA 4J28A 2Q8AL 3KJ6H 1PCXA 5DJ8B 1OSZA 1FF5A 1OARH 2VDOB 3CUPA 2GB2A 2H3NA 4G3YH 4PP2B 1AS8A 3CSYA 5EH1A 3UTZB 3APMA 4BSWA 1I1AD 4L0YA 1NOFA 3KWUA 4G7RB 5DJ8A 3STLA 4XNDA 4JPIB 3T09A 1NCDL 4U1MB 2HRHA 1NL0H 3D0LB 1MFCH 3NVQA 2MKLC 4X6CB 4EF3A 3HNTL 5IZ7A 4G7VL 3APDA 4E9VA 4LSSH 4NNYB 1CN4A 3U2JA 3VI4B 3ZN6A 5GGSB 4N6RA 2JTYA 4F58L 3D0LA 4X83A 1F56A 3LQZA 2H0PA 4HIXH 4YSTA 1ORQA 3RKDD 3HIZA 3S37L 3HUJF 5I19L 1IBGH 3BQVA 2DMGA 1HSBA 4XE5B 3SDAD 5KVFH 2CLZA 4PMEA 1P7BA 3O2DL 2ENJA 4GAGH 2KT6A 4FNTA 2LHAA 2D7NA 1KLFB 4MWFB 1ZRUA 4KMQA 4NPYB 1T1ZB 4ZW3A 1W9XA 2GBAA 3B4NA 4M02A 4YE4L 4HBCL 4BWUA 4E9RA 1HNYA 5FUCE 1AQHA 4JKKA 5T5FH 4ZFZB 1KLFA 4KXZI 3G04A 5E2VH 1OD9A 3MUUA 5D96C 1OAXH 3QDJA 3IGKA 3US1A 1OL0A 4Z0BH 5E0FA 3QEGH 4MFHA 4B9PA 2WGNB 2YD9A 1A3LL 1G7IA 3BP7B 5IB1A 2BVPB 3DO7B 5FYJD 4U3HA 1CGUA 4XNUL 2BNRA 1PX4A 4OIIH 4DPRA 4CL7A 5HDLA 3US0A 2PYEB 2VH5L 4NUGL 1FJ1A 5AAWA 5SWZE 5D7KE 3VFOB 5IHZB 3F00A 2XX0A 2GABA 2AGJH 3VDBA 4NQEB 3FO2B 4U1KA 3OXRB 4BRJA 6TAAA 2XG4A 3FU9A 2BNRB 5CGTA 3BESR 4N0CC 4XWOC 5KYYA 1ZEAH 1UASA 4DCQA 1H6FA 1T7ZA 1Z5HA 3B43A 5JXED 1ILUA 2ESVA 1DO6A 1QLEB 2ODHA 2AJZB 4F15C 1Q0YL 1T20A 4PJ5E 2DWDB 1OAZH 3FQUA 1H8LA 1L9RA 2UUDK 4NDMB 3FTVA 2PW2A 4MQ7B 5LXVA 1KJVB 3U9WA 2EKJA 1IKFH 2H6OA 5C9JA 2ILLA 2RB8A 1LO2H 4F2FA 2IWKA 3P2DA 5I1KH 2DWDA 3K1KC 2DQHH 4DP1X 4WSKA 1OTTC 4ZOBA 2PR4L 4AUJA 3KPRE 1W0WA 4PWGA 4WF7A 3TF4A 4WI8A 4U6YB 4IRZH 1ZLSH 3PV6A 5I24A 1HCVA 3ARGD 3N40P 4GKNA 1M05B 4JR9H 4UINH 1LTXA 1VFBA 4JLRA 5TH2A 3ILQC 3P77A 1PZ5B 5FF6B 1YSOA 3HS0A 1MPAH 3UTTE 4JREC 3WY2A 2VDMB 4YHYC 1DEEB 3LRSA 1ND0A 4GIAA 3QORC 4N1CA 4P07A 4F9PA 2OR9H 2AXGA 3RZWA 2DQFB 1XR9A 2NNFA 2WOYA 4LRNH 4MJ6A 5HDQH 1C1EL 2ROXA 3BVTA 3OKNA 4UT6H 1BXAA 2QPSA 3KYNB 4HEPG 5A2KH 3EYOB 2R1YB 1LO3H 3FFOA 4XR8C 5CIPH 1U21A 5F0MB 3WELA 4XPBL 5JLZA 1QUNB 4ES9A 4PJHE 4NUMA 3QIUB 3F8UB 1XH3A 4H2AA 4TLKA 1FG2B 4S1RL 3V6ZA 2VCOA 4PJEA 2VKWA 1U3HC 2FIKB 3LHPH 4HJGB 2XC8A 4F27A 3RWHA 2FK9A 4GW5A 5I1IH 5AVSB 1EHXA 1S46A 2A6KB 3WKMH 1NCNA 3QNYA 2EDMA 3MZGB 4W93A 4XNQB 3VA2C 2Y36L 1A7PH 1FDLH 3O81A 2FIKA 4HJGA 1XF4A 4U2YA 1NAML 1DLHA 1HS6A 3QDJD 4A63A 3EOTL 4JRYD 1QQDA 2ZOLB 4LCCC 2W07A 3IRPX 1UACH 3QEQB 1NFDB 4DKTA 1JPTH 1RSYA 2PXYA 3MGTA 1BM3L 2NXZB 3TPUA 3UBXB 1N6VA 3IDIA 3FUDA 1TTGA 1RK1A 3NIDF 4G6JL 1P1VA 5AQ0A 4HC1L 4JHWH 5IB4B 2R0KH 5F71A 4KY1H 1A9BA 3EJTA 2D03H 3IGAB 5KG9B 2VDKH 4ZFGL 1D6EA 3NPSC 1HI6B 3S88H 3ARZA 4HF5H 5AB2A 3PJNA 5IKCB 3QJZA 3F6IA 3H4HA 3T0DA 4EZJA 5DUML 1BZ9B 3DX8A 3EH3B 5FUOH 2MCAA 4P2OD 2VR4A 5EZIH 3B7RL 3TCLA 5GXBB 4KZCA 2Y69B 1N8ZA 2R0WL 4A68A 1U42A 3SDCA 1TUPA 1ZMYA 2HRGA 1KTCA 1X5YA 2X1PA 1KCVL 3ZTCC 3GRWL 3PREA 1MAML 3OHXC 2AJYL 1J0YA 4HS6B 2FIRT 3RB7A 1PGRB 4PBVC 5DK3A 4F24A 4ENZA 3UPCA 3OR7A 4RFEB 2VDRL 1CD1B 4M03A 3KS0J 3ISWA 2WO3B 2EYRB 3PP3K 5AUMB 1EEZB 2YAOA 2HG0A 1P5UA 4R4FH 1FRGL 1KC5L 3NPSB 4OFYA 3TO2B 4ODTH 4JZJC 1MN4A 4L37A 2HH0L 1PG7H 1C12A 1OE1A 4NQSB 5ICYB 1KB5A 3L2NA 3TC9A 4AQAA 2GC4C 5ACZA 1W8EA 2G9HA 2P42B 4HKJB 4LCWD 5GGUB 3ZDYF 3FO9A 3OX8A 1INDL 1AOHA 2YD6A 1G9NH 1C12B 4TUJA 4GG6E 2K3HA 3VWKC 3STZB 1I3GH 5GZNC 3C08L 3L4YA 4H8WC 1JP5A 3RWJB 3KLAB 3PV7A 3LSOB 4K9EH 4S1RH 4X4YB 3TEYA 1AO7A 1BGXL 5EO9B 4Z3HA 3OM3B 4QYOB 3TEWA 2LAAA 3HOGA 1SY6H 1N70A 3ME0B 2ZUVA 3H42L 3DHMA 3QNZB 2AP2A 1NGWB 4YLCA 5HTSA 2XY1A 4K23H 4A1RA 2D3LA 3DHJA 4OQTH 2B15A 4P57B 4Z3TA 1OALA 3RNKA 3SE4C 5DS8A 5DT1H 3QDHA 4GO8A 1VADA 4BXSV 5C7XH 1A65A 5HVFB 4D8PB 1KUMA 5I15L 1WITA 3WY4A 1DJXA 3MV9D 4NUPA 4MCYA 1DQTA 4P9HC 3RI5F 4P3WA 3UAJD 1BZEA 4NQVB 3V0WL 5F0PB 3C6SA 4ETQB 1L9PA 4RMTA 1KLGA 4H8UA 1ZS8B 3X3FL 1AKJB 1NANI 4GBXA 1DVYA 3N43F 1C5BL 4AMXA 1XZ0A 3GSRA 2JXMB 3IF1A 4PIBA 4FQLL 1D7BA 2WXLA 3V0EA 4PJ7B 4XMWA 3O4OB 1DVUA 1K8IA 3VSQA 2P26A 3SDXF 4IEFA 3D5OF 1RU9L 1GOHA 3WSQH 1VERA 2NY3C 4E41D 1ES0A 2JKJA 2YA0A 5IQMA 4S0HA 2CO7A 4C54A 3WS6A 2XWXA 3UADA 4ZMWA 2A73B 2XWJB 1Q9LB 4PN6A 5FHBL 4OCSL 1CFMA 3IRCA 3WKNA 2D8KA 4WUUB 3NCYP 1F90L 3BAEL 4QRUA 3JWNC 3BAJA 4G11A 4MAYB 4MZ2A 4KKZA 3BH8B 4PJ9A 3M1BA 5FGBC 4DVBA 3OB0K 5IBTH 4F7PA 2DI7A 2IDFA 2BRRL 1EZLA 2A99A 4KK6D 4Y5VC 2OBGA 1BF2A 4Z7QF 5DUBB 3BH8A 1YG9A 3VM5A 3L3DB 2AEPH 2NTFB 2BC4A 2OXGA 2EYSA 4AJWA 2VL4A 1I31A 2ALAA 2DS4A 2OZNA 1WA1X 1MI5E 1AZUA 4EI5D 4G9FD 1S7UA 2IV9A 3WENA 2HJLA 4G1MB 2GY5A 3UOAB 3DXAD 5E5MB 5D2LA 1G1CA 5AVWB 5L2KB 2J73A 1OM9A 5ANME 1JHTB 3DVGA 3D69B 5AZ2L 4XNAA 3ULUH 3QFJD 4YAQB 5HJ3A 2WD0A 5EUOB 3FT2A 4RA3A 4UIKL 4Z76B 1RPQA 2VDMH 3SY0A 3KWTA 1QRNE 1U2HA 1X7SA 4MB3A 3MLVH 1GZPB 3QIBA 5D8JH 5GGTH 2GHZA 4ZDHB 5DGQA 1ASOA 4PJ8A 4KKCD 2C3VA 2VO8A 4ZOEA 3VTTA 5JW4N 3QISA 2J2ZA 2K0RA 3SDAB 3JQOB 3WUWA 2R69L 2G60L 4GT7A 3QH3A 3ETTA 5GS0H 4W9LC 2J6WA 4YSRA 4TF4A 1CR9H 4N8VB 4HIHB 3II2A 3VCLA 4I3GA 3SPJA 4J23A 1R4XA 3MRBA 2YKLL 5ILTL 1AQDA 1XCWA 3IDMB 1N3NA 4PBWD 1MCPL 3LQAL 5EWIL 4PM1A 5GISH 5IEHA 1FFNA 4WJG3 2XZZA 1FNHA 4IOFC 5DVOA 3UJJL 1Z9PA 4JM2B 2OSWA 4AYMC 4OJCA 3UBXG 5A40E 3BQUA 1T0NA 5JIQA 1K8DB 1I1AB 1ULVA 3P9MA 3K0YA 1G5AA 3ZHKA 2APXA 2NW3B 5HI4C 2BMKA 5F9OH 2JB5H 1XSKA 2FAUA 4UQIM 1EEQA 1OY3B 2X70A 2P28B 2OJEB 4LEXL 5D1ZB 1IC7L 4JJ5B 4D7PA 1FNSL 5C9KA 4JO2H 4NAQA 5GS1C 3B5HA 1FH2A 4YDIL 5AOKA 1X6LA 2OZ4L 3BGFC 4C4KT 2QPEB 1KENL 3X13A 1SOSA 1EJ8A 2VAAA 1MRFH 5EO1A 3VFWB 2QHLA 1KV3A 2H6PB 3G6JA 3NTCH 3FNKA 1RIVH 1LO4L 2GJZB 1BQ5A 3C6LD 4FL4B 3CDZB 2JTDA 4UT7H 4XWGL 2VZOA 3POHA 1F1DA 5DFVC 3ZUCA 3ARPA 1A8JH 1NGPL 3RDTA 1QHPA 5E08L 1Q94A 3M88A 4PJ5D 3MRLB 1NCUA 3VD9A 1NEZA 5B4MD 1CGWA 2K70A 4GUCA 4P2OA 3H6JA 4WJ5B 2BWIA 3S3BB 3SE3A 3S3JA 4N8CL 3P11L 2OXHB 2ZCHL 4PJFA 4Y88A 3SJVD 5I1AB 2LGNA 4AVKA 4JPVH 4WGVB 2AQNA 5C0EB 4M6MH 3L3GA 3WIFB 1NGYA 3KPQB 1YECL 3MREA 3TONA 4AIEA 2BHYA 4ZFOL 1BLNB 5E6IA 1LE9B 4XO5A 3IT8D 1IKFL 1JZJA 1KBGH 5D4QA 3FW6A 3NSFA 1GGIL 3O3DB 2Y6SC 3QQ4A 4K5NA 4NZJA 4NN7B 3V4PL 5SX5H 4HAGA 4M8VA 4KFZC 3TZVA 3FTYA 3UTTD 2O5XH 3PWUB 4F2MA 2X28A 1BAGA 4MJHA 3VQ1C 1T22B 3KBPA 3T4AB 3TH4T 3PQYE 5AKVA 3QWNA 4XVJL 3KLLA 2AK1H 4KJWD 3T0XA 4L4VB 1F6LL 1INDH 5BVJB 4MXWH 3PGCA 1RUML 2ZJSL 4X80H 3T4AC 3C6LB 4JCMA 2AK4E 3TASA 4AGOA 1CPUA 3DGCR 3VD0A 3GGWA 3G6AA 4N2EA 4Y1AB 4QRPB 1O9ZA 2VDNB 5GJSH 3TBTA 2DJUA 3GK8L 1UZ6E 1CF8H 4PGDA 1E5AA 5D7JA 5E23A 1EV2E 1CXLA 1REIA 2BDNH 1EFXB 2XVLA 1BX2A 1ZPUA 4ZX4A 3MVSA 1WISA 3JTTA 4GUQA 1S9XB 5AZUA 3DMMC 3LH9A 3PABB 4LHJB 3GLZA 4UTCA 1KWKA 5KSBB 1D9KB 2W9LA 2IDSA 4Y8AA 4Z23A 1I9RL 2O6DA 1UUNA 4IKIA 2NX5E 3K6IA 3EJSA 4AMKL 2VXVH 2KQMA 4RGND 2W0FA 5ID1A 3VNZA 1E65A 4NM8L 3V4LA 1OIOA 2DJ4A 4NO0D 5LGYA 3VQ2C 1ZTXH 2QTEA 1E5YA 3OG6B 4B9YA 3TZVC 2PCYA 2YZ8A 2WXOA 1E4WL 5ID1B 5C09E 4DW2L 1VKXA 3N42B 3KLSA 1MY5A 1DQML 4FHKA 1RZPA 4Y5XB 15C8H 3C08H 5E6IC 3T4YB 1ODUA 3WFHB 2Q86A 1RU9H 3TEUA 3WSQL 4AKQA 2XN9A 3RJOA 4GXVH 4CUCA 1Y0LB 2VDOH 1IV8A 4GI8A 5CZVL 4PRDA 3IFLH 2X4UB 2I07B 2Z35A 4FQHA 1YNTA 2QADB 3O0RH 3PNWA 4JFFE 5GIRB 4P3DA 3BDYL 2IAMD 5C0RL 4I1PA 4J3SA 2QJDA 3H9SD 3HW7A 3C5XA 4EI0A 3NIGE 2GBVA 1JGUL 2BSEA 2ZXDA 1DJSA 4GQRA 3L5HA 3ASNB 3L3IB 3EUDA 5CAYB 2DQDH 3NFNA 4R97B 4CADB 2YPLA 2HRPL 3LD8B 4LDLB 1RAMA 5TDOB 5DCCA 3VMPA 4K3DL 4ACPA 4WHDA 3VXUB 3D0VB 1EAQA 3M46A 2H9GA 1J9TA 1KV7A 4AYDC 1CJYA 3L17A 4LP8A 3HZVB 1W0YT 4WV1B 4JPIA 2GVYA 4G70B 1A3ZA 5JHDE 4XE0A 4CC4A 1RIUL 2YD4A 5L6YL 1T80A 5DJDA 2WGXA 5J9PB 1JPGB 1IILE 2ORBH 1C16A 2BW5A 3VDCA 4MZ3A 4ORZC 1FRGH 2G75A 1ETB1 5D71H 1SY6A 4FZ8L 1KB3A 35C8H 4CRPA 3MV9A 1QA9A 1A3RL 1XGQB 4Q6KA 4LNRB 4DNLA 2ZXQA 3V55A 4ORGA 4OQTA 2WLHA 1JK9A 2GTQA 1V7MH 2HX9A 4OZIF 1UT2A 3MV9B 2Z7UA 2I5YH 3FB7A 3K5RA 4JDVA 1AAJA 5FM5O 4S1DC 1Z66A 4LPYA 4YDVB 1VB9A 1T04B 4PV8A 5CD5D 3ZQWA 1LNUB 3ARGA 1CFSA 4FP8H 1MW0A 5CLYA 5C0CE 4YDVA 4ONHA 4X98A 4F92B 2F54D 1D5ZA 4IOFD 5IB2A 3GNMH 2R1XA 1QVOA 4N22A 3I3DA 3D0AA 4QUOA 1G7LB 4NAJA 3I6GA 4L8SA 1RUMH 2ZJSH 2JCCB 1NDGB 5KVGL 1HXYB 1E30A 3JWDL 3RVUC 2P7TA 2WXQA 3A6BH 5FO9B 5KW9L 1JL8A 4KX7A 3QDMB 2AJXH 5BOPA 2X87A 1QFPA 1LL1A 1ZXQA 3D39A 2PCFA 4MAYC 2WK2A 4KK8C 3HN8A 2IVFC 3RWGA 1NOLA 5HHOE 1C1EH 2WKGA 3DYPA 5DK0A 3BVNB 4H13C 5TDPA 2N1TE 2EVGA 5I0YA 1J48A 3TX4A 1I53A 1ZD6A 3EADA 1SVCP 1FIGH 1BYOA 2FGWH 3KEDA 1WAEA 1LEKA 1OVZA 4UQ2B 3U25A 1B9ZA 1Z7JA 4DUWA 4HV8A 5C0IB 2DQDL 2MTPA 2VZ3A 3N1PC 4DZ8A 1I8KB 2W65B 5T1LD 2UWEB 5CUSL 5FGBA 5I66B 4BH8B 5I1IL 2HKHL 4PJ8D 1UA7A 3QRGH 3KH4A 4UQ2A 4WI5A 4TSCL 1EMTL 1OCWL 4PRHB 3V8CA 4OSUL 4C4BA 3SBPA 3TO4B 4N2CA 1A7PL 5AW6B 1BWWA 1PZ5A 4A7GA 3L48A 4R7VA 3TT3L 2DQEH 2X1XR 3VXSE 2KPWA 2CH8A 3F7YA 3QJUB 2DM4A 4J6RH 4K5MA 4OCXL 4OUOA 4XVSL 5CILL 4AM0B 5B38G 1AIFA 1N64L 1JVLA 1QNZL 3BUPA 1WA0X 1T83C 2BZCA 2FQEA 4XCFH 5G55A 4KK6C 5BJTB 6PAZA 4NQCB 4PRAB 3PIQA 1RUPH 3LYRA 1PNDA 3GMLB 1RIHH 3E2HB 3WAJA 1M7IB 5C92A 4HMEA 4Y4KC 1QLEL 1P7QA 4N26A 3P69A 3ZIMA 2GW5A 2R1YA 4WJKB 4B97A 5K59E 5E4IA 5E2JA 1KJMA 3GSOA 2H7WA 4F7MB 5D72H 1QLRB 2H1PL 5HDOA 1U3YA 1U6AL 2G30A 3LZFH 2OFQA 3AZUA 4JFOA 4XMUA 4B5ZA 1CUOA 5C0AA 3D25A 1NCDH 2CE6A 4M1GH 3D4YA 5EO0B 4MYPA 2FJFA 4XGZA 3FQNA 3RFZB 1KBPA 4NENA 1QLRA 4IYKA 5F3HB 4P5TB 1R3IL 1VEOA 2DQHL 3BFQG 3ZTJG 3DTXA 1JPST 1IIKA 2I9TB 5I71B 3U7YL 5C0AB 1BZDA 3T6ZA 1NUFA 4HUWA 5IJBC 1AD9A 2HLAB 3LH2H 4G9FB 1E4JA 4PJHA 1ZLUH 3KBFA 5HDBF 3S3PA 3HHRB 3MRIB 4N8UA 1EIBA 2P80A 2YAMA 1WYJA 2CDFB 4NIYE 3WLBB 2VLRB 5BNXD 2PXYB 4UQBA 3CSFA 1EGJA 3NCWA 3VJ6A 2WWNA 4NFCA 4PI0A 3ETBF 5C07B 1OQOA 3U4EA 1U8OB 1JTOA 1GY1A 4RQQA 5IFJB 2ICWA 3LPWA 2QVFB 4NQCD 2R59A 1QHOA 5JW4R 4JRXA 3S96A 3B2UC 1P5UB 1MG2C 2VJ0A 2WBJC 2VZTA 4CMMB 1ZA3A 1OAQH 3D85B 3DRQB 3QXDA 3CGTA 5E5LA 1TF4A 5CU9A 2WWKO 3BRDA 2GT9B 3SKOA 1HOCA 4R90H 3DX3A 3VWKD 1IAKB 3HC0A 5E03A 2HXAA 3DRQA 1CF8L 1E9PB 3QEQE 4TVPH 2IPKA 4I3RL 1TEGA 1YLBB 2VDPL 1IGTB 4WI2A 4P5TD 3QHZH 1TTAA 2P8PB 5T5NF 2NUTA 5F6HJ 3S5LG 3R8BB 3E6HB 2Y1VA 3EYFB 3BZFB 3IPEA 1T21A 2A0LD 3O6FA 4OJDH 3V4PH 1KGYE 1URIA 2ADJB 2D03L 1FE8H 3QXAA 3NPZB 2IDCA 1VJSA 2G5UA 1AMYA 5ESVA 5MHSD 4K5OA 3WKPA 1NFIB 2R0ZH 5D9SA 2ADJA 5I15H 5FV2A 4YNYB 3HMXA 4L3ED 2XX1A 4JRYB 2VR6A 5B1JA 1AANA 4KQ3L 1WVZA 3PHOB 4WWOA 1HHJB 5DURD 2LOEA 1KYAA 1CL7I 3N0PB 1IGJA 3Q6FB 2VXQH 4FQXB 1G1KA 3SQRA 3GZPA 1SZNA 4A04A 1CB4A 1E9QA 2HFTA 1M1XA 3VGFA 2CALA 5EBWB 4W70A 5I74C 4G42B 2YBRB 4JM4L 4FX5A 3CPUA 1CQKA 4HXBH 2VJXA 2QPFA 3OJ2C 1EO7A 3VXRE 2CO1A 5AVUB 3G6DL 1PNCA 2F7QA 1DLFH 5KJRH 1KGCE 1DSWA 2F1BA 3FCUB 2AJSH 3EOAA 4YGAB 3P30H 3BC9A 4YK4B 5SWSD 4P04A 4XBPB 3D2UB 3QDAA 1MXDA 1VGKB 5FYKE 2TAAA 3ELQA 3UJIH 3T1WA 2FYVA 3BIKB 4YHYB 3HMXH 4FFYH 2YK1H 4MD4B 4XNBA 2CWRA 1AO7E 1CVRA 1HQRA 4XH2A 3WCYA 1XL6A 5EMYA 4G8IB 5LNEA 4GG6B 5EEZA 4AM0Q 3H0TA 3TTSA 3ZQXA 1IM3D 3TBSA 3RKDC 1Z9OA 2YSSA 4JM2F 5IREA 3RHWK 2IGFH 1IARB 1Z9SA 4HDIB 5J8OA 1RZFH 2VXTL 3VW3H 3SKMA 4PLOB 5TTRA 1TVDA 4GXVL 1DVSA 2UXVA 3MBXH 3TA3D 3IF1B 2D7MA 2X88A 1S3KL 1S7QB 1XCQB 2HFFB 3VO0A 4BZ1A 1F4YH 1AC6A 1THCA 1DBKH 3HE6B 3B8YA 4ANXA 5E9DA 4CW1B 5L2KA 4WWKB 4K2UH 1L0QA 1B3IA 1DN2A 2HKFH 5E00A 5I26A 4DWHA 2IF7A 4BEIA 1M1SA 4KDTC 4UTBH 5EFIB 3UTOA 2VR9A 2V9RA 3BEWA 2EEXA 3JVGC 5DJAA 3VFVA 5HDQL 2KH2B 4OH2A 2OMVB 3T3PE 5E00B 4ZNCD 5KN5B 1X3DA 2CM6A 4F7PB 2GUYA 4NUJA 4IRJC 2DTML 4NN6C 4MJ5A 4FTVB 1M7DB 1TSHA 3QH3B 1HDMB 5LBSL 1Q8MA 1OSPH 4R2GC 2R2HA 2HKAA 4PRIA 1SUHA 1RPKA 4FTVA 5BV7B 1KCKA 3KJ4C 3L9EA 4LLYB 1AI1H 3RU8H 2QADC 4A6YH 1ZIBA 4EOWL 5AVTB 5ITFA 2E7CA 2C1PA 4WZ9A 4YSOA 2F53E 4KU1A 4HS3A 2WQAA 3RWFB 1MHCA 3DSNA 1BG9A 2JKWA 1UXSA 1TQWA 3BH9A 1JBJA 1NJ9A 1RJZB 4ZSOE 3QBTB 3RHWF 1BQRA 1P2CA 2EDTA 1UYWH 4XNZB 1QO3B 1GJIA 2RQ8A 1VACA 4Y2DC 3APFA 4PRNB 1Q0YH 2ROYA 3DUUB 3P4NB 3N5AA 4JFXA 3RY4A 5KSVA 1NMAH 2JLPA 5HHNB 2VC2L 2DQGL 4N3TA 2J5WA 5JW3H 1OAYH 2R4RL 2WXFA 3OKEB 1W6WA 2V5SA 3Q5TA 2XV6B 2OMNA 1F90H 3KPLB 4JGJA 2NY4B 5LBVA 1YEIL 3E8UH 4AGPA 3ARDD 3ULVE 2HG5B 3LRGA 1D9KC 5IEKB 4QOKB 3OKEA 1UD6A 1UWYA 3B9KB 2NW2B 5FDWB 4WFGD 1P4LB 2JWYA 5EUOE 3BDYH 5C0RH 5KANG 1HL5A 4R26H 5FKAA 1NCTA 4HQQH 4FKKA 4B9JA 2AKRA 2HJFA 1JGUH 3TNNB 1XB8A 1JHKL 3VWJA 4N0YH 4RMVA 5IHUH 4RH4A 1CBVH 5B4MC 2N4IA 1JGVH 3V0VA 3JTSA 3FUKA 3T6QC 5KZCD 1X4XA 1JFQL 3BUYB 1HVXA 4WHCA 4XP9H 5AW1B 4PJIF 2VN4A 4EZMA 5L2JB 2TSAA 5E1HB 2CJ3A 3Q06A 3A6CL 1IM3B 3BD3A 4FXTA 4O02L 2M2DA 1ZT4A 3AUVA 3QAZB 4IHOA 1M7UA 1CLYL 1AGFB 3LIZL 3ARUA 4JN2A 5CSGA 3WGVB 1FL3A 2X2UA 1IUZA 2JIXD 1C7TA 2F9BT 2OM5A 3FCTA 3HKFA 3X1GA 4G2AA 4DK6A 4DT2A 3KMDA 2X6CA 4XCYB 1JPFA 4WTXA 1A47A 3GSWA 4M43L 1HZHL 3FPYA 3H3BC 3CFKA 1N2RA 2R0ZL 1TNNA 1XR8A 3HAEB 4QXGH 4PMFA 5IG7A 1KTBA 3IE9A 4DKFL 4YHZH 1RZ7L 3ORJA 3D8MA 3D3VB 4OZ4B 4RZCB 1GZQB 2FNBA 5I17A 5DYOA 4Z5RA 2IH3B 4P5MB 2NLJB 3HBZA 3LNGA 3AG2B 4NEHB 4L4VA 4PRHD 4QR7A 1Q94B 4TTGA 1AHWA 2WV3A 5BO1H 2ZG1A 3GSXA 4AL8C 1E3XA 1MFDH 1SF3A 3HI5L 4HWBH 5EBMB 2MCG1 5C0FA 1JGEB 3PHQB 2VDPH 3MYZA 5K69A 4A6YL 1Q9KA 4L4TD 1R47A 3FCGA 3U2SB 4IW4C 1EDHA 1S9KC 5AW4B 4DPAX 1GIGH 5EOTB 5H37G 2XZQH 3RZCD 2FGWL 3NJNA 3LKOA 2PO6A 5HDBB 1ZVNA 4KKQA 2CD0A 4GRWF 5EZPA 3MBWA 2PPCA 3D9AH 3U9UA 5FO2A 2XCMC 4PJFE 1S9VA 4F3FB 2XIDA 1TZIB 3LZFL 1DUZB 3F7PC 2QKIA 3QORD 4LKCB 5L8JB 3DV4B 4MNQA 4CILA 4QJ4B 3MFFB 2DD8H 1SHSA 4X5LA 2EIZA 5D1ZC 3WG7B 3DUSA 2VTFA 3A6BL 4UQDA 4G6JH 2Q3AA 1KTKE 2GEEA 4M7JL 5DHVB 2HFEA 4QT5A 4NN7C 4EKXA 4FQ2L 1BPVA 5BVJA 4KGJA 4LSSL 3MLWH 1E5UI 1XF2B 4Q58C 4BQ6A 5CD5C 5BRZB 5JORA 4J5VA 1U36A 1BVNP 2ZX6A 1WTLA 5IJVB 4QHUB 3VWJC 5KVDL 4X7SH 5HGDA 4L8BA 3T2NH 4ODWA 3H2QA 4N8CH 1N68A 1HL8A 1IFHL 4O4YL 2DQUH 1UFGA 4P3DB 5D7EA 2IG2L 1MG3C 4W9IC 5HGAA 3MLRH 4A38A 3S8GB 1G9MH 2L3BA 5B1CA 3W9DA 3OV6A 5JXEC 1CICC 3CN4A 3RIKA 4ADIA 3MCKA 2YK1L 3CFJA 3UROR 2X0WA 4IJ3B 1A21A 5IWLC 1KJ3H 3CSYB 4FFWD 2OI9B 3LIZH 4BRVA 2ZXCA 1SDDB 4BDVB 3OWEA 5IBLD 4DGIL 2PPDA 4S1QL 1GGCL 4XVUD 4XCFL 2G2PA 1OT2A 4Z78A 5FW6A 4JM4H 5KVEE 1OE2A 3NCJH 3V6FA 5I1CH 3VI4A 1QD0A 2IWEA 1LO5A 2VXQA 2WBXA 4Q6YA 4Z7UA 3LVEA 4MRBA 5I75C 3BQUC 2DLGA 3NCFB 3Q3GA 4J3OH 2X4UA 4YQXH 2NQ3A 1Z5YD 3STLB 1JPGA 1JPEA 4HLZH 4UZUA 1GSKA 1UTDA 1RHFA 3IMBA 5HHOD 1JF5A 2EC8A 2YARA 1EHKB 4QKXB 2VITB 3QI9B 2WCGA 5HHVL 2FT6A 4WK2B 4ZMPA 2XPGB 4R7DA 5FOJA 1KMGA 1J8RA 1BIIA 3PS6A 4ZUSB 3ZE0B 3L16A 4MWFA 4NKOA 4OZIA 1CVSC 1RHHA 3O41B 2YKLH 3FRUA 3ECBB 2AABL 2CZNA 4I18C 3MBEA 3JT0A 3QI9A 3WO4C 5B8CB 3BO8B 4Q89A 2XPGA 2EEFA 5DR5L 1XQ4A 1WHPA 1Q1PA 4J3UA 4ZTEA 4E9SA 1QW9A 3S4SB 1X5ZA 1MY7A 2ESVB 4RFOH 4LRIA 4PV8B 5I0DA 4PGJA 5CZVH 2EQDA 1GC1C 1ADWA 2P48B 5EZOH 1AXSA 1DE4A 1OD7A 3TBWA 3CZNA 5I1GH 2DQ6A 4NDMA 3TBBA 3VFNB 4OLVH 3D39E 5IHUL 5KZCB 1F00I 1YEGH 4AK1A 4BGLA 3EF7A 4UDUA 1BQHG 2XFXA 5J9PA 1NKGA 1QI3A 3RX8A 4XX1G 2WWOA 3KNBA 4JFVA 3ATEA 4M5TA 1GYVA 2A74A 2WBKA 2YD8A 2J71A 3MLWL 4HWBL 4DTGH 4PUBH 4W4NA 4PS8A 4N2OA 1K4CB 4PW4A 1JOIA 3VXUE 3QWQB 5BXFB 4M6OL 5F7EH 3TJHC 1H8OA 1QBMH 3JBG7 3FTGA 2VISA 3NESA 3NJJA 4FNPA 4KRLB 5DD1H 4HVBA 3HN5A 5FKPB 5T5FL 5LJYH 2J56A 3QI9D 5GS0C 1DP0A 1IGMH 4JFZH 3Q8CA 1HL4A 1UB6A 1LDSA 3N1MC 4GAJL 4ZT1A 2CRZA 4AXWB 5GQBA 1E3FA 2X4PB 4WI0B 3T3MF 2RFXB 2HUHA 4NKDB 3JWNH 4IU2A 2BJML 3GHEH 2VLJA 4S1DD 3BKJL 4HS8H 5E8EA 2RAMA 3HUJA 2HKFL 1VFBB 4JLRB 4Y9EA 4XPAL 1WBZA 1LK2B 2E75C 1JERA 2F54B 3Q6GH 4AUUA 3KXFD 4MMXA 4WKXA 2DQJL 2CCWA 5HJBA 3MYJA 4G7QB 5I6LA 1RLBA 5D2NC 1JJUA 3IJ7A 4TVUA 1KYOJ 4TQHA 1DVFA 3J8F7 4RETB 1E67A 5L6YH 1S78C 2CO2A 1BZ8A 3TFBA 1GC1H 1ZT7B 4L1BA 1QEWA 4HCRH 1FBIL 2CJSA 3E7JA 5KYUB 1XAUA 2AEWA 5CZKA 3T0EB 5C0CA 2Z92A 2ZX8A 5IQ9A 1I8MB 2VMDA 3OKYA 3Q2CA 3JWNE 3HCVB 3L5XL 1QMUA 4V2BA 4ODSH 2DF3A 4UT9A 4UAOC 1DBAL 1LK3H 4L9LB 4NJAH 1ZTXL 5HI3D 3FT3A 1EQWA 3MJGX 3MV11 1NBZB 3H2PA 4LLUB 4PJEB 4Y5YA 3C5SB 3WFDL 2VRKA 1XV8A 1CL7L 1JF6A 4FRWA 2UY7B 1MAKA 2OCCB 4KK5D 4U6VL 2EZ0C 4NC1C 3TBYB 5IFHL 2UWEA 4OF7A 2XQ0A 4LHUG 1QSFE 2HYMA 5HGGS 3GMOB 2X41A 1YAIA 3QZMA 4J1UB 3MRKA 4XN8A 5BRZD 5KBLA 1DCEA 3A47A 1T66D 1HI6A 2VC2B 1HSAB 4GSDL 3IFLL 3ZHNA 5IHLB 3F01A 5IMMA 5BUGA 3HPLB 2I9TA 3KXFB 4RGNE 3TA3B 1FNEB 2P24B 3NZHL 4P4KC 5J12B 2FJUB 2CLRB 4RCAA 1S8DA 4GQQA 2WVVB 3BAIA 3RWEA 3X11B 1GTNA 4R4FL 1AI1L 4YFEA 5A2BA 4OLEA 4JZJA 3UP1A 1PBYA 5EIVA 1KT2B 1A66A 2YMXL 1QQDB 4QRRD 4CVZA 1T6VN 3K7UA 3AVEA 1XHHA 2BSED 3MCG1 1B4JH 1O9VA 5KYNA 1EDYA 4RFEA 4JRXB 1UH2A 4JO4H 4ATTA 4JZJB 1I9IH 3WE6B 4UM9D 3QGVA 1HWWA 1OGAB 1AFVL 5CMAA 3RWDB 4IRZL 1ZLSL 1DQJB 2G2RA 3VXNB 1GW0A 1D6EB 3C8HA 5B1AB 3G5VB 3AAZB 1T3FB 5HBBA 1KB5B 1UM6L 2IH9A 3ZY7A 2J8OA 3UPRB 5CIPA 2NXYD 4ERSH 3PPSA 1UT1A 4GUPA 1AD9B 2HLAA 4AL8H 1P1ZA 4E0RA 1IEBA 2X5PA 1PSKH 2KMWA 3U4KA 4QLWA 1JYVA 4LAQH 2HFGL 1T7YA 2WNGA 4CC0A 3RVWC 1T21B 1PZCA 4LLWB 1KGCD 2JJWA 2Y6SD 9PCYA 2X3CA 4M48L 5HYJA 5F8QC 4Y9FA 5C71A 1MHPH 4I5BA 2A5UA 4RQQB 4QRRA 4ZZKA 1NGWA 3FONA 3L4ZA 4EQ2A 5F97E 4P3CL 4XTRC 3VI4F 1J9RA 2AHIA 4N87A 1YMHB 3K3QA 4WFFE 1G7HB 2XJLA 4MSWB 3OAWA 5CGMA 2X89D 2RIKA 1MJ7H 4RDBA 3VFPA 3A24A 3VXRA 1JNHA 4QRPD 1A1MB 1BJMA 2CDGB 3AACA 4POZD 1YEHH 1E8ZA 1G9HA 1L0XA 1A6PA 3L6FA 4X5WA 1AE6L 4KROD 3BUIA 3BKYH 1FDLL 2A6IA 5E8PB 5IBUB 3CE1A 2YD7A 3CLEH 5FECA 4U2ZA 3WEMA 4JDZB 3PXLA 1BAFL 2HZHA 3MXVL 1OPGH 4RMUA 3SJVB 4CNIA 1GAFL 4KZEL 4TQPA 3REWB 1WZKA 1F6FB 5F44A 5HHME 4IEFB 1WFIA 3FQXA 4PV9A 3QXAB 5F7AA 3QIUD 3QJQB 2R15A 2YAEA 5ALBL 4UANA 3LKNB 2WSDA 2CO7B 2AF2A 3D1MC 1UCBH 2WLJA 3W1ZA 3WS3A 1G7MB 4GIPD 5AW0B 2OMXB 4YC2B 4EQ3A 4X5XB 3QIUC 3ZDXE 4AQ8C 2X89A 1HHIB 5EC1A 4OI7A 2ZF8A 2B77A 2FD6H 1KLUB 3BKCH 4JPWH 1U8IB 5CLTA 3E9TA 2DDQL 1RZKC 1L9QA 1DBAH 3FO0H 4NJAL 2VYRE 1NQBA 4Y16D 1MPAL 3UZEC 3WTVA 1O7DE 3SCMD 3RPIA 4HX1A 3RB5A 3SKJL 1HN1A 4MCYB 3ZE1B 2WOBA 4NO5B 1QAWA 1FL5B 5T3ZD 4LRIC 2WZPA 3P3UA 2V7NA 3PXHA 5I0XA 3HFFA 4U1NB 2JJSA 3D05A 3ILDA 4LARL 2YAPA 2OR7A 4TVPL 2Y1ZA 5D2LB 3JUZA 4I18A 3P3SA 3W82A 4UM9B 1NBYB 1CTNA 1S7SA 3D2UA 1A9EB 4L48A 3F7RA 2MHAB 3WNKA 4PRIE 3D7PA 3P4LA 4Z76A 4KQ3H 3LS4H 2ZYRA 3WO4B 5K5YA 5IVOA 1IGML 2V3EA 4JFZL 1MNUL 4CSZA 2UYLB 3WN6A 4TUKL 1CLZH 3NEOA 4MS8C 4FFZH 5IVXF 3H0TB 4D0CB 3SE8H 2ZSWB 4Z7QB 1I9RH 1IFGA 1OTTD 5F9WC 4N28A 1CF1A 5CGBA