5F7BA

Resting state structure of cunir form alcaligenes faecalis determined at 293 k
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 95
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5f7bA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5f7bA02
2B3IA 3NJGA 1W6LA 1GR7A 1JZIA 1IC0A 1M56B 4YSEA 1NIDA 3IEAA 2HRGA 1L9TA 1T5KA 4YSDA 2YAOA 3T6VA 1AZBA 3NYKA 2FWLB 1KCBA 3CG8A 1GSKA 1AG6A 4DP5X 5B1KA 2B08A 2DV6A 1WA0X 2VSKB 2EILB 3PPSA 2XXGA 5PAZA 4HHGA 3NJLA 1TEFA 4AKQA 1BQ5A 2WO2B 2EIKB 3UABA 3CDZB 3KW7A 4X4KA 4WTQA 1ID2A 3N2JA 2BP0A 2P80A 3FQYA 4HAKA 3ABLB 1F56A 2HXAA 1AANA 2AFNA 1A4AA 3PAVA 2YQBA 1PLCA 4G7QB 4G70B 6PCYA 1OE2A 1ZIBA 2PPEA 3EHBB 4F7KA 2FQDA 1X9RA 1UATA 1KBWA 4A2EA 4AI7A 4QKTA 3FU7B 5B1JC 1A8ZA 1WA2X 2XUWA 2JFCA 2PP7A 2BZ7A 3UAEA 2FT7A 5B7EA 3S3DB 4A2GA 4DPCX 1ET8A 3HB3B 1VLXA 2UXVA 3OMNB 3QJTB 3X1NA 2FJSA 1PZBA 1EZLA 5IY5B 3IBOA 4AKOA 1KYAA 3SQRA 1GY2A 3FQ2A 3BQVA 3X1EA 1ILUA 4W1TA 2VW7A 4W9ZA 1OCZB 3ABMB 3S3CB 3NP4A 1A3ZA 4BXSV 4A67A 4PAZA 3TBCA 1JVOA 2BP8B 4DP6X 2HX9A 3PXLA 1CYXA 1MG2C 4KO6A 3FSAA 3QJVB 4JKNA 2TSBA 1NDTA 2VW4A 1KCWA 3QQXA 3GDCA 2PCFA 1OE1A 4Q8BA 1J5CA 1FA4A 1MZYA 1V55B 5B1JA 3UACA 4YSAA 1JZGA 1AZUA 1ASPA 1X9UA 4L0PB 4G7RB 3S3BB 2EINB 5I5IA 6PAZA 1AOZA 2XV3A 1XB8A 2VSMB 1J5DA 4BDVB 4FAAB 1NTDA 3U25A 2XXFA 1E65A 1JERA 2UX7A 1L9SA 2VMJA 5E9NA 1L9QA 4E9VA 1N70A 2RACA 3X2QB 1QLEB 1M57B 2BWDA 4BXVA 3ZDWA 2FNWA 3EH5B 1IBZA 3ABGA 2IDQA 2IDUA 3G5WA 4YVNA 3UAAA 3FU9A 4GP4B 2DY2A 2H3XC 1SF3A 3OQRA 2UXTA 4HCGA 7PAZA 2ZONA 1ASOA 1ETJA 1ZIAA 3WNIA 1HAWA 4K9JA 3AY2A 4BK5C 2X87A 4YVUA 1GY1A 1PMYA 2IWFA 2YAFA 2EIJB 1GW0A 1SFHA 4UAHA 2PPCA 2I7OA 5F7BA 2ZOOA 3PCYA 5TK2A 3T71A 4DPAX 5AZUA 3T6XA 2R7EA 1A4BA 1JZFA 7PCYA 1B3IA 2JKWA 5F7AA 1V54B 3T9WA 4Q89A 5D4JA 3T6WA 2IWKA 4N4YB 3NSDA 4RH4A 4KNTA 1FWXA 2BO0A 2BZCA 4ZK8A 1J9RA 1IBYA 3AZUA 2IH9A 2P80D 2OV0A 1KDIA 2DYRB 4KO9A 1CURA 1E67A 3TBBA 4P5RA 1AR1B 3FPYA 1L9OA 4NB7A 1OV8A 3AG4B 2QPEB 3QJUB 2BP8A 2I7SA 2PPDA 1AG0A 3NP3A 1SDDB 4QLWA 1AZCA 1AZRA 8PAZA 4YSRA 1ET5A 1NIFA 1ASQA 1SJMA 1AZNA 1W6WA 1TEGA 3QPKA 1AS6A 1R1CA 2WO3B 1NPJA 1PZAA 1OCOB 3EH3B 2CBPA 5I6KA 2AANA 1JXFA 4G71B 1KGYE 4YSOA 1TU2A 4M3HA 2BWIA 3AG3B 3JTBA 4BDVA 1HFUA 1NIAA 5D4IA 3DIVA 5FC9A 4E9SA 1PLBA 2YAEA 2PCYA 2J55A 4BWTA 2AZUA 4YSSA 1A4CA 2XWZA 3MX0B 4KOBA 2R7EB 3TA4D 1FFTB 2HLEB 1OCRB 2QT6A 1J9QA 2QDWA 3C75A 4FA7B 3NJNA 3FQ1A 4MFHA 1BQKA 2UXFA 1ILSA 1DYZA 2J56A 1AACA 2EIMB 1OCCB 5I6LA 1BEXA 1WS8A 1ZV2A 1NPNA 2GBAA 3NJFA 3N55A 1AAJA 1KV7A 3RYMA 1DZ0A 1MDAA 1NINA 3EH4B 3JT2A 1SFDA 2XX1A 1HAUA 3D12B 4F2EA 2N0MA 1JXGA 2PP8A 2XU9A 4A2HA 4EF3A 2FT6A 1BQRA 4E9WA 3PAUA 3NSFA 4CSZA 1NIBA 1RKRA 3UGEA 4A2DA 4YSUA 5I6NA 2DWTA 3EF4A 3NSCA 3WI9A 4JHUA 1ADWA 1RCYA 5PCYA 3OM3B 2XVBA 1WA1X 3ZIYA 2NRDA 4DP9X 4DP7X 4KO5A 3WG7B 4DP1X 3V9CA 4KNUA 1E5YA 3QJSB 2PPAA 1SDDA 3KW8A 3FYIB 1YLBB 4A68A 4GP8B 3X1GA 2IDTA 1MG3C 4E9TA 2IDSA 2FQGA 1ZPUA 4GYBA 2VM4A 4G7SB 3PLYA 3SBRA 1XB6A 3V9EA 3AW5A 3ZBMA 2ZWNA 2QPDB 3X1BA 4A66A 2AVFA 1OE3A 3NT0A 3HEIB 4HHWA 4DP4X 3AG2B 2BW5A 3IE9A 4YSPA 1AS7A 3ERXA 1AS8A 5B7MA 4WKXA 1GYCA 4GP5B 3S8FB 2J5WA 3FS9A 2MRYA 3WNJA 1XB3A 4UANA 1ZDQA 2JXMA 1JVLA 1PZCA 1BXAA 4UF7C 4DP0X 5D4HA 2W8CA 2Y69B 4M4RB 1SF5A 2Q9OA 4AZUA 3SBQA 2CCWA 1KDJA 3AG1B 1NWOA 3OMAB 1KBVA 2YXWA 2GB2A 4HALA 5I5MA 2AZAA 4KO7A 1BAWA 3FSVA 2HRHA 3X1FA 5A7EA 4YL4A 4YSCA 5AFAA 1NICA 3DTUB 1URIA 2Q5BA 4F2FA 4DP2X 2FQFA 1M9WA 4HIPA 1PAZA 1WAEA 4HCFA 1J9SA 1NZRA 2PPFA 2UX6A 1AIZA 5B1AB 3IN0A 2XLLA 3H4FA 3BVDB 1BYOA 4N8UA 2XV0A 5I5JA 1QNIA 1L9RA 3SBPA 1BXUA 4E9XA 1E5ZA 5I28A 2TSAA 4NAJA 4HCIA 1PCSA 1GS6X 2FT8A 3CVCA 2IAAC 4PCYA 2I85A 4G72B 5I26A 3CZUB 4DP8X 2CAKA 1MZZA 3GYRA 1XMEB 5B7FA 3CVDA 1ET7A 1PLAA 5I6PA 1JZHA 2OCCB 3FT0A 3GXUB 1BXVA 1NWPA 2BW4A 2FQEA 2PP9A 9PCYA 2YARA 1IUZA 2GIMA 1OF0A 2GI0A 2J57A 2H5UA 2XV2A 3NJKA 4ENZA 1JZJA 1RZPA 2LLNA 3S8GB 2FTAA 3OMIB 3FPXA 1L9PA 1CUOA 1CYWA 2YXVA 5LDUA 3FSWA 2QDVA 3MBWB 5B1BB 4E9YA 2XYBA 1GS8A 1PNCA 1N68A 4NERA 2OJ1A 3OD3A 1GS7A 1WS7A 2H47C 2YAPA 3TU6A 2XX0A 4YSTA 1ZDSA 2PLTA 4AX3A 2YAMA 2IDFA 3IN2A 4CSPA 4E9RA 2W88A 3QJRB 2VM3A 3L45A 2DWSA 2E86A 2VN3A 3WIAA 3ASNB 4DPBX 1J9TA 3NJIA 2IH8A 1TKWA 4P5SA 2A3TA 5B3SB 3UADA 5TK4A 3NJJA 2YAHA 2YAQA 3ZX1A 2UXGA 3FU8A 3NJHA 1I53A 5I6MA 4TXVB 4YSQA 2BP0B 2CALA 2MTAA 3H4HA 1SNRA 1CC3A 1SHWA 2BHFA 2WSDA 2ZXWB 3DKHA 3H56A 2HZHA 3FSZA 5EHFA 4BWWA 1A65A 1JZEA 1E30A 1V10A 2IWEA 4KOCA 1JOIA 1EHKB 4KNSA 1PF3A 1QHQA 2CUAA 1NIEA 1IKOP 4BWUA 5I6OA 2HX8A 2Y1AA 3ABKB 1W8EA 3CDZA 4GXFA 4GY4A 2HX7A 4JHVA 2VW6A 1OOWA 3PAZA 3T6ZA 2GC7C 3WKQA 2GHZA 1RZQA 2DYSB 3ASOB 3FYEB 2CJ3A 1BYPA 4HZ1A 1JXDA 1AQ8A 3TASA 5ANHA 4A2FA 1SHXA 1PNDA 4E9QA 3FU7A 3NSYA 2GSMB 4AKPA 3CVBA 3WKPA 1PY0A 5AKRA 2X88A 2GC4C 3NJMA 3QJQB
chains in the Genus database with same CATH superfamily
4M3KB 4EE2A 1CCZA 4AYEC 4EDWH 2K8QA 3MNMA 5CN1A 1UD2A 1D7DA 2ICES 3QRFM 1KENL 4QRTB 2J88H 1L9TA 3FUKA 3QEUB 3UTPD 1PIFA 4RFOL 5HDBF 3ZUNC 3WJMA 4XX1G 3DMMD 3NYKA 2OS7A 5IQLA 3F7PC 2NTFB 2ZUUA 3I6LE 4LF3B 2O61B 5FECB 3DXAB 4HXBL 2EDEA 1N0LB 3HG4A 3FCBA 3QIUA 4LFHG 3BAYA 3UBXB 4P46A 3TBYA 2B08A 1A9BA 4FNPA 1UM5L 1U36A 5CLXA 1A6AB 2D7MA 4OTXH 3QUXD 1BX2A 1TIUA 5KYUA 5JIQA 5AAPA 4HEPG 2OK0H 2OTPA 3T0EA 2C7UA 1UEMA 3GMMB 3OMZA 4UYPA 3VJ6A 1A1OA 3P0YL 3EFDH 1UOKA 2NSXA 4GBXA 3GIVA 3SE8L 4HAKA 4PLOB 3MRNB 1AANA 3CQQA 1P9MA 2F1AA 5KW9L 5IQNA 1PLCA 2Z7YA 4LLUA 1ZIBA 3IPEA 5MEOA 1YJDC 2IMNA 4A2EA 2VAAB 1DDTA 3D48R 1VJSA 2BVPA 2CKBL 4E41A 2AHIA 2XUWA 4OJDH 1K5NB 5C0CB 3D0LB 4PRPD 3PHQA 3IRCA 3A47A 3S0PA 4PRHD 1JTPA 3X1NA 2FK9A 2BRRL 4MA7H 3CFDA 1PZBA 2DN7A 4ACTA 5AW6B 1X5JA 1FBIH 1JGVL 3O2DL 4GAJL 5M95B 3IPBA 1UB6A 1N8OE 1UC6A 2BHUA 2VQTA 4XNYL 1A6ZA 1H0DB 3FQNB 4FXTA 2IPKA 4LSRH 1MEXL 3C2AL 1K2DB 1NPUA 2D7OA 4M7KL 1JVOA 3ZQXA 1XSIA 5IB3A 2QBWA 1ZTXE 2BCKA 1CYXA 2C9UA 4E5XG 1KBPA 1CFNB 3QJVB 4Y5XA 2G3MA 5GS1B 1RULH 3TH4T 4CVUA 2ZYRA 4F58L 2WWKO 1VACA 3GMRA 4QRPE 1JZ6A 4X6CF 1CGSH 2K6WA 1ZTXL 3VH8B 3WIHH 1K5WA 1X5GA 3D06A 4R8WH 4YLQT 4B0MM 3GMQA 1S8DA 4TQEH 1A6VH 3GXDA 3V5DB 3RX7A 1IKNC 4FAAB 1I8LA 4Y1AE 1RSFA 5D4QA 4AZ8A 1OSZB 5J1SC 4JHZA 1C5DB 1NGXA 2VMJA 5E9NA 5KN5A 1T03H 5C0AE 2PR9A 3E80A 1HWGB 1TTCA 1U91B 3MLSL 4KXBA 1S7XA 4NFDA 1TQSA 4PWIA 4F8TA 5LNDA 3F83A 5KSBE 5I1LA 2MOGA 2BNRD 3HNTL 3ZDWA 4RMRA 1IBZA 3ARPA 4L9LB 3CFCH 4JJOA 3S7GA 5DZLA 2ROYA 4YHLL 4HUVA 3BPOC 4H2CA 2DY2A 1MRCL 4EN3A 2UY6A 1X5FA 1B0RB 3IXAA 4XBEH 1B6UA 3RZCA 4G43A 4P04A 2VR4A 1JGLH 5AOJA 1ASOA 3SDCA 3GHBH 3AJ7A 1K85A 1RU9L 2O1AA 4NJ9L 1AC6A 3W11C 5KVFH 1BVNT 1PLGH 1Y6KR 5GGQL 1HHIA 5KTEL 1GY1A 2GPZA 5C3LD 2ICEC 2YAFA 1SFHA 2XDHA 4Z7VE 3K46A 5CJOH 5IHZB 1QQDB 3GSVA 4DPAX 4JANA 5DJAB 5HGHB 2VABB 4AT6B 2R29L 1CDYA 1JNHB 3CX5J 3T3PE 3WS3A 2CK0H 2DRUA 2OMTB 5CZKA 2B0SL 4OFQA 5KVGH 4AXWA 2K6ZA 2VDOH 2Z31B 5EU4A 3MRRB 4ODTH 1XDTT 3QZWG 4XP4H 2R27A 3V4VL 1WCQA 2E7CA 2BIHA 3GFUA 1FG9C 3HS0A 1NLBL 4BFNA 1UOVA 2A6JA 1KXQE 3C6SB 3JWNC 1JI2A 3K2UL 4FABH 5JIIA 5J12C 3CVIL 1ZVYA 4ODUA 2VDQH 4P5RA 3ZT5A 2ZUXA 1CFQB 1SJXA 1U95A 3CFMA 5JHDA 2BP8A 1XWVA 2I7SA 2WAQA 2NY0D 5K9KB 1WP6A 1ET5A 4QIRA 4FD0A 1E9OB 1AOHA 4L37A 5IBUB 3JSSA 4QRRD 4I13B 3U0PB 5LGJB 4QXGL 3PWPD 5CINH 4M8UA 1AS6A 4LBEA 1GIGH 1MW0A 3KWVA 4NYLA 4GSDL 3FB6B 3O4LD 1PZAA 5F88B 3EH3B 2Q2EB 1EMTH 4NO2B 1KGYE 4PBDA 2EDFA 5K1JA 4AQ1C 2J8UB 3DJZA 4XB7A 3VXSD 1N6QL 4MJID 4PRNA 5HYEA 2OXGB 3DX7A 3CLEH 4HUCA 4Z7UE 3SOBL 2PCYA 5DZOA 1SXZA 4UQ3A 2WLZA 3EYUL 2XWTA 2N56A 3VW3L 1KYUA 2Y7QB 4PN6A 1PG7L 1O75A 4P23A 5GGSB 5G2NA 1KLGB 2Z4QB 2AJZA 5E08L 4J2XA 4P9HC 5E1AB 3V0FA 3S98A 4HP5A 4GXUM 3VQ1C 1PZ3A 3EH4B 1CG9B 2GITA 5F3BA 1AR1D 3GBMH 1RZJC 5CMAB 1Z9OA 4EI5B 4GJTB 5KBDA 3K8MA 4PHXA 3QDJE 2WXOA 2J1ZA 2Z7UA 1T0NA 3MCYA 3LKOA 2A6KB 1KTKE 3Q2LA 3CCHA 3EF4A 4XN8A 3HE7A 4ZTPH 4B50A 4JFDB 1QFUL 3QAQA 1RCYA 5CCJA 1OGAD 3RVWD 5PCYA 4R7XA 4EVNB 5MENE 1JPSH 2YSTA 2V2TB 4MXVE 1ZJBA 2MJWA 5I17A 2QTEA 1IQDA 1P5UB 3P4MB 3T1WA 3Q2WA 2XJLA 5CSGA 5T1KD 4FOMA 2JELL 2ATAA 1UUSA 2L3BA 1VIWA 2OTUB 2Y07H 5BMFH 2ED6A 1X6NA 1IBHA 1ZS8A 2G5BB 1QX1A 5IVXB 1X4XA 4LAJH 4P5MA 2Y0SA 2I07A 4QHUB 1IC5L 5LCVH 4RGMB 1A7OL 1I9IL 1XGPA 3ESVF 1I3UA 5HJBA 1FNFA 3CX5K 5ICZB 1ACYL 4PJEB 1DVFB 1NCWL 1J8HE 2MIZA 1FG2B 2C8NA 1KY6A 2WUBH 1X7QA 1QLRA 3ESPA 1YAZA 1XTLA 2OR9H 3ZDYB 4RMBA 5ERWA 3TLRA 4HK0B 5KJ7E 3ZY7A 4XWGL 4M4PA 4IOIB 4UZUA 4N2MA 2IANB 2V2XB 1UM4L 3L3OB 2BSRA 2FBOJ 4OZHE 4UDTA 4ZMWA 1SXSA 1JNNL 2GJ6B 4Y5VB 1XGTB 5JXEC 5K33A 5EEWA 3VWJC 2KH2B 4IRSA 4L4TD 5KVEL 2F18A 2VLKE 2H6OA 3HTLX 3MRPB 2FYYA 4KKAD 3VU1A 5ESVB 1G7MB 5DR5L 2AZAA 3O45B 5C7ZA 3RIFK 3KNBA 3DJRA 3LS4L 3RVXC 1G7JA 3OLDA 1JV5B 3PWJA 1AP2A 4NSKB 5AZ2H 2EEFA 3Q13A 3F8UB 2DH2A 4KK9C 2MCPL 1WD9A 3TVMC 4OZFG 3IFOA 5DI8A 5FM8A 1TJGL 5CLTA 1P1ZA 1T7YA 4B9GA 3MOAH 5EF3A 2NZ9C 5DEGB 1ITCA 4DH2A 1QNIA 1V7ML 4QEGA 3QEHB 5CU9A 4XXDA 1IVTA 1HTYA 4QHPA 5H37G 4ZW7A 4PCYA 5DS8A 1NSNL 2GCYA 4OU3A 3SGEI 5AVTB 4JKKA 4NP4L 3WNNA 1YMMB 1CDHA 4S10A 5TQ2L 4Z7QE 1R5VA 3P77A 2ED9A 2BIMA 2WLLB 2P5EE 2J8UF 2WANA 5DVOA 3LYRA 3KLSA 4L4JA 3L5HA 4LFHD 3UYPB 4K94H 2IBZX 5C7XL 5T3ZH 1B0WA 2ESVA 1QRND 3IDYB 2R83A 4Z7WE 1VKXB 2GFBB 3MNWB 4PJ8A 4XC1L 1A6TA 5AOMA 3CN3A 3ARXA 4U6HA 2RGSA 3FZUC 3WTWA 4Q97A 3W5MA 3RUGA 2NX5B 3KYNA 4XXWC 5HYQB 3L5WA 2YUWA 5CO1A 2VZ1A 5GS3A 4ZFOL 5CBAB 1S7QA 1BJ8A 1UD8A 2GI7A 2K0RA 2W94A 3QJOA 4XP6L 2YSSB 1IARB 3AXLB 4HFUL 4WUUB 4CMHC 3QG6B 1JWUA 3F7YA 4G5ZH 3EJZD 1G4RA 3OWRA 1FVDA 3KWWA 1RK0A 2QGEA 3MTRA 3G5VA 3C5JA 2E86A 1RH8A 1ORQA 4ISVA 1UZ8B 1MFEH 3QO1B 3S4SG 5CEXA 2PTTB 2A3TA 4FNRA 1CYGA 3SGJA 5JPMB 5DK0B 2EO1A 3KAAA 1BYNA 2OMWB 2DQIH 3C9NB 4POZC 1CLVA 5MEPB 2DQGL 3G04B 3NCJL 5FYKL 1XXDC 3ULUD 1LO5A 1T1YB 1XZ0A 1AH1A 5SX5K 3RI5K 2VDNL 2F08A 2H26B 2UZIL 1A65A 1U8QB 2GJPA 5C0FA 1CXEA 1ZT4B 4Y9CA 4ZFFA 2IOMA 2PYEE 4OCMC 5T8IA 3QFJE 1F90L 1O7DC 3A67H 2EYTA 4G59C 2OSWA 4AOFA 3LZQA 3UROR 2DWDA 1MI5E 3KPOA 5EUOA 5IVXF 5IREA 4KMLB 1J86A 5T1MA 5DGQA 3T6ZA 4BH8A 1ZGLM 1BZ8A 2IVFC 2IH1A 5DRXB 2H6PB 1RZQA 4GPVA 3ASOB 3RL1B 4JBSA 4N2HA 4JFUA 4D3CL 3B9KC 5EN3A 5DMIL 4R0LB 2Y6SC 3UJIH 5CEZH 5JA9A 4H4NA 1EAPA 3QCUL 4CNIB 4BFBD 2GSMB 3FFDB 2PTUA 3KL0A 3AC0A 2QR0B 1N3NA 5GZOD 3HFFA 4PUBH 1MNNA 5A2AA 3UTSA 1NANI 3U30B 4O2FA 4OF0A 3BAWA 3H3BC 3WTSA 2RAMA 2AS5M 2ZSVA 2AJYL 4QXTB 3D39E 1T5KA 4YSDA 3LJ3A 3RX5A 4X7TA 4KQ4H 3H9SA 3U46A 4ZJ9A 4L1HA 1FC2D 1UD4A 4QYAA 5HVFB 2X6CA 5HPMB 3WTTA 3ZZQA 1FV1A 5B1KA 3WLBA 5G55A 3RKDD 3K72A 3MMEA 5EZIH 2ZPKL 2WXJA 4KTGA 3VG0H 2XXGA 3S9DB 5GRUL 1P4LB 1C9SA 2ITDB 2WO2B 1Q9LA 2X4SB 2J8HA 4KKZA 3T8VA 5EWIH 4DKDC 3MREA 4GO9A 4QXUL 4ZMNA 2KBGA 3FFCE 5DJ2B 2P80A 3VFSA 5EBMB 3U7WH 2X4QB 1F56A 4JG0L 1DQKA 3BUDA 3OQ3B 5AW5B 5IFJB 1IEAB 4P9ML 5DS2A 1QUNB 1W72B 3BO8B 4KROB 2W0FA 1CDBA 5E6UB 1MHHB 3EHBB 4XPFH 3FO0L 5MP6H 4PY7A 4LEEA 2OSXA 5FGRA 5DVKA 3SE3A 5C0IA 2Q20A 3LNDA 3PY9A 2KQMA 2V4LA 3BEWB 1AFVH 4PV1C 2IFFL 3OKNB 3OTTA 4HLJA 3ZE0E 4K4KA 1NAMH 4K7PH 4P3DB 1BREA 3SOTA 4NC1E 3QIBB 5HYJA 5CCGE 2G4EA 3BGFB 4M56A 4KMQA 1KENH 5E2VL 3D4CA 1ZLDA 2BK8A 2XRAL 4JJ5A 4KJYA 5GHWL 4RFOH 3L3GB 3STLA 1M05A 3WTYA 4ONFL 3VAEA 1P7BA 3FQ2A 3IT8D 3ELAT 1N2RA 3L4VA 4WI8A 3X1EA 4P5TC 4ZMQA 2FIKA 3S3CB 4HXBH 2F7RA 3K0YA 1WFOA 3SJVE 3W2DL 1A4JB 4P05A 2E27L 4DZBB 5IVZA 4PW3A 4XCNB 2YKKA 1UM5H 5F44A 3TNMB 5GRVK 1N18A 1NCTA 3II3A 2ZWZA 4KO6A 5CIPB 4FC3E 3VDBA 4Z5RA 3GDCA 3K1DA 3WN5C 4Q8BA 4XBGA 3SE8H 1M7UA 43C9A 4D9QE 1UACL 4NZRH 2R0LL 2PMZA 4JRYB 1JK8B 3W0WD 1KGWA 1TPXB 1YUHB 3KPPA 5D93B 4L3FA 4JQVA 1F2QA 1JERA 3PHAA 3ISYA 5I0DA 4APQA 4W9GC 4P4KD 3X2QB 5C2BL 4G8GD 2WCSA 1KBGL 2CH8A 3QIUC 2BWQA 2ZIDA 4XP5L 4XPHL 1ZTMA 3PRZA 1DEEB 1QI5A 2BRRH 5J06A 1N6VA 3L4TA 1TENA 1AGBB 4B7LA 2WCGA 3T0EC 3BPLC 5E94B 1JGVH 1FL5A 3O2DH 4WO4B 2X09A 5INDB 4GAJH 3HG0A 4MSWA 1DQQA 4PCTA 3WNIA 4PRIA 3H85A 4G80A 4P2OA 2D7NA 3RWEA 5EF2A 1JTTA 4XNYH 1OAKL 3PGDA 1N26A 1MEXH 3QCTH 1MFUA 3C2AH 3HG1A 1HNFA 3NQIA 1EEYB 3NZSA 3QJFB 1A47A 4UYQA 5BRZA 1JPFA 3DIDA 3EGXA 3LN4B 4M7KH 2HJFA 3QS2A 1FZMA 2W60B 3G6AA 1OSEA 1TCRB 4YGVA 1I1YA 2HJLA 5BS0A 1MAKA 1PQZA 2Q8AL 4PJ9C 4DGVL 3CBJB 1HL4A 3L3IB 3FCUB 1XH3B 3UXFA 3IWVA 1ZTXH 4KO9A 4F9LC 3NFSL 4EPSA 1J0IA 2UZPA 4IBVA 4N2KA 5JHBA 2B1AL 5JO5A 3GMPB 1OIOA 3RHWK 2JIXD 2RQ8A 1X5IA 2DQTL 4MXQC 2X28A 3QUML 1AZRA 2CRIA 4YBLC 1LNUB 2OXHB 2OX5A 1BZOA 2JH2A 3IE4A 3MLSH 4NQEB 1UCBL 4QOKA 5EZLB 4D0DA 1ZHLA 4JO1H 1AZNA 2AEQL 1TEGA 4MHHI 3HNTH 4F2MB 3KGUA 4X9BA 3BIKB 2BJML 4PMFA 4TRPL 4YHLH 2CBPA 4Z0XB 1K4CB 1MRCH 1I1CA 4QRUB 1P7HL 2QADC 1RZFL 4FEIA 3CE1A 5I8EB 3R0NA 1FJ1B 1RU9H 4NJ9H 1T4WA 3UTQB 5AAMC 5D7JB 2FLRT 5GGQH 5KTEH 2XYCA 3MN8A 4MKMA 3WD5L 5F6IB 1TSHA 4O02L 4RQQB 1T1XA 2XTJB 2ZXDA 4ZXBD 3V0GA 2R29H 2R7EB 1HEZA 4A7GA 3ARQA 4JVPA 3KPSB 5HVHC 3BZ4B 2B0SH 1J9QA 2QDWA 4H8PA 1EXUA 2P5WE 1I1AA 1K8DB 3TBWB 3V4VH 3VYNA 5DJCB 5E2UL 1OL0A 5HHNB 5IHLB 2PABA 1NLBH 5AYUL 5EU5B 2F7QA 3K2UH 1MSPA 3Q05A 4HSQA 3CVIH 2CPUA 1CICA 2NSQA 2VDML 3FTSA 3ZMRA 4XO9A 5ICXA 2WVSA 1NBCA 2MPAL 3HBQA 1PYWB 3X14B 2R4RL 3ULVH 1MFAL 2A6DA 4L48A 2FT6A 3D2UD 3Q1SL 1IILE 3MRHB 4A2DA 4MCYA 1G43A 4NOBA 1F4WL 4QXGH 4OKVB 3WEAA 3EIFA 4Y2OA 4GSDH 3G6DL 3OSKA 3L3HA 4ZUSA 4C8XA 3B9EA 2OSYA 4KHTL 4YDIL 2JJWA 3QJSB 2PPAA 2CCVA 3VI3E 4OFKA 3UZVA 1N6QH 3ORJA 1HNGA 1GZPB 1IU1A 3HS0C 1BP3B 3N0PB 4WWNA 3SOBH 3WLWC 2JB6A 2WBJC 4JPQA 1MCLA 4UNUA 1IZJA 3OB0H 1MG3C 1CN4A 1N67A 4ZPVB 3RFZA 3GSWA 1G6VK 4PB9L 4CJ0A 3EYUH 2GJZA 3VW3H 1PG7H 1L9MA 2O6FA 3FT4A 3KPLB 3SYPA 4OFPA 3EADA 3OJVC 3EYOB 3ARGC 3H9HA 5GGUB 3O8XB 4XP9L 5E08H 2AXHA 1LMIA 1PD6A 1MJJB 3HEIB 5MHSD 1BZ9A 4KV5E 2VLJB 5GIRA 3QW9A 5AG8A 2WYZA 2BSBA 1IE4A 3AAZB 3AS0A 4N5UA 2DKMA 2FVNA 4MAYD 3RNKA 5D2NE 1AD9A 4P49A 5D7LA 2PO6B 5B7MA 2E6PA 4JDVA 4HH8A 1OWWA 4DHLA 2J6EA 5AOLA 1MCNA 1XB3A 2FHFA 3IJ7A 3D33A 2JXMA 4JG5A 1KEGL 3JV6A 2D0GA 5J9PB 4NN6B 3QYCA 2XFGB 4IOSD 3QIWC 2FJUB 2EVJA 3BT0A 1WEJL 2JJUA 1LDPL 4DCQB 4DSYA 1VFAB 1D5XB 1T7ZA 3MRFB 2Y4SA 5IFHL 2JELH 3B6SB 3DTUB 4PVBA 4AVIA 1ORSA 4O2EA 1H6UA 5EUKA 1AO7B 3U0WL 4CAGA 4JLRA 3UBGA 3D3VA 3GSNA 2IADB 3T8MA 4OI8A 4YFEA 3X12A 1IC5H 3KL3A 3P73A 1YN6B 3BAEH 1IM3D 1I9IH 4M1CC 2VDRB 3FH5A 4M3JA 4XMLH 4PJGE 4NAJA 1ACYH 4OLEA 4OZGE 1P4BL 5F9OL 1NCWH 2GIYA 3WXWL 5CGMA 4XNUL 1FDLL 1MY7A 3EG9A 1MKFA 2YPVA 4UZGA 3L5IA 3L48A 2DKUA 4J3VA 1YY8B 4I0PA 1HWHB 3DMMA 5CCKL 4XWGH 3I6GB 4OIAA 5I6PA 2VC2B 2A4ZA 1UM4H 1TQWA 5DK3A 4MA1C 4Y4KB 1JNNH 3OHMB 3GDBA 2YHGA 1J1XL 4GRLA 4GLRI 4KI5D 5I6XC 5KVEH 4GAGL 3H2WA 1UYWL 4OR1A 5D7KD 4JM2B 4X5RA 3DECA 1CUOA 1CYWA 4NGHL 5FHAH 5FUZL 1C08A 3EYFB 2F8VA 5T1LA 1GOFA 5DR5H 3N40F 3LS4H 5GZND 2VIRA 3F3HA 2X3CA 1JWSA 4H8WC 2XTLA 1USQA 5L0QB 2EADA 3LN5A 2MCPH 1Z7JA 2G9HB 4MDRA 2VLRE 4TNGA 1EK3A 1MCRA 3B3IA 3DV6A 1TJGH 2XX0A 4DW2L 4C57C 3FRPB 2CSPA 5GGRA 3V9FA 3W9DB 3DVGA 3ZRSA 4XBMA 2AQ3A 4PRPA 4A2LA 3V6OE 4KKBC 5E9DD 1RL1A 1V7MH 3WE6A 4PRHA 1ESOA 2BINA 2RD0A 1AXSA 1NGWA 4Y2DC 2FBJL 2AV1A 3ARDB 4ZW5A 4QHMA 5TK4A 3KPRE 5C0BD 2P46B 1NSNH 5L2KE 4IRJB 1G87A 4MLIA 3ZO0A 2CRZA 5I1IL 5E6IB 1AMXA 3NJHA 3GRBA 4NP4H 4TSCL 5TQ2H 3WY2A 1KB5L 4JREB 5CLWA 3QEQD 4O5LH 1M6OA 1JN6B 3HAEG 4UM9D 4BBWA 4XNZB 2J2ZB 1DQLL 4BKLB 5DJDA 1PD1A 5C7XH 1WFUA 3IJEA 3MOBL 3MUGA 2CUAA 2D31B 2R4SL 5H94A 1OGPA 3ETTA 3CDCA 2ZX7A 5DUPL 4A7SA 5SWQB 2Y1AA 3QA3B 2VLLA 5F0PB 3TO2B 4I18A 3QQ3A 5FW7A 2QVKA 3BD4A 3S3SA 2HX7A 3JQOB 4N85A 4GRWE 1YMHA 3WKQA 2VR3A 2CM5A 1NBQA 1Q1PA 3ZL1A 3BKCL 4N2DA 3S97C 4ZO7A 4CVZA 1XF3B 1KN4L 2CDEB 3OKOA 3EJRA 1RUML 3BUTA 4LCCA 4WTWA 4XP6H 4HFUH 4KI1A 4AUUA 1WFNA 2NW3B 1KSRA 3U2SA 2LU5A 3O6FC 4PWKA 1RJYB 4GSUA 2C4XA 4AY0A 4DUWA 3ZQ9A 4ANUA 1F97A 3PIQB 4M02A 1YEKL 1OK8A 2BNRA 3WG7B 2PWHA 3NJGA 4XPGL 1WAAF 2F1EA 1MLBB 3TNNB 2ATKB 4HT1L 3KPQA 4V1DE 3ZLQC 3U4EB 2HRGA 4IBYA 4JRXE 5IK3B 2IH3B 4F7EB 3AU1A 5DQ9B 2DQGH 2XQYG 4PRAA 3B9AA 5FYKH 4N0YL 3U0TA 2YQ3A 2APBA 4HWEL 2BVYA 4F3FB 1ZS2A 3C09C 2DL9A 4FQQB 3HR5B 1NGZA 2VDNH 3EBHA 2UZIH 3V6FA 5DJYA 5I1GL 5IQOA 4M5TA 2VSKB 5TPWL 4HQQL 5JIPA 5BUAA 1F90H 2V3DA 4G1EA 1SY6A 1LEKB 1WZ1L 3K4AA 4G42A 3VXMA 1C7SA 5I9QC 1WWBX 1D6VL 3SDDC 1RUQL 4GB9A 1WHOA 1A6PA 4NLAA 4U1LA 1ZLEA 1SYVA 1KGCE 1EZVY 1ZCRA 2UVEA 3MV11 3OGOE 3Q1EA 4BFRA 5AD0B 5IJDC 3L16A 3Q8FA 1NEZB 3A4AA 4D3CH 6PCYA 1BF8A 3R0MA 2DQCL 2ZKXA 5DMIH 2Z91B 3WHXA 1EGJA 3L2NA 2XWEA 4F7KA 1FGNL 4X4ZA 4LXFA 5LQBL 4N2OA 3QCUH 1U92B 3REWB 3BISA 2KMWA 2E76C 3OKKB 4QRRA 4YHPA 3O9WB 3UAEA 4U1IB 3PWPA 3GB7A 4B6ZA 1JK9A 3IS1X 3VSTA 3QWRA 2WB7A 3O4LA 4IM8A 4XN1A 2KDGA 4TUJA 5A16A 5KS9A 4NZFA 2OL3A 2CD0A 3BP4B 5CJQL 2A83B 1NCCL 1FIGL 1UASA 2EYSB 5E0FA 4MJIA 4TF4A 2NXYC 1ILUA 4OLUH 4JM2F 4PJFA 1F13A 3B5TA 2QPFA 4WWID 3BUYB 4AQEA 2VZUA 4X4MA 3LIZL 4UOJA 4Y7MA 1IAKA 1PSKL 2ZPKH 2Z3FA 5GRUH 1CGXA 3BPOB 3ILDA 5FGBC 1SQ2N 3D9AL 1F58L 3JYCA 5EIIB 1J87A 4GKSB 4JFHD 2VRQA 4GSRA 4XVUD 4QXUH 1D9KD 4YSAA 4KVCH 2Z93B 3S3BB 4P9MH 5DRWA 4YDVB 1JV2A 1TVHB 3FCGA 3TCTA 5CP7A 3FO0H 4HSAC 5ACZA 2K7QA 2XXFA 5HHOA 4G9FE 4ZSOB 4GQZA 4PGBB 3GXPA 3GZPA 3ECWA 3KBHE 1EBAA 3S35X 3VQLA 4L18A 2NY6B 2IFFH 3BFWA 2RACA 1YQ2A 3BQUD 1QLEB 1RK1A 3ULVC 3QWOB 3LZNA 3UMTA 2OZ4L 2VLKD 5CU5A 5J12B 4LCYB 1UH3A 3UDWC 3VFPB 3PP3K 1YPZB 5CGYD 5E2VH 3QQDB 1E4KC 2XRAH 5GHWH 3TJHC 2XXCB 4UWQB 1A3QA 7PAZA 1I8KB 4ONFH 4G8EA 2QLVB 2AV7A 3AY2A 4LEXH 1TEYA 3L3KA 1VDGA 2CG9X 3DSFL 1CDCA 3W2DH 5L88L 4PD4J 2E27H 4EUPB 2HWZL 2WAHA 2FLMA 3PCYA 3HMWL 3LVTA 4J3UA 4HUNB 1JWMA 5GGTL 1B3IA 3SE3C 1U8CA 4XI5C 4NXKA 4IU3A 4MB1A 4AQ1B 2LVCA 3DVIA 3SY6A 4XHJC 2Q6WB 3ZPDA 1IBYA 4KJWD 5E5LA 5HPOA 3DYPA 3NEXA 2Y1YA 4JVWA 1UACH 3QDHA 4AJVA 1FFOB 2GTZB 2R0LH 2WKGA 1E67A 3LRHA 1IIKA 2C9RA 3ZW3A 3TZVD 3KS0H 4HUXB 5I66A 2W07A 2DBLL 5C0DA 4IGBC 1U58B 1DANT 3J8F7 1HZHL 1Q9WA 2BOBA 4YDJB 2P8LA 2CRYA 3HS8A 4LEOA 1F4XH 4KDWA 5C2BH 1KBGH 4Y4HD 1RIHL 3M7OA 1OTSC 2GYSA 2F7OA 3QPKA 4XP5H 1IV8A 1UXSB 4XNAA 4XPHH 5HGDA 5IM7B 3WMSA 4L4TA 4AJYV 2Q7NA 1CGTA 4WV1C 3PWVB 4H1LG 2W59A 2Y3NA 4J4PA 4KUCF 1JXFA 2DBJA 2CZNA 4OZ4A 1XZWA 3UIZA 5FA3B 2WTPA 4HWNA 1YYLH 2LFGA 3DIVA 3MV7E 5FYJU 3ROOA 2ETWA 1OAKH 1PLBA 2YAEA 5JW5B 4HAFA 5L8JB 5D96C 3CBKB 2GK0B 3FTYA 4NKQB 4LRNL 4R97C 3NSJA 3BD5A 5B3NA 1Q4NX 3PJSA 5J8OA 5DFWH 4KKLC 1NFDE 1FFTB 3V5KA 3EYQC 3QXAA 3QNZB 3ES6A 4G1MA 4CMMB 1DLHB 4APQC 5F21B 4YLCA 2UXFA 4ELME 4U1NA 3JV5A 1U33A 1LWRA 5J89A 5CP3H 2Q8AH 4DGVH 4IBTA 5C71A 3SKNB 3NRPA 3NFSH 1QLFB 3Q3GB 4JFEE 3JTTB 4Y89A 3X3FL 4QPEA 2DQTH 1NDMB 3GXFA 3QUMH 3GMOA 1JXGA 2XU9A 4YNYA 5HDBE 1RY7B 3BP6B 4P2OC 3OXRB 3VXTB 1UCBH 1UGKA 3NCWA 4FI7A 3L95B 1LLAA 1RZGA 2AEQH 2V8MA 4UQ2A 4LVNC 4MD4B 1T1WA 5EN2B 4WHCA 2UV3A 2BJMH 5EC1A 1WISA 3TN0C 4F9PA 4TRPH 1WTLA 2MOVA 4DP1X 3LV3B 3SD5A 4KNUA 1XSKA 3SCMB 2Z8SA 1RZFH 5C07D 1FFNB 1NC2D 1P6WA 3CHQA 1QYGL 3LB6D 1DO6A 1DEDA 3IU3B 2HKAA 5ESAA 4K3JL 3RFRA 3DX6B 1BVZA 4ZO9A 1X4ZA 3IMUA 4GP8B 4HEME 1JZ2A 3LKSA 4HC1L 3WD5H 4O02H 3TEWA 2OPCA 2IDTA 5D1ZC 2DAVA 3UG4A 3VWJB 3VXQA 1QAWA 3MJ7B 2VRKA 2BY2A 3BVWA 3OLEA 4FHBD 4RRPA 2WLIA 1KB9J 1R34A 4BD4A 3ILQC 4G7VL 4HPOL 1DTUA 4UT6L 5D6CB 3X1BA 2HPOA 4QHKI 5E2UH 1ED3A 1V3MA 3QUYD 2OZNA 3F58L 5FO8B 5AYUH 4H8HA 3O3DA 1FO0A 1N59A 2XOTA 2VDMH 2ZAHA 3HRZC 5IF0A 43CAA 3TVMB 1OM9A 4WJ5A 4BGLA 2MPAH 5A43C 1EX0A 1G1OA 4HVBA 1QSZA 2R4RH 1F3RB 3FF7A 3S2AA 2X4TA 1YPZF 3Q1SH 1PZ2A 4DOHE 1SM3H 4LK4A 3STBA 4LT7A 1F4WH 3RGVD 5DHVB 4E9LA 1E9QB 3H7BA 3VFNB 1CL7L 3PS6A 1L0PA 3B7YA 3G6DH 1GGUA 2WIIA 5GRXG 1J05A 1KBVA 2HG5A 4KHTH 4YDIH 4ONHA 4PJHB 3WFBL 4W4NA 4AL8L 3DI2B 5IT2L 3BE1L 1FZJA 1KTRL 1NICA 3MBEC 3RWDA 2Q5BA 4GKZA 4W6XB 3V0VA 1P7QA 2R9HC 4X6CE 4BZ2A 3SHSA 1WAEA 4DF9A 5IB4B 4MASA 1URLA 4PB9H 3P9LB 5GZOA 1Q94B 1XBDA 4N8UA 4NDMB 3OC8A 4XP9H 3LZLA 4ZUWB 4UBDD 4PM1A 3FONB 1NBVL 2X5PA 5I24A 3SDXF 1UT1A 3ZT6A 4OV6F 4HFWB 2I27N 4L3EE 4H20L 2EO9A 1WBYB 4CMHB 4MCMA 4KZDL 3VXOB 5KYNA 5CD5C 4FRWA 2YD9A 9PCYA 1JMXA 3WGUB 1Z9SB 4PJCB 2YARA 3MGAA 4L4VD 1XH2A 2KHAA 5C0GA 1QFHA 2GIMA 2J57A 1WFJA 4B3VA 4F15C 2NSMA 3FT3A 4POYA 4ENZA 2Q76B 1E27B 4LPUA 3VRLF 3TEZA 1IMHC 1WEJH 1BOGB 3FPXA 5E8PB 1AGDB 1LDPH 2HFFA 2GAZA 2ZWYA 1T83A 3SO5A 2ICWB 5E8DL 1QKZL 1UXWB 4D9QD 5IOPA 2C26A 1EFXB 4UAOC 5C6TL 5IFHH 4PTTA 3PFQA 4J1UB 2H9GB 4GG6F 1GYWA 1XIWA 3U0WH 2YGOA 3FN0L 4X9GA 2EH8L 4JE0A 4Z7NE 2OMVB 4QYOA 2WLJA 4OD2A 1S7WA 4PLJC 5BRPA 3T65A 2A73B 4WK4B 2NY4D 3QJRB 1L0YA 2Q1EA 2ADJB 4V33A 5IBLD 1G7QA 1QSFD 3B4NA 3EKCA 1HQRB 2VN3A 3F64A 4FFZA 1Y0LB 4C83A 5FS5A 2N0KA 1P4BH 4DPBX 1KB9K 4HUUA 5F9OH 5GRJL 3S5LB 4XNUH 1FDLH 2H7WA 2EXYC 3GQFA 3J07A 5DA4A 3B9KB 2YAQA 1XSOA 4L2LA 4Q7DA 4CGUB 3DXAE 1IL1B 1KTCA 5CCKH 1KBBA 2ZKMX 4WFEE 3KGTA 2MQGA 4GINA 2CPCA 2MTAA 1FQ9C 3H9ZA 1KGIA 2B39A 4QHNB 2PKDA 3L4YA 3VD5A 5IKCA 1WZLA 2WSKA 3ZE1F 5IMOB 1JZEA 1HVXA 1V10A 2HT3D 2VXUL 1J1XH 1E4XI 8FABA 3JBG7 1UQSA 4BWUA 3P69A 2HMID 4FNUA 4GAGH 4EI6B 1UYWH 2EICA 2HFEA 4XWOD 4MLSA 4YR6B 5FUZH 4NGHH 5C0NC 4HWBH 4JQXA 4AMXA 4E0RA 5KAQF 2H0EA 4OZIA 1KCSL 4N8VG 5A2KH 4A6YB 2EABA 5HVGB 2CNZA 5DRNB 5LBSA 3VGFA 1EWHA 3S37X 4DW2H 1ZHNA 4ODBD 3QT2A 2YEZA 4YBQD 5ITFB 4OJEH 4P4KA 5KSVB 4Z3EA 1SEQH 4G8GA 5I1DA 5C08A 5AKRA 3UPRA 1HHHB 2OLDA 3NJMA 4YHIB 1VENA 2N4IA 3QJQB 2EAEA 2XBDA 2FBJH 5CLYA 2F53E 3QUXC 2K7PA 1I3RB 2VDOB 2DJMA 4NQCD 5I1IH 3HI1A 4NUPA 4PI2A 4U6YA 2ZAGA 4RX4A 4X6FB 2HVKB 1TYJA 4TSCH 2GIXA 3CV5A 3MZTA 1KB5H 5EBLA 4ZX3A 3F7LA 3IJSA 3VQ2C 1SGKA 1KJ2L 4PJXA 3FT2B 2QELA 1E3FA 2GBUA 2VR6A 4PJHF 4R7NB 4RMUA 1DQLH 2CO1A 3Q2VA 1NGYB 3MOBH 2R4SH 4MS8D 3GUTB 3EXJA 3F7VB 5I1JL 5DUPH 3CSPA 3FU3A 1OPOA 2V0AA 1U8LB 1J88A 4LLDA 2EIKB 2NYYD 2YFNA 2EDTA 4PBXA 5IFAL 2VAJA 1Q9OA 3QZBA 1KOAA 3OZ9L 1RJZB 4QF1B 1OAXH 3N1PC 4P5TB 2NNAA 5HI3D 1S7RA 4UB0L 4W4OC 2R2HB 1A1NA 3WNOA 3BKCH 3EGDB 5JLZA 4ZMTA 4PP1D 1KN4H 4IIZA 1R3KA 5EO1B 2FR4B 1RUMH 1ND0B 4XNBA 1ADQL 2JIXA 1IAIL 3LD8B 1UATA 3WL9B 2ZWKA 1XGRA 2YBRB 2ZXGA 3QHFL 2XN9D 3BZDA 3TC9A 1AXTL 4MDJB 5GGVY 3WN5B 1YEKH 1MCQA 5EF1A 2W0PA 4JN2B 3L9RB 4NQDD 4XPGH 5AKVA 5AW0B 1QABA 5BJTB 4HT1H 2FJSA 3BVXA 4EZKA 4PJCF 1K4DB 1EZLA 1OQOA 1A14L 1MFCL 3O41B 1HJBC 5SWZD 1DO5A 3WJMB 4N0YH 3GUFA 1Z0NA 4HWEH 1HILA 3S34L 4LQFL 4JGJA 4MZIA 5AVRB 3V7MA 5EEVA 3QIUB 2PR4L 3T2NL 1KXVA 1PEWA 4KH9A 3TBYB 2BIPA 2AJ3B 1A9BB 3VFMA 4BRJA 3B7TA 5TPWH 5ICYA 1NEUA 1DUYA 1INDL 1TJIL 1BX2B 1SJEA 4HQQH 5KYUB 1H15A 5CUSL 1A5FL 3C5ZA 1WZ1H 2BP3A 3BPLB 3BYYA 3II2A 3T0EB 3OAUL 1OGSA 3VJ6B 5FFLA 3ZTDC 1C1EL 2HTLD 3T8XB 1OAUL 1D6VH 2ZUYA 2GEQA 1RUQH 3U9UA 2BOCA 3G5ZB 4QGTA 1FA4A 1WRFA 1HE7A 1RMFL 5H37A 2DMKA 5F7HA 5I5IA 3CPLB 2APXA 4LLUB 4NZTL 1VCBC 5EIQA 2E7LC 4AENA 4UQAA 4HCRA 1FGNH 1KCLA 5LQBH 5L7XL 3KLLA 4M93C 3FQRA 3TT1L 3MRQB 2VGLM 2ZUSA 3IMTA 4KK8D 4PJ9B 5AVYB 2YIHA 1DQVA 4UTAL 3B9DA 2J8UE 3G08B 4JX0A 4K7FA 3VCLB 1BD2B 3G5WA 4I2XA 4WU5B 3F6JA 4WWOA 4BINA 2OI9C 1M7IB 4KY1L 4X5LA 2CIKA 4NUGL 5CJQH 1ZHBA 1NCCH 1TZOA 4L3CB 4TMPA 1FIGH 4XVOA 2JKSA 5JDJA 3BW9A 4YBLB 4U4IA 1VFOA 4XX5A 1MQ8A 1G7PB 3M45A 1TVBB 1L5GB 1PDKB 1E4WL 3LIZH 1PSKH 4TTDC 1KG0B 3ARBD 3RWCB 5IB3B 3G3LA 4OY9A 3BH9B 3FUHA 2NY0C 4R4FL 5CN2A 3AXIA 4WI0B 3T9WA 3D9AH 4IMKA 2V2WB 1F58H 2QADB 2K1MA 1CMOA 2ADGB 3EO1A 2BZCA 3F00A 3SDAA 4KDTC 3B9VA 4WW2C 4X42A 2NPLX 2R39A 1PZ5A 3S4SA 3SZKC 5DDHB 1A4KA 3GMQB 3W37A 4YPJA 5AL8A 4MAYA 4KXCA 5TDNB 3MV8E 1NGXB 4JFDE 3Q5YA 4XN4A 5HVHB 1ZT1B 1AZCA 4FA8A 3SN6N 4D9RE 2Y23A 4RRPM 5JPNC 4HZAA 3WFHA 1S7XB 4AQ8C 2KC0A 5H2BA 2K4WA 3WNLA 4NP9A 1QFOA 3I9AA 1FZKA 2OZ4H 4IOSA 4ZMOA 4JFOB 1IT9L 3AQZA 4G71B 2DIEA 2NNFA 4YSOA 3UAJA 1PX8A 4G43B 4OFDA 4BDVA 1R24A 2CKBA 1AIFB 1H3UA 4B5ZA 4YC2C 1O6VA 2ZUTA 5IVXE 1RZIB 4EXKA 1W0VA 2WWKT 4E42A 1KIPB 3DSFH 4YGAB 2O30A 5L88H 1JF5A 2HWZH 4YSSA 1AR1C 1URZA 3HMWH 1FSKC 2C3HA 2WNGA 3QDGD 3D52A 5GGTH 1D5MA 2J3SA 1IM3A 2BIIA 3WS3B 5HJ3A 3P11L 1RJLA 2V33A 3FQ1A 1BQKA 2VZOA 5EU4B 4IMLA 3CZSA 1B6DA 1CI3M 1OEZW 3CFJA 3HS0B 3RVWC 4QNPF 2IANE 5I1AA 4G8FA 5EBWA 2WBJB 5AKTA 4ODUB 3UTTD 3VUAA 2P24B 3E1ZA 2GJ6E 1GGYA 1U95B 1A7PL 1JP5A 2DBLH 2ZAIA 3VA2C 1NCNA 4M7LL 1HZHH 1X4YA 1XF4A 1MNUL 1DCEA 1NIBA 4QT5A 4N1EA 1SRDA 1RIHH 3D09A 3L1FA 2P52A 4WW1A 4B5EA 1TTBA 4CRPA 3O3UN 4HD5A 4N9GA 2X1OA 3T0XA 4JFXB 3MV9E 5KSAD 3TIDA 1RSYA 2YGVA 5D2NC 1HCFX 1Y1DA 1I31A 2OTWA 2YLKA 4PRNB 1SOKA 3DX7B 1YRKA 1H6TA 4GXUN 4HW6A 1UTDA 4Y1AA 4PREB 1RHHB 4LLVB 1CTNA 2CMRL 3CN1A 4M9OA 4K71C 2FEEI 4LRNH 4WI9A 1CWVA 4JFFB 3FHEA 4I89A 4W9JC 5F7DA 4UQ3B 4KGJA 3KYMB 3QIWB 4ZDHA 1LE5B 3ARFD 4W70A 1OAJA 5SX4I 1CVRA 1T3FA 2IBBA 3GJFH 3KYAA 5ANMA 4B27A 3U6XA 2ICWI 5E9DA 1T66D 4OGQC 4R4BA 5IESL 5I8CA 1I9RL 3DSNB 4IU2A 4LDOB 1KMGA 4F7PB 4YHKL 3VI4B 4DTGL 1YMME 4LOUC 1XCQB 2IXQA 2WTRA 5G5DB 2XWBB 2WSPA 5EU6B 2XVKA 4PG9A 3U2JA 2VH5L 2PWGA 2R29A 3UERA 3UZQA 3MLYL 5F3BB 4U7MA 3KXFD 4FXKA 4RCAA 3MROA 4F5CA 3CFBB 5ELIA 4UM9A 1Z5HA 1T0NB 1WZAA 3BFQG 1MCHA 1DN0A 4UANA 4JZJC 2KPWA 1UA3A 3CCHB 3L7FB 5TQ0L 1BXAA 3V7AG 4DZ8A 4ZAKC 3DWTA 1BPVA 5ISZB 5JQIB 3VRJA 1N4XL 2VMEA 3PP4L 1I1RA 3T0DA 1FRGH 3LAFA 5I17B 4DK6A 2O93L 1IQDB 1JGIA 2GG1A 5BZZA 5BVJA 3O2WL 4HULB 1KXQA 4XVTL 4Q14A 1QYGH 2HRHA 5HGBB 4K3JH 4XCCL 1BJ1H 1I4FB 4MA1B 4WUUE 3ATBA 4PJBB 4FFYH 1J0KA 3FQUB 4M6OL 1BQSA 3TA3D 1ZS8B 2F8IA 4H0IA 4HC1H 4HIPA 3VU2A 3G6JB 4NO5A 2JKTM 3PABA 4YDKL 2X38A 5I6XB 5BXFA 5F7WC 4P5MB 3IK2A 1Z2KA 2I07B 5HHMB 4IYKA 1UHVA 4ENEC 1CGYA 6FABL 4HPOH 4Z78B 4UT6H 5IQ9A 5E4AA 4EDXB 5FDWB 3F58H 4Z3IA 4S0HA 3CVCA 2IAAC 2FGWL 1X7QB 1QLRB 4F9PC 2JKNA 5LXGL 2LLLA 1RK7A 3FO9B 1NCHA 1ZRUA 1BZDA 3BVUA 1TTGA 4Z7UA 5JOEA 4LLWA 3VXPB 4J3OG 4NKDB 3U48A 1HCVA 2ADIB 3ZGIA 1KBKA 1TF4A 3OWEA 3AM8A 3C6LA 3KL5A 4XMZA 5AUMB 3ECBA 1SYSB 1TNMA 2E8ZA 3IMWA 4Y2DB 1HSAB 1M7DA 3GHEL 2XV2A 3NJKA 4WSGA 5BPPA 2NR6D 2V9RA 4JZOA 3EJZC 1NAMB 5CAYB 1L0XA 4AM0A 5JIHA 4NJAL 4M43L 3WFBH 1CIDA 4M1GL 4QTHA 4DN4L 4AL8H 3LSOA 2ZCHL 3IKCA 1BJMA 2C9XA 5IT2H 3BE1H 2IQAA 3HC3L 1F6FB 1DE4A 5EOCJ 1RZ8A 3M17A 5HDOA 3QXDB 2NY1C 4RVBA 3SKOA 4XB8A 4WQOA 5DI8B 3V0JA 3QDJA 3GC3A 1EDHA 2NY2D 3LHAA 4CSPA 2XKNA 3OKEA 1SJHA 2GJJA 5CILL 3N1MC 1MIML 4I4WA 4DUVA 4Z18A 5DYOB 2Q3ZA 2ZOKB 1TKWA 4TL4A 2P4AB 4RNRB 3V10A 1S7SA 1FVCB 1NBVH 3AREC 3OR7B 5JW4R 3CDFA 3SQBA 2QQQA 2UXGA 3BSGA 5TGBB 5CEYA 4WI3A 4OAWB 4H20H 3O6FB 1MCPL 1Q9KB 2P8PB 3ZN6A 4KZDH 2Q86A 3FOMB 1DDHB 2DLIA 4TLTA 1I8IA 2YPLE 5FKPB 1N0XL 1NKRA 3RWHA 1QHQA 2ESVB 3IXTA 3PDDA 1IKOP 5DUJA 2QSVA 4PJ8B 3VH8G 4MZ3A 4LHUG 1IE5A 3BHBA 3CDZA 3RGBA 1EO5A 2YD7A 3ZTNL 1AHWA 3R06A 4JZNA 4ZNEE 3PAZA 2VL4A 5E8DH 1D9KA 1QKZH 3EDKA 4A37A 4F1SA 2WJ5A 3C09B 3KYNB 1GJIA 5C6TH 3ZR6A 3FYEB 4PRBB 3MJ9L 1M1SA 1Z5YD 5F7UA 1QHPA 2DJ4A 4LAQL 3I9IA 3VI4F 1YN7A 1XR8A 3FN0H 2EH8H 4FFVC 1W72L 5FCUL 2HG0A 3WNPA 1OLZA 3SGEH 3FU7A 3NSYA 4U1HA 4E9QA 2BIOA 5I9QB 3RVVC 3SDDB 2CR3A 3G5VB 3C5JB 1WLHA 4J8RB 4NOFA 5HHXL 3RKDC 1JG9A 3ZHKA 2VLKA 2YA2A 5GRJH 5CEXB 3MNVB 2PW2A 1U8MB 4LASL 4CN4A 1NGPL 1CE1L 5IROC 2KS0A 4AJ0A 2WO4A 3DPBA 1LO5B 2ALAA 4MX7B 1MVFA 1XZ0B 4RA0C 1XXFC 3LZRA 1OSPL 3FTUA 3HZKA 5LB1A 3BRGC 3PL6D 3D4GA 3HC2A 1ONQA 2VXUH 32C2B 1NCOA 4PJBF 5CBEB 3HFML 2EYTB 1GAFL 1CFMA 1SXCA 3G6JF 4NI6A 1IGFL 4JRYE 3KPOB 5EUOB 1U6AL 1A6WL 2B5IC 3IPFA 3VFGH 1KCSH 1VPOL 4BH8B 2NXYB 2F54B 3D2TA 2DJUA 5FO7A 5C0AB 4BSVA 1S3RA 5IBUG 3G5YB 4IHBA 1F3DJ 2B15A 4F7MB 4P59L 1X9QA 2BPBA 4N90E 4KJPD 3PDGA 2B7DT 5KBNC 1MCDA 1T7XA 3P9MB 4JAMB 2F74A 3FB7B 3HE6D 3FQTA 1S7VB 4Y4HA 2BZ7A 4LSUL 3UTSB 1R17A 4Z7WA 4O2FB 1RFDL 2VUKA 3QI9C 4NAQA 4EMZA 2XFXA 2AKRB 2BHYA 3IFNL 2YRBA 4Z7VB 3V4VB 4P2RB 5D6DC 1EQWA 2Q10A 1PY9A 3T3PB 4X7TB 4OUUA 1MHEA 3BKJL 1KYAA 1MVUA 3C87A 1DANU 3U46B 1ERNA 2A9NL 3CC5B 2WP3O 2RFXB 1KT2B 4AIEA 1CFSB 3QQNA 2FWSA 1KJ2H 4JNXA 2EIBA 4BZ1L 4BXSV 1DP0A 2IAMC 4RIRA 2Y36L 3K72B 3MMEB 4RAUA 3FRUB 4NNYB 3RTQD 5A2BA 1YEFL 4BFIA 4L8SA 1IJ9A 3GSUA 5I1JH 1ETZB 4IK7A 2WQRA 5IFAH 1IIIA 5FYJE 2XV6B 1TFHA 2HTKD 3OZ9H 3DBXB 4AVHA 1NCBL 1V55B 3HOGA 4OVUA 5B1JA 5EC2B 3VFSB 4YHNB 4UB0H 3O6KL 3QR1A 4ZPTB 1NANH 3BDBA 3TH3T 2EP6A 1DFBL 3RRQA 6PAZA 2VUOA 4NQEE 5BQ7A 4R7VA 1J5DA 1ADQH 5LAXB 2ED8A 5C0IB 1M1XB 4M5SA 1SUHA 4JUTA 4JN1L 4LLAA 4XTRC 1V3LA 4E68A 3QHFH 1I8MB 4HIQA 1AXTH 1YNLL 2BWDA 1I7RB 1TQCC 2FNWA 3QFJA 3LPFA 1BDYA 3PJLA 2GBTA 2XWRA 3FBQA 3CIQA 1MI5A 3B7RL 3FU9A 3RBSA 4FERA 4Z7IA 1SF3A 1A14H 1MFCH 4BQCA 1AJ7L 1VZIA 5C07A 1J12A 3O6LL 5LGHH 1NC2A 3CAFA 4IGBB 2GW5A 3GTTA 2H2SD 1E8ZA 2NW2B 3S34H 4F33B 4LQFH 2A38A 5BV7L 4YVUA 2ZG3A 3I74A 1TZ8A 1RUKL 3KPSE 3Q8EA 3RUGF 4FTVB 3T2NH 3EAKA 2PPCA 3FH8A 2PYFB 2OJZL 3CSYA 5F7NC 3KLQA 2H2PC 1JDCA 1INDH 4JO5A 1U30A 4WV1B 5CUSH 1A5FH 3SGKC 2IWKA 2XNAB 3OAUH 1C1EH 1OAUH 3GK8L 2BO0A 4ZK8A 4UQBA 4Z5RB 5AL0A 1RMFH 2TRHA 1UWXK 2V9QA 3CQFA 4HJTA 4PBWD 3D39A 4MQ7A 3IBEA 1VFUA 5CFAA 5D96B 5BZWA 1WDAA 4Z6AT 3QQ4A 1KXHA 1YEGL 4NZTH 4UUJA 4S1SL 3THML 5CJ8A 1MCWM 1JHLL 5T5NG 4G8IB 5MENB 4WEUD 3DTDA 4KRNA 4NBYB 5DSCB 4R84A 5L7XH 3TTYA 4APQB 4OGXL 3TT1H 2XACC 3BAIA 3DGCR 3RGVA 3BLKA 3K71A 5CGTA 4X6EA 4UTAH 5D7SL 4HKZB 1MFVA 2WO3B 4ZXBC 3BIAX 1E43A 4KITB 1U8OB 1PAMA 5C3TA 3S5ZA 1OCOB 2XA3A 2VDLB 1QBLL 4KY1H 4OD1L 1TU2A 3FFCA 4NUGH 4PR5B 5IB1A 1F1DA 4U2ZA 4NWTL 1MF2L 4LCWD 4JJHA 3T0VA 4MSWB 2ITFA 3MVSA 3MYJB 3OJMB 4P2OB 3CWGA 3RWEB 4FJ6A 1I7UB 4OQTA 2E0PA 1NFAA 2BSSA 5D9SB 5EUOF 4B9YA 4WKZB 2EECA 3HG1B 4WHTA 2J21A 3SKJL 5BRZB 1CE6B 4PJ6A 1E4WH 4A39A 1RZ7L 2JKIS 3TN0B 4RDQF 5KUKA 1FZMB 4R4FH 1T2QL 4PY8J 2W80C 5C0JB 4P4RA 1I1YB 2HJLB 1SEBA 3NJNA 2WV3A 1PQZB 2VLJE 3B3BA 3CMGA 3GS0A 4OZHB 5I1HL 2GK2A 4XVSL 5F7FA 1ZV2A 4TYUA 3QBTB 4RETB 1WAAE 3IETA 5B39B 2BVUA 3D18B 5D1ZB 5IEKA 2AC0A 3DUUA 3NABL 3JT2A 5GS2H 2XQYA 3ILEA 5I1KL 3TPUB 3EOYG 4NWUL 5TDOA 3SJVA 4X7DC 2ZUWA 3OHXC 4J3OD 2OX5B 4QOKB 5ID1A 4L4VA 2EDQA 4MCNA 4NT6A 2YQ2A 4JFQA 1R3HA 2W38A 1ADWA 2VLME 2IPUK 2V5MA 4U4BA 5EZPA 3HRZB 1AY1L 2DQUL 1IT9H 3HUJA 4NNPL 3ULVF 1R33A 2X70A 5CFHA 3II1A 1SDYA 4IMKC 4XNMB 3FT1A 1HSBA 2EC8A 1AO7E 3KS0J 4HUKB 2ERJC 1DVTA 3M8OL 4KK5D 2AI0L 4DVBA 3M46A 3S96B 5C0CD 1L6ZA 2QV2A 2H1LM 3N1FC 2WYIA 4JO4L 4AL8C 4DQOL 3F62A 3MRMB 2V7NA 1B4LA 1M9SA 2OW6A 1DJZA 5F0LB 5IHUL 2XWCA 4YZFF 2D4FA 3P11H 5GSVA 4AGOA 1SBBA 1HHGA 4HWZA 3EDFA 1INQB 3MBEB 3NIGB 5GGVL 4TLSA 1T5XA 2H8PB 5DTFA 1JHTB 2FJHA 5B38A 2IIJA 3VXUE 4AK1A 2HYMA 3X3GL 3IE9A 5HHQA 1A7PH 1XAKA 5I30L 5DD0H 1IGIL 5EU7E 4M7LH 2GT9B 4IBUA 5E5MA 1MNUH 1F1GA 2MRYA 4UT9A 4MCYB 7FABH 4HG4J 1HDMA 2JTDA 2K45A 4QR7A 4BEIA 1OALA 2JF1A 4YE0A 2R69A 2DLFL 2VWEC 2L04A 2B1OA 5JHMA 3N44B 3NTCH 4LHUD 2YXWA 2XVLA 2GTWA 2G3ZA 4J2QA 3GMNB 1EANA 2YK1L 2YUVA 2YO3A 4BH7B 5JZ7D 1CLYL 1UWFA 2C3GA 4YSCA 3BLBA 4F2FA 4GH7B 4OGAC 4DESA 2BNQD 3ZIMA 1LQBC 1FI8C 1QBBA 2CMRH 2JWYA 4F15B 3F05A 3FTGA 3JUYA 1NZRA 4X8CA 2VDNB 5EZJB 2H3NB 4G8AC 5F1SA 5B1AB 2H41A 4YDLC 4NS0A 5AW3B 1T04A 3V4PL 4F8PA 4PJ5D 2WGXA 4XMWA 3FT4B 5A2JH 5IESH 2X7LA 5I28A 3BT2L 1I9RH 1ZMYA 2OFQA 3LRSB 1G4MA 4UAOB 4W9HC 3LQZA 4YHKH 5FIEA 4DTGH 2FATL 4UV7L 1EHLL 3QULB 4MMZC 1Z9LA 3BSZA 2HN7B 4NQCA 4TVPE 4W6YB 3WHE1 3LKRA 3CLFL 2I85A 2WZ6A 2VH5H 4X7SL 2BY3A 2PYEB 1IGTA 1X3DA 2E3VA 3MLYH 2VQUA 3NESA 3KMDA 3RNKB 1OPGL 5D7LB 5GZNC 4L0YA 4YFDB 4YS4A 3OAZH 1FVEB 3GM0A 4UTBA 4O2CA 1MDTA 1BQUA 3T4AC 2X4RA 4XMVA 1XR9A 1T4KB 3NBNA 1UJ3C 1N4XH 4LCUA 1R47A 3PP4H 1YUKB 4YO0A 2P5WA 1KCKA 3FXIC 3WEXA 4Q6YA 1LE9B 3O2WH 3KM1A 4XVTH 1HH9A 4J3BA 3BGMA 2X3BA 3V4LA 4XCCH 1CGWA 4QHLA 4OF8A 5FV2A 4M6OH 4F8OA 4ZUVB 3HAEH 5F8RC 3KYOA 4YDKH 2XBZA 5CSZA 3SPJA 1YC7A 2H4EA 3QFDB 3S3PA 3P73B 2MEJB 3IDJB 1IM9A 3WTUA 2AVGA 5IW1A 1TSRA 2NQCA 1KIRB 6FABH 3IDMA 5GRYA 4MYWB 4YQXL 4Y16D 2N7BA 2Y2TA 4GIOA 4D0BB 5E00A 2FGWH 5DO2D 4YAQA 3ZX1A 3W82A 1A9EB 5LXGH 5SWZA 3DIFA 5HGGS 2VDKL 3SY0A 1RVFL 1YJDL 3EGSB 4YXLL 4XNXL 3NQKA 4F27A 1FCCA 1L3WA 5FYLE 2ZXWB 2ZE0A 1SLXA 3DGDA 1MLCA 3TXAA 4BWWA 1INEL 4MNQE 4K5NA 5CD3B 4NKIL 2OCJA 2QHRH 1EHKB 4NQXA 4YHOL 3QUXB 3GHEH 3I02B 3SD2A 4CW1B 1OGTA 4HG4K 3WSQL 1HYSC 2YJLA 5FYLL 4BCYA 3UEZA 4NJAH 4GY4A 3ZHLA 2IALA 4HS3B 4M43H 2K9UA 2HH0H 2KZKA 4M1GH 5AYTA 5TJWK 1DQJB 4DN4H 2ZCHH 4W9KC 2GC7C 4A7GF 1JWSB 4EAEA 3GJEB 3HC3H 3BH4A 2I5YL 4DQAA 1DZBA 4HDIA 2XZZA 1V5JA 4H5SB 5EO9A 1AQ8A 5B8CC 3BDYL 4Y9BA 5F3HA 3NIGF 3STZB 4UZSA 3K81A 1UCTA 4PRPB 2Y5TB 3TYFA 1TZHB 1V3JA 1KZQA 2DEYX 1TT6A 3EFFA 3AM8C 1MIMH 3BP5B 2X4NA 3ME0B 4P46D 4PRHB 5DMKB 1JYWA 2C9PA 1AXSB 1W6LA 4P5KA 3IEAA 3IDGB 1RIUL 1U3JA 1E4XL 4CU7A 4GLRH 5IGXH 4WU7B 3T6QC 1MCPH 2BVQA 2XXMB 1M6OB 4L9LC 3GWJA 3N44F 4X99B 4FZ8L 1N0XH 1AGCB 2EH7L 1JFQL 1WFTA 4OSUL 4V2CB 1OANA 4K5LA 5FDYA 4HHGA 1DVFD 4K5MA 4ZO6A 1BF5A 2ZQKA 4JY6A 2R2EB 3LKNB 3NJLA 4E41D 4FCAA 1LK2A 4OZGA 3HC4L 3L1OL 3FO2A 4I18B 4FYTA 3ZTNH 4FQXD 4F7TB 2UZXA 5H35A 1YMHB 4RZKA 5AB2A 2PCXA 3MJ9H 3HLAA 4LAQH 2OAAA 2HVJA 4AV4A 3H7LA 2PPEA 3HJ0A 5FCUH 1W72H 4UDUB 1T2JA 3L9YA 4F8LA 3U2SB 2WOYA 4M8QA 5DEZA 3RIAK 1A8ZA 1X5HA 4D7PA 2SEBB 1HHKB 1YYCA 1YPZE 5CILH 4AGPA 2J4WL 1ET8A 3I6KA 5HHXH 1VLXA 1NJ9A 2OMYB 5HGAA 3RURA 4ZG1A 2WIMA 1CFTA 3SDYL 4GKNA 1S78C 1CE1H 4L05A 2A7BA 3AU1B 1AGEA 3C60A 4PRAB 1MUJB 1P4IL 4XVUC 1GY2A 2AQPA 2I69A 4KX9A 1MREL 2O6EA 4M93B 1C16A 2VW7A 4MQXD 1OSPH 1NGZB 3ABMB 2VLRA 3IFPA 3P2DA 5GRZA 4NZUL 3QUMB 3ECUA 5DJYB 3PPEA 4XP1L 3UGUA 3P40A 5D2LB 3PXLA 3V6OA 2C3WA 2OI9B 3HFMH 3PHOB 5DJXA 3L3DB 2FAUA 1S7UA 4G42B 1UJTA 3BVTA 1IGFH 2CO2A 2ZP0T 1YEJL 4WI4A 1BPLB 3QQXA 1U6AH 3BQUC 3OAYH 3BCFA 1A6WH 3MLTA 2OMXA 3KPRA 1VPOH 1ZVHA 2Z92B 3WS6A 5L2KA 2OCFD 2ZKHL 4NRXA 1LHZA 3I84A 1WWAX 5ACLA 4N0UA 1E5AA 4EN3D 2X6VA 1CJYA 4Y19D 4UTCA 5CGYC 1XX9C 3FUJA 3SDXE 1BECA 3WHXB 2VXTL 4HLZG 1NTDA 4P59H 2NY0B 5L2JA 4JGNA 3SDCD 4HYTB 1E65A 1WT5C 4LVHC 4QTIL 4AUYA 3S8WA 2R23A 4O02B 1N70A 4B9PA 3RY6A 5DD6A 1FAIL 4YHPB 3QUKB 4Z77B 4LSUH 4WW2B 1EEUA 3CUPB 3GB7B 1JK9B 3PWPB 1XHHA 3O4OC 1TJMA 2NX5D 1RFDH 3ROLA 5ITBL 3OBAA 1T21A 4P9HL 4YVNA 3IFNH 5D1QE 1HKLL 1BM3L 4Y5YC 1W8OA 3UCQA 5INCB 3JUZA 4ELDA 4MJHA 3VRLE 2ENSA 2OL3B 4EIZC 1TZIA 4J39A 2YLHA 3BKJH 5TH2A 2VDMB 5E6SB 3VXSB 1RZJL 2A9NH 4MJIB 5JPNB 1JGDA 5HBBA 2ZYHA 4K55A 4PJFB 3GS7A 1KTLA 1JNJA 3MLPA 3QDMD 4HOMA 4BZ1H 1GW0A 3T71A 2V6HA 2ZSWB 2Y36H 3TZVC 2WVVB 5CZVL 4GG6E 5A2FA 3RAJL 1YEFH 1A4BA 3ARFA 3HZYA 1XF2A 5F1IA 4C59B 4XXCA 1BQHA 4X6BA 3VO0A 3WO4B 3WN6A 4AYID 1IEHA 4RH4A 5CF3A 1L3NA 2QKSA 4H1LH 1J9RA 4WVRA 4YC2B 1NCBH 3CFNA 3EYVA 3Q5OA 2W81C 4FQIL 3Q43A 1YA5A 2AXJA 1IAOB 4MS6A 2XIIA 2A74C 2BS8A 3O6KH 4RGMC 5DRWB 2NOYA 1DFBH 1AR1B 4Y8AA 1FSKB 3DO4A 2WM0A 3NP3A 4IJ3C 1G9EA 1OO2A 4JN1H 2MPVA 1NIFA 1ZKAA 3ATEA 1CQKA 1YNLH 4HXAL 3GKZA 4M62H 5E5RB 3S5YA 5DRZB 3B8YA 4ZS7L 1OGAB 3ZE1E 3ARSA 1WHPA 5DU7A 4TLUA 1EEZB 3L3OC 3U1SL 1HX0A 4HKJA 4Q2ZA 1SOQA 1AJ7H 4P23D 3D34A 1JPGA 1OW0C 3O6LH 5SWSE 5T1KB 1HFUA 3CVHB 4N6RB 5J1AA 2XQBL 4G8EB 4Q9RL 1QFWL 4X0KA 4M29A 5BV7H 3NZ8A 2VXQA 3TA3A 5IJKA 1T20A 4GSQA 1JUFA 4RGND 1RUKH 1NA8A 5EDSA 4BJLA 4BQBA 2OJZH 2NUTA 4LQ1A 1JWMB 1ZT7A 1NMAL 3GGWA 4PJAA 2QT6A 3NCYP 3ZJAA 3GK8H 3NH7L 2J56A 2NZIA 5FK9A 1AQDA 1F41A 1U8KA 3D0AA 4JFPA 3ASWA 1U3NA 2AJVL 3LDBC 1TQVA 1FGVL 2CDFA 1KPUB 1ZV9A 1CXLA 4K71B 4CGTA 1YEGH 4Z76A 3THMH 1F4AA 4S1SH 4OV5A 1JHLH 4FKEA 4F2EA 3LB6C 2CO6A 5E1GA 1Q9WB 1NDGA 2PXYA 2P8LB 2RH0A 5G4NA 5B22A 4OGXH 3QVAA 4KXAA 4YSUA 4YFLI 1QRKA 12E8L 2BFVL 3SYQA 1MFNA 2YMOA 5D7SH 3U1QA 2GSIA 3KR3L 4LPWA 3SPIA 4K2UL 4PJHE 4L4TB 2NR6A 2J25A 1DUZA 4JY4B 3DETC 3QQ9C 3DNKA 3VFUA 2RJMA 1QBLH 4LBAA 3MI6A 4AIZA 1FCGA 1RLWA 1I7ZB 5IUSA 1DJYA 4NWTH 1MF2H 5D2LF 4XH2B 3QUYC 2I24N 1QPXA 4M1DL 1GZHC 2H0FA 1JVKA 4PJGB 4JZJB 5C0RL 4FYSA 4KHXL 3SKJH 4KRPD 4ZAKB 1YNTB 1RZ7H 5ENWA 3A3YB 3PJSB 3PLYA 2B14A 2VL5A 1T2QH 3V9EA 4ATWA 2MHAB 5FO2A 2A4CA 4DFHA 4P2QD 1YEIL 2WXKA 5FWRA 4HJGB 1JCKA 1WO2A 4HKXA 4PTUB 2ZICA 5TDPB 3RGVC 5I1HH 1DBAL 2UWEA 2OSLB 2ZP8A 4XVSH 1BFOA 4G7YL 4BUQA 4DP4X 4LESA 5JDSA 2VXVL 5GGTA 3NABH 3P4NA 4PJCE 3WOVA 4OBSA 3KVPA 4IIQC 5FOJA 3MX0A 1DSYA 5I1KH 4U3SB 4NWUH 3GMOB 4R2GD 3NN8A 1MRDL 2JLLA 4Q4IA 5JPMC 3N50A 4B95C 2XPZA 3MRCA 1ZDQA 2VO5A 3GSRB 1KIUA 4FQPA 1FHNA 1UM6L 4XHQA 4M6ML 1QRNB 2WQXA 4JO2L 2XKSA 1TZAA 4OT1L 4YHYB 4PJFF 5BW7C 2WINB 4AZUA 4EI0A 3RG1C 2DQUH 4NNPH 4U6VL 2CIIA 3OMAB 2FEEL 1QMUA 2DI8A 5IVNA 5I5MA 4PCKA 2FH8A 4UBDC 4NNXA 4TUUA 5AFAA 3KHOA 3M8OH 2G75A 4P2AA 1IBBA 3O6ML 1O7DE 5BUPA 4LSTL 2FO4A 1KB5B 5IR1A 2CO7B 4JO4H 4O58L 4DQOH 3TH2T 3NZHL 4IRZL 5TTRA 3TV3L 3VXQB 2JKXA 1U8JA 2COQA 1KC5L 3P4OA 1MFMA 5IHUH 5CNHA 5FCSH 2BSED 4TOYL 3B5GA 4LSRL 5JOFB 3SBPA 2K70A 5L4IA 5C86A 1ZWIA 1QEWB 3VFTA 3KDPB 3V5HA 4IEFA 5GGVH 3AMKA 4DJMA 1N7ML 5I0VA 1FO0B 1Z32X 4P48A 2NY1B 1H3XA 4WJ5B 1XMEB 3OX8A 3LNEA 3X3GH 3MV7A 3WDIA 3QORD 4AGQA 5I30H 2X6UA 3TF7C 3AVEA 1IGIH 2Q8BL 5K93A 2IV9A 5FYKU 5CXPA 4ZNCD 3PL6A 3H8NA 4F92B 3UTZA 3RX8A 4WLCA 1X9LA 2GI0A 1PJ9A 4X5XB 5FOBA 3H7BB 5E8OB 3DX9A 2IPTL 3VFWB 2DLFH 4JDZB 3R7QA 3S8GB 3MNZB 4ELMA 5FYJD 1H9DA 1NEZG 3OSVA 4E5XB 3U9WA 2NY4C 2CR0A 4UNTA 4ONHB 3X14A 3GM8A 2YK1H 3RWGB 5IWLA 1JZ5A 4RFEA 1CLYH 5KVFE 2XYBA 1FZJB 3SGDI 4LDCA 4GKZB 1KTDA 5JIDA 2TRYA 2XPGB 4N28A 3K2MC 1PKQB 4W9LC 4XCYB 4A6YL 4WFGE 1U3HD 5F71A 1E7VA 4LP5A 3GHBL 2Q0ZX 4EOWL 1ZDSA 4X8XA 1SXNA 1UVQA 3CQPA 4JRXB 3HE6A 4FQHA 4YEEA 5KVFL 1BVOA 3V4PH 3LHPH 4QRSB 2GQHA 3BT2H 2HT3C 1U0QA 2Z35B 2BMKB 2YN5A 1HL5A 15C8L 5F1OB 2FATH 3FU5A 1R75A 4UV7H 1EHLH 1Y18A 2HMIC 1BJ1J 3CLFH 3U6RA 4X7SH 5KG9B 2CJSA 2NNXA 4XVJL 2VDOL 3GRWA 4MJ2A 4YSQA 2ITCB 3A24A 1RUPL 2XTJD 3DDFA 1OPGH 1U8IA 2DQFA 3J7HA 3LXCA 1CGVA 1XEUA 3NRFA 3CHOA 3PQYE 3QIBC 2CHDA 1GSMA 1WFMA 2AK4B 2WSDA 3F85A 4H40A 4FABL 2DH3A 3E8VA 1E30A 2EKSA 3IJ9A 1IGYB 5AW7B 4GRMB 1UADC 1A2YA 5EFIB 1PF3A 1R5IA 2OMNA 1NBYA 2WUCL 3QZPA 4CC4A 4DVRL 4YN3A 4HBCL 4FG6D 2Z9TA 2HFFB 1E7UA 4MA3A 2FH6A 1YNTF 4K3DL 1DVQA 3QZWB 5T3XE 3PNWB 5KYYA 4YBHA 2R1YB 1VRSA 2XSKA 3JXAA 4DETA 4FFWD 1BYPA 4HZ1A 4K7PX 4L1LA 1IC7L 4QNPE 4ANKA 4XMKL 4Y0GA 1M3IA 2GABA 2DMGA 1UEYA 3JWNG 2DYPA 4WSJA 5T3XL 3C8DA 4WEMB 4OD2B 1CD8A 2EZ0C 4X0NA 1FHGA 3C8KA 2Q7YA 4ZI8A 3FBKA 4JO3L 4M6NL 2B5IB 2ZT9C 5D93C 3VFRB 4YQXH 4FXGC 1CLCA 1KCRH 1H5BC 1QATA 3L7EA 1KV3A 5CCHE 4MS8C 2OA9A 4Z7OB 3MRLB 3F7KA 4F93B 4XC3L 3S36X 3VTTA 3T5WA 4AEHL 2B9AA 2PCFB 2VDKH 1RVFH 3H0TB 2ZOTA 1YJDH 4YXLH 4XNXH 4KNQA 4QO1A 4P8QA 1NCUA 4X6CA 4Y9FA 1INEH 4TNWK 4PV8A 3DOIA 3T0EE 4UV4L 1T0MA 4ZS6D 2IMMA 4NKIH 3O8XD 3GI8L 4YHOH 1FNHA 3GJFK 3DJ9A 3QI9B 5FM4A 2YA1A 3RDTC 3WSQH 1I3VA 1TEFA 2CLVB 4GKLA 5AW9B 5FYLH 2VLJD 5I0XA 2WYTA 4ZMAT 1WJ3A 3APFA 1XFPA 2DWEA 2WZAA 3C12A 3JVGC 4G9FB 4E2OA 3MR9B 2WQAA 4U6XA 2BP0A 1G1CA 3ABLB 2PO6D 2ADFL 3TEXA 1JPSL 1S9YA 4WWKA 3O11B 2I5YH 4OCYL 3W0WB 2IAMB 1WC7B 4HX1B 3BDYH 3E6FB 2RCSL 4Q58C 4AE1A 5IMKB 4WNQA 5IB2A 4QKTA 2BVEA 4GG8A 5KYWA 1MPAL 3FK3A 3V0IA 1BD2E 1CVSC 5I1DB 2JSFA 3ULUF 3ML8A 3IJYA 1I1FB 4MNHB 5ESQB 1EJ6A 2JJTA 3KPTA 3QJTB 4XZUA 2ENJA 2AEIT 2HP4A 2XICA 3KPMA 4PSPA 4RDBA 4O51B 3TTSA 3HI1B 1MJUL 1RIUH 2OMZB 1E4XH 3E38A 3FHAA 5SV3A 4UM8A 4K3GA 1E50A 1J0ZA 2EYRB 4LCWA 1F6AB 2QQLL 1QP1A 3MRIA 4WFHD 5FX3A 2WUBL 1CD1A 4EXPX 5DK2A 3REVA 1KPVA 1P1VA 1TQCB 2EH7H 1JFQH 2G60L 1MXDA 4OSUH 3AGVA 1DJGA 2ZG1A 5BV7C 4LKXB 1O9ZA 5ILTL 1WE5A 4LLDB 4QRTA 4ORZC 3H2PA 3HC4H 3JV4B 3L1OH 3QEUA 2TSBA 4XPAL 4FXLA 4LCVA 1QR1B 3LQAL 4QJ3B 4I88A 1ZXKA 1MZYA 3LCYA 4IS6B 4KMTL 5CJXC 3OC5A 1X9UA 1ECZA 4WHYG 2E8YA 5FECA 4K5OA 5IQ7L 5J56B 4G7RB 1TMCB 4I9WE 3DXAA 5K9OA 4G82A 1N0LA 1EVUA 5JLZB 3HHRB 1XB8A 5I71C 1SMOA 1BA9A 4PW9A 1A6AA 4PGJA 1LILA 1XGRB 4PRID 2D9QB 1BBJA 3OPZL 5E8EB 3GMMA 1BLNB 4M5ZL 3SKMA 2X0WA 4UINL 3F7RA 2J4WH 5E6YA 5E99L 1MY5A 3RWFB 3QUZC 4P57B 3ARBC 1KPRB 3MRNA 1FFRA 1GRWA 3CMOL 3SDYH 4GI8A 3RIKA 3T0BA 5BS0D 3VD4A 2VE6B 2PCPB 2YWYA 1J0JA 1VESA 3K6FA 4BQ6A 4KKCD 5CR1A 1NFDB 1WBXB 3K91A 1P4IH 3R7RA 2Y72A 1ZIAA 1GKEA 1MREH 3VSQA 3BVNA 3CFKB 3I2CL 1IGJA 1K5NA 2AJUL 5C0CA 4GO8A 1S9XA 3D0LA 3Q48A 4NZUH 4R7LA 5GS0D 3T09A 3VFMB 4XP1H 3ESUF 4G6FD 4ZXBB 1S9WB 4OZFB 1FH2A 2NTSP 3NVQA 3TBVA 2WXPA 5ICYB 4B97A 1BGXL 4EUPH 2XVGA 1H15B 1BVKA 3H42L 4NCDA 3NSDA 4Q56A 2BRQA 2OJEB 3LXAA 5DVMA 4Z0BL 5DZPA 4KNTA 4BQ8A 5IMMB 4DEPC 4YE4L 1E9PA 1OTTC 3IMVA 4TVPD 2ZKHH 5IVOA 5JHDE 3FQNA 1H0DA 5DFAA 3HRPA 3WDHA 1K2DA 2K3HA 3RJDA 1S7TA 3IAPA 3GLZA 2QPEB 2VXTH 3IGKA 3JZ7A 2X3AA 4FFTA 4QTIH 4Z7OF 3D2UB 3QNXA 2VN6A 5FEBA 3BPCB 5BZDB 3MRGB 3UO1L 4R7DA 1AZVA 1SJMA 1FAIH 1SLUA 1YC8A 5AEAA 3KJ6L 3SIKA 5ITBH 4BSJA 3EJPA 4L29B 4KKQA 3LH8A 1WUZA 3VH8A 3ZYJA 1HKLH 1BM3H 3MRKA 4YX2L 4Z95L 3SO3C 4FGMA 3V5DA 2HJKA 2KPNA 1I1AD 5LN4A 5DEJA 1OSZA 1C5DA 1GYUA 4WTXA 1RZJH 3EH2A 3PJNA 4JFFE 3BW9B 3OHXB 1PG7X