5F7BA

Resting state structure of cunir form alcaligenes faecalis determined at 293 k
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 95
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5f7bA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5f7bA02
2AVFA 4HIPA 3GDCA 1PLBA 2GIMA 4BWUA 5I28A 4DPBX 1OE3A 1GS7A 3DKHA 3EF4A 1NWPA 2B08A 4E9VA 3QJTB 4KOBA 7PAZA 2IDQA 3MBWB 2XWZA 5B1AB 2UX6A 1M9WA 4KO9A 3ASNB 2BW4A 4KNUA 2CBPA 1HFUA 1NTDA 4YSPA 2DWSA 3CVDA 2XU9A 4UANA 2TSBA 2FQEA 2GB2A 1AIZA 2FTAA 1ET5A 2H5UA 2FWLB 5I6PA 4KO5A 1GYCA 1XB6A 1SF3A 2VN3A 3CVCA 1FFTB 5B1JA 4CSPA 4M4RB 1RKRA 4BWWA 1ILSA 1MG3C 3FU8A 1IBZA 4GYBA 3X1NA 2GC4C 6PAZA 3QJQB 1W6WA 2FT6A 1QLEB 1JXFA 3QQXA 1AZNA 3C75A 1MZZA 3SBRA 2IDSA 1GW0A 3AG3B 2IWEA 1A65A 5LDUA 4DP2X 4E9QA 1EHKB 3KW8A 2DV6A 3OQRA 4A2GA 2UX7A 4DP7X 1SDDA 2PLTA 2Y1AA 4GP4B 3X1EA 4AX3A 2YAEA 4G7SB 3T6VA 3PLYA 2UXTA 1PCSA 2CCWA 4BXVA 4MFHA 1AS8A 2J55A 3NJNA 1T5KA 1BQ5A 4YVUA 3IN0A 4YSSA 3WG7B 4E9RA 1MDAA 1AZRA 1BAWA 1JZFA 2Q5BA 4HZ1A 4AKPA 4DPAX 1JOIA 1OV8A 1BYOA 3UABA 3X1GA 4EF3A 1OCOB 2OJ1A 2BP0A 5I5JA 3QJUB 4HHWA 2W8CA 2HXAA 4E9YA 1J9QA 1AS7A 3SBPA 3V9CA 4PCYA 5AFAA 4GXFA 3OMNB 1CUOA 4BDVB 4YSEA 4A67A 3V9EA 2UXVA 2BZ7A 4A68A 3NJGA 1NIAA 5I6NA 5D4JA 1ILUA 3QJVB 4ZK8A 4DP6X 4KOCA 3PCYA 1N68A 1J5CA 2TSAA 3AG2B 4UF7C 3S3DB 4YSRA 3FU9A 4A66A 3ABGA 2QPDB 4NAJA 2CAKA 2OV0A 1ZDSA 3NSDA 2YQBA 2BHFA 2IDUA 4TXVB 1PZCA 3FU7A 2HLEB 1KCBA 1KDIA 2AZAA 1A3ZA 2BWIA 1V10A 4X4KA 5D4IA 2YAOA 2QT6A 3FYIB 1FWXA 2ZXWB 2JKWA 3T6XA 5I6MA 2R7EB 3AG1B 2FNWA 4HHGA 4WTQA 1ASOA 1NIBA 2FT8A 2IDTA 2QPEB 2DWTA 4G7RB 1ASQA 5FC9A 4GY4A 3FQ2A 3NP4A 3NSYA 6PCYA 2XYBA 2ZOOA 5I5IA 3L45A 3GXUB 3T9WA 4A2DA 1PNDA 1JVOA 2XVBA 3NJLA 4Q89A 1IC0A 3ABKB 1TKWA 1AZUA 4F2EA 9PCYA 2XXFA 5B1BB 1NICA 2EIKB 1E30A 2VSKB 4CSZA 4YSTA 1WS8A 4P5SA 4L0PB 4DP0X 3H4FA 1ZPUA 2X87A 1NPNA 2ZWNA 3FYEB 2A3TA 3PPSA 2EIMB 3DIVA 1PLCA 1J5DA 2BW5A 1JERA 2J56A 3FT0A 3AW5A 3QPKA 3NJMA 1GSKA 1NWOA 2DYSB 1J9TA 4G72B 5TK4A 2GBAA 1GY2A 1W8EA 3AG4B 2JXMA 4E9SA 4N4YB 3N55A 3CDZB 3FQ1A 1AS6A 2FQGA 4QKTA 1KBVA 1WA1X 2QDVA 5F7BA 1SNRA 1L9QA 2PP8A 1FA4A 2UXGA 3S8GB 2FQDA 2YXVA 1GS6X 4E9TA 3FSAA 1ASPA 1QHQA 4BK5C 1ET7A 2IDFA 5EHFA 1V54B 1J9SA 4YSAA 5PCYA 4E9XA 1J9RA 1JXDA 1X9RA 2YARA 3EHBB 1M57B 4AKQA 3NSCA 4BDVA 4HCGA 4YSCA 1E67A 3WKPA 3FS9A 3ZX1A 2YAMA 2PPEA 3NJHA 1YLBB 1NIDA 2EIJB 3SBQA 4FAAB 1AZCA 2H47C 4BXSV 3H56A 1ETJA 1PLAA 1IKOP 3WKQA 4NB7A 4YL4A 1XB8A 2IAAC 2VM4A 4HAKA 2B3IA 1OF0A 2DY2A 2VSMB 4RH4A 2BZCA 1L9PA 3EH4B 1OCRB 2I7SA 4YVNA 1WA0X 1NINA 4YSQA 4W9ZA 1CURA 2VM3A 1SFHA 1OCZB 4N8UA 1HAWA 1IBYA 5I6LA 2HRGA 4FA7B 2W88A 3NT0A 1W6LA 2R7EA 2IWKA 3FPYA 1KGYE 1URIA 2VW7A 2E86A 3UGEA 2GSMB 2P80D 1JVLA 4YSOA 2QDWA 1SHXA 4DP5X 1AACA 4GP5B 2BP8B 4DPCX 4G71B 2LLNA 3ABLB 2PPAA 2CALA 4A2HA 1SJMA 2BO0A 4KNTA 1AQ8A 4HCFA 2Y69B 3FQYA 5E9NA 1PF3A 3UAEA 2WO3B 3IE9A 3DTUB 1AG0A 4F7KA 1ET8A 2P80A 4F2FA 1L9RA 1A8ZA 1ADWA 2HX8A 4KO7A 2FT7A 3QJSB 3U25A 1QNIA 3BQVA 3MX0B 5F7AA 5TK2A 3X1FA 5I5MA 3S3BB 3IBOA 2GC7C 8PAZA 2ZONA 1NIFA 1JZHA 4DP9X 1CC3A 1DYZA 3EH5B 7PCYA 2FQFA 3PAUA 4JKNA 4PAZA 3RYMA 3BVDB 3NJJA 3ASOB 5ANHA 2YAPA 1NDTA 1ZV2A 3AZUA 1XB3A 4DP4X 5B3SB 4GP8B 1RZQA 3D12B 3NJFA 4BWTA 2AFNA 5B1JC 1WA2X 2RACA 1RZPA 2Q9OA 4K9JA 3CDZA 4M3HA 1AOZA 1L9OA 2XLLA 1JZGA 1L9TA 3KW7A 1OCCB 4G70B 1CYXA 1MG2C 1AAJA 2IWFA 5AZUA 3WNJA 3X1BA 1B3IA 2EINB 2WO2B 1TU2A 4DP8X 3TBCA 4JHVA 2CUAA 4ENZA 1OE1A 5IY5B 2PP7A 2PPDA 4W1TA 1KYAA 1JZIA 1N70A 2YXWA 2EILB 5AKRA 3H4HA 4AI7A 1BYPA 2GHZA 3T6ZA 4A2EA 1NPJA 3AY2A 3UADA 3ZBMA 2PCYA 1NZRA 1JZJA 3JTBA 3NP3A 3WNIA 4NERA 1I53A 2BWDA 2XXGA 5I26A 3SQRA 1KBWA 3WIAA 3ZDWA 3HEIB 1BQKA 3WI9A 2IH8A 5B7EA 1L9SA 4Q8BA 2YAFA 3ERXA 2N0MA 5D4HA 1PY0A 3PAVA 1PAZA 2XX1A 1MZYA 3TA4D 4AKOA 4WKXA 3PXLA 5B1KA 3CG8A 1A4BA 1SHWA 4KO6A 1OE2A 3CVBA 1E65A 2GI0A 1ZIBA 1BEXA 4AZUA 3T71A 1KCWA 2UXFA 1UATA 2VMJA 3G5WA 2J5WA 3FPXA 3ABMB 5B7FA 1ZDQA 1R1CA 1PZBA 4A2FA 2I85A 2XV0A 2XV2A 1M56B 3EH3B 3TASA 4UAHA 1GR7A 1SF5A 2BP8A 2HZHA 3FSWA 3HB3B 3OMAB 2WSDA 2YAQA 1WS7A 4G7QB 1V55B 2FJSA 4QLWA 3IEAA 1IUZA 2MRYA 3OM3B 1X9UA 3IN2A 1A4AA 4HCIA 1GS8A 1TEGA 5B7MA 3NJIA 3FSZA 1SDDB 3UAAA 2PPFA 2I7OA 1SFDA 3OD3A 2PP9A 4YSUA 2NRDA 1BXAA 2X88A 4P5RA 3FSVA 3JT2A 1AG6A 1OOWA 2JFCA 4HALA 2DYRB 2CJ3A 2IH9A 2XX0A 1WAEA 4JHUA 1DZ0A 2YAHA 3CZUB 1TEFA 3S3CB 1GY1A 2HX9A 2VW6A 1JZEA 3S8FB 2HRHA 2AZUA 1PMYA 3ZIYA 3T6WA 3NJKA 4DP1X 1JXGA 5I6OA 1AR1B 1KDJA 3PAZA 2OCCB 2BP0B 5A7EA 1BQRA 2VW4A 1PZAA 2AANA 3NSFA 3NYKA 2PCFA 1NIEA 1ZIAA 4KNSA 5I6KA 1AANA 1EZLA 1XMEB 2MTAA 1BXUA 4E9WA 1F56A 1PNCA 3OMIB 1VLXA 1CYWA 1E5ZA 3TBBA 1KV7A 3QJRB 3X2QB 1AZBA 3TU6A 3UACA 1RCYA 1ID2A 5PAZA 2J57A 1E5YA 3GYRA 1BXVA 2PPCA 1HAUA 4YSDA 3N2JA 2H3XC 2XUWA 2XV3A 3FU7B 1A4CA 2HX7A
chains in the Genus database with same CATH superfamily
1QSFB 2BXZA 2DEYX 2Q86A 3RTQB 3KJ6L 3BDYH 3QDAA 3MA9L 3DJSA 3UBGA 1LK2B 1IM9D 5H35B 2OXHB 2BPBA 4B9GA 3P2DA 4ZW6A 4Q14A 3NCBB 4UOW0 3D85B 5FAAA 2MEJB 2GUYA 4JAMA 1K5NA 3VTMA 1NWPA 2B08A 4PY7A 1AC6A 3BP7B 4OFYA 2IDQA 2XWZA 1EO5A 2IGLA 2A74A 2ZX6A 3S5LB 2J20A 3L3HB 1M6OA 2CBPA 1LD9A 1NTDA 3UJJH 2X9ZA 2DAVA 2Y07L 4LPCA 4CN1A 4XH2A 2XU9A 1ZLWK 1CLOL 4G7YL 3FO1A 2CM5A 4HZAA 1PZ5B 1AIZA 4HIXL 5FDWA 1MJ7L 4GUQA 3MXVH 4L3ED 4EJ1C 2R2HB 2ZUQB 3WEXA 1TVHB 2IV8A 3VI4A 4HSCX 1JN6A 4PRNB 3RWCA 5I1GH 3HR6A 2J7LA 2IXQB 1MCBA 4YWGH 1KZQA 6PAZA 3NCEB 3DO7B 3WD5H 1R3JB 3B2UD 3KVQA 1QFWL 4DKDC 1IBGL 3L5XH 3QQXA 4I89A 1MZZA 4HFUH 4OUUA 1S9YB 1ZHLA 2Q7YA 4B9KC 1MCPH 5TDNA 1Z32X 3BDBA 1P6WA 2W59A 2WTPA 3MLSH 4A7GA 4G6KL 1ZXKA 3AQZA 4TUOB 2V4LA 1OGAE 4TSAH 5HXMA 3VXUD 4B27A 3K1DA 5F3HA 3WTSA 4Y2DD 1G6RB 3RDTD 3IU4L 3CFKB 3PREA 5E5UB 3PWNA 5EWIL 5CP7B 4J6RL 4IHOB 5L6YL 4PVLA 5H94B 3A47A 4GW1B 4DPAX 5I9QC 3IXAB 3QZWB 2BNUA 3HPJB 4WWNA 3BSZH 2WVTA 4N9OB 5E9DB 5J6SA 1K4DA 3FU6A 3T77B 2AJ3A 2NQCA 3CDCA 2FYVA 1B0GB 1U8IB 1V3MA 4E5XB 1J9QA 3MKGA 2K8QA 1WQVT 1UD3A 1KLGB 1EZVY 3OJVC 4FQIH 1PZ2A 3O9WD 1IMHC 2RJMA 2F5AL 5FHAH 1XSJA 3VB9A 3FZUC 4F5CA 1HXYB 2D3NA 2DRUA 4WEEA 3T3PE 4FQ1L 4MJ5B 1MRDL 3OB0K 3KXFA 3IMRA 3G6JB 1DQDH 1ESOA 4M7ZB 5EBLA 4LNRA 4BH8B 1PJWA 4D3CH 4GAYB 2IWGA 4JRXA 5CEZL 1XD0A 2PXYA 2HLEB 4EVNA 1AZZC 1QX1A 4HV8B 3O2VL 4HF5H 4X4KA 2P5EB 2AJXH 5D4IA 4K8RL 3SBWC 1I9JL 2UZIH 4HFWA 4KC3B 4KK6D 4X99A 3SCMB 4AT6A 4ANWA 2D2CC 3LSOA 1NSNH 1WFOA 1VFBB 2BHUA 1F1GA 1SPDA 4JFQB 4UV7H 1CD0A 4PGBB 2ED8A 1NCHA 4JCLA 1PIFA 1KFAL 3LPFA 3U6RA 1JV2B 2H0EA 1OQOA 2XWJA 2CMRL 5DUJA 5JZ7C 2QLVB 4YE4H 3CXDL 1FBIL 1Z9NA 5I5IA 3D51A 4QJ3B 3IVKB 3CSGA 4X6DA 3H9SB 4NYLA 2OR7A 3QG7L 2WZPD 2ARJB 3NACL 4QJ5B 4PRDB 1JGVL 5FHBL 1JXJA 1FORL 4KRMB 3BUTA 1U3JA 1G7LA 3CFQA 1Y6KR 3FQTA 3QNXA 4RGMC 5HDBB 3DXAE 4QRUB 3ZTJG 3VSQA 5F9AC 4KITB 2QQQA 2YK1H 1NEUA 1XIWA 3C8DA 4GQPH 3RL2B 2CUHA 5KS9F 3S8WA 3JWOL 4N0FB 1PY9A 3GRGA 1WS8A 2J8HA 2HA1A 1EJFA 4N8VG 2XWTA 1IZKA 5LQBL 2XRAL 3S37L 1U3YA 3VGAC 1UB5B 3O3DA 4FXGC 2J56A 1KXQA 1R6VA 1QR4A 5FM4A 4UILL 5SV4A 2XY2A 1EAQA 4G8GA 4X4ME 2YUXA 5SWSD 1BBJB 4O2EA 5C0FB 3WFDL 3EGXB 4E41D 4HD9A 3RZCC 3P9MA 5A2LH 1SVZA 2DMBA 3F83A 4M5YH 4BSVA 1CL7H 4J8RB 4JDZA 1H15B 3F65A 1HH6B 3RGVB 3VM7A 5IR1B 3KPRE 1FNEB 5DD1H 1V8HA 4HWZA 3MV01 1TJHL 4KXCA 3P54A 4MX7B 4JFHD 4L1HA 4ZODA 1G7PB 3QQDA 4P2RB 4PJ5B 5EHFA 5IROA 1UCBH 2RCSH 2BVOA 5JUEH 4I0CC 1VACB 3QZBA 4N6RA 4J2QA 2W80C 4M4PA 3MOBH 1XF3B 2WQ8A 1PTZA 3EYFB 4J7RA 1E67A 3HLAA 4GUPA 4LLQB 2DI7A 1U3NA 4EQ3A 3QIBB 2DQIH 4YFEA 3VXMA 4LCIL 4ZSOB 1JTTA 3BVUA 1R3LB 5HHOE 5I17A 5IBUB 2B59A 2F5BH 4G8EB 5EU7E 4AMKH 1KPUA 4ECNA 1HKFA 3GQFA 1SJHA 3ZRCC 3OSKA 3T0EC 4U1IB 1TZIA 4NZFA 1I8IB 2FUTA 4PHZA 1G9MH 1TMCB 3MLTB 1BD2D 1OSPL 2GCYA 2EZ0D 1NBYA 2OXGB 5K9QI 5I1KH 1ZGLM 1HQ4B 3HG0A 3GHBH 2ZKHH 3G9AB 3O2DH 3Q44A 2WIMA 3CQQA 1HSBB 5CSBA 1XGYL 4JZJA 3AADB 5GGTL 2YBRB 1RU9L 4Q9RH 1G1YA 3PV6A 5EOTB 3K2MC 1URIA 3TJPA 1JZ5A 1HSAB 4XPAL 4NCC2 3VXTB 5JW4N 3E6HB 1LO2L 3AQDA 4OGYH 3UBFA 3KPMB 4GAGL 2LLNA 3QJZA 4FNUA 5I0VA 1GGYA 1GA2A 1LP9A 4LPVA 1EJOH 2FO1A 1KXTA 5CHNA 5D1XB 5E03A 5IB3B 3Q3GB 4OZFH 4AH2A 4NIYE 4PJFA 1XGPB 1CCZA 1RIVH 5BQ7B 5D70H 5D5MA 2VQTA 3HVNA 2C9RA 4RFOL 1A8ZA 1YY8A 3VE0B 3ZL2A 5DURD 3EJTA 5BO1L 2KLTA 3NFSH 5DEJA 1RH8A 3QJSB 3W56A 3FU5A 4M6ML 4PJXF 3IBOA 5JHBA 3LKSB 3TF7C 1A5FL 5MEOB 1HHIA 1NIFA 4RBPH 3EH5B 4XC1H 2NUTA 4APXA 3PAUA 4GRMA 4WKZB 1HYRC 1GHFH 2ETWA 5EIIB 3VNZA 3KZ8A 1K2DA 1X5FA 4HLZG 4L37B 4P2AA 3WIFA 2K9FB 3O6FA 2Y2WA 4FQXA 1CE1L 2IAMD 4FLRA 2AEPL 5E2WL 5T1MB 5E5MA 1IAIH 5AZUA 3VH8B 3V0VA 5AG8A 5SWZE 1QRNE 3EHBD 1HIML 2VSCA 5EORH 5GSRB 1IARB 3ZUNC 1MAJA 4DP8X 4XAKD 3X3FH 2H2SD 2R1WA 3TH3T 1HTYA 4UOJA 5DRZA 3TNNA 5CCGE 3RWFB 2VGLM 1DUYB 5JIPA 2MWCA 3J07A 3ROLA 4U3SB 4F9LC 4WU7A 2FJGB 4A2EA 3QQ3A 2O1AA 5IREA 3B9KD 3D05A 3NP3A 5KOVC 1X7SA 1I1AC 2H32B 2NY6C 4IBLT 5FFLA 1D5BB 4R9HA 3GSVA 4XWGH 4UCFA 3K72A 5EN3A 3C6LB 3BUYB 4HH8A 5C08B 1DJIA 2O4EA 5C3IA 1E28B 5G2NA 3CC5A 3AACA 3WEAA 3O6ML 5DT1L 4L5FL 3AB0B 1OQXA 3U9PL 2HT2C 4RZCB 1HOCA 4XVOA 1Z9PA 4IS6B 1S8DB 3MCG1 1RSFA 1ZTXL 1QFUH 3G5VB 1LO0H 3HMXL 4OM0H 5C0AB 1OO2A 2QSQA 1OE2A 4I4WA 3T0WA 1BDYA 4WV1C 3GJEB 2KQNA 5FUOH 4YUEH 1M05A 2I9LB 3ESNA 1GMEA 2QV4A 4OD2B 5MP6L 1KCWA 3FO9B 2JK5B 3BO8A 4PTUB 2QVIA 2X4NB 4PHXA 5T3ZH 3VTAA 3VDBA 1QEXA 4GJTB 2OMUB 2DQUH 3ILQC 1E8YA 1R1CA 1SRDA 2ZSWB 4A2FA 5E4EB 2FSDA 1M56B 3U1QA 2HJLA 3FSWA 3FONA 4X9IA 4AXWB 3TYFB 1BJMA 2N4IA 4J12A 5I8EA 1AQHA 3ROOB 3L4UA 3SE4A 3HMWL 1TO5A 2EO7A 1CICC 1WUNT 4K3JH 4JG0L 4K7PY 2F7PA 3INUL 4EXPX 3IB4A 4H8VA 3GJFA 5GZOD 2XZAL 1E27B 3LIZH 1SYVB 2X70A 4MJID 1LE5B 1WZMA 2XVLA 3D0VA 1QUNB 3WXWH 3STZB 2EVIA 1NUDA 4IDLA 2VRQA 4WJKB 3S4SG 1AGDA 4LOUC 4HALA 4GQ9L 3ZE1E 4NI6A 4PWEA 1USQA 3BIAX 2C3HA 3B4NA 4IJ3C 2QADD 4ELME 2PTTB 2WYIA 3VMOA 5LCVH 1GPOL 3GB7B 3ZIYA 4DP1X 1N8ZA 1L0QA 2ZUWA 1DBMH 3OX8A 1E5AA 1RUKH 5D7KD 5CIPA 4PWHA 5K69A 4PJCA 3D85D 1CFSB 1VGKB 3IPEA 3HBZA 3MLRH 4WK4B 4GO9A 4KNSA 2DQFB 4ICXA 5E8EB 3DVGB 3L3KB 3K6IA 4XPHL 3MOQA 1EO8H 2YUWA 2ZKYA 1NLDH 2CR3A 1FHNA 4G83A 4OJCA 4AE0A 2EO9A 3JYBA 3IU3A 3US0A 5CP3A 5AAWC 1MQ8A 2NTSP 3M8OL 1TEYA 3OMIB 4J3OG 4DGYH 1DJWA 1ZEAH 3IKCB 4P0DA 2OYMA 3VG0H 3X2QB 1IIIA 2V7HA 4QRPB 2WMPA 4XMXA 5HI5D 1XGUA 1SM3L 3G04B 1TSRA 1BXVA 3BN3B 5EZOH 1QNZH 1RZGB 3MJGX 2N01B 2BHZA 2CLZB 3SB3A 2VL5A 4Q58C 4RMRA 3NSXA 3BXNA 4YHOH 4JFOA 3ATAA 3WEBA 2JI2A 3VFOB 2PW2B 3MCLH 1KT2B 1M6UA 1RMFH 2NQ3A 1CFTB 4UBDC 4TVPD 2WWKO 3CZFA 4J1UB 5TDOB 3U46A 2PNDA 2JJVA 2JKRM 2HVKB 5FYJD 3AREC 1RK7A 1VERA 5LVEA 1UWGH 1YEFL 1N5YL 4K3EL 3MOAL 1E6OL 3P02A 3LKQB 3V4UL 1JGUL 1VKXA 3CXHK 3N0PB 3M7OA 4Y1TA 1DJYA 1T04B 3ZRSA 4PGDB 1HYSC 2WXJA 5MENE 4AMXA 4UIMA 5A16B 5CINH 5I1LB 3NAAH 1A9BB 1X7QA 4WW2C 4CSPA 1TTGA 4QLRA 2O5NA 3M17B 1Q9WB 5DUBA 2P5WD 4NRZA 5E9DD 3RTLA 4ZG1A 3PWPE 1ZLUK 4BA0A 1M7IB 1ZCRA 4XP4L 2X4RB 2ID5A 2UUDH 2ICES 2AXFB 3SOTA 1P2CA 3HHSB 3EUUA 4ZD3L 4ZXBA 2XCMC 5FF6B 1T0NA 4XX1G 5FOBA 3GLEA 1WTLA 2Y5EA 2V3EA 4P3CH 2IDSA 3SBRA 4JM2C 1JZ3A 1LMIA 2GSIA 3LEVH 4G6AC 4IJTA 1HZHL 1NKGA 1IEBA 3AXLB 2C3XA 4P9HL 3LS4H 3S4SA 2PWHA 2Z64C 2NX5A 5B38G 5JQHC 4KRPD 2XA8L 1SMOA 2VITA 2Z31B 3FFCA 3MRJB 3P40A 4MFHA 4Z0XB 4BXVA 1Q9LA 3MRRA 4S1SH 4L3CB 1SYSA 3DOSB 4NC1C 4TRPL 3WYRA 5E99L 2HG5A 5TH2A 1AZRA 3CSTA 4NWTH 4P4KB 3KLLA 4ODTL 5BW7C 4U1NB 1GYVA 5JDJA 2UY7A 3T8VA 1NDGB 3CPUA 3U4BH 1T6BX 2P5ED 1TLMA 5DJ2B 5AZEH 3VYNA 4BFIB 1FZKB 4QHMB 3SCMD 1PJ9A 4HHWA 2GJZB 4FC3E 2PO6C 1FRGL 4FFYH 3RVXD 3PDOB 4JANA 3G5XA 5D7IA 4ACPA 4BE5A 1DDHB 3OR7A 5AFAA 3ESPA 5IFJA 1GJIA 1RZ8A 4UDTA 3TH2T 3TVMB 1LDPL 4DH2A 4F8NA 2NCEA 5JHDA 1AHWC 1RZIB 1A6PA 4ONFH 5D7JA 2GITA 3F7VA 2XWBA 4F7TB 4ZK8A 3KM2A 3IDXL 3IJ9A 5FO7A 4H8UA 1V3LA 3K8LA 4TQEL 2J1KA 4OJEH 3E6FA 4R83A 4JG1H 5D6DA 3MLZL 5IFAH 2EACA 1YYCA 1GW6A 4U6HA 1WRFA 3NZHL 2PABA 3MR9A 5D1QA 5A1AA 1GGIL 3B37A 3DMMA 4CW1A 1JNNH 4H8PA 4K7PL 4P2QD 1MPAL 2WXIA 4NZJA 4WUKL 3V4PA 4XPBL 3T5WA 3TO4D 2QT6A 1WT5A 1FZOA 3SYOA 4BSJA 3QCTL 4I77H 4NWUL 4IRJB 3OPZH 3QAZC 4PS7A 3VA2C 4HS3B 1H9VA 1WZAA 4MRCA 1R3HA 2WQAA 3SDAB 1ASQA 4GY4A 4ZAKC 4KVPA 2XT1B 4LLWB 5F1IA 1JVKA 3FAWA 5JA9A 1A3RH 3R8BB 1F90L 4A6YH 2FEEL 1OGAB 4HDIB 2WVVB 4LT7A 4H7VA 2AJSL 2X4SA 2RB8A 4AUYA 3QQNA 3RGVD 4KUCD 1XGTA 4FFZL 1GTNA 2YD1A 4GKOA 1IT9H 2C9SA 3BN9C 3LNGA 4QY8B 5AUMA 4Z7UB 4XBMA 2EYTB 1XGZA 4FTVA 1IAIM 4NQDD 1DLFH 2YKKA 2VDOH 4TOYH 1I8KB 1XQ4A 2JIXA 1ZPUA 2ZXCA 3H4FA 4KU1A 2EABA 4OT1L 1P9MC 1J0IA 5D1ZA 1OGSA 3S34H 5ACLA 2HH0L 2JQAA 5FGCB 3T0DA 1HHGA 1F0LA 2A6JA 1YQVH 2HMIC 3NA9L 1QHPA 4Z3GA 1A6UH 3H2PA 4JGJA 1GY2A 3II2A 1SY6H 4PRIA 3VWKB 3L9RB 5HPOA 3NGBB 1T5WA 2CBQA 5DJAB 3OL2A 1MQKL 2YLKA 3T3PB 3KYMA 2JJWA 4U1GC 5DMGC 4LLYA 4GFTB 1UKTA 3O6LH 4JFVA 2O6FA 2VDNH 5A2FA 3GKZA 3BQUB 2IQ9H 3WV0A 1QBBA 3QR1A 4PJDF 4EQ2A 3K8MA 1EXUB 1XV8A 2X2IA 3I9PA 4NENB 5DQJA 4PU2A 5KS9E 3LZRA 2AQ1A 1HWGB 4TLSA 5FYKH 4JDVB 4QT5B 3DARA 4JM4L 5KYXA 2YRLA 5PCYA 3QI9A 3T1FA 3HI1B 2HKFH 3ZXAC 3O8XA 4Z7VB 4GAJH 4LVEA 3TN0A 2F74A 2ZT9C 2MQ0A 4KI1A 3CSYA 2YXFA 4KJYA 2VLJD 5HPMB 2QJDA 1LGVA 5E08L 1MF2H 1NIDA 2B1HH 4FAAB 1AZCA 4LPYA 4KUZH 2AKRA 3QUKA 3ZSSA 2R56L 3V0AC 3CN4A 2Q87A 4NB7A 4YL4A 1U3HB 5D1XD 5JIMA 4DGIL 3WFHA 5FECA 3RZCA 5C6TL 4NPJA 4N2LA 2NY4C 1CF8L 2A83A 4CU7A 4ZFOL 3JUZA 3Q01A 4NAQA 2OR9H 1FSKB 1DVTA 3ECBB 2Z7UA 3BD3A 2ED7A 3T04D 3DXAB 3LQAH 2BS71 4PTTB 4UIKH 5HI3D 1WE5A 2WWMD 3EXJA 1UUSA 1QBLL 1SFHA 2VJ8A 1A7OL 3GLDA 3GRWA 3U7WL 2K45A 5IESL 3NT0A 3DNKA 2IWKA 3B8YA 4LSQH 3IDJA 4YGVA 1J1OL 2FH6A 1Z7JA 1X3DA 4F57L 3HFFA 5FM5O 3KPPB 3BLBA 3CU7A 4MMXC 4BRJA 4BKLB 4GG6F 2VN4A 4A2HA 1FC1A 4BUHA 1KXHA 4WZ9A 4XPTL 3V6OE 2BO0A 1MW3A 1NGPH 4JG9A 4F92B 1AQ8A 5IEKB 3H9HA 3KNBA 5GS1C 2D0HA 3LRKA 1TF4A 5AW7B 2Y3AA 5HHNB 4HKJA 5J12B 1B90A 1CVRA 4F7KA 4QXWA 4RAVB 1JYNA 4G82A 1DHKA 1R3IL 2VXSH 4F2FA 5B39G 5IHLB 1L5GB 1ADWA 5AZ2H 4KDWA 4A7VA 1XCQA 3MX0B 1N10A 1UYWL 3R4RA 1VDGA 3WE6A 4NZRH 4K7FB 4PV9B 3CXFA 1UH4A 1KGCD 2B4CH 3WOVA 4ZS6D 2FQFA 2HFEB 7PCYA 2XPZA 5F9OH 4DKFH 2WPGA 5ANHA 2FH8A 2YD9A 3X11A 4JQXC 4YHYB 2AJYL 5L2KE 4B0MB 3PXHA 3LX9A 1Y1DA 1Z5YD 4RGOH 5DLMH 4QRRA 5DEFA 4XRCA 2A73A 5DI8B 5T5NF 3WFCL 3D12B 3NJFA 2V17L 5FGRA 2DL2A 5K9OA 4HXAL 3GTNA 4GIOA 5HHOB 1OGTB 5KJ4A 4N20A 1HQRA 4X6BA 3D69B 3NEEA 2UV3A 3PJSA 1J12A 5JZ7D 2AI0L 2JELH 2XZZA 3E3QC 4BZ1H 1AAJA 1S9VB 4WWKC 4RZKA 4JNXA 3HB3C 3TO2B 1GRWA 4P46C 1DQQB 3MN8A 3S36X 1INDL 2VUOA 2CUAA 3W57A 4B9IA 4EI0A 4FZ8H 2WQVA 1CR9H 2X44D 2P46B 4IKJA 2WZ6A 2WXQA 5CGYC 4PJXE 2ROXA 5BVPL 1G94A 4BUGA 4OIBA 1EAPA 3FN0L 2CIKB 3GSXB 3UO8B 5BUPA 1JZ4A 1E3FA 3AY2A 4OJFH 4JRWA 5FYKD 4ORGB 4MQSB 1KJ2B 2FJHA 2E6JA 3PWUA 1T1ZB 5KWYC 1JNHA 2XXGA 4TUJB 5B22A 1KB9J 2ESVA 3AJ7A 1TU2B 1UT1A 1RJZB 1UM5L 1A9VA 4NJ9H 4Q8BA 2K0RA 3LHPH 2WQSA 1D9KB 1PY0A 1WHOA 4AIXA 4NKMB 4BZ2A 2C1PB 3OXSA 2RFXB 3TA4D 1T21A 2BP3A 2CO7A 3HC0A 4AKOA 1QTPA 2E27H 1E5CA 2P47B 5B1KA 2AXHA 1JGIA 2ZWZA 1L0XA 4PBWD 3BGFB 3CVBA 3MREA 4LARH 2GI0A 1ZIBA 2ZKMX 3D39A 2I07B 3BAWA 4JO4L 2FECL 4O4YL 1U8MB 5JIQA 3QNFA 3WNMA 3REWA 3V9FA 1UGKA 4JZOA 3LAFA 5LO7A 4OZIB 1FN4A 2D03H 4S0HA 3V4VB 3C09C 4UUJB 4JJHA 2OM5A 2BP8A 3OJ2C 3PP4L 1U33A 1NPUA 4WVRA 3RX8A 3DX9B 4OQTH 3BDYL 3SGJC 4JFFD 1T7XA 2PYEE 4G5ZH 4PP1C 3TH4T 3T3MF 5B39A 4I1NB 3VA6A 1KV3A 4LMQI 3PHOB 1QRNB 1OAQH 3L6FB 3E80A 3T8XB 2Q0ZX 3P3RA 3BPCB 4GEIA 3T0ED 2ATPA 4LLMB 3H0TA 3UJJL 5CSZA 5DJ0B 5D2NC 2V5RA 4JUTA 5J1AB 2G60H 1KJVB 4JB9H 5EU3A 3OGOE 4K5MA 1U8KB 3MXVL 4X6CA 4ZO9A 1FL6A 3FDWA 4P23A 1G1CA 2WXMA 4JGUA 2D7TH 1AHKA 3FTGB 4U1MB 5I1GL 3DURA 3C60B 2FK9A 4YR6A 1RJYB 3NSFA 5E6UB 4YWGL 2BLFA 3I6LD 3WD5L 3DSFH 1P7QB 3M1CA 5DC2A 4L4JA 5LAPA 2ICCA 1Q9KB 3L5XL 4Y8DC 4F3FB 2GTWA 1QPPA 1XMEB 4ZPTB 5I6KA 4XBGA 5BRZB 5SX5H 1PQZB 4HFUL 4YDIL 1MCPL 3MZGB 5IMLB 2UZXA 1BJ1H 4GW5A 1NCAH 4EI5A 3MLSL 4KX8A 4PS3A 5KEZA 3EG9A 3VCLB 5F21B 2E46A 3K74B 1CDJA 1P4LA 1A1OB 2XUWA 2Y7OA 1D7CA 1U8CB 2LR4A 3ALWA 3WDHA 4HJ0D 4R7VA 2HX7A 2CRMA 4MA7H 1TTUA 3CX5J 4HIPA 5DR5H 4HJIA 1KG0A 4GMTL 1O5PA 1J8SA 3BSZL 1DN0B 1KY6A 2FIKB 3IMSA 1MWAH 1X5IA 1A3LH 1RL1A 1BAFH 4XBPA 3ZE2F 4G2AA 4ZX5A 4J23A 2D2OA 4U33A 4XPGH 1PX3A 1GH7A 1U8OB 1QLEH 5IJKC 3TXAA 3QWOA 2Z31D 1RLBA 1HFUA 4FQIL 4JO1H 5AAWA 5FO8A 2XBDA 1RP9A 3ML8A 5HTSA 5AW9B 5FHAL 3GMPA 4PV8B 1K8DA 4CC1A 2WUCH 3EJZC 2WGXA 3EYUH 4NFDA 3HG1B 3OGCB 1ZLDA 1DN2A 2BVQB 4P4KD 1TYJA 4PJCF 3UC0H 1TKWB 5B1JA 2EDEA 2WBJC 4FXLA 1DQDL 4HKZA 4UYQA 3BHBA 3V0WH 4ELMB 1BLNA 4JJOA 4D3CL 5BV7L 2ADGA 3KYOA 4CMHC 1Z5HA 1DFXA 4UOZA 1K4CA 1U8JA 5KVDE 1JWUA 3CFBA 4JVUA 3TCLB 5GZNC 1IO4C 2Q8AH 4IQHA 2NY6D 3OJDB 3BIBX 2AJXL 5BS0A 2E59A 3TVMD 5LXGH 1FYTD 5DDHA 1EBPA 2XVGA 4YC2B 3JWNC 4YNYB 1MELA 1NSNL 4Y5XC 4UV7L 4A2GA 1RZJC 1U8NB 4R96B 5GS2H 4O02A 3MUJA 2WBKA 2EXTA 4UQ9A 5D96C 1OEZW 4HMEA 4R3SB 4YBHA 2I5YH 4LDCA 3UZEC 2YSSA 4V2CB 1OANA 3KMDA 4YE4L 1PEWA 3KPSB 3P1VA 1YMHA 2B16A 3SE9H 3QWNA 1BQ5A 5C9JB 4Z7NB 1FNSH 1BAWA 3P0VH 5KANG 5J1SC 5C0DA 3MLUH 4GQQA 2ZWSA 4HZ1A 2VR4A 3RTQC 1OV8A 2BNQA 3EO0B 4AWJC 2E6QA 4ISVB 1BYOA 4APQA 2F8XC 2IBBA 3P4NB 4F33A 3UAJA 2DJUA 1OCOB 2YK1L 5JHMA 3ENEA 3QARA 2IF7A 2L0DA 2FD6H 3F6LA 1AOHA 3J7HA 4IRJD 4OAWA 5EZJB 4LOEA 4P5TD 2EEDA 2IH3B 3CFMA 3FB5A 3SBPA 4EI6A 3MUUA 1GZPB 2QTVA 5I1CH 3U48A 2EIZA 2VLKA 2FYYA 3CTTA 2CXKA 4GRWF 1U91A 1CGVA 2RHEA 4LIQH 3GSNH 2VLME 4WUUA 2DMCA 1KJMB 5HHPA 5ITFA 1JHTA 1CICD 1J10A 5EPMA 5IUCA 2VXQA 4IIQB 1ZE3H 2OMXB 4EZMA 4WFGD 1UTDA 2NXYC 1S7UB 2BSRA 2A6KA 2N3JA 2ZUQC 3PGFH 1E9QA 4MA1B 3DJZA 1QHOA 4JDEA 2IPTH 4ETYA 1JHKH 4F7CA 2BHFA 4M5YL 1CL7L 1DFBH 2AK1H 2MOGA 3FU7A 4LOUD 2JJUA 2XKUA 5IW1B 5BW7A 2FZ3B 4GKSB 1OSZA 3BCFA 4V33A 3TX4A 4C4KT 5DD1L 4FYSA 1MAMH 2N1TE 1Q0YH 3TJEH 4E9LA 1OGPA 3PWPB 3TIEB 2BOCA 1ROWA 1S7WB 1T3FB 4PLJD 3FQWB 3TM6A 3WUWB 1NCWH 2PO6A 1UCBL 3PHAA 4J6IA 1I1RA 5JUEL 1ZS8A 3VFNB 3E38A 3LD8B 2GY7B 3VWKD 3CVHH 3F2LA 3CLWA 3ECQA 3VI4E 5HGAA 4PJ8A 1DBJL 4F8QA 1TQCC 3L3IA 4WJ5A 3VXPA 2F5BL 2XPGA 4Q89A 1KCRH 2M8XA 3ARFB 2Y36H 4P3DB 4AMKL 1WG3A 3V0EA 5EOQH 1XGQB 3A24A 3UIZA 3ZQ9A 2EYSA 5C0JB 4J3OF 3ZHLA 1NL0H 3QUXC 4QXGH 4XVJH 3MNWB 4M7KH 2I25N 2EIKB 1EFXD 4BD4A 1L0YA 4UTAH 3PFUA 1G9ML 4QOKD 2ITFA 32C2B 2KZBA 1QSZA 4XGZB 5E00B 3VM5A 3UGUA 5I1KL 3GHBL 4WI8A 2ZKHL 3O2DL 5T1LB 3KGUA 2JKSA 3PHQA 4OI9A 2C9XA 5I1EH 5J11B 4Q9RL 3LZQA 1U8HB 2OR8A 3D4YA 2R69L 4UBDD 2EDKA 5L4IA 3DBXB 4F91B 1BX2B 4E9SA 1JYVA 4XR8C 1CXKA 4HU2A 4LDOB 2C26A 3MRBB 5F3BA 1MJ8H 3ARED 3KPLA 1NFIA 2Q76A 4OGYL 2EDBA 5GGRA 5GS2D 5GRVL 3SDCC 4WEBH 2VDMB 3MLXH 4NP9A 3B83A 3HN8A 1FNGA 1EJOL 3BZ4A 4NZDA 2KHAA 1CG9A 1QTYT 4NBYB 4H26B 1NUGA 1LWRA 4JMNA 5DVOA 3CH1A 4JQIH 5G4MA 1HYSD 1GS6X 1XEDA 2L4OA 1WBXA 1RIVL 1ASPA 4GRLA 5FA4A 5D70L 1QHQA 1U92A 4JFDA 5IMKB 1DEEB 4NOBA 5DHEA 2NXZC 4IOSA 4Y4KB 3TESA 3NFSL 1NFDF 1XF5B 4F5CE 1INQB 2WLNA 3IE4A 3LKPB 3OQ3B 3TIDB 3WJLC 2Y25A 4GB9A 4AKQA 5ICZB 5L8KB 2MOQA 3TBYB 3EW3B 1NKRA 4XC1L 2PPEA 1GHFL 2VOTA 5DYOA 1HU8A 1E8ZA 3N04A 4JM2D 2DQTL 4K5OA 3ZHKA 3P2TA 1ZGLA 1SXBA 3DHJA 4JRXE 2XA3A 2ATKA 2WNKA 3ILPA 3RVWD 3F7KA 4ZQTA 1H8OA 4N8PA 3IAPA 2G3MA 5FO9B 2CCVA 4QHLB 4IMLB 1S7QA 1JF5A 5E6RB 3UTSA 3LEYH 5CZVH 1HZLA 1WWWX 1Y6MR 2A9NH 2W0KA 4O2CB 3GZPA 4S10A 4PJDE 5EORL 4GBXA 1I7TA 3S98A 4NDMB 4Y5VC 3K6SB 2BC4A 3X3FL 5I6LA 2Y06H 4JUSA 4PBDA 5K9KA 2IANB 2VDPB 2ZUXA 3BVXA 4AQAA 2ALAA 4X6DE 2AQTA 4PVMA 5KVGE 1AGBB 3FU3A 3U79A 1XR9A 1B9KA 4Z7QF 1IRAY 1BEYH 3IJ8A 3BUIA 4RFEB 3UTPD 2LGNA 3U9WA 2ZOKB 1OHZA 4XWGL 4NKIH 4KHXL 3VFVB 4NUPA 1P4BH 4FCHA 3TEYA 3W9DA 1M1XB 4QXTB 2H8PA 3SHSA 1P7KA 1M53A 3AFLA 2VXTH 1TTFA 5C0CA 2H3NA 1KXQE 4GXVH 4OM0L 1LO0L 5CUSH 4G8GE 5KS9B 4X9BA 4L4TD 1HZKA 3FQRB 4JKNA 5FUOL 2VM9A 4YUEL 3RY4A 1S7SA 2WLIA 5DFAA 5KN5B 1TQTA 1N64H 1NDTA 2WXHA 1U8PB 2E9WA 2VLRD 3PABA 4HIHB 3REVA 5T3ZL 1UFGA 2OI9B 4C55A 3QEUB 2DQUL 3MQIA 3NIFF 2GIXA 3I2CH 2NY1B 4K9JA 4GG6E 2KYIA 4IRSC 3L1FA 4LHQB 3PP3H 4UU9B 1UD5A 4ZAKD 4I3SH 3DIFA 1KIUB 3K4DA 1WCQA 3LPGA 1MG2C 5DMKA 5F72S 1CFQA 3CIQA 2WZPA 1M42A 3B2VH 3KWTA 4CJ1A 4K3JL 2YPVH 4MAYB 2DWEB 4Y4HB 2BSTB 2FCBA 5IY5B 3KLSA 5JOEA 4W1TA 4OQ1A 1Q72H 2WWOA 5A7BA 1IEHA 1L6ZA 3LIZL 2EE0A 1N2RB 3VU2A 3WO4C 1ZA6A 3WXWL 3LQZB 5EOCJ 1OHQA 5GRVK 4S2SA 1UADC 3ZBMA 4AK2A 1VCAA 3ZN6A 2IADB 3QXTA 1FIGH 3BWZA 1ETZA 3GNMH 5LCVL 1Z9OA 1KLUA 4FHKA 5SWSA 2HMID 3V0FA 1DBML 3WELA 1RUKL 2ADFH 1KACB 3QUZC 4LFHD 1YNLH 3JT0A 5ANMA 4JPIB 3OF6D 5E2UH 5INDA 1KLFB 1RUAH 2XG4B 3OWRA 5EBMB 4ICWA 4U2ZA 3KG5A 4XE0A 1GZQB 4LEOB 4RBPK 1IE4A 1T2QH 2BY2A 4NZ8A 3W39B 4JDTL 4DGYL 1H6EA 1ZEAL 1UENA 1J8HD 3D0LA 4PCKA 1C7SA 4WI9A 1Y18B 4Y4FB 2CIIA 3VG0L 3WU1A 4TF4A 4W9EC 2LLGA 2EDWA 3DX3A 4MMZB 1GYAA 4MNHA 5IQOA 1N18A 1U93A 2LTQB 2W0FA 4WHYG 2X1QA 1UA3A 2Z0UA 4WTXA 5EZOL 1NGYB 1CLVA 3U2SA 2XV2A 1I7RA 4QTHA 1G9HA 3KGTA 4NNPL 3RFZA 2R39A 3E7JA 1IV8A 5IUSA 4HPHA 5E4IA 1BOGA 4YHOL 2Z92A 3IEAA 3S5ZA 5BQDA 2BSSA 3EFOB 2QGEA 1IU1A 2X6AA 5F1NA 3MCLL 4BK5A 1RMFL 5FW7A 3QQ4A 3QXWA 2QKIC 4ODVH 3UMTA 4M1GH 3WKMH 5ID1A 1NCOA 2YA2A 5FW6A 3MRPB 2ZXEB 1UWGL 4P06A 2J4WH 4ZNEE 4KV5F 1T20A 4ZQKA 2VDQB 2CKBB 2CJ3A 3B3IA 1NFAA 2X4PA 5KSUA 4BFJA 4GS7B 3F5WA 4LCWD 5CINL 3GTVA 3NAAL 3TZVB 2Z91B 3WO3B 1K9TA 1U95A 2IBZY 1MHHB 1U0QA 2FAUA 5JPNB 3QCVH 2EIBA 3UYPB 1KBKA 2CNYA 2MH4A 2RD0A 4JCWA 2FATH 5KSBA 3ASWA 4KK9C 3D2UB 4Q9CA 5AVVB 3IETA 3RUGA 1AMXA 4DGUA 1I9IH 4IBSA 1AANA 3ARQA 3T3ME 4Z76B 1G5GA 4P3CL 4XNBA 5AW6B 2H3KA 3DK2A 5DUMH 4MJ6B 4BEIA 3GTTA 4B0MM 3O4LD 1VLXA 4G8FB 3LEVL 1BIIA 2XWXA 3NCYP 5TPWH 3S36H 2ZCZA 2FJFA 3LS4L 4N2KA 3HG1D 1IAOA 3FCBA 3EOAB 5HP5A 3PIQB 1ULVA 1CDYA 5DFTA 2AHIA 1DUZA 3MRKB 4S1SL 3ME0A 4UQAA 2CPCA 4WI5A 1HH9A 4X7EC 5DHVA 3OAZH 4D8PB 5AVXB 1NOAA 3E8VA 1RUMH 2GC4C 2W81C 3QH3A 4NWTL 3CU1A 1CLYH 5BZDA 4N1EA 1ORSA 2MQGA 2X2YA 1TJGH 3I02A 1HNFA 2H2PC 1JJUA 5K39B 3U4BL 4YHPA 4BWUA 5AZEL 5I28A 5LNDA 5F7YC 2GAZB 3BAKA 4E0RB 3H6AA 3S35X 1QOKA 2IAMA 2N56A 4QRAA 4YFLI 4MQXC 2PYEB 5GIRB 2HRLA 2VDMH 4U1KB 4N2CA 4KO9A 4QO1B 5KJ7E 5DLLA 3TA3C 4ZUWB 4J3UA 3D30A 5IK3A 4HJEA 4ONFL 3G08A 2X42A 4G42B 4WWKD 3L7EB 3HB3D 5DHYA 3SO3B 5G5DB 2GJPA 5TE4H 4P46D 4HG4J 1A22B 2FWLB 5CU9A 2CO2A 4LB8A 3N40F 5KUKA 1SF3A 1DR9A 3MRCB 5J1TC 2X89D 2IGFL 1S5HA 4AYID 1NOLA 5CGYD 3C5JB 4GYBA 5IFAL 2FL5A 3QDJB 1E8XA 2WK2A 1EJ8A 4NAMA 4GIPD 3UG3A 5K9JH 2XQ0A 1JNNL 4PGCB 1DE4A 3JBG7 1H3WM 1OAYH 2EC9U 3IJSA 2YPLA 3P9LA 5C86A 4BQ8A 4D9QE 1Q9OA 3U0WH 2CWRA 3WLBB 4I77L 1A6ZA 4ORZC 1HWHB 1JPGA 4JHAH 3ZE2E 1D5XB 3OPZL 1W72H 3EJSA 5I6XC 2QQKH 4D0DA 3GSRB 4YO0B 4AVHA 3TONA 3TYGH 1CTNA 1DSFH 2E7CA 4QF1B 4Q4IA 5JW3H 2BIQA 3HBQA 4R26L 2XFXA 2BCMA 1UHVA 4K23H 3GMOA 5HJGA 1A3RL 4BK8A 5C7XH 4A6YL 2XKNA 4YSSA 2X1PA 3ZLQC 2BH0A 1NAMB 4PJCE 5AWNH 1T22B 1TDQA 2F15A 2Q5BA 2IPKA 5ICXA 1NGZB 5M94B 2NUPB 1AJ7H 2ZAHA 1I4FA 3AT9A 1PIGA 3EO1A 3CSPA 4WFED 5C0BD 3PS6A 1OP4A 2UWEB 3BWUC 1X4XA 4L4VD 2DLFH 1RSYA 1MLBA 1DLFL 2WUBH 4PCYA 2VDOL 3QZNA 1WSST 3ETTA 4FG4A 4NFCA 4LCCC 4TOYL 5DA0B 4ZOCA 5ENWA 4AENA 5C09E 4Z3JA 2ITDB 4WSKA 3JWNH 5DJXB 3S34L 1MJJA 1ECZA 5I6NA 5DEGB 3PAYA 3DX7B 5GZOA 1YQVL 2NSMA 2P42B 4KOCA 1A6UL 1N68A 1J5CA 3P11H 1SY6L 4KK8C 5AOKA 4FEIA 3ABGA 2NY3B 4UMSA 1QR1A 3EAKA 3TBWB 5FFOA 4WWOA 4MS8C 5I71B 3HLKA 2UUDK 2KDGA 4Z7AA 5ACMA 4Y0GA 3ETSA 3O6LL 3EJQA 1PZDA 1A3ZA 3A23A 4HK3N 1QSFA 2VDNL 4L8BB 3HE7C 5EV7A 3FBKA 3RTQA 2IQ9L 3ZHNA 1LK2A 5H35A 1VSCA 2OXHA 2W9LA 3GI9H 2JKWA 4F8PA 3V8OA 3ZTCC 4ZTPH 5EEUA 1E4XI 2R7EB 1QFPA 1SQ2N 3D85A 3CDFA 5FYKL 4HHGA 5CEZE 4WSJA 3BP7A 4EDWH 1FGVH 1HEJC 1P7BA 5GGQH 2HKFL 4GRWE 1L4IA 4QTIH 1HXMB 5FC9A 2X4OB 4GAJL 1MHCB 3ZT6A 3DX4A 4JPVH 1NCNA 3S5LA 1TETH 3L3HA 2CGRH 1BPVA 4HVBA 2EEAA 1C08B 4C54A 1RK0B 3U1PA 1KTCA 2LQRA 1MF2L 3L45A 3NCWA 4KUZL 1PZ5A 4PEEA 3APMA 1L0PA 2R2HA 5DWUH 2B3RA 1TVHA 4RMUA 1PW3A 1WLHA 2VH5H 3D4ZA 3L5JA 4PRNA 5TTRA 1DQJB 2IOIA 2OP4H 2HT3D 2OR9L 2IXQA 4M62H 3T09A 2NDFA 1BFOB 3DO7A 3K0WA 1R3JA 4BBWA 2C5DC 4UIKL 2PWGA 4HIEB 1DJGA 3IFPB 3D3VD 2A3TA 1WV7T 4H1LH 2G30A 2X5PA 4RVBA 2BW5A 1S9YA 3FTZA 3IBEA 4GSUA 4P57B 1N12A 3N1MC 4XWOC 2V9RA 5CLWA 3CZNA 3MRIB 1KNOB 4PLNC 4TUOA 3HAEB 2J6WA 3EGSB 4QKTA 4POZC 3UTOA 5CBEB 4AGPA 3ARDB 4YAQB 2KI6A 1G6RA 3RQ3A 3W11D 1NGPL 1UJ3C 4ATWA 5HJBA 4RMVA 3CFKA 3EJZD 2AV7B 5CP7A 4IHOA 3WUZA 4E9TA 1E9PB 1CDUA 3QWQB 5H94A 4GW1A 4FZEH 5JHAA 3LNHA 3X13B 3IXAA 3BAIA 3QZWA 4KXZI 3HPJA 1O6TA 3T77A 2VXSL 1EHNA 5E9DA 3UAFA 4AEIH 2NPLX 3FCGA 5AZ2L 2E0PA 4NN6B 1B0GA 4KFMA 1U8IA 2BFVH 1JXDA 1T83A 1TSHA 1VB9A 2H0JA 2IAND 3P3TA 3TTSA 3EOYG 4F8OA 3MUGB 4NZRL 2AXWA 5EG6C 3NG5A 1KLGA 5CNHA 5IVXF 4YSCA 3LRLA 5ECGA 3FTSA 2XV6B 5I73B 1KB5B 2WCSA 3CWGA 5B4MD 4Z95H 1B2WH 5F9OL 4DKFL 2Y4SA 2NLJB 3WXVH 4RNRB 1HXYA 2JKIS 1L9MA 4FMFA 2WNGA 3V2AR 4RGOL 1JGEB 4MJ5A 5CGTA 2OSWA 1R5IB 4X83A 2FWUA 2WTRB 4AV0A 3G6JA 5KVFH 3PUCA 5IBUG 4BH8A 5EUOF 2O26U 3SDDC 2W0PA 4U0RB 4YDMA 2JELL 4GAYA 3ZSTA 5E6IC 4BZ1L 5H4YA 5J8OA 1UACH 2CHWA 2X6UA 1CO1A 4HV8A 3LNFA 3BP5B 2X6MA 4YSQA 4PH8A 2P5EA 4FZ8L 1CR9L 3SCMA 1NFDE 1U3ZA 1TJMA 4DFHA 1VFBA 4JFQA 1KSRA 4PSRA 3VX1A 4PGBA 1CN4A 1DL7H 2NY0C 1JV2A 3BMWA 3FFDB 1SHXA 1OT4A 3E2HC 4OJFL 3MV7B 4JFEB 4XOBA 2AJUH 3NABH 2OS7A 3IVKA 5I1IH 2JLLA 3WAKA 3FSOA 3H9SA 4XX1E 2GEEA 4CC0A 5A43C 4FTVE 2ARJA 4NJ9L 4ZMLA 2QVFB 3LHPL 1PAMA 1T89C 4NCDA 4PRDA 5GGSY 2HTLD 4G9FE 1ET8A 4IGBC 4QRUA 1BQSA 2ERJC 5IQLA 4DERA 1CD8A 2FT7A 2AERT 3C5ZD 3RL2A 1F1AA 4N0FA 4NO3B 2X3CA 4RA0C 4W9IC 4F8LA 4HEMA 4U1JB 4U1SB 3RZWA 4Q6IC 4PRIE 4LARL 3DJTA 5FGBC 4ODWB 1UB5A 3MBXH 3HE6C 5FDYA 3TPKA 3AZUA 3UOAB 1A6AB 4RQQB 2YXMA 4UMGA 4MHHG 4Z7QE 1RQ5A 2AAVA 1ZT1B 1BBJA 2D03L 3DPBB 4NO5B 1HN1A 5C0FA 4RMQA 5EIIG 1RZPA 2Q9OA 2Z4TA 1L7IH 3EGXA 3UDWA 2ZYRA 1JZGA 4HUVB 2D8KA 2OMWB 2VERA 3ELAT 3KW7A 3A4FA 3C8KB 3MV8E 4G70B 4N9GB 3TP4A 5I1HH 1YHPA 2DMKA 4OQTL 5T1KB 2A9DA 4P5KB 4J8RA 1CI5A 3S7GA 4FG2A 1H15A 5F1OB 1HH6A 3NCFB 4G5ZL 4OZGF 1GGTA 3RGVA 4ZMWA 5IR1A 3UBXB 2Y7LA 3BH8B 1FNEA 3TBCA 4B9YA 1VADB 1N6UA 1TLKA 1X5LA 4MX7A 5F9JB 4FA6A 1OAQL 4PJDB 5L2JB 1YUKB 3DGGB 1G7PA 4P2RA 5D7LE 4PJ5A 4QCIB 3WMQA 4K0OA 4FOMA 4YDLC 1VACA 3RGHA 4JN2B 4G1MB 3ISRA 1ITBB 3RNKB 2WWNA 1RHHB 2PCYA 1XF3A 1UZ8B 2G60L 2NY2B 3EYFA 4JL2A 4LLQA 4GXUN 4JB9L 1TMQA 3QIBA 3L4ZA 1KBWA 4CKVX 3PJLA 3QJFB 1GJWA 3MV9E 3QDMD 4ZSOA 3ZZSA 3NIFE 1R3LA 3JVGC 4DK6A 4CC4A 1O7DE 2EDFA 2D7TL 1JGLH 2N0MA 3ERXA 4G8EA 1ERNA 1H3UA 1YNKH 2GQHA 2WY3B 4UQEA 4XODA 5BJTB 1P6AB 1AI1H 4MZIA 2Y7NA 3DSFL 1BOYA 3GXPA 1PY4A 3A0OA 4U1IA 3BPNB 3RU8H 4PGZA 3SDCD 3MRHB 2O72A 1LEGB 1I8IA 3UEQA 3CG8A 3MLTA 5CN3A 3UO1H 4PJ9C 2OXGA 2NW2B 1OAKH 2E8ZA 2C3GA 1HQ4A 2EC9T 4H8WC 2IH1B 5JTWA 3K2KA 4PVBA 4YEFA 4PJ7F 4C83B 4N0CC 1HSBA 1NCAL 3ZGHA 4N8CH 2YBRA 4EUPH 3FPXA 5EOTA 3BAEH 1BPLB 2NXZD 3TZVD 4ANUA 4I9WD 3HZYB 1PZBA 1D5RA 1HSAA 3QC6X 4RMSA 3VXTA 2JTYA 3E6HA 4RSYA 3VDAA 2OMNA 3CBKB 4FFYA 4XN2A 2EVGA 3OMAB 3KPMA 3CFIC 2AF2A 1A2YB 3P4LA 1R24B 2XNAB 3V0JA 3GHEH 2MRYA 3TEUA 5DR5L 3P3YA 4JHWH 4GG6B 1A4AA 5IB3A 5D1XA 3E1ZA 12E8H 3Q3GA 1BJ8A 1MWAL 3OAYH 1XGPA 2Z8RA 1A3LL 5BQ7A 1JPFB 1BAFL 4DK3A 5JPMC 3OD3A 4ZZFA 4IBTA 5K33A 4FFWC 4XPGL 3JUYA 4XP5H 3VE0A 1FG2B 4WCYH 1KC5H 3BRGC 4PRHB 1QLEL 3F58H 3M07A 4JO1L 1RD6A 1OW0C 4HGMA 3BW9B 4HS6B 1CF1A 4AC4A 2VQ4A 4TPRH 2DBLL 3LKSA 2GUOB 4U6XB 5MEOA 1LL1A 3EYUL 5K5YA 4I0PB 4Z18A 3HA0A 3N1FC 4WKZA 2WLZA 1KBPA 4DN3H 1MFVA 3QIUC 5EIIA 3DDGA 1AHMA 4L37A 2R0ZH 2VZ3A 3APDA 5F88B 2OCCB 3V0WL 2RALA 5IHHA 4FNRA 4YIQB 3CX5K 1D9KC 3F8UB 4WEMB 4LEEA 1A66A 3WL9B 5T1MA 2Q8AL 3VH8A 5LXGL 4DQOH 4YX2H 3WTWA 1J5IA 5GSRA 1ANUA 2XN2A 3DGCR 1G4MA 2N7BA 2EUWA 1UEMA 3OPUA 3C2AH 4AIOA 5KVEH 4KV5E 3K6OA 4Q7DA 5CXPA 4JFUA 2I5YL 1HAUA 2ESVE 3QIWB 4PPTA 3RWFA 1DUYA 1C5DB 1SDAB 4OFPA 4OLWH 4U3SA 2FJGA 1Z2KA 1BSIA 3QDJD 3SE9L 5IKCB 3QHTC 1FNSL 3E9UA 3L48A 3JSSA 3P0VL 1KOAA 3QFJB 2H32A 3ZHDA 5E70A 5GJSH 4PJBB 1D5BA 3MLUL 2WKOF 1PLBA 4LESA 3DHUA 5F9WC 2GIMA 3C6LA 4AQ1B 1N9PA 1YO4A 4M3KB 4PD4K 5EF3A 3BUYA 3S6CA 4ONHB 4E68A 5C08A 4DPBX 4L1DA 2VC2H 4KH2A 4ZPVB 1E28A 4X42A 4N8VB 1EEUA 2FD6L 4UTBA 4DZ8B 5IP4A 4NJAH 3HAEH 3D39E 3QR2A 4IRSD 3FTXA 5I1CL 4RZCA 1E4KA 4BFNA 4EN3C 2BW4A 4IS6A 3ARWA 2V9UA 1S8DA 2J6EH 3G5VA 3MROB 4G8AC 4LIQL 4YSPA 5C0AA 3CVDA 4CKQA 3GSNL 5FW8A 3SPJA 5JMOC 1QFOA 2F1EA 3GJEA 2I9LA 3H6JA 4OD2A 3FO9A 2JK5A 3DO4A 4QRFA 4PTUA 1MY7A 2X4NA 3RPKA 3DYMA 3QUHA 4LKXB 5T3XH 2OMUA 3PGFL 2WAHA 4NQSB 3RUGF 3QE5A 2IPTL 2ZSWA 3C60C 3DX2A 1DFBL 2AK1L 2K8MA 1N4XL 3WGUB 2K3TA 2XQYK 5SX5K 4N22A 2RAMA 4AXWA 3QRBA 3S3SA 3GXIA 3TYFA 2W9EH 1MAML 1O75A 3TJEL 3I85A 2SODB 4G80B 3KPNB 4XXCA 2EXYC 3ROOA 5DO8A 1NCBL 4HKBB 3LN5B 4DP2X 2VZ1A 4FYRA 3DI2B 2EXSA 1H19A 1NCWL 2YWYA 3T3MB 2MCG1 2IBGA 3QXAB 4U2YA 4O9HH 3SQOH 1E27A 2WW8A 1BQLH 1SYVA 3HG4A 1LE5A 5CCJA 4NUJB 2JV6A 1QUNA 4GW4B 1KIRB 2NT1A 2YZ1A 3STZA 5FGSA 3CVHL 3KE0A 5H2BB 2QGBA 2HRPH 2VL4A 1LVEA 4URTB 2DH3A 3BUPA 2YGVA 1JRHI 2VAAB 1OLZA 5JIIA 4YHMH 3TNMB 2PTTA 3N43F 4EZLA 4IBYA 1KCRL 3IS1X 1N0XH 2Y36L 2WLJA 3B5GA 2R59A 3GB7A 4KKQA 5EOQL 4AE1A 5I19H 2X1XR 1NL0L 4JW3A 4LLUB 2BSDA 4QXGL 1EZVX 4XVJL 4M7KL 4UZGA 2MQCA 4LK4A 4NQEB 1F8TH 2KT6A 1BMZA 4ZUVB 1CFSA 1VGKA 4XNYH 4UTAL 5BOJA 2DQFA 4IBWA 2A0LC 5E8EA 1C1EH 3DVGA 3L3KA 5IMMB 1Z5LB 3IJ7A 4JS7A 4A67A 4JY5L 2BZ7A 2DMHA 2ENJA 4KTGA 5EDSA 4PWKA 2FNBA 3ESVF 3O41B 3O3EB 1Z3RA 4DP6X 3IKCA 3KLHD 5DZ9A 3U9UB 5CCKL 4YPJA 4QRPA 3F04A 3US1A 3G04A 1I8LC 3QJHB 3C12A 1YEKH 3JXAA 1FCGA 3TBVB 1MJ8L 4L05A 4WEBL 1RZGA 3MLXL 4S11A 3S96B 3I50H 2CLZA 5I2IB 3G7TA 4XBEH 4JQIL 1BV8A 2DOCA 1G9NC 4KPHH 3K4ZA 3WS3B 5IB4B 3FYIB 4Y1AE 2PW2A 3VFOA 5DD3H 1KT2A 1CFTA 4J1UA 2WLMA 5TDOA 4WTQA 1T7WA 3ZL4H 1SJXA 3UGXA 2JTDA 2HVKA 3S35H 3DJ9A 1OTTC 1CYGA 1OSEA 2G9HB 1TJXA 4HIJB 3T2LA 4KK9D 2WB7A 1YYMH 2R27A 3LKQA 5AENA 3N1PC 1LEKB 1T04A 4PGDA 4NM4H 5DQ9B 3UTZB 2R0WH 5A16A 4MD5B 5I1LA 1A9BA 4F24A 1HCVA 1YZZA 3T0AA 2CR6A 4PR5B 1L7TL 3M17A 3PG2A 4EO5A 5BS0E 1K3IA 1Q9WA 3BIKB 3LEYL 1NCTA 5CZVL 1HXKA 5JYMA 1OTUC 5T3XD 2A9NL 1M7IA 4N2FA 2X4RA 2AXFA 1OY3B 3BESR 3FNKA 3FYEB 3EFDH 3HHSA 5A40E 5FF6A 2YLHA 3PPSA 4L1TA 1TG8A 2EIMB 1QUPA 2F1BA 2Y06L 3FT0A 3TCTA 3NJMA 4LHUA 2Z7WA 1YEIH 5C09B 1U4EA 3TEZA 3PL6B 1F18A 3AXLA 2B7DT 3D9AH 5L8JB 3WN6A 1JFHA 5GRJH 4IIQC 3FTVA 1JZ8A 5AVUB 4LBAA 2Z31A 3HG2A 4HYTB 4MQXD 4AL8C 1BEYL 1JD9A 4FD0A 3MRJA 4Z0XA 1J11A 2BNQE 1WA1X 3AROA 5IQMA 3A5VA 4MA1C 3EYQC 4L3CA 3KM1A 1UT2A 3DOSA 4PCTA 4NKIL 2WKLA 4XP1L 1EPFA 1P4BL 1DANT 1SQMA 4P4KA 5DZNA 3MBEC 4U1NA 4D0BB 4P2OC 2G2NA 2VLKE 1NDGA 4UOW1 2VXTL 3L5IA 5ALCH 5DJ2A 4BFIA 4B9ZA 1FZKA 4IEFB 4QHMA 5DD5H 4WUUE 2F9BT 2GJZA 4EIGB 4GXVL 4ZDHB 2F53E 3PDOA 1BCIA 5CUSL 1DDHA 5EU4B 3RY5A 5IJVB 4FG6C 3TVMA 3LD8C 1AE6H 1HL8A 3ZX1A 4NO0D 1RZIA 4QJ4B 3MV7D 4F7PB 1HJBC 4JRYE 1UEYA 1XZ0B 3GXFA 1N64L 2JJSA 1WFUA 4GRWB 3UP6A 4F7TA 2H47C 4Z3FA 2J2ZB 4WQOA 3WKQA 2ZPKH 3D18B 2CJTA 1W8NA 4HJUA 4NKDB 3UH8A 3I2CL 3L4VA 3QS3A 4Y8AA 4OM1H 1KTKE 4I3SL 4JFZL 1C8QA 2BZCA 2VXVH 1NUNB 5TE7H 4IK6A 5LXVA 1OCRB 2Z4QB 2D0GA 3B2VL 3CZGA 1CZ8H 1X44A 1CURA 5D7SH 2APVA 2YPVL 1OCZB 4HAFA 3B9DA 3A6CH 4FQLH 1Q72L 1N5AB 4TNVK 3BEWB 2XZCH 3RFRA 1JFQH 1W6LA 4DWHA 4IRJA 3UXFA 5J11C 5DJZB 4WI3A 4HS3A 1QI4A 3ECUA 3NA4A 5IVXE 4Z0BH 3C9NB 4N25A 3SDAA 4OGXH 3VXNB 4DP5X 4DVBB 1AACA 4X98B 4L2YA 4G71B 4LLWA 1FIGL 4ZMZA 5HJ3B 3NFPB 4MZ3A 1MH5B 3GNML 1EDYA 1OGAA 4HCFA 3KLDA 3FULA 2WVVA 4HDIA 3TBSB 1E4WH 3DHMA 2N0KA 3DTUB 1EEYB 2FX9H 2ADFL 5EUOE 1YNLL 2WXLA 4X0KB 1EERB 4LL9A 5E2UL 1RUAL 1WBYB 4QY8A 3CC1A 3MLYH 4H5SB 4K2UH 4Z7UA 3LKOB 4ABQA 5IVNA 4MS8D 2HYMA 5I5MA 2EYTA 3S3BB 3SY0B 4BK4A 1T2QL 2EDOA 2OK0H 1I8KA 1MNUH 4N2DA 4EAEA 1CT8B 1V3KA 1HEZB 2NY2D 3HE7D 3ZIMA 5JXAH 4WHTB 2VQ1B 2YIHA 3BE1H 3DPDA 3G6JF 2P45B 4N28A 2OZNA 3BKJH 3F62A 4HETA 4F7EB 1UG9A 1RZQA 3SJVB 2EIDA 4JY6B 4KJQD 3VWKA 4F37K 3L9RA 4L3EE 4HC1A 1DVXA 3SQBB 1BGXH 4X5RA 5DJAA 1DBKH 5HGBB 2R83A 1FFRA 2DQMA 4XN1A 1FO0H 3W2DH 3COOA 4ANVA 4QHKJ 3BQUA 1RK1B 2YUVA 3NCJH 4M7LT 4ODVL 2M2DA 4M1GL 3WKML 3IDIB 4HUMB 4MD4B 5DD6B 4NENA 2PF6A 3GXNA 5I1DB 5KVMC 4JDVA 5F7KC 2J4WL 4QT5A 1PSKH 2RQEA 5I1JH 2YA1A 2F7QA 2DDQH 3HI1A 1NFDB 2K6WA 1N8OE 4YS4A 4Z7VA 3OZ9L 1GGUA 1UC6A 5GRZA 5FGBA 3VXUE 5AW5B 1FVCB 3MJ9A 4ZW3A 5HPMA 4DUVA 2CDFB 1M4KA 4LP5A 1G7JB 3CAFA 4MNGB 1RY7B 5HDBF 3ARGC 3L13A 3Q2CA 1U3HA 4QRBA 3EOTH 1QSED 2PN5A 3QCVL 4JM0A 5B1CA 2K6YA 3BEVB 5M7QA 3RI5F 2FATL 1RZKC 3CJJA 4OF5A 3BI9X 2CM6A 4PUBH 4I18B 2V2TB 3NCYS 2VMDA 4OZGE 1I9IL 3ECBA 3PXLA 4G9FB 2ZXDA 4PRHD 1GZHC 2QEJA 3U30B 5DUML 3DXAA 2UYLB 4PTTA 5E24E 5HHVH 3S36L 4NFBA 3LKRB 1BVNT 1AQMA 2V5MA 1I82A 4I0PD 4ELKB 3OKOB 1QPKA 5AOJA 4AGOA 4F2ME 4WGWB 3N42B 4OFIA 2YPKB 2OMVB 3PP3K 1ODAA 2I85A 2ZG3A 3KPPA 5IMOB 1XFPA 2XZQH 4K7PX 2LOEA 4KUCF 4ZT1A 3WHXB 4BKLA 2C7FA 1CLYL 4X4MA 4QLWA 4Z7QB 1OB0A 1ZHKB 3RVVC 1TJGL 2BWQA 4A7TA 1ZV5A 5IEKA 1BF8A 4Z7OF 2D7QA 3MV8B 2H26B 5HHNA 2O30A 5C07B 3WSQH 8FABB 3AABA 3ZK0A 4Y4HC 1WBZB 2R2EB 4RAVA 3NN8B 1L5GA 2VDML 4LFHG 2B1AH 1VFMA 3O4OB 3U6XA 3MX0A 4H8WH 2GABA 3N44B 1J86A 3BPOB 5E6ID 5J06A 3ALXA 4PJ7E 2GBTA 1KTBA 2Y07H 3EBIA 5D7LB 4K7FA 4PV9A 5SWQB 5TE4L 2C9AA 2HFEA 5TD4A 4DEUA 4HQQL 4NQUA 1XF2B 4Y16C 3SKUD 2HX9A 4HW6A 4HIXH 3QFJD 2HRHA 4H2CA 1MJ7H 5F7DB 3KWUA 4Z7WF 2CA4A 1VCBC 1TQVA 1GC1C 4BQ6A 5DI8A 5A7EA 2E7BA 1V7NH 3MV9B 2OCJA 1NIEA 3V6OC 5HHOA 1OGTA 3NIFB 4RRPM 1CS6A 5K9JL 1OAYL 3CBRA 3D69A 4LRNL 3QDGD 3U0WL 5EF0A 4R4ND 5AW1B 3TO2A 4JREC 5K9QG 1RVFH 1DQQA 1LLAA 4JHAL 3B5HA 1W72L 1AZBA 3Q7JA 1P6FA 4LL1A 1Z1WA 2QQKL 1NC4B 1JMZA 3JVFC 4Y4FC 1BM7A 3TYGL 1DSFL 5HHMB 1A7NH 5JW3L 4Y1SA 5KSAD 4NN5B 2LTQC 5SWSE 4K23L 1ZPLA 1RUQH 2CIKA 3GSXA 5C7XL 4ORGA 4HWBA 1KJ2A 2O6CA 1PBYA 5AWNL 3IKKA 1T1ZA 3I6GB 1MKFA 3S97C 4TUJA 4DF9A 1XO8A 5LLIC 4MJHA 1AJ7L 1SLUA 1RJZA 4ZTEA 3K2IA 3SD5A 1OE3A 5LUMA 3L1OH 5JLZB 2R4RH 5DK0B 1D9KA 3GGWB 1DZBA 5K1NA 1JNLL 2DLFL 3B9AA 4JFHE 4NKMA 2WUBL 4WIQA 2C1PA 2RFXA 3ASNB 4KNUA 5AW0B 4KXAA 1CK0H 1EIBA 1IC5L 4AV5A 2IQAB 3L4WA 2CQVA 5A2CA 1SXAA 4HJ1A 1P84K 3OMZA 4JPKH 2I07A 1DQVA 1XB6A 4GS7C 1U8MA 1J0HA 3NIGF 4M4RB 4OFDA 4NBZB 3KLAB 4OZIA 1Q0XH 4OBSA 3V4VA 3VVVA 4UUJA 3TJHC 4NQED 4JFTA 5F7FA 1XD1A 3N9GH 1E40A 1YNTF 1QKZH 4GNKB 4X8JB 4HWEH 3DX9A 5A6IA 1NMCC 3KYKH 3GUFA 1GW0A 1BD2E 3DX1A 3GI9L 4XMPH 1LM8V 2K78A 2VB5A 3DJRA 1WAPA 4N6QA 4ZTPL 1LQSR 4L9DA 2JJTC 3JQOB 3OF6A 4MZRA 4U3XA 2Z8VC 2YAEA 1FGVL 4G7SB 3PHOA 1QRNA 5GGQL 3L6FA 4NQVB 4XCEB 4QTIL 4CVZA 3T8XA 3BPCA 3OAZK 5KBPA 4JPVL 1TETL 2CGRL 4BGLA 2YQGA 3KJ4C 3NJNA 1FDLL 4LLMA 1FF5A 4KX9A 1UM4L 2DYPB 5DJ0A 2VDRH 5J1AA 4PJ9D 3WG7B 3UYOD 1KJVA 1HEHC 4MAUH 4OCXH 4QWWC 3RX9A 3ARBB 2MHAB 1E42A 5F1SA 4I87A 5MERB 1MFBH 4XNDA 1MUJB 1U8KA 3QA3B 3RUGE 3VWJC 2FLBT 5DWUL 3UABA 2CUMA 4EF3A 2VH5L 3FTGA 3HNSH 3MRGB 4U1MA 4YHKH 1W0YT 2OP4L 3C60A 4M62L 3QCUH 1RJYA 2FRGP 4ZUSB 1P7QA 3MRQB 3S2AA 1PKOA 1Q0EA 1Q9KA 2QL1A 3I9GH 4F3FA 5DHMC 4ZPTA 5BRZA 1PQZA 2A9AA 4HCRH 5IMLA 3V4LA 4C4UA 4DKTA 4Z3EA 3EF7A 5HSFA 4FNLH 2J8OA 4M6OH 2YEZB 3CQPA 3ZU8A 3VCLA 4M8VA 2CRZA 4FFWD 4GLRH 3MGAA 4FXKB 2IDUA 1A1OA 4OCMC 4HJJH 1U8CA 3LQMA 4OCYH 2YGOA 1I3VA 3EJRA 4AQ8C 4B5ZA 3EBGA 2QTEA 4HT1H 3US9A 4PS4L 43C9B 3KGRA 5HD8C 4DGVL 2AEQH 3AXHA 1DN0A 1UASA 3IRCA 2FIKA 4AEIL 4OKVB 4XAKE 2OSYA 5HI4C 2BFVL 5CKAA 3PL6D 4H8HA 4LSSL 1U8OA 5DJ6B 1HL9A 3RL1B 3KLKA 3WUWG 5HYIA 4KRNA 4KKLD 3IMBA 5F89B 2BMKB 1I8MB 3LZFH 3RNQB 1B2WL 3AVEA 4PV8A 2DWDB 3S5YA 3WXVL 4FI8A 5IVOA 3DX6B 1E4XH 1JVOA 2Y2TA 3HG1A 3OGCA 3ZYZA 2OZ4H 5EU6D 2BVQA 4PRBB 1XH0A 1ITCA 1R9FA 2G2PA 5E8PB 3V5HB 3WKNA 1TKWA 2A7BA 2EYRB 2XXFA 1B4LA 3EOBB 5KVFL 1X5XA 4NQCB 3OZLA 4ELMA 4ZX6A 2VSKB 3AS2A 1A6VH 1UACL 2NCMA 1G9NH 5G4NA 2FBOJ 1MCJA 1JZ6A 1MRCH 3I6SA 2QGCA 3TCLA 5IWLC 2ROYA 4RFNB 4JRFA 3OJDA 1BM3L 3N1QC 1RERA 4Z9KB 1PLCA 3T8MA 4L8CB 3ZW3A 3O81A 3ZT5A 2B20A 1GSKA 2LU3A 1ZLSH 4RX4D 2DYSB 2LABA 4G72B 4ESKA 1U8NA 4R96A 1DL7L 3D87B 3SYQA 4K8RD 4Q74A 3LNIA 1IBBA 4R3SA 3HN3A 2IC2A 1TTBA 4U7MA 1MEXH 3QZPA 3CMGA 2CHXA 2MIZA 2N1KA 3EDEA 3E1F1 3FKUS 3TFBA 4LPTA 3L54A 2AJUL 1SNRA 3KPSA 3NABL 1H8LA 2O61B 5I71C 2QV2A 3WJJA 5ESVB 5C9JA 5I1IL 3S8GB 2Y24A 4YPGB 3M1OA 3RKPA 3HOGA 1J9CT 2CPUA 5KTEH 1QFHA 1T1WB 3HR5B 3EO0A 4ISVA 3V79C 3P4NA 1V54B 2KQMA 3GPEA 3QUMH 5F70A 1J9RA 5EZJA 4Y1AB 4YK4B 1U30A 2IH3A 1GZPA 4I9XA 4A7UA 1ACZA 2X40A 3NSCA 3QXDB 4LSUH 1H8SA 2HVJB 4PI0A 1AGFB 3MBXL 5DO2D 4BFGA 4KXZH 2V37A 1KJMA 4R7LA 4CRPA 4JQVC 3EYVB 4NZTL 1IKOP 4IIQA 4JFPB 4AL8H 2OMXA 3AXIA 3PGDB 1HK6A 2E9GA 2X10A 1QSFE 1S7UA 2E7HA 1KXVC 1L7IL 2YGNA 3KBFA 3OKEB 4XN4A 5IG7B 5I1HL 4QPEA 5D7KE 3AT8A 5A3IC 1JMXA 5IW1A 2FZ3A 4GKSA 5DSCB 3GIVB 3IFOB 2VZUA 3PWPA 4GG8B 3TIEA 1UXSB 1S7WA 3QORC 3P0GB 1T3FA 1A7PH 1T1XB 3FQWA 3WUWA 5DD0H 3FFOA 4WI0B 2RTTA 3SEPA 5I30H 1VHPA 1JPEA 1JVLA 4YSOA 3CLEL 3GUTB 3VFNA 1YN6B 3SJVD 4ZMTA 1OP3H 4PWGA 4AVKA 3A22A 4ZMXA 1MI5B 3RPIB 4NC0B 4AJVA 5HVHC 3L95B 4PJHB 3UTTB 4DCQB 4CVUA 2VR8A 4R0LB 2WO3B 3P0YH 3CCHB 2A6DB 1JGLL 1WWBX 1AG0A 1FC2D 2VWEE 1YNKL 3ARFA 4HWUA 4P3DA 2NYZA 1NCIA 1QA9B 3IRPX 1XGQA 5C0JA 4K4KA 2QSTA 4TVPE 3MNWA 4G8IB 2C9UA 3RU8L 5KOMC 1OL0A 1OK0A 3CSFA 4RESB 1QFWM 2A74C 5FYJE 3UO1L 32C2A 4X2UA 4CDGC 1OAKL 1DCEA 4XGZA 5E00A 3K0YA 4OV6F 5T1LA 5T5FA 3JZ7A 4JG5A 5I73C 2F53B 4N8CL 4C56D 1EV2E 4ZOAA 5DFVC 1U8HA 2VR3A 3HN5A 4DP4X 4MMYB 3BAEL 3DBXA 3O0RH 1BX2A 3O6KH 1O9WA 4JRYB 4UNIA 3MRBA 2PCFB 2HAZA 1OTTD 4TTDD 2XLLA 5BVJB 2A9MH 1SOSA 5E9DE 1GKOA 1ZSDB 3GHEL 1H3TA 4U0RC 4FKEA 4JHWL 1AFVH 1CGSH 3MNDA 4H26A 5DYFA 4Y2NA 12E8L 1I3GH 2Z1PA 3WIHA 3HZ3A 5ACZB 1A7RL 2ICEB 1II4E 5IMKA 1DEEA 4XP5L 1WEJH 4CUCA 5IOPB 4Y4KA 4WCYL 1BQUA 3SO5A 2PR4H 1XF5A 3F58L 1INQA 3LKPA 4B3VA 4ZFOB 3TIDA 1OTUD 3CFUA 4TPRL 5ICZA 3TBYA 1DJZA 1FG9C 2NY5H 3G6JE 5I26A 3SQRA 1BQHB 4OLVH 5IVXB 4DN3L 2G5UA 4YJZL 2J1ZA 4PG2A 3IDYC 4OLXH 4AM0B 1L9SA 2R0ZL 3RY6A 5KW9H 2YAFA 4B41A 4Z7UF 4MVBD 4RCAA 5D4HA 4LRIA 5IB1B 1JS4A 4H1LG 2O6EA 5C07D 3MC0A 5FO9A 2D31B 2P5EE 4QHLA 3PXJA 4IMLA 4LPXA 1MCKA 2G4EA 3CX2A 2Y3NA 4OIIH 5DC0A 5EUOB 3EYQD 2EXWC 1IM9B 4O2CA 4M1CC 3I84A 3N3EA 4DQOL 4YX2L 5L4FA 1RUPH 4NDMA 2BJMH 3M8OH 3K6SA 4W9JC 4WW1B 3MBED 2WYHA 1OT2A 4TLKA 4P2OD 4JPSA 3KR3H 3C2AL 5KVEL 3CXHJ 1NANI 5F1KC 5BPPA 4J39A 3QUYB 2J5WA 1YMMD 2IANA 1SM3H 1FI8C 4OIAA 5B7FA 4IOFD 5EA0H 3HRZB 4AVIA 4OLWL 5FUCE 1MDTA 1AGBA 3TEXA 4RFEA 4KKBC 4FG6D 3SKMB 2UVFA 5ALBH 5HDBE 5I8CB 2ZOKA 2WZAA 2PXYC 3OM3B 4MRBA 3VFVA 4L3EB 1DDTA 4JFWA 5AB9A 4P2QE 4F15B 3NJIA 1M1XA 4E42B 3M46A 4QXTA 1SDDB 1MCSA 2VC2L 1RZKH 3UAAA 2I7OA 1SFDA 2YJLA 1SEQH 4NJAL 2OTWB 4Z7VF 4X8CA 2X88A 2WYTA 4HSAC 1ORQB 1Q94B 1U2CA 2ZUUA 3HHRB 3F12B 4M8UA 1B0RB 3FSVA 5HHMD 1GZHA 1UJTA 1BZ7B 3HI6H 2HG0A 2J6EL 4EIUA 4F80A 5KG9B 4M93B 5KS9A 2OFQA 2APFA 1R4XA 4V1DD 5E7FA 3LTVA 3H7LA 5GSVB 3ETBJ 4NQQA 5KN5A 3I3BA 1AGEB 1BZ9B 3C6SB 1XF4B 3KPQB 1U8PA 2DM2A 4HIHA 4AYSA 3FHQA 3PYCA 5EEVA 1P7HL 4WO4B 3ZGIA 5T3XL 5EN2B 3VXUB 1AR1B 2FO8A 3QEUA 4NRYB 3EYOB 4Y2DB 4AMWA 1PZAA 2HN7B 4OCWH 5D72H 3LEXB 3VFGH 3RDTB 4L29B 4UU9A 1XIWC 4PQXA 3QPQD 1KIUA 4ATTA 3MKKA 4Z7OE 2W9EL 3B2DC 4PJ5E 3GKWL 4JN1H 5D55A 5F0LB 5J7CC 1IGJB 1F56A 2ED6A 3BVVA 4L8SB 3V0HA 4ETQB 4G43B 3HFMH 4OZGB 4MAYA 2DWEA 4Y4HA 2BSTA 2H45A 4O9HL 3SQOL 5IVZB 1BQLL 1N2RA 3VU1A 3BLPX 1DO5A 3N2JA 5J13C 3LQZA 3T2NH 3O9WB 4JM2F 2HRPL 2JLPA 1EGJH 1YEEH 5D93B 2W60B 2UZYB 2AVFA 2IADA 4YHML 1Z0NA 5D1ZI 4WFFD 1GC1H 1N0XL 3D52A 1YEHH 3OAYK 4QUOA 3VJ6B 5I19L 1CJYA 4ZFFB 2GVYA 3C5SB 2PWFA 3ILEA 2ZKXA 4GFXA 4OV5B 1F8TL 2TAAA 1M2OA 4XNYL 3VXOB 5IROC 4BUQA 4JPIA 4N0UB 1KLFA 1C1EL 3AITA 3AM8A 2VMEA 2XG4A 3RKDD 5EBMA 4JGMA 4W9LC 5C70A 1R17A 1GZQA 4LEOA 2IV9A 1N7MH 4HPYH 3W39A 1IX2A 1XHHA 2FQEA 2AEIT 4P4RB 2ZCKH 4XN8A 4Y4FA 5KAQG 1Y18A 1HC1A 4WNJA 3ARBD 2VLJE 4JY4B 4QIRA 3X17A 4PJ7B 1E5BA 1FFTB 3QWRD 4MMZA 3ZMNA 1YEKL 3RIFK 5D1XE 2YUZA 1NGYA 4F9PA 2RGSA 3WGVB 3I50L 1GGIH 5L2KA 4K7PH 5I75B 2K7QA 4K71B 1MPAH 4MDIB 4XBEL 3WLWC 4KPHL 3EFOA 3MXWH 3AG3B 1A65A 5DD3L 1EHKB 3ARGD 3K5RA 3VD0A 3BP6B 3QCTH 4JZJC 4NLAA 1YJDC 1JG9A 2BVPB 3S35L 4KROD 3MRPA 1WAAF 1AS8A 2HLAB 1YYML 3CH8A 3QIWC 1H0DB 2XTJD 3PV7A 4N5EC 4LVOC 4A2MA 3SPCA 4L8DB 2CKBA 3OC5A 2NT0A 4YVUA 2IFFH 2YRZA 1MIMH 5AOMA 1PG7W 4NM4L 3BVTA 2JCCB 2R0WL 4GMSH 2F54D 4QYOB 2DJMA 3TZVA 2Z91A 2Z0BA 4TNVF 4E41B 5HBBA 4QMEA 4DKAA 5AVRB 4AQ1C 2R23B 4PG9B 1MHHA 2KMWA 1OARH 3N85H 1RXLA 2A38A 2HXAA 5JPNA 2P5PA 3UYPA 4ADIA 3V5KB 1JRHH 2GKIA 3B5TA 3D2UA 1AKPA 4AYMC 4M56A 4XO9A 4AV4A 3EFDL 4Z76A 3PWNB 4OD1H 5TFSH 1JNJA 1UT9A 4MJ6A 3RVVD 3BUDA 1EHLH 4G8FA 3QGVA 1YEIL 3SKJH 1KGCE 4OZIF 3D9AL 4U4BA