5F89B

Structure of the unliganded fab from hiv-1 neutralising antibody cap248-2b that binds to the gp120 c-terminus - gp41 interface
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
222
Chain Sequence
SALTQPASVSGSPGQSISISCTGTSSDIGGYKYVSWYQQHPGRAPKLIIYDVIKRPSGISDRFSGSKSANTASLTISGLQAGDEASYYCSSYTTKKTSFFGPATRAYVFGSGTQVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Recognition of a Novel HIV-1 gp120-gp41 Interface Antibody that Caused MPER Exposure through Viral Escape.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CAP248-2B Heavy Chain
total genus 39
structure length 222
sequence length 222
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f89B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f89B02
2DTML 3D0VA 5F9JB 3DUUA 1X5XA 3QDJD 1EEYA 2EO9A 3WXVH 3ES6A 2YUWA 4GRWH 1G9NL 3GBML 5KAQF 3QI9D 5J13B 3OPZH 3IKCB 4TULH 1NFDB 1INQB 1NC4B 4OZGB 3MFFA 3REWB 2QSCL 5E2UH 4KK9D 3U82B 1H8NA 1UJTA 3PIQA 1G6RH 3P0VL 4M7ZC 2YD3A 1CFNA 1AR2A 1CD0A 3DIFB 5DUBA 5IB5B 5B3JF 5FDWB 3QFJE 5EU7C 1I9JH 4TPRH 5F7WC 3QWRA 2UY7A 2Y5TA 4C57C 1B4RA 1DLHB 4XCEA 1QSED 2FWOA 4HMEA 1JWSA 4DEPC 3IVKA 1KSRA 3VWKD 2R2CA 5IMLA 1ACZA 1FLRH 4H1LB 4G9FE 2ICCA 1WFUA 5D1XB 2VERN 4PJAF 2ZKHL 2DICA 1ZLSH 1A7PH 2BCKA 1U3HA 3DUSB 4LPYA 1XGUB 4ZFZA 1XGTB 1NL0H 4CBPA 4M1GH 2OL3B 3ARZA 3PGDB 1P1ZA 5H35A 3DSFL 4EI6B 1MFEL 3W0WA 3GSNL 3QEGL 1SYVA 4HUKB 4I5BA 3MRDA 4HG4J 1UH3A 3RGVB 1D7FA 3D18B 1DQLH 2F8VA 3QPXL 1OF2A 4DAGH 2C3GA 4XHQA 3R8BB 3JVGC 2E7LC 4D0BA 3MFGB 2OJEB 5KVDL 5KANG 4KK9C 1FNGB 1TCRB 2A6KB 3Q5OA 5D6DA 3ZKSD 3TZVD 3GUTB 4HQQL 2PYEE 5EU3A 4P23C 1K8DB 2IG2H 5FGCE 3WNMA 2ZCHH 3MV8B 1B0GB 4Y8DC 4KROC 3VXME 2DTSA 5DMYA 3PQYE 4F3FB 3OKEB 3BPNC 2UZIL 5SWZB 3SGEI 4E0RA 5F6HI 4HWBL 1YQVL 2BVQB 3QZWG 4HKBB 1OW0A 1IGFH 3KLHD 4NQDE 3L3OA 3VRLF 2XWBA 1TVBA 4Z6AT 4JPIB 5JUEL 4OLVH 1RURL 2F54B 3F7VA 3S5LB 4D0CB 1GOHA 1X44A 3NACH 4M00A 3IDIB 4RFEB 3BE1L 2CKBL 1NGYA 1EEZA 5JOPE 3SKOA 3IGAB 1NBVL 4YR6A 5SX4I 1FGNL 4AT6A 3I85A 4TVPE 3TO2A 5ENWB 1E6OH 5GGRB 1BIIA 4I18B 4TUKH 2DQUH 2BVTA 5B38B 1P7QA 5KBNC 2EDEA 4UQ2A 4X4YA 1EUTA 5FO9A 5HDLA 3ZLQC 2BVEA 1OARH 3V4UL 2EDKA 4ONFH 3D39D 2FBJH 4KVCH 5MP6L 2VQUA 3SDAD 1H3UA 3O3DA 3RKPA 4I77L 3GJFK 4OCNC 1S9XB 3UJIL 5FAAA 1FCGA 2QQNL 3GMQB 3RDTD 3MBED 1RUKH 3HC4L 5CHNB 3BUTA 1CYGA 3CDFA 4O2EA 4Q2ZA 3VRIA 2XTJC 4FFZL 1SEBA 3L1OL 3BKJH 5L8LB 1UJ3B 3OZ9L 2D03L 1LEKB 1T5WA 4P2RE 3IRZA 4XAWL 1T04B 3I3DA 5D7IE 2FBOJ 4HC1H 5A2LH 4X6DF 5IJVB 1QLRB 3TN0B 2OBGA 4PJXA 2DQGH 5EBWB 1AQDB 3WFHA 5CBAA 5IJKA 4NKQB 1E6JL 3ULUH 4MX7A 1H8OA 3G6AB 2J6EL 1I8LA 4RBPK 5IEHB 1P6FA 3FN0H 3NFSL 4JZNB 3P4OB 3VFVB 4I8DA 5DK0A 3ESUF 3ARDB 1FNFA 1KCSL 2BNUB 4NQSB 1AO7D 4NQVA 1ZLUH 1Y6NR 1MWAL 4GRWB 1J8HA 2OM5A 4BQBA 3HG1D 3CMOH 1S7VA 4PTTA 1X5GA 1J05B 5CSZA 5F71A 1KB5H 1OP5K 4JREC 1MY7A 3LEYH 2NLJB 3GMPB 3TZVB 5L6YL 1FVCA 4P4KA 3OKOB 1FNSL 1NLBH 1NAMB 2F5AH 3O41A 4N9GB 4GRMB 2DIAA 4XHJC 1XF2A 5FO8B 5C8JB 3BHBB 1GZPA 4J3UA 4WUUE 3U7YL 4FZEH 1CD1B 2D3VA 4QHLA 3WS6C 3WN5B 4FS0A 5IG7B 3T09A 5EO1B 2DM4A 4RAVB 4NKOA 3QUXC 4RA3A 5C0RL 5CJ8A 4MXVF 2V6HA 4FZEL 4WGVB 2ARJQ 2Y6SD 2UVFA 1UKSA 4U1HA 4YHMH 1UVQB 4F33B 5I18L 2XKNB 1BPVA 4ODUA 1U6AH 4LLQA 4NP4H 2OR7A 3GSNB 5C9KA 5J6HA 4ISVB 3B4NA 2VABB 4OZGF 3HC0A 1Y6KR 1MCOH 2YD8A 2F8XC 3ZT6A 4AEIL 5CUSH 4G5ZL 3M17A 4FFWD 3K81A 5EBWA 3X13A 4HPYH 4ODXB 1A9EB 5F7MC 3I6GA 2Q8BL 1U3ZA 1OAUH 4NHCH 1JGUL 1J1PL 1I4FB 3G5ZB 4PJ5A 4S1QL 3PP3K 1G7JB 2R15A 4P9HC 5CEXB 4G6AC 3O9WC 3CZFB 5KS9E 1BZ7A 5IROC 3ZO0A 3AUVA 4XCCL 5B39B 4X5WB 5D2NC 1T22A 1ZA6A 1I8IA 4YGAB 3JV0A 3TN0C 4XB8A 3FCTA 1CXHA 3ARGB 5E08L 4GW5A 5DC0A 3RZWA 2VXUL 3SDXA 2NXYD 4LCIL 1P84K 3P9MA 1NCBL 3MR9A 5TE6L 3RWGB 3H9HA 5F3BB 1OT1A 1OM3H 4G42B 5I1EL 2EDQA 1CGSH 3MO1A 1INDH 5I8KH 1ORQA 2FX9L 1T66C 1BIIB 2C4FU 2Y06L 4QO1A 3QUKA 2I5YH 5HHOE 3KPRB 4DOHE 1L9MA 3HG1E 3SJVA 4UIKH 5I75C 5T3XD 5E24E 1E27A 1YC8A 4D94A 2QQLH 3P11H 3PJSA 1LK3L 3UPCA 1C7SA 2DIBA 4G7YL 3RBGA 4H5SA 1H3TA 3JWOL 5I1LB 1JNJA 3RTQC 1KJ2B 5DQJA 3DROB 4O4YL 4HMCA 4GMSL 4D0CA 3F7YA 5JZ7D 2ZCLL 2SEBA 2ZOLA 5F8QC 1C1EH 5C0FA 3WNKA 2CRIA 3HMWH 4WW2F 4RGNC 5FGCB 1AI1H 1IGJB 2BXZA 4ZTOH 4ODTH 2BHUA 3ROLB 5EUKB 4PYGA 1G7LB 1S5HB 4EVNA 5BJTA 1FORL 4HJJL 3C6LC 2JE8A 3EDEA 3HE6C 2R29H 2V2TA 2J8HA 5GRJL 4C54A 2XI9A 1ZLSL 1IGTA 3O11B 1R3KA 2R0ZL 1RUMH 2VE6B 4I9WD 4Y2DB 2DQIL 1DVFB 2OMNA 5JIPA 1A3RL 5CINH 3R0NA 5DJAA 1J5OH 4XZUB 3OJVC 3S3PA 3HG1A 5MP6H 1U58B 4G6JL 2DJ4A 4MWFA 4X6DB 4HJ0D 2KBGA 2W65B 2A6IA 4NOFA 4BUGA 4HT1H 3TT3H 4FFYH 4P46A 3DJ9A 3DMMD 4DN3L 3ARWA 3KR3H 5IK3A 5TJWK 3IDNA 4TNVF 1I3UA 2E8ZA 2ZPKH 2AGJH 25C8H 3AAZB 5DYOB 3EOBA 5D5MB 4PRPA 2HJFB 1JHLL 2HLFC 4BM7A 4JZJB 3D85B 3RWCB 3T3ME 2B0SL 2Q7YA 1N0XH 5KVGL 1G84A 3FO2B 5E6YA 4H25B 2DM3A 2BCKB 3WHE0 1LD9A 3ALPA 2BVPA 5D1QC 2FB4L 2R23A 3QWOB 3CPLA 4IIQB 3FT2A 1F8TH 1QRND 2L7UA 3CLEH 3L5IA 1MLCB 2GCYA 4NQDD 3V7AG 3TLRA 1F3DJ 4NRXA 1CICD 4HWEH 2YRZA 3HRZB 3LH2H 3EW3B 4MCZA 3LKOB 4FFVC 5FYKL 4MJ5A 4EZMA 1HIMH 3D39A 1MCDA 3B5HA 2WW8A 4GQPH 1ADQA 3VXMD 2IG2L 1KGCE 1UM6H 3KS0J 1KPRA 2AXFA 2R1WB 5EZOL 3GSOB 3MLZL 3RWIB 2JJSC 4BH8B 4R4FL 32C2B 3DTXA 3WEXA 1ZSDA 1LMKA 2PYED 3U9PL 1F42A 4NZTH 1VKXB 1BZQK 3O9WD 1F45A 5JLZA 3KPPA 5FB8B 4KKBD 3RWIA 3DVNB 4ONHA 2RAMA 2OI9C 2V7HA 2BRQA 4GMTL 3RBSA 1BM3L 4AIZB 3D39B 5CCKH 1WZMA 4LGSB 5DJXB 4NM8H 4DFIA 5DJYA 3WDJA 5F97E 1I3GL 3HLAB 4X7TB 2DWDA 4C83B 4YNYB 4EQ2A 5L9DH 4XVJH 5CBEA 1PLGH 3BD3A 5JHLL 4PJ8B 3RKDC 1ZT7B 2W91A 1OOAA 1HQRA 5AYUL 3O3BA 1VPOH 1ITBB 4MQXC 3AXLB 3VE0B 2W0LA 5I8CB 1FZOA 3G5YA 2D31B 2VAAB 4POUB 4Y1AE 4ZFFB 5KANI 5IWLA 3BKYH 4MNHB 1EZVY 3EOBB 5D5MA 3I6KB 4LLVA 5TE4L 1HXYA 2LE9A 3OKLB 4P2QE 4OT1L 3ULUL 5A2FA 3AB0B 3S8WA 3QWQB 1CGYA 1JPTL 4X7DC 3B9KA 1EMTH 1EVTC 4A2MA 4XH2A 4Y2DC 5E6ID 4XTRC 2R2EA 3T4YA 3H42L 5BW7A 4MJ6A 3AMKA 4I48A 3SY0B 3LMJL 1U8JA 2Z91A 3AXLA 3FO9B 4U6XB 2ZUWA 2DI7A 3N1QC 4MDIA 3PL6C 1JZ6A 4IIQC 1U8IB 1ZMYA 2UWEA 4WI3A 1VB9A 4Z18A 2CIKB 3T77B 5F88B 4QRSB 2NY4C 5ABDE 3T1FA 3MYJA 1E6JH 1HXMA 1SJHA 1NDGA 3KPQA 5CBEB 4APQD 3T0BA 2P49B 3VFSB 5K9OA 3BDYH 4R4ND 1G7LA 3V6ZA 2YPVL 4PTUA 4NNYB 5E5MB 4LCWA 5J12B 1AGDA 4LKCB 3UTPD 4G6ML 5CZXC 1SVZA 4CN4A 4M1DH 3HZVA 4HT1L 3C5ZB 2V7HB 3TT3L 4BZYA 1N26A 2D7NA 5E94A 4JY5H 3F7YB 5E7BA 5ANMB 4NC1E 3KAAA 3TCLA 3JTSA 4TVPL 4L4TD 1XCTA 3WLWD 5HHVL 3ARED 2EH7H 3MRGA 1BJ1H 1G9NC 4LCIH 3IDYC 2GEEA 1EBAA 1KEMH 3GI9L 1HEZB 2AXFB 2R1WA 4LSSH 4K23L 4N8VG 3EO1B 2F58L 4YO0A 1IBGL 4XBPA 1DQMH 5HGHB 4DOHB 2EDTA 4MJ5B 3UBXG 1IAIM 3GSVB 4CAGA 1IC5L 3ARRA 3HRZA 3L5XL 1FP5A 2DQUL 5B3NA 1I1CA 2FD6L 4YXLH 5ICZB 1XGRB 5C09B 4C4KO 2X41A 4OZ4A 5F7UA 3NAAH 3T0DA 3QG7H 3KJ6L 4XP5H 3RWFA 1REIA 4ZUTA 1HHJB 5BV7C 5C6WH 4QRPE 4JPVL 3EAKA 4EIZC 1VESA 2B39A 1CFSB 2NY2D 3RI5K 4ZOBA 3UYOD 6FABL 3VG9C 4LVNB 4XVTL 1HZHH 2A9ML 1TZIA 2A1WH 2BNQA 4R2GB 2H2PD 4TULL 1PDKA 4QGYA 3CDCA 2YS4A 2HLAA 5GRZA 2IPUG 5LGKA 4OD1H 2I07A 1AD0A 2YUVA 3C5ZD 4ETQB 1JGDB 3LOWA 5EIQA 4YX2H 3QIUC 4WTZA 4PGDB 1RU9L 4HH8A 4FQ2H 3GKWL 2MHAB 3HAEA 2DI9A 4J4PC 4G9DB 2XWTB 3G04A 3P2TA 3FB7A 1Z0NA 2NY3C 2X09A 4J3VA 2BZDA 5CCKL 5EO1A 1Z5LA 3S3SA 5CJXA 4OZFA 2BMKA 3TEUA 4LGPB 4PRIE 4X98B 3OG6B 3WD5L 1XCQB 1CLZH 1X6NA 1EXUA 4X9GA 1MH5B 3MLTA 3D3VB 1T0NB 5IVOA 3G04B 1MFNA 2FEDC 1U3YA 1I8KA 3EGSA 1MFEH 2R1YB 4P9MH 5F1OB 3DX6B 3ULUD 1KB5A 4KKBC 4FFVD 4NSKA 5B3JE 3L3JA 4CVUA 3VG0L 2W59A 2Z8VC 2A77H 2JIXA 4K71B 3X12B 4YAQA 4WTZG 4DVBA 2OZ4H 3O81A 4PB9H 3D6GA 2HRLA 4L3CB 3HAEG 4NYLB 5HBBA 1QR1A 5IHLB 4V1DB 3VRJA 2X5PA 3ZTNL 2COQA 2ITDA 2OX5A 3U30B 4OV5B 3U9UB 4E9LA 3CSYA 4HXAL 3VFGH 1BECA 3MJ8A 4WEMB 2DQCL 1MCLA 3EFFB 1WBYB 2P4AB 2LFGA 1RZJC 1BIHA 3SDYH 4X0KA 3RNQB 4Y4HB 5KVFH 5CEXA 4GSDH 3ABZA 4IHOA 5KOVC 4N90E 1GGBH 4XTRD 1YN6A 4X80L 5GRXG 1CF8H 1YJDC 3DV4B 5F7DA 5LWYH 3VGAC 4FA8A 4LLUB 5LQBH 1P7KA 3MJ9H 5D72H 3X13B 3D5OF 1PY9A 5J1AA 4KUCD 3KPRD 3LAFA 1HHHB 4R3SB 3W11C 2X4TA 5F1NA 2HVJB 4OBRA 3GJEA 1ZT1B 4GXVH 4P3DA 3IDJA 1GHFL 1AJ7H 3BYYA 3WO3B 3KYOA 1A6WL 4H26B 4MB3A 1INDL 4TUKL 3MV8D 4ZYKB 4D0DB 1DL7L 3PXHA 4M61B 5ICZA 3ULSA 3WDIA 2UV3A 4KKNA 3VFTB 4TSBL 4LARH 4APQB 4M6MH 3RVVC 2OTPA 2GJ6A 2IBZY 3QIWD 4Z77A 3SEPA 1FAIL 1J1OL 4NKDA 2NY1C 4EN3D 5C0CD 3UTTE 4KJPD 3S4SG 3U4BH 4RFNC 2NY1B 1NDGB 3OB0H 2HFEA 2VYRE 2AEPL 4Y19A 3GHBH 4Q7DA 4EOWL 4OTXH 3UTSE 4RMWA 1XCTB 1FVCB 4P4KB 4PJ5E 5D4QA 5SX5H 2EDYA 3WDHA 4R8WH 3WJLA 1R5WB 1YEIH 3GSWB 4ZTOL 4POZC 4U3HA 4NZTL 7FABL 1J05A 5HYJE 1O5DT 4JFXA 1NJ9B 5KSAA 4K71C 3KPSD 2AJYH 3BIBX 1BD2D 5F70A 4U7KA 2X4UA 4ZOEA 5IBUG 3MYJB 3MODH 4NIKB 5DJ0B 2X7LB 4JO4H 3QNYA 4HUNB 1VSCA 2XWTA 4XNZB 5D70L 4ZUVB 5GS1B 4MDIB 4Z7OF 4LSRL 5J57B 4JEGB 1XF4B 3KPSA 1OF2B 5ALBL 4WO4D 2W0PA 5JQHC 1P4IH 2OSLB 3NPZB 4UB0L 1UG9A 4KROB 4A6YA 4PD4J 3S3JA 2C3VB 4LCYB 1SYVB 1JN6A 1LWRA 5T3ZL 5FGBC 1C5DA 3PWPE 2G60L 4ODHL 3NCYP 3WJLC 1LO0H 5IESH 1X5FA 3GJFH 4YBQD 3PWJB 1IJ9A 1WZKA 5FGBA 1CTNA 4Y19D 4WI7A 3VFGL 1U8HB 3GMQA 1N2RA 2YUZA 3O6LL 5T33H 3ZTJH 3ULVD 2FX8L 3MRQA 5HJ3B 3RDTC 1RZ8B 2IH1B 3UPRB 3TVMB 2ADJB 4QRPB 5FO9B 1EHLL 4N0FA 3TBYA 3VFWA 5JPNA 4JFDB 4ODBD 4F7EA 3EO9L 3VMNA 1FZJA 1KPRB 1S9WA 2HT3D 4FQLH 3S96A 3I6LE 1OD9A 1CDBA 3FB6B 3WNPA 4XWGH 3WL9A 3SDAA 3IDIA 1QVOB 3TIEB 3NCJH 3GSNH 1NFDA 4YFLI 1HILB 2DWEB 1MI5D 1F90H 4OLYL 5CSBA 1G7PA 3GBMH 3RU8L 2G5BA 4MA1B 1KB9J 3DX9B 1S7TA 2X10A 1ZEAL 5SWZA 3SGJA 3STLA 1FO0B 3I75A 5J1TC 2NPLX 4LU5H 1EVUA 4ZODA 3TNNA 4X7CC 2I9LB 2P5EB 1PD6A 4EUPA 5EUOB 4MCZB 2AV1B 3VI4E 3MNZB 1FPTL 1DSFH 2A0LD 5DMKB 1D6VL 1E28B 4PLOB 4JJ5A 2B1HH 1RIHH 2VZVA 4HKZB 1F02I 3QUYB 2E7MA 3KYNA 2Y36L 4M8QA 5D96B 3K1DA 3RL1A 4MD5B 3IXTA 1C8PA 3PHOB 2AS5M 1W0YT 5IFAH 1MJJB 2NNAA 5TH2A 2D03H 5IB1A 2Q7YB 1U8LA 4LVHB 3FKUS 5K9JH 3VG0H 3ZKMC 1ZA3A 4PRPB 5GQBA 3OR6A 2KZWA 1K4DB 4OT1H 4Z7VB 4O4YH 2AAVA 3B9KB 4P5MA 4YXKL 3WFEL 4LPTA 4UIMB 1T1YB 2ADJA 3CSPA 3PGCA 3TVMA 4GLRH 4I77H 4BSVA 3FONA 5IQ7H 2CDFB 2FNBA 1ORSB 3DGGA 3JWDL 2XTJD 5HY9A 4UIKL 5DHYA 5FYKE 4K2UH 5I30H 1MRDH 5FHBH 1GH7A 4MGXA 5IMLB 2DQTL 3PWJA 2VKWA 2W60A 1LDSA 3HR6A 4X6EA 2AVGA 4AEHH 1IZKA 1DP0A 4Z7VA 3VFMA 3VXRA 4LHUD 1JRHI 4Y2DA 1JWUB 1I7RA 4NKMA 1ZHKA 2VZUA 2YD6A 3V5HA 2WIIB 4G7VL 1T0MA 5CJBA 5I9QC 4UTBL 3B9VA 4YNYA 5C6TH 3VXUA 1P5VA 4JZJC 1M7DB 4IRJA 5E8PA 4S1RH 5KN5B 3RL1B 5DI8B 3LKSB 2E9BA 4WUKH 1Z2KA 1ERNA 2KQNA 1MAKA 3MV7D 3QWRD 1A4KA 4DKEH 4ERSL 4MLSA 5B4MD 2Z8SA 4NQXA 3VXTA 3EOAA 3B8SA 1UH2A 5L2JA 2I9LA 1DBAL 4KMLB 1VKXA 4JKKA 3BO8A 1P2CB 5IM7B 3ZDYE 5KSAB 5ESVB 3JWOC 3NFNA 1UACH 4CNIA 4CVXA 1TQBC 3OAYH 2DBJA 5DJ2A 3WLWC 2IBZX 4LLAA 1JZ3A 4QYOA 1JYWA 3M1BB 4GXUM 3JV6B 4MAUL 3EOTH 3L3KB 4WEUD 3FJTA 2QHRL 3NAAL 4X6FA 5GS2H 2DWEA 1JJUA 2CDEA 2IMMA 3QFJA 1F2XK 2W92A 3LDBC 4Y16D 3KNBB 2AEWA 4HBQA 1U8KA 3FT2B 3VI4F 1DBJL 5E2VL 1LD9B 4F9PA 1EH9A 1NLDL 2JCCA 3FB6A 2XACC 4JDZA 2NW3A 3MXVL 3UJIH 1T22B 1C12A 1KN2H 2JB5L 5BOPA 4S0TD 2W9LA 1Q9WB 3FQTB 3SKMB 2AK4B 4WGWB 4MNGE 3EDFA 3QIBD 3ZDXF 1YNKL 1JZ5A 4FQHA 4OGAC 2W0FA 4N5EC 2WZPD 1VFBA 4QOKD 4WI5A 2FHBA 4R3SA 1KCLA 5T1KD 4UBDC 4G3YL 4O51B 2J4WH 1AQKL 1WZ1L 4CN6A 3U7WH 3D2UB 4MA8H 3RTQB 2EDNA 4HAFA 5I8EA 3KPLA 5IIEA 4M5ZH 4BKLB 5L8KB 3RZCC 3BE1H 1G7MB 4XPTL 1KTDA 1QA9A 3T0EA 4OCSH 3TZVA 2YD9A 5MHSE 4LLQB 1ZHLB 4QTHB 2WINB 3HE6B 1IILE 4GLRI 1FDLH 3AS3A 2G75A 1NGPL 4KK6C 3ZKND 1FSKB 3IFNL 1EAPA 2B4CC 3Q1SL 4PRHB 3KPOA 4S1DC 4U6HA 1MWAH 2DLIA 3MRIA 4OV6F 2F53D 4FQ1H 3VXOA 5L7XL 4M9OA 2DQFB 4NQEE 4PREB 5FO8A 2FZ3A 2V2WA 2Q1EA 3BD5A 4U1MB 43CAB 3LD8C 5C07A 4H8WH 5FO7B 4XNUH 5FCUL 5GISL 2O93L 5E9DD 5BXFA 4L4VB 4EIGB 1JGLL 2WK2A 1YEHL 3CCHB 5E99L 4HC1L 5JW4N 4HS3B 3DX6A 4GXUN 4JM4L 1NAKH 3SKJL 1MF2L 4XC3H 4LOUC 4Z8FL 2IPKB 4Z7OE 4AY0A 2VLKB 2XQYK 1WK0A 2NXYB 2IBBA 3HI1B 1H8SA 3HS0A 1P5UA 4EEEA 4Y7MA 1OP9A 1AY1H 1PSKH 3QEGH 1Q72H 4PGEB 4Y5VB 3FMGL 5C86A 5IW6A 2YZ8A 3P4MB 4XVUD 1DBKH 5C6PB 2EDRA 2Z35B 3LN5A 1NCAH 1KB9K 5DWUL 1IQWL 3M8OL 2VDQH 3FB7B 1ZEAH 2ZKHH 3I84A 2D2OA 5HHNA 4PG2C 1Q9LA 5F9DC 4KVNL 4Z7UE 4LP4A 4ZFOL 1BVLA 4UILL 2Q7NA 4I3RH 1CDYA 1BEYH 3LEVL 3FFCE 1WQVT 1MHCB 1UZ6F 3V2AR 3C8KA 1S5IH 4YDLB 4JLRB 1JF5A 4J8RA 4PLNC 1BBJB 3DX8A 5DD0L 4LSVL 3H6JA 1MUJA 1HINH 1T66D 1EERB 1XR8A 4YO0B 4MAUH 3I9GH 4ZO6A 5DHVB 1EA9C 3TVMD 1MPAL 3ZKMD 1CICA 3SKNA 4IRZH 1MHCA 3LCYA 4NKIL 1BD2A 4NQDA 3MC0A 1NSNL 4J1UB 4G9FB 4YUEL 1BVLB 5K9JL 5I18H 2X1PA 1OW0C 3N9GL 2NZ9C 4U1HB 5HDBE 4ELMB 2WBJC 1KYOJ 4ZXBC 2VXSH 2BSTA 4DQOH 2FB4H 4U33A 1QFUL 1FGVL 1ES0A 1GZQA 4NO0B 4NN5B 5BQ7A 3KLAA 4YGVA 4QXUH 4RX4D 1U2CA 3WO4B 4OM1H 4Q6YA 2RBLA 3D1MC 2Q8AL 5CKGA 1MHPH 1ZLWK 1BZ9B 1YJDH 4X83A 1OTTD 1IKFL 5BVJB 5GGRY 2O61A 2ICWB 2BC4B 4HIIB 4V2CB 3VG9B 5JW4R 2IANE 2YWZA 5EH1A 3RIFF 1CT8A 3QIWA 3SDCC 4XCCH 2I5YL 2Q86B 4N1EA 3HMXA 5DLML 1XAUA 4Z0BL 3L3JB 2AJXH 4HLZG 4QRQA 5ILTH 1T6VN 3TO4D 4MA3B 3MRGB 3BZEB 2DKMA 3LQAH 5F6HJ 3ARVA 4OLZH 3DARA 3NIGE 5BXFB 5F9AC 5FYJL 5H35B 5HI3D 3OR7A 3EYFA 2AXGA 5IWLC 1HE7A 4UDUA 5D1XC 3WXWL 2AKRA 3S36X 1LP9E 3LKPA 4J6RH 4ZFZB 1CBVL 1NC4D 5D1XA 3QEQE 2DQJH 1RUQL 4GAJH 3EO0A 4L3EE 5DRNB 5A40E 4RRPA 3X11A 5IJVA 2DQHH 3UCRA 3OPZL 3QEHB 1RZFH 1HQRB 2UWEB 1MCWM 3WFCH 4X7SH 2VH5H 2BHZA 3OWEA 3PUCA 4U0RC 1AQKH 4XCFL 1UT9A 2MTPA 3T2NL 3HLAA 4C83A 4ZMAT 1I9EA 4HEME 4WEBH 2YKLL 4HLZH 1W0VB 4JG0L 4U1JB 1GGUA 3JZ7A 2KL6A 4H88L 4U1SB 2IGFH 1HN1A 3FB5B 2G60H 5KJRH 4NN7B 5KVMC 4QT5A 3RJQB 3MV9D 3A6OA 3CLFL 4QXGL 4Z9KB 1XGQA 3EYVB 3MUHL 5GGQH 3TIDA 3F58H 3GMOB 4FQPA 1C5CH 4JPKH 2AK4A 4RMVA 4TN9A 4LLYA 1QUNA 1A47A 5EOCJ 5F96L 1KIQB 1IFHL 3DIFA 1IM9A 4PV9A 4HH9A 1CLOH 1OAQL 3SKOB 5D7IF 1A7NL 3HI5H 1AFVH 4M43L 3T1WA 5T1DL 1ULVA 4EUPH 4TYUA 2MQ3A 1NC4A 1S3KL 3ULVH 4S2SA 3T04D 3F6LA 12E8H 2NY0D 1KB5L 5TQ0L 3S5LA 1GPOL 2WWMC 2Q6WA 4PJHF 1BMGA 2CXGA 1A8JH 2F53A 4MB5A 5CJOL 3VFPB 3BEWA 1WUNT 1WIUA 2XWBB 4WTXA 4ZAKC 1QBML 3ZYOA 1E4XL 4FZ8H 4RWHA 4PRAB 3ZYIA 3P4NB 3V0VA 2DMKA 2Y6SC 3UAJC 1YEFL 3MCKA 3BSZL 4XGZA 2EDFA 5FEBA 2Z31A 1QNZH 5JLZB 3QQ4B 3EYOB 1D5IH 4PJ7A 4QCIA 1CGXA 1IAMA 4I18C 2XZQL 5I6XC 2VDRL 3ECBB 1A4KB 5EOTA 1U42A 4HUVB 4EN3C 2DLHA 4OCSL 2A6IB 3HZVB 4S1QH 1NGQH 4PJHE 1UM4L 4O02L 1AGDB 4LKCA 4BZ2L 3V7MA 4NOBA 3LQMA 4DTGH 4BK5A 4JCMA 3RIAF 4TVPH 1A21A 2DDQH 3D9AH 5T1KA 2NY2B 4NRZA 3I50H 4QOKA 3FRUA 4ZDHA 4YJZL 2B8OT 4YPJA 1R24B 2WWKT 2CIKA 3T77A 1CBVH 5IVZB 4RQQB 2VSCA 5EZIH 3G5VA 5F8RC 4M1CC 3VRLE 4KMTL 3QG6B 3HB3C 5D96C 3GJFB 1HHKB 3BAEH 3IAPA 4KROD 4AH2A 4NJ9L 3ROLA 3ZDXE 5DJZA 1NKRA 1QFWL 4KTEH 2AJYL 4UAOC 1MFDH 2ZOKB 1EFQA 4HZLA 2IPTH 1YMME 2EYTB 3WFCL 4LVHC 1R24A 4L1HA 3SOBH 3V6BR 1SJEB 4A6YH 5DD5H 4BYHA 1Z3GH 4EUPG 3LPWA 4G8GE 4FQ1L 1KUMA 4K55A 1DLHA 4XCEB 1Q0YL 4WY7H 3KWWA 4YDVA 2X05A 5B21A 3KPNB 6FABH 4RAUB 4MNQE 4Q9QH 3GSQB 1XF4A 1FZOB 3KPSB 1FDLL 3AREA 3DVGB 3BJLA 1HWHB 2NY7L 4IS6A 5TF0A 4X7SL 1JTOA 2HTKD 5FV2A 4NT6B 5HYSB 4KDTC 4JRYA 4PR5B 2IAMB 4JFYA 2R69H 4XGZB 3AROA 4X6CA 1ETZA 5HYEA 3QR2A 2KZ1B 1SY6A 4F15C 1I1FB 3UYPA 4YBLB 2EEAA 5C0CB 1PQZA 4D9LH 3BEWB 1QEWA 3QP3A 4ELME 4JFFD 4QRRD 1ZHBA 1I1FA 3LS4H 3MA9H 5D1XD 2J88H 2Q6WB 4NHUA 2W0KA 1BOYA 2W9DH 4KRPB 3VXSA 3VXRD 3MBEC 1A1MB 4KQ4H 5BZWA 1N59B 1N6UA 2A74A 1G7JA 4PJ7F 1INEH 5IKCB 1OAZH 3G5ZA 3GRWL 2X4PB 5BO1H 4N0CD 1IEBA 1LEGA 4X4XB 5E2VH 3I6GB 3AREB 1YMHB 3A0OA 5JHDB 1M7IB 4JFPA 3ZSTA 1GOFA 1BFSA 1D5MB 2B0SH 5T1MB 3I02A 4BA8A 3VFUB 2CPCA 5GSVA 3BI9X 5JORB 5CGTA 4PJEA 3S96B 4ZPVB 2J7LA 1CDUA 1CXIA 3LN4B 5JNYB 3CPLB 1C5CL 4JPKL 2E8YA 4OF0A 1D5XA 3S97C 1OT2A 4K8RH 4U1JA 5IBLD 5I6XB 3OJDA 4YWGH 4PJBA 3EFDL 1T1ZA 4HUXB 5KVFL 1JPFB 3K0WA 3MNWB 3WV0A 3QXTA 3NIGF 1MJUH 3CVHH 1NMAL 3CNKA 4YDIH 2WLZA 5ISZE 2BOCB 3L7EA 5ID0A 1OLZA 1HZHL 1NEZB 3VWKB 3W11D 2V2XA 3VD4A 5DRWB 1NGPH 1D6VH 3HC4H 3MRKB 3RWEA 2I25N 3X11B 2QL1A 3QIBC 1TENA 4ODXA 5CEZE 4RGMB 5JUEH 2QR0A 3CFDA 1T21B 4MSWB 4YK4C 1NAML 4Y16A 1QD0A 1P6AB 5EOCH 4ISVA 3QFDB 4OZHA 2H3NA 4BH7B 3GFUA 4OV5A 2HVKA 5EOTB 2J8UF 3ARFB 2OR9L 5I0ZA 1N4XH 2VE6A 4MNGA 1GPOH 1KLUA 4TSAH 1FV1A 3U4BL 2CSPA 4L1DA 1Z9MA 4O02H 4R6UA 3E6HA 2PXYC 3BXNA 3DYMA 4HS8L 1AGEB 3EYUH 3BDBA 4JN1L 5MENA 4QY8B 4O2FB 5LAXA 2BDNH 3ULVF 3CAFA 4HZAA 2YD2A 5L0QB 1CGWA 1YY8A 4U2ZA 1N7ML 1AXSA 1QRNA 1JP5A 2HT2D 5D5ME 3TFKC 4JM2B 4LSUH 1CGSL 3RDTB 1DVFC 2R2HA 3VXPA 4Y4KD 5K9QG 5FYJD 4A2LA 4Y19B 1PG7L 4R0LA 4WFEE 1I1RA 5E99H 5IHBA 4HXAH 4XCYB 3C2AH 3KLSA 1NL0L 3DWTA 2I60L 5GGTH 4FP8H 5D2LA 1GXEA 3RP1A 5FHAH 4P46D 3C9NB 4JFEB 5ID1A 3B9AA 4Z77B 3BISA 3TYFA 4OF5A 5MEND 3P4OA 3CMOL 4YHNB 5MEPA 1MFAL 1G7HA 4N0UA 3PQYB 4AJ0A 1Q0YH 3OGCA 1NBYB 4M61A 3LQZB 4DKEL 2IJ0C 4ERSH 4UOJA 3LKRA 3V6FB 2FIKA 1MRCL 2EDWA 5IJKC 5LWYL 1A1OA 5D71L 3UBXB 3VFOA 1M6OB 4HUUB 5GGVL 1JNLL 2F15A 3DO3A 4DVRL 2OQJB 3RWDB 5F89A 4FQIH 2FIRT 4WWID 1UJ3A 3GB7B 5SX4H 4BFIA 5HHNB 5GRWA 3N1GC 5F7DB 3TA3B 2XY1A 3L95A 5HGGS 3CFBB 4L8CB 4TTDD 3C09B 1J18A 3LEYL 3KXFA 4OQ1A 2YA2A 2GUOA 5C0BE 4C56D 1OQXA 2W38A 1JZ7A 1DBJH 1OB1A 3W82A 5T1LB 2AI0H 2EXWD 4WCYL 2RCSL 5BV7B 3S7GA 2C1OA 3EJJX 2CD0A 4LK4A 1JHTB 5L2KA 2DMBA 4YUEH 3O45B 3TO2B 3GMMB 3QDGA 5ADPH 5JMOC 3QIBA 4JZOB 1UQSB 2Z31D 2BXYA 1QLFB 2FX7L 3S36H 1AXSB 4L3CA 4NYLA 1QR1B 5SWZD 5HHMB 4LRIA 5SWSB 5EU6D 3ZT5A 1KTKE 4WFFE 4MAYC 3IXAB 4NP4L 4QRTB 2WSKA 4DVBB 5I1DA 4P5TC 4O2FA 2G2RB 4ALAL 2FO4A 4P2CG 1VCAA 3NN8A 1MCHA 1HEZA 5H2BB 4PJGB 1OSZA 4AM0B 5T3ZD 4BZ2H 3O41B 3EJYC 4OD3L 2HFGH 5HDQH 2IEPA 3RVVD 1T6WA 1O7SA 4Z0XA 3DRQA 3H9ZA 4M6AA 2PYEA 4XVTH 4LSQL 3IETB 1RHFA 2APVA 3A6CL 3KLAB 3C2SA 5DZOA 4GAGH 4XRCB 1A6UH 4AIXA 1WFNA 1S7VB 3HI6H 5DVOA 4M02A 3L9RB 4GKSB 3UO1L 4QTIH 4RMQA 3DXAE 1EXUB 2H1PL 4GJTB 3WE6B 4X5XB 1MCPH 3WSQH 3B9EA 1OAXL 1OARL 4GW1B 5I9QB 3BPCA 3IF1B 1RVFH 3JBG7 2PYEB 1JK8A 2RQ8A 1MWAB 1W72L 3RVUC 1CE6B 4KU1A 3IDMA 4L8CA 1WTGT 3MV7A 4L8DA 1JGVH 3BEVA 5A43C 4MX7B 4PJGA 3GM0A 4D0BB 1RUKL 2EIBA 2Z91B 4XPBL 4QRUB 4BFIB 1KEGH 5HGBB 1YEIL 8FABA 3MYZA 1U95A 4ZFOA 2Z9TA 3N85L 4Z7UF 3ZL4L 3VMPA 1SM3H 4KXZH 4QHKJ 3REWA 3FN0L 4XNQB 3C6LA 3DUHA 1UWXK 1NDMA 1FL6B 2VLLB 1CIDA 1S7WB 1A22B 4FG6C 2YA0A 2C7UA 1FFOA 1PG7H 3ZDYF 5C0DB 2ZZUT 5AZEH 5MEOB 1INEL 3H42H 5KS9F 3O3DB 4LHUG 4O58H 5DT1H 3DX7A 1J0JA 1KJMA 3Q1SH 3GI8L 1F58L 1NUDA 5I8CA 4NO2A 3AU1A 2DS4A 4Z5RB 5HHQB 5LJYH 4GOSA 5HGAA 3FQUB 4HQQH 1FYTA 4Y4HC 2FEEL 5I76B 5BZWB 2R0WL 3BESR 2OS7A 2Q20A 2R0LL 5IESL 5CEYA 2ADIB 4JM2A 1S7UA 1A6ZA 2XN9E 5DTFA 4M48L 4GBXC 4WDIB 2ZSVA 5IMMA 5L2JB 2ZP0T 3HNTH 3PWVA 4J3OC 4JO1H 2BSRA 1AGEA 3WUWA 4X6CB 3U7YH 3MACL 5CD3A 5F1KC 2XWJA 5J13C 1J7VR 1VACA 3X3GL 1UACL 1JYNA 1MHEB 2FGWL 4PREA 4DZ8A 3FFCA 1FIGL 5E2WH 5ID1B 4GKNA 2R4RL 1CXLA 3L7FB 4OLXH 2HAZA 1RMFL 3D3VE 1RJLB 4KDVA 1PSKL 3C5ZA 1G7QA 2VXVL 1G9NH 2GJ6D 5H94A 4YFLF 4UV7H 2CKBA 1UM5H 1DUYB 4XMPL 3OX8B 3P73B 4DEPB 5KVGH 5DZNA 4AMKH 5DS8A 1TLKA 3KPQB 1F90L 3W2DH 1MY5A 2YSSB 1QRNB 2P45B 5CKAA 2NY6C 3GIZL 2CRMA 5I8EB 4P3CH 1EGJL 3W39A 3QA3A 5DJZB 3LSOB 4OFVA 1BBDL 5FYKH 1P7QD 1PKOA 1J1OH 4L3AA 2V17H 3AAZA 5DYOA 5TFSL 2AK4D 2GW5A 1DQJA 3CFJA 4X99A 3A67H 3PV6A 5ICYB 4OTXL 1XGTA 4CW1B 1UXWA 3MUGA 5AYUH 3MRBB 2GKIA 1DDHA 4UT9H 4FXKA 4RZCA 4FHBD 1VERA 4OUUA 1V3JA 3QT2A 3LB6D 1E28A 1ZVHA 2Y5TB 1Q72L 1TJHL 4Z7WA 3T65B 2XKSA 4NM8L 5CJQL 3L5JA 4S11A 1OL0A 1QSFB 2QADD 4QCIB 2HTLD 4KK8D 3QYCA 1NCWH 3M1BA 4HW6A 1XGPA 3MNWA 2D7MA 4TNVK 4KRMB 1MCPL 1MAJA 1GVIA 3FFCB 4GFTB 5E00B 4OZGA 5C0FB 4B7LA 2APBA 3IKCA 3AS1A 4KUCF 2BSRB 2AQ3A 1S7XB 3FFDB 4PJEB 5IBUB 1GGIL 4NDMB 2X9YA 3DROA 3NOIA 1U93A 5DI8A 3DUUB 3RJDA 4XPFL 1YUHA 3F62A 1AP2A 5D7KE 3ROOB 5FFLA 3P77B 3GGWA 1X7QA 4PJFA 4GQ9H 2ZCKH 3N1MC 2DI8A 5KSAD 4JRXE 3TYGH 1YDPA 3FO1B 3TP4A 3L5HA 5GPRA 4X8JA 5I76A 3GGWB 3RY6A 2AJSH 1YEKL 1WT5A 2X4NB 2MMXA 4KUZL 4I0PC 4WNQA 1SJXA 3WUWG 4OCWL 5EN2A 1S3KH 4OI8A 3KLDA 2FJGB 1CVRA 1U3HD 4OUUB 2J2ZA 3T0ED 4KUZH 2W60B 3ZE0E 3I9GL 4HJGA 1S9KC 4O9HH 3ZHDA 4ENED 3EO9H 2ZOKA 1JNNH 1IGIL 3FQRA 1AGFA 4ZNCD 1JTTA 5IFHH 1G0YR 2HKHH 5FA4A 4XVSL 2EXWC 4PJAE 3PXJA 2V5YA 1A6AA 1C16B 4ZUSB 4C58B 3B8YA 2WUCH 3GBNL 3MGAA 4LCYA 4W6XB 5HYJB 3ULVL 1DEDA 1MFCL 1ZVSB 5H37H 4TUJB 2VXTL 2VLRE 2XZCL 4ZFOB 2BNQD 2N56A 4M7KL 4OD2A 3VCLA 4MJIE 4DUXA 1MVUB 4NGHL 1JV5B 1WWCA 3TJHD 2P8LB 2UWEE 2OTWA 2HMIC 3IJHB 4LAQL 5C0EA 3QNXB 4XNZC 1D5ZA 4ELKA 1A4JB 4YHKH 3MREB 2DYPB 3RZCA 4HKZA 2OLDA 3GSRA 3SN6N 5ICYA 1JE6A 3QDJA 1AGBA 4D3CH 4LFHG 5TE6H 5ALCL 1U8QA 2GY5A 3UTSA 2AW2A 1MIML 1U8MA 3WE6A 2F5AL 5I1JH 4YPGB 4RNRA 5D9SB 4RBPH 5IB2B 4OLUL 4E41E 2ADFH 3E6FB 4OM1L 4AH2B 3C8HA 1QO3A 3UZVB 4Q9CA 3DYOA 1RZGB 1DCLA 5T3XH 3DRQB 4PLKC 3X17A 5J3HC 4U7MA 2UUDK 4NZDA 1DE4B 1OSPH 1PFCA 2EZ0C 2F53B 3B2VH 5TQ2L 1WJ3A 1FVDB 3T0VA 1EEQA 3ZKXB 4JFED 3RPIB 5JIIA 2Q3ZA 4PB9L 1PZUB 3MRCB 3QRGH 5GS1C 4S2SB 1U91B 2EDOA 3TFKD 1V05A 4G80B 3RWHB 4AEEA 3K4ZA 3T0WA 1Y18A 2FJHA 1LEIB 2G9HB 3HHRB 4APQA 1IC4L 2AEPH 1F3JA 2Z92B 1LE9A 4HUVA 3MJ6A 3MLRH 3FQUA 3HAEH 4KY1L 4J1UA 2DB8A 3FTGA 1LE5B 3GJEB 4I2XA 1FRGH 2C9AA 3GBLA 3SO3C 4QRPA 5I1AB 3QHTC 1QSZA 1I3RB 2CUHA 1P4IL 4UB0H 5EUOE 3Q5TA 5FM5M 2LV4A 4DUWA 1FNEA 1DQTA 4J8RB 4PG2A 3UEZA 4DKFL 2I27N 1NCAL 2OTUB 5C6TL 1S7WA 1LO4H 1S7UB 2NR6D 2P44B 2YPLB 3FB8A 4LEOB 3O6ML 3WIFA 3DSFH 5J06A 1S78C 2IFFL 3QUYD 1I9IH 1RUML 2HN7A 1H3PH 4LKXB 5B8CC 5CHNA 2IWGA 5KS9A 4JR9L 5T5FH 2R4SH 1GGBL 4KTYA 5EU4B 2VDPH 1BAFL 5ACZB 3CZJA 5BRZB 1B0RA 4P9HH 4M1DL 1W0WB 3ARGC 2AERT 1V3MA 3ZDZF 4GT7A 3TBTB 1CL7I 4CVZB 4JFHE 1LE5A 2DQCH 4EXPX 4JFEA 5E8DL 3RKDD 5GS0H 4GMSH 2X1OA 3MCLH 1S9YB 1QFHA 2ATPA 5CEZH 4ZNEA 1UEYA 2P24B 3RHWF 1BLNB 4NO3A 1RI8A 1OGTA 4LSPL 4R90L 2E27L 3OAZK 4JFZL 5C0GA 1G6VK 5ALCH 4Z0XB 2NTFB 1CGVA 3AVEA 5I66A 4LCWE 4LVEA 4GRMA 1TTUA 2I24N 5H2BA 5JQ6H 3SDYL 2NTFA 2FEEI 2EDHA 1UKTA 4PS4H 5FGRA 1IGIH 5FF6A 2NQCA 5K9KA 3MOQA 5FA3A 1EZVX 4HJ0C 4P2YA 4NKDB 4UQ3A 2JB6B 1BLNA 4LL9A 4NO3B 1FIGH 5E2WL 1IEAA 4ESKA 1S8DB 3VXMA 2MKLC 3QIBB 4JZOA 4PRDB 1BJ8A 2BSTB 2CMRL 5L0QC 2AKRB 4JM2C 1KF9B 3S6CA 4BQ9A 5TDOA 3U0PA 1ZLUK 5SWQA 1IGCL 3HUJF 4ZNEE 3G5XA 3VFNA 2HVJA 5TFSH 1FNGA 1TCRA 4Y16B 3IDUA 2Q8BH 2VXUH 4QXTB 4XC1L 3IU4H 2H1PH 4V1DE 1CT8B 3QIWB 1QZ1A 1HSBA 1A3RH 4HIIA 2XG4A 3QI9C 4JRXB 4P3CL 4YE4H 1DSFL 2K7QA 4TUJA 1QLFA 2AABL 4ZD3H 1V7MH 3Q3GB 4M4PA 1SEBB 3I3BA 3DMMA 1Q9WA 2OQJA 1BVKB 2BNRD 5L2KB 2HJKA 1CLZL 5EC1B 5FYLE 5CILH 3OXSA 1JPGB 1EV2E 2FIKB 3ZHKA 5DJCB 2EEDA 4G9FA 1YPZF 4JHAH 5DJDB 1GAFL 3PWNA 5T1MA 3HE7D 4PUBH 4NUJA 1ZK9A 3CFCL 3LS4L 3DVIA 3JV6A 4KTDL 1K8IA 1T7ZA 2ZUXA 4XCYA 5CIPH 4Y5YB 2VDKL 4XNUL 3DX8B 4WJ5A 3IGAA 3V8OA 3P77A 1DQLL 3QPXH 3C87A 1JWMA 1U92A 4K9EL 5AUMB 1AO7A 2H2SD 3H0TB 2VDKH 3HPLB 3N0PB 4GS7C 1WWBX 3EHBD 4KI5E 1AKJD 4WHTA 2A0LC 1TZGL 5C07B 3X3FH 1BF2A 4NO5A 5EU6B 1YY8B 3P3YA 4KK5C 2V2WB 2VZSA 3V79C 1FJ1A 1WCBB 2K7PA 3F5WB 3KHOA 3RVUD 1EJOH 2XPGB 2Y9RT 4JFYB 2WIIA 5IVNA 3OKEA 2GTZB 4ZTPH 1EGJA 4YK4B 4FRWA 4M5YL 3Q6GH 3T3MF 1MELA 2AXHA 4PJ8C 3MV8A 3IDXL 2LTQB 5DEGB 2FD6H 15C8H 4LPUA 1FYTE 1NUNB 3DVGA 2VLJB 4PYHA 3UPAA 3RDTA 4Q74A 5FKPA 3ARFC 5E2TL 1PKQB 2DYPA 3RZCB 1DDHB 1LNUB 4G6KL 1OPGL 4IMKC 5IIEB 4JPVH 5LBSL 5D2LF 5IT2H 4ODSL 1ORSA 2NX5D 3DGGB 3PV6B 4OM0L 4PJ9A 5MENB 3LZFL 1FFNB 5J4MA 4O51A 1KXVC 2DYPD 3LKNB 4K07A 1IC4H 3PP4L 4I5BB 1BFVL 3HE7C 4QXUL 2OL3L 4YXLL 1R3JA 1P9MC 5F6IB 2VL5A 4KHXL 4ZUSA 3SE3C 3W0WE 5IHZB 3L3HB 3T4AA 4EI6A 1N7MH 1QBAA 4X6DE 2OP4L 5TPWH 1Z6JT 3T2QA 3LSOA 1UM4H 1XGUA 2F58H 3NZ8B 3STBA 2QQLL 2NY4B 3BKCL 2QR0B 4PJCE 1L9NA 2JJWA 2V5TA 3IKKA 3RHWK 2WBWB 4KAQL 1MCWW 4OBSA 4P59L 3FRUB 4ZDHB 2HP4A 2FWOB 1T89C 3WFBL 3QDGD 3O8XB 4GH7B 1GC1H 1JGVL 1NCUA 4M7LH 3ILQC 1EAJA 3DRTA 4HKJB 4XP6H 2CKBB 2NX5E 1MJ8H 4JM4H 5J12C 1J12A 1I1AC 3DBXB 3T0XA 4Z7QF 4JFDD 2FSEA 2LU4A 5DJ2B 4WU5A 3CX5K 3NACL 4HS6B 4ZS7L 2X4PA 3RVXC 5ESVA 1YUHB 1BQLL 1VFBB 3MOBH 1IC5H 2KH2B 4QHNB 4V2BA 4KJYB 5HHPA 2CXKA 1U93B 4XBGB 5MI0B 1FYTD 1BM3H 3LN9A 4YHLL 3LN4A 5JNYA 2J8UE 2HG5B 3C2AL 1I7UA 4PGZA 3OKNA 4ZSOA 4OKDA 1U0QA 3NCBB 4WFHD 2M2DA 4JDZB 2B7DT 3KJ6H 3BWAA 1FVEB 1MNUH 1J8HD 4FQQA 4GAJL 4CUCA 2DOCA 3RA7L 3MGTA 1W8NA 4O5LH 3ZT7A 3O2DA 1RVFL 2FJFA 2NMSA 4PV8B 4R90H 3MA7B 3SQOH 3A6BH 1T03L 4KI5D 5GGUB 3V5KA 4NO2B 1HH6B 4XT1C 2ZG2A 3C6SB 1NCTA 4H20H 4Q9RL 5D2NE 4OKVB 1CFQA 4FOMA 1Z9LA 2VL5B 2VITB 1QEWB 3AB0C 5DD3H 4OLVL 3IDNB 1JMZA 5C0CA 4JO2L 3ORJA 15C8L 4UU9B 5CLTA 3OJ2C 2IGFL 3DETC 5FM4A 2YD4A 3SQBA 4ALAH 3IU3B 4LLVB 4QHMA 4FQJL 4ZXBB 3GMNA 2AGJL 1L7TH 3WIHA 3VGFA 4X4MA 5FHAL 4XI5C 2XT1B 3E2HC 4Z7VE 5FKPB 2N7BA 2Z4QB 1JNHB 5DRXB 3G5VB 4XBEL 5IGXL 4QHUA 3TH3T 1I7RB 4XP5L 4JFOB 1MRCH 4Z7VF 1MSPA 5JXEA 3OKMA 2BRRL 3O8XC 2OP4H 2R0WH 3TJEH 2AJXL 3TBSB 2EYTA 2H26B 1X5IA 1UB6A 1ED3B 2BFVL 3MBXL 5IR1B 3L3DB 4D8PA 2PO6D 5EU6A 4HX1B 2P1YA 2VUYA 1DEEB 1A7OL 2PCPA 2E7BA 4HIHB 2VO5A 2IFGA 2ED8A 3VGDA 4YQXL 3QG6A 1KIRA 3FOLB 3IJSB 3EYSH 4DZBA 1Q8MA 1UCTA 1JWMB 4PLKD 3S98A 5HYIA 5IOPA 2PETA 3SDAC 5ESAB 1WT5C 2VXVH 4L8BA 3MRRA 3QPQC 3F6IA 3LKOA 1OGAA 2JIXD 4M8QB 5KOMC 3KXFD 4ORZC 1YEHH 4R4NC 4KY1H 1D6EB 2VSDA 5CEYB 3QDGB 4YHOL 5EZJA 4D0DA 2R2BB 3SDXE 3VA6A 4M1GL 2CQVA 4F7EB 2EZ0D 4MHHG 3OXRB 4AG4H 2VJXA 4X80H 4XPGL 2VR9A 4YXHH 2MQ0A 1TMCB 1TVHA 4WW2A 1OM3L 5LGJA 2B1AL 1IM9B 5LGHL 5D71H 1D5BA 4NN7C 1FAIH 3QQ3B 3V52H 2HWZL 2P5ED 4N8CH 3DX7B 1GGYA 1QFWI 5EZLB 4FTVB 4M03A 3L1OH 2Q87A 4CADA 1XF5A 3J7HA 3T8XA 4HK0B 1DANU 1T89A 5FM5O 1HSBB 3CFEB 5ISZA 4EJ1C 3TIEA 3M17B 2VLJE 3EDDA 1T1WA 4Y5XC 3CC5A 4WY7L 1P7HL 1G0DA 3VFNB 3GHEL 4QRRA 3X3GH 1BFTA 4PP2B 3L6FB 2EECA 1MCIA 2EC9T 4XNXL 4U6VH 2UZIH 1KLGA 3ILQD 4NJAL 1F97A 2XKNA 3WJJA 4LVOB 4HFWB 2ITDB 1IE5A 2VAJA 1AXTH 1I7TB 4KHTH 3KYMB 4R97C 4U6VL 3TIDB 1GGIH 4XC3L 4WFGD 5IVXE 2DLFH 2Z35A 4P2RB 2HYMA 3OV6A 1PYWA 4CJ0A 4R8WL 5IW6B 5D93C 1T5XB 1YMMB 3VFRA 3WYRA 1T20A 2FYYA 5IHUL 4Q0XH 1F4WH 2FLBT 4WI2A 3PL6A 1NAMA 4PRPE 3VD7A 3MOBL 3G6JA 4RWYL 3QBTB 1ZKAA 1FORH 2D9CA 3WHXB 1OGTB 5DT1L 2EC8A 3VD9A 3Q6GL 4ZS6D 5BOZG 3OTTA 3NFPA 5E4IA 1GC1C 4L9LC 3MLVH 4M7LL 3CK0L 4JG1H 1I1YA 4JGUA 3H3BC 3QULA 2X70B 1HQ4B 4YHPA 1XR9B 5BZDB 1EEUA 2O61B 2YMXH 4U31A 4OFIA 3U30C 3S5LG 1PJ9A 3U0WH 4XP9H 5F3BA 5E9DB 3VFTA 3LKPB 4QNPE 3O45A 4KI1A 4NZRH 4B53A 1MIMH 4MJIA 4OLZL 1KLGB 1B0RB 4GW5B 4L4TA 5BQ7B 3MRNB 3K4AA 3C5JA 1VGKA 4XMPH 5T5NG 4Q9BA 3TWCH 5HI4D 1I8IB 2X4TB 3EIFA 4QRQB 1QSFE 3BRGC 4JM2F 5FUZH 2HN7B 3P9LA 4FXGB 4LGRB 4OZHE 5KTEL 1OAXH 3ULVC 3MRKA 2PUQT 4BFBD 5EZIL 1XF5B 1WWAX 5GJSL 1BFOB 2PTUA 4EI5C 1KBGH 5EZLA 3HB3D 2VRAA 2GSGA 4JFFB 4ZUWA 5F89B 5E8NA 2DDQL 4Z7UB 1WIOA 3OJDB 4OQTL 1XH3A 5I30L 4GUPB 2A2QT 4P5TA 1UZ8B 1JGUH 4JY6A 3X14B 1F4AA 5C3LD 4RMSA 5D70H 4F7TB 3BMVA 4ZYKA 2JELH 1J5OL 2BNQE 3B2VL 1WBXA 3HRPA 1X6LA 3QSKB 4JRYE 3RGVD 3VXSD 1FL5B 4TQEL 3IDJB 1EEZB 5DUMH 1HKFA 4JFFA 4HJJH 2APWA 5ISZB 3D9AL 4FQJH 4Y2OA 1TCMA 5IOPB 4K7PX 5C8JA 1B0WA 3HZYA 4LFHD 3P30L 5D6CA 1LDPH 2GK0A 3TNMA 1EO8H 5D7LE 1KB5B 5DD1L 5IKCA 3OKOA 4S10A 3PGFL 5C0RH 1KENL 5TQ2H 4EI5A 3H9SD 3V4VH 4P5KA 4NQCE 4D9RD 2EDLA 3MV9A 4OCLC 4XAKE 5CSZB 2IADB 3SHSA 4PBXA 3MSPA 2VOTA 4IEFB 1RMFH 2A6JB 2BVUA 2XTJB 4PJIE 4YPGA 4JHWL 2IQ9L 5EC2A 4NZJA 4YHIA 2OCFD 2PNDA 4IDJL 2VQ1B 4PTUB 5LAXB 3BIKB 4JO4L 5AWNL 4M7KH 4DGYH 1U8QB 3UTSB 2DQDL 1NMCC 3KYAA 1AY1L 5F96H 4C55A 2FCBA 2R2BA 5EU3B 4Y4FB 2HRPH 5F88A 3HZKB 4K8RL 1T7YA 4JY5L 5KN5A 4Q97A 4L4VD 5I2IA 4J2XA 5J9PB 1G7IB 4EDXB 4M1CD 4Y89A 1HQ4A 5CJ5A 5F21B 2ESVD 5HHOB 2IQAB 2HH0H 4L29A 3GHEH 4UAOB 1JV5A 3H9YA 5FOBB 1DQDH 4XXDA 4F57H 1MVUA 4HGMA 4LSSL 2VDLH 3MUJA 4M6NH 3OF6D 2WV3A 4YDVB 5DMIH 3RNKA 3HE6A 1UZ6E 2I07B 4TSCL 3S88H 4WV1C 1Y0LA 3UZQA 1X4ZA 2IANB 5TF1L 3PWPA 3UTQA 3VRIB 5D7SL 3SGJC 1Q94B 3O0RH 3MUY1 2CRYA 3MQIA 5D7JD 5ITFB 1U8OA 3FT4B 3CSBA 1DLFH 1S9XA 1P4LA 1GCFA 4K3DH 1KIUA 2AQ2A 1IAKB 3TO4A 1JPFA 4XVJL 4OI9A 4JJHA 1ZE3C 1FO0L 1BBDH 3MRLB 3QUZA 2Q3AA 5C0AE 1PY4A 3C08L 3HKFA 2B5IB 4OUOA 1P7QB 1GHFH 3TA3D 2G75B 4GG8B 4LAQH 1HH9A 4NQEA 1C12B 2VLME 2DWDB 4NWTH 4GRLC 1QA9B 2F8OA 5TGBB 1YY9D 2PF6A 2YD5A 4IBLT 4JKPL 4BELD 4EN3A 5FUOL 4BKLA 3DV6A 3U7WL 4G43A 3GBNH 4IJ3B 4Y4HD 3U36B 4HBCL 3G08A 4ONHB 3TT1H 2HA1A 4HK0A 4PGCA 4JM2D 4KJWD 3WSQL 3P0YL 4KJPC 4YBHA 1MCBA 1EHNA 2W9DL 1YNLH 2JCCF 3BH9B 2VXQL 4MVBD 4KDWA 4LLMB 3MCKB 1RK1B 3W9EB 3ZSSA 4BQCA 5GRUH 3SO5A 3DBXA 4OF7A 1HHJA 2JCCB 3D0LA 2GJ6E 5DJ8A 5B8CB 2VIRA 2R1XB 1NMAH 4YDIL 1SY6H 3PP3H 2FH6A 3ARFD 5JZ7C 3DSNA 3U0TB 5CS7A 2IBGA 5CGYC 5BRZE 4PR5A 4AENA 5TE7L 2NY7H 4OB5H 4WIQA 2A6DA 4DN3H 1YEDA 2XQBH 4GAFB 4OSUH 3UROR 5GZND 3LRHA 2WUBH 4NNPH 4WWKB 3BRDA 1EX0A 5TE4H 4F2MA 2X44D 2ZUTA 3B9KC 3PGFH 3V0AC 3SJVD 1TETL 4N0FB 4XPTH 3TBYB 5TDPA 2YD7A 1KPUB 1XGQB 3EYVA 5IMOB 2MCG1 4RMTA 3SBWC 4AL8L 3TBWA 4K3GA 5E94B 3G08B 3TF7C 3MZTA 3OKLA 1AR1C 4RWYH 2ESVE 2XZAL 4PRBB 4U1SA 3S4SB 5DHYB 1OLLA 1E4XI 4NO0D 1U8OB 1ED3A 1W0VA 1BF8A 2PTTB 3O6LH 4Y1AB 4RGNB 1KCVH 4PRBA 3JVGA 1W8OA 2E7LA 3KHQA 3O4OC 5DDHA 5GSRA 1B4JH 1PKQA 1EUUA 4K7PY 3HMXL 3O8XA 3SBWA 3U1SH 3FL7A 1CD8A 3E3QE 2PO6B 5HYSG 4XP4L 1DBAH 4B5EA 1NFKA 1EO7A 4PS4L 4D9QE 4UI2A 1CN4A 5I17A 1FNLA 1KPUA 4WHYH 4O2CA 3WMSA 1UEMA 2UWEF 1NGWB 4A6YB 4K7FA 2BSED 1ONQB 2NY3D 2ICWI 5EO0B 5GGVH 1OD7A 4XAKD 2WQ8A 3NMEA 1UA6L 1HHIA 1KLFA 1U36A 5T1KB 4Y88A 3ZZ1A 2R2EB 4G8GB 5DMIL 2CKBH 4LHQB 3RIFK 5IB3B 4U1GC 3R4DA 1I8LC 4PFEA 1J0IA 4U1GB 4S1SH 3THMH 5C2UB 3TVMC 1KV3A 3IFLL 1UM6L 5GJTL 4F8TA 3PWPB 3UTQB 1G9MH 1HXYB 1Y0LB 4JO1L 2VC2H 3MXWH 1K4DA 4JDTL 2OR9H 1AO7B 3H0TA 1VEOA 3HR5A 4D9QD 3FHAA 2VAAA 1BWWA 1KPVA 2VXSL 5L2KD 5GS2D 1YQ2A 2CJUH 4JCLA 1R3HB 3MRHB 4JDVB 4Y4KC 4GRLB 5AWNH 4MB4A 3LHPH 4Z78B 3RIAK 3CH8A 4KV5E 4HXBL 2MPAL 5JA8B 1BZ9A 3EJYD 2X2YA 4YIQA 2X40A 2F74B 3TBVA 3A6CH 1T4KA 5GZOD 5IBTL 4H1LG 3BAEL 4RIRA 4PJ7E 2EIDA 3LKQA 1B2WH 5MEOA 2BNRB 1FL3A 3KJ4C 3FO2A 1EIBA 5EU6E 1O7VA 3U46A 4PY7B 4GKZA 5SWZE 5JW4Q 4HGKC 4LLMA 1R0AH 4PB0H 5MEQB 5ETUA 1QSFD 2QADB 1YEJL 3CVIH 5C92A 4NQDB 5JO5A 1CICB 1I9IL 1XMWA 5JHLH 5E08H 4HK3N 2B20A 4P2OB 1HILA 2ICWJ 5HGBA 4F9LC 2W65A 4KVCL 2GIYA 3QCVL 3AM8A 2WAHA 1MI5B 2ATKB 3N1PC 4M93C 3MV7B 5JA9A 1AC0A 2FO1A 4IHOB 4LCUA 2BERA 4M7JL 2YXMA 3QO0B 5A2IH 1UVQA 4N8PA 4HWBH 4F7TA 3EFFA 3DLQR 5DRZB 4NQTA 2GTWB 1RUPL 4PRDA 1MFAH 3LN5B 3JSSA 1ZT4A 3O0RL 5E2JA 5IEKB 2J12B 3WIHL 2JB6A 5DRNA 3HPJB 1RUQH 2YKLH 1SMAA 4IRJD 4MJIB 4FQ2L 1ZGLP 3FQXA 1KIPA 1WISA 4JPWH 4P3WA 5I2IB 3PDDA 5E9DA 3ARUA 1JNLH 1MHHA 4IOFC 5IK3B 1CTOA 4N9GA 4DQOL 5CZXD 5EFIB 1LO4L 1RZFL 1RUAH 2VLMD 4Y2DD 2RFXA 3NN8B 3QULB 4FQCL 1YQVH 4PJDB 5MENE 4JB9L 1QFOA 3RNKB 5J3HD 5C3TA 3WD5H 5F7HA 3BZEA 2PR4H 4Z95H 4PRIB 5C0AD 1WVZA 5F7YC 1NBZB 1U9KA 2YMXL 1E27B 5DQDH 3HCVA 2JJTA 2AK1L 3CXHJ 4P5KB 3K8KA 4WFED 4L4TB 4NQVB 2NX5B 2RFXB 5EWIH 1YEGL 2YK1H 4MCYA 3BPLB 5FYJE 1UC6A 4J3TA 1Q9KA 2H9GB 2GTZA 3TT1L 3KPTA 4PGBB 5GGVY 2WMPA 3P9MB 1UA6H 3L3GB 4K9EH 3SE4C 4XMLL 1WCBA 2CLVB 1DANT 4UV7L 3D25A 3TN0A 3KPOB 4AK1A 3BP7A 4LMQE 3MJ7B 3CFBA 1J0HA 1YA5A 4G9DA 5GHWH 1ZTXL 3MV9B 1TXKA 1FG9C 1BHGA 2AABH 1KJ2A 2MJWA 2EC9U 4L4VE 1HK6A 4GUPA 2ATKA 5E56A 5JHDE 2Z93B 4OFYD 1OHQA 4X7EC 1QBLH 3SE8H 3JV5A 1S9YA 2GFBA 1A1NB 3MRMB 2VZOA 1KG0B 1XIWC 3MLXL 3NVQA 1CR9H 3PQYA 1JRHH 1TZIB 3WXVL 2GI7A 2BY3A 1CFSA 4XB7A 4Z0BH 12E8L 4NN6C 5TDNA 1KT2B 3H9SE 1KBGL 3KYOB 1FC1A 4MS8D 4XMKL 3DHJA 3GDBA 4DCQA 5ACZA 1TVHB 4FMFA 4YDLC 2H32A 4E42A 3MLPA 4RAVA 1MHPL 2I9TA 2NXZB 5LCVH 5C09A 1BZ7B 5EZJB 5A2KH 4X6FB 2WWKO 3HNTL 3BRFA 1P53A 3CDGB 1F6LL 1N6VA 2QHLA 4MJ4A 3QAZC 5DA4A 2RGSA 3VXSE 4RFOL 2EKJA 4JRYD 4OJFH 1SVCP 4N9OB 4YFDB 1FPTH 4XBPB 3IS0X 3P9LB 3BKCH 5CSGA 3UMTA 3K2MC 5AEAA 4K3EL 4PRIA 2E6PA 4RNRB 2VABA 4YHLH 5EG6C 3SQOL 5K59E 1KEGL 4KRPD 3QCTL 1NBQA 1F4HA 2OMBA 1YEEL 4QLRA 5SWQB 4LHUA 2BNUA 4LPCA 5ITBL 3PL6B 3E2HB 3GRWH 3MJ7A 3LMJH 3L3DA 1S8DA 5K93A 1OGAB 5E5MA 3VWJB 1A0QL 3H3KA 5E8PB 5EIVA 3DXAA 4XNMA 5KSUB 4NPYB 2ERJC 1AQDA 5CBAB 4G8IB 2X1XR 2OTWB 2C3XA 1WITA 4WO4A 4TNWF 3T2OA 1ZT4B 1GZPB 1RZJH 5DRWA 4GBXD 1EAPB 1GGTA 4YHYC 4U7SA 4IOSD 3JWOH 1NCNA 1QRKA 3W9DA 1X5KA 1F58H 5I17B 5A16A 3TO4C 4LCUB 4UV4L 2VKXA 1CLYL 2PW2A 2ZUQB 4PTTB 5CFHA 3HMWL 1Q0XH 3GKZA 3DUSA 3EFDH 4K8RD 2CO6B 3CSGA 4Z7WF 2ATPB 1XCQA 3TBSA 5CP3A 1G1CA 2CDFA 2JJSA 5TF1H 3QDJB 3LZFH 5DK0B 3O3UN 1IVLA 1JZ4A 2W0FB 2C5DC 4Z76B 5HVWA 1OAQH 1NC2B 1JVKA 4WFHE 3MACH 4AMKL 1YMMD 2ENSA 5C9JB 4XWGL 3HPJA 1L0QA 3LB6C 4YZFE 2J3SA 5JQ6L 3IDGB 3PWLB 1RQ5A 1CF8L 3TPUB 4RFEA 2NXZC 4YFEA 2VDOH 3SGDH 2X4OA 1ZVSA 2HTLC 3CVHL 3QO0A 3CFEA 4JFDE 2WIMA 4KQ4L 4HKXB 4WFGE 3LIZH 1KJ2L 3ZYJA 1GL4B 2KDGA 2XV6B 1XGYL 3R1GH 2CR6A 4FTVE 4KZEH 4NC2B 5EO9B 4M9PA 5GRJH 2CR3A 3SE4A 1CFQB 4OCMC 1J11A 1LO2H 2PW1A 3MBEB 2YPLE 4PJCF 5HI3C 1D5BB 2IALA 2IAMA 3K3QA 1F2QA 2FJGA 3TM6A 5GGUA 1F11B 4QF1A 2VLJD 5AD0B 4M5ZL 4BSJA 2AEQL 4X6CF 4OZ4B 2R8SH 1I9JL 3MGTB 2FL5B 1MCKA 2EH8H 4U1IB 4MHHI 1D6EA 3GSQA 1C5BL 2BVYA 3KPMB 5HYQA 4PJDE 2CRZA 3RAJH 4IRJB 5C07E 2DIJA 2OJEA 5FM8A 1W72A 5HGHA 3O4LA 4J12A 2P5EE 3OKNB 1T4KB 2UVEA 4B50A 1OWWA 5F1IB 2Y07H 1WV7T 4M7LT 3F7VB 4K7FB 5DQDL 1HSAA 5DFTA 5HGDB 3VXRB 1WAAF 4KJYA 5HHPB 4MQTB 4RISH 4LQ1A 3F58L 5AG8A 5KSVA 1CK0L 1QFWH 5SWSE 1KJVB 3K74B 4PJFF 3D85A 4P23B 4MLIA 5HDOA 5CZVL 1M05B 5KG9A 4JFQB 2MKWA 5JIKA 5M7QA 1Q9OB 3QQNA 4LIQE 3CXDH 4YHZL 5BW7C 5HY9B 2O26U 1WBZA 4HKJA 3LKNA 5D1ZC 2NY2C 5IGXH 1V3LA 2KKQA 1RV6X 2QQKL 3FHQA 3DNKA 3NABH 4Q6IA 4P4KD 4M62L 3UTTA 4PJHB 4LHJB 3MREA 3MV9E 5IB3A 3VWJD 3MRBA 4BSWA 5I1HH 1FFQA 1SMOA 4F7CB 3E3QC 1NEUA 5IB1B 1MRFL 4K2UL 5DRXA 3G5YB 1RJZA 4LSPH 2H2SC 1S5IL 4EQ3A 1H15A 1A02N 4KDTA 1RJLA 4KC3B 2IQ9H 4ZOAA 3VCLB 3MRDB 2CUMA 4O00A 2OZ4A 1AD9B 4K94H 4O2CB 4YBLC 3SGEH 3MCLL 3UTOA 3M8OH 1A6AB 1C16A 4HIXH 3F65A 5I71B 4X7TA 4P2QB 3V4VL 3SCMB 5DDHB 2APTA 1ZTXH 5J8OA 2WANA 1RZ7H 2VITA 2ZSVB 4RX4A 5F9JA 3ARBB 2WBKA 4H1LA 4HFUL 4UT6L 3PDOA 4UUJA 1N3NB 1KJVA 3NCMA 3OAUL 1U41A 2OXGA 5DS8B 3U4AA 2CLZB 2H6PB 4HFUH 4UT6H 1FGNH 4ODVH 2FJFB 1WTLA 4MA1C 4MDJB 1DUZB 3IYLW 4MNQB 5L9DL 5F1IA 4JQIH 4WI4A 2KUTA 1KACB 2WLYA 3WIIH 2X4SB 4JN2B 1CE1L 4FXLA 1T1XA 3V4UH 4BFEA 2XN9A 3DV6B 1MEXL 2BFVH 1ORQB 3MROA 2RCSH 4G42A 2IAND 4Y4FD 1R0AL 2AJZA 1A5FL 1AGCA 2HT4C 5HDQL 4PJCA 5GS0C 2VDMH 4V1DD 4WW2C 5JPMA 1TJIH 2R1XA 2E3VA 4IJ3C 1JPGA 5AD0A 5EU5B 5E00A 2EYSA 1OSPL 3HPLA 2DD8H 2HJKB 4Z7UA 1RSFA 5DSCB 1GC1L 4XX1G 2NR6C 3W9EA 4OZIE 3HI6L 3AREC 4OF3A 4AZ8A 2YN3A 2ZCHL 1YN7B 3B6SA 1MCEA 3Q3GA 3IFOB 1CS6A 1I75A 1MIEH 1FYTB 4CGTA 4H0HB 1IAOB 1IGML 1BX2B 2D7OA 1L4IA 1I1AA 2G5RA 4OQTH 2FLRT 3E8UL 3NCCB 3V0WL 3SDDB 4FQXD 1DTUA 2R23B 3QWOA 5SWSD 5F7EL 2OSLA 1DBBL 4H25A 1IKNA 4LCWD 4WW1B 4GS7B 2IQAA 1RZKH 2QQKH 2VWEE 4WI6A 3U0PB 5ACLA 3IETA 5GS1A 3VH8A 5J9PA 2HJFA 2PXYA 1P84J 3QNYB 4ZO7A 1IEAB 1N64H 4XP1H 1JZ8A 5JTWA 5C0JB 4GG6E 5JW3H 5C07D 1IEHA 5DXWA 4YHPB 1FFNA 2HT4D 4FFZH 3L5XH 3B3IB 4PY8I 3UX9B 3NA9L 5CJXC 3IXAA 3GO1H 3QA3B 4M48H 5GZNC 5JW3L 2VDQL 1ZAGA 3EOYG 2CKNA 2FATH 2GT9A 1EFXB 2IADA 4G7VH 1Q94A 1BGXH 5E6IA 2PW2B 2O5YL 3WHXA 1EBPA 1R5WA 1GAFH 1JK8B 5BS0A 3B9KD 4DGVL 4XZUA 3GZKA 5DJ6A 3W0WD 3F12B 2JB5H 5FCUH 5I15H 2YPLD 3D85D 4O5LL 2V9RA 1T0NA 1YPZA 3HZYB 2Y72A 3JWDC 4XXDB 3MLWL 1HINL 2C1OB 2HFEB 4HWZA 1OAYL 1LP9A 2QJDA 4FTVD 4X98A 5BJTB 1ZHNA 4XAWH 4H0GA 2GUOB 4FQXC 4ZPTB 5FV1L 4OGZA 1WAAA 4O9HL 1WGOA 4LLDB 3L95B 4XBEH 3GSUA 5CMAA 3WUWB 4H26A 3L5WB 4YE4L 2J6EH 3BX7C 2VQ1A 4KTDH 3ARGA 3D69A 4OIAA 4QRTA 5LG1A 1RULL 2GJJA 2WBJA 5DFVC 1AHWA 1U92B 2F53E 3LIZL 1T04A 5CZVH 5EORL 3PJSB 3MGOB 1CZ8H 3MLXH 2XZCH 4CKVX 1P7KB 2H41A 1K8IB 4IMLB 3OZ9H 1JF6A 3GIVA 1H0DB 3QI9A 1I4FA 1YN6B 4F58H 3BPOC 1P4BH 3QZWB 1FN4A 2W07A 3VJ6A 4JY4B 1G9ML 2CMRH 4ORGB 3BPOB 5T5NF 1A9EA 3PG2A 1RZ7L 5D2LB 3OB0K 4CVWA 1NQBA 4KK5D 3H8NA 2I9TB 4JHBA 4JN1H 1PX4A 5F3HA 5AG9A 3S37X 1MREL 3KXFB 4JFEE 2UZXB 4N68A 5ERWB 3TH2T 1ROWA 4UQ2B 4X4YB 1FE8H 3HI1A 1H0DA 5TDOB 1UB5B 1CU4H 4MD4A 4W68A 4BFGA 4P5TB 5IFAL 3C60A 3BQUB 4LSDA 1FNEB 5IG7A 1A1OB 5K9KB 1I3GH 3WS3B 5E8EA 1RZKL 4YXHL 3IFNH 1CFVH 4Y5XB 2RB8A 1CFTB 1FIEA 4Q9QL 1NBYA 4KAQH 2LAGB 4YH6A 5FYLD 4LLWB 1UWEL 3IDMB 4P48A 2MPAH 2R29L 5IW1A 2JELL 4NBXB 5C0BB 7CGTA 2PCPB 1QO3B 3TGXA 1A0QH 2JTDA 2Z92A 2NY3B 1NMBH 3R8QA 1J10A 1SY6L 5ESQB 2EIEA 5BVPL 1YPZB 1MH5A 1VGKB 2FX9H 3MLTB 1Y18B 4I1NB 4LCWB 3QXVA 3D25B 3ARPA 4XRCA 1W72H 3WBDA 1VADA 2YC1B 3AY4A 1YEEH 1VEPA 2R2HB 1SJHB 4OLXL 4P2RA 2NXYC 4OB5L 1TFHA 2O5XH 2KQMA 4JFOA 3MODL 4PJAA 1V8HA 5J56B 1XR9A 5BZDA 3QNXA 4YEFA 4DKFH 5C0EB 5DD5L 4YDKH 4RSVA 2Z8RA 5IVXA 1A2YA 4KKLD 2GSIB 3T0EE 2C3HA 3ARBD 4R7DB 4X5LA 3E6FA 4HEPG 5LVEA 1IM3B 5E70A 5C08A 5KSAC 3WLBB 3U7AA 1FFRA 4LKXA 1PEZA 3MOAH 1CE1H 1MCNA 4OLYH 4LEOA 4PJ9C 3FT3B 4NQSA 1EO5A 5IT2L 1NUGA 1QPPA 4OZHB 1MPAH 3BP6B 5D7KD 1HDMB 3MCG1 2BOBA 2CK0H 2NY1D 3QEQB 1PG7X 3CFDB 5JHDD 4ZFFA 1TJGH 3I2CL 5JOEA 3I50L 4Z95L 3T2PA 3W2DL 5DUPH 2Y7QA 2HKHL 4AL8H 1EJ6A 1AI1L 1FFPB 4M6ML 2GTWA 1FNAA 3MA7A 2BY1A 3AMLA 4I18A 1EHLH 3HNSL 3O9WA 4HUWB 5DUPL 3IFOA 1A3LH 5DC4B 1RIHL 4OIIH 3BGMA 3LRSA 3M07A 1CFNB 4P59H 2G9HA 4JQXC 3CC5B 5HVGB 2OTUA 1MI5A 1ZHBB 4JFHD 1WICA 2ADFL 3RUGB 5CP3H 3EOAB 1QPXA 4KJQD 1UWXH 1I7UB 5KZCB 4P2OA 1EFXD 4YHML 2X89A 5CMAB 4X9IA 5GIRB 2AK1H 5HI5C 3OGCB 1B3JA 2K3TA 5GSVB 1C1EL 4CADB 4P2OC 4D3CL 4DZBB 1WEJH 3AS0A 1F13A 4X9FA 2XN9B 4LASH 3O6FA 5GGRA 4PD4K 5HI4C 2YEZA 5JHDA 3MLUH 4HX1A 3PWUA 4JANA 4NQCB 4NZRL 4G7YH 4CDGC 1EK3A 1ZHKB 1NGYB 4GW4B 2ZUVA 3VI3E 2A9MH 3KPNA 2GAZB 4R26H 3HFML 4WEBL 5IBTH 3H2WA 1N59A 2A74B 3LVEA 1CIUA 5F9OL 2NW2A 3MRCA 3RFZC 3ZKQD 1GJIA 5DFVD 3T1FB 3EDJA 4CL7A 3GNML 2F74A 4RZCB 1IL1B 5FUCC 3TBVB 3WNLA 1GSMA 4KXZI 3UYRL 2RIKA 1QHPA 2GHWB 1D5ZB 3RU8H 4L8BB 2QKIB 3RI5F 4Z7NE 4N8CL 4PLJC 4GRLA 2EDXA 4HKBA 4IRSB 1A14H 4NBZB 3SCMA 4M7JH 4Q6IC 5LKNA 1HHKA 1I7ZA 2YZ1A 3MLWH 4P46C 1XGPB 3QEUB 3T3PE 4ZAKB 2DQJL 2DQIH 1R3JB 4PJGE 1SEQL 4MQ7A 3RGVC 4FP8L 3VH8G 5T1DH 4ZS7H 1AGBB 2O5YH 3UP1A 4KQ3H 5DD1H 5FUCE 1T2XA 2IMNA 4M3JA 4N8VA 3I6KA 3IXTB 1A4JA 3V6OE 4MWFB 1DZBA 1I9RL 1MAML 3CVIL 2D7QA 2ZNWA 3QJHB 2A77L 1UXWB 1LHZA 1TPXB 1D9KC 1WC7A 2H32H 2DQTH 1TPXC 3P73A 1OAZL 1PEWA 3H3PL 1NANI 1IGTB 3O11A 3X3FL 3QXDA 2IFFH 3TNNB 4NCC1 3OAYK 1T0PB 3GK8H 4JFQA 1M05A 1BQSA 3TPKA 3S34H 4POYA 5H94B 1UGNA 3PF2A 5GS0D 5DQ9B 3HUJE 1IT9H 5GSRB 4QEGA 4KFZC 4L5FL 2X6MA 5DJYB 3C60D 3U4EA 1CL7L 1XF3A 3W39B 3D2UD 1NFIB 4L8SC 3TJEL 3ZE0F 3TH4T 4HPOL 3QXAB 2YSSA 2P43B 2A83A 2ZJSL 4IDLA 4K3JL 4TTDC 2VR4A 4NNXA 3E1F1 4DGYL 5DQJB 1JHLH 2DKUA 3CX5J 2ARWA 2VLRD 2FHCA 2FGWH 2GAZA 5CGMA 2AP2A 4WDIA 4K7PL 5L2KE 4M4RA 3ZHLA 4F7PA 5FECA 2N4IA 4HCRL 4WJ5B 4X8JB 5FUZL 4XPHL 3KPSE 1G7QB 3QJFA 3KPRA 4OFPA 4OCYH 4P57A 1IRAY 3ECBA 4FQLL 5I1JL 2L0DA 3S9DB 4PJ5D 2QHRH 1M71A 3PDOB 1HCFX 3HNVH 1LVEA 4YHKL 4JDTH 2VZ3A 3MUGB 3NPSC 1KXTB 5F7LB 1RHHB 2FR4B 1F4WL 2C7UB 1ITCA 4I3GA 3MLYL 4P4RA 4X5WA 3LPGA 4JRXD 5I19L 1UWGL 3FT3A 3SDCB 2ADIA 5IHZA 3RWJA 3BH9A 1KJ3H 4RRPG 3VDBA 2CGRL 1IM3A 4FNLH 4WU5B 5HHQA 3MTRA 4X4ME 3AU1B 3QUYC 1HYRC 4ZS6C 2J4WL 3U36A 2DM7A 4LLYB 1CXKA 1B90A 3O2DH 2WNGA 2NY6B 2HJLB 5D1QA 4OLWL 1N8ZB 1B2WL 4NWTL 4N0YL 4CN1A 4LF3B 1HDMA 4K94C 2Z0BA 5J6GA 3SJVE 2AJVH 1CDIA 3FRPA 5M94B 3MA9L 1DVFA 1K5NB 2GQHA 3GMRA 3O3AA 4BQ6A 4B0MM 4N90D 4HZLB 1CVSC 3VXMB 4BQ8A 3NIFE 4XI5D 1RFDL 4PJXE 2QSCH 3TWCL 1E6OL 1A14L 4JREB 5FKAA 1S5HA 4U0RB 2DQDH 5FF6B 1CD1A 2EYRA 4G6JH 5K33A 5BRZD 3VDCA 4RQQA 3D48R 2JJTC 1NKOA 3HZMB 4JR9H 3O8XD 3NCEB 5HVHB 1CFTA 3QUXB 4TOYL 4RAHA 2VWEC 1XFPA 2DQGL 1IT9L 3BH8A 3QHZH 3VA2C 3VGBA 1IBGH 5C0BD 4QKXB 2DJUA 4BJLA 3OX8A 4XHJD 3BQUA 1KCUH 1VGEL 4RGOL 5E2UL 2ZPKL 3ULUC 2P24A 2DLFL 2J8OA 2ZCKL 3GRWA 4LPWA 1V5JA 3VGAB 4ELMA 4F8QA 4YWGL 4WV1B 4N5ED 5T5FL 5GGTA 3BZDA 1PW3A 4J4PD 1QSEA 1Q0XL 2FX7H 3S36L 2DLGA 3IB4A 3RWGA 4TQEH 5IEHA 4MXWH 5IQ9A 3CUPA 1CGTA 3MBEA 4GAYB 3ARTA 3QXUA 4P23D 4PJFE 4MXQD 4LLUA 3M45A 1ACYH 1FLTX 4IRSD 1SBSL 3FQWB 3MLUL 3MRPB 2YRLA 1JI1A 4L4JA 2ZG1A 3DMMC 3QI9B 5FXCH 3QB7C 5C7XL 1FL6A 2VLLA 1NDMB 2EIZA 3DMMB 1FG2B 3AM8C 3SPVB 3D3VD 4JKWA 2J8UB 1BFVH 4Q2ZB 2UYLB 4PJEE 3QIUD 5L8JB 4JKLA 1JHKH 2ZUUA 1TTGA 3W5NA 5JW5A 1TNMA 4G6KH 5C0ND 3S35H 1NC2A 1EGJH 5INDA 4TSCH 4I2XB 1XGYH 3O2WH 3BDXA 5SV3A 4YC2C 1VFMA 1MWAA 3CFKA 5IW3A 5F93C 1P69B 3TA3C 5DD6A 3IDXH 1X5HA 4R4BB 1HHGA 3P30H 4U1NB 1AHWC 3U79A 2VDOL 5D2NB 4XNQA 2QEJA 2AI0L 1QACA 4KGLA 1AXIB 1ND0B 1CL7H 2ICEA 4LNRA 3CCHA 5I1EH 2BSSB 3BH8B 3OKKB 5IVXB 4HSQA 3S88L 5LCVL 3ARDC 3CDYA 2F9BT 5TE7H 3WN5C 2F54A 5IFJB 2Q8AH 4U05A 3MRPA 3FQWA 1GGCH 4L8DB 5EIIB 2J5LC 1EHXA 1ADQH 4ZOCA 1TVBB 2VDML 4ODVL 1CDGA 1NPUA 2DQFA 2VLRB 2DM2A 3G6DH 1PVHA 2EYRB 2PYFB 3EO0B 2BMKB 2GK2A 4NFBA 1JIBA 2AV7B 4OFDA 1MQKH 1SJVA 3HC3L 4HWZB 2BJML 1MNUL 3K2UL 4NQCD 4D9RE 4W4OA 2CK2A 3KDMA 3TZVC 1KNOA 1ZLVH 3CFCH 1U8NA 4Y16C 5D7LD 4K8RC 3VH8B 2AXGB 3EYFB 1IGMH 2MHAA 3C5SA 3VGEA 1IZJA 3GUTA 2QSVA 5I1CL 4IMKA 4L4TE 3LD8B 1AKJB 5DFWH 4KRNA 3CJJA 4ELKB 4NNPL 1YEJH 4OAWA 5T1LA 1OB1B 1C08B 1DR9A 3RTQA 4GRLD 4L4VA 4U4BA 4E41B 2EXYD 1TZGH 2JK5B 3UDWC 2AEQH 1N5YL 3VWKA 2F5BL 3SDCD 1BX2A 1NUFA 2DQHL 2E9JA 4NM4H 2R0LH 3QHFL 5I66B 2GJZA 3QHZL 3Q6FB 3OKKA 4KH2A 5CP7A 3ISWA 1IQDA 4O2EB 43C9B 5JR1L 1BQHB 5DWUH <