5F8BA

Crystallographic structure of psoe with co
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
MVFGTLYTFPGDQCRTIAIKAVAKANGLDLDIRETPRTPDHLSISKLGKVPAFQGADSFKLFECMAIALYITSQNEQTTLLGKDKKEYAEIIKWMSFFNTEIVILMTQQLLPQLGVIPYDRDQVEFFANMTQRSVDVVEEYLQDRTFLVGDQLSLADLFCAGNISLGFQFFYGKAWRQQNPNVSRWYEMVCHQPIYAAVTDKFQLLDEPKLTNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, putative
publication title Oxidative trans to cis Isomerization of Olefins in Polyketide Biosynthesis.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Transferase
total genus 71
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f8bA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f8bA01
2RUFA 5D8IA 4MJBA 1FB0A 3LEFA 12GSA 3FRCA 4O92A 2IMKA 3CTFA 3MNGA 1TRUA 3M0FA 1VF2A 4AJ7A 1OE8A 5IO0A 3IPZA 22GSA 3KXOA 1HNBA 5ECMB 4KW6A 4BVYB 4G2EA 3F6DA 3GURA 4YAPA 3WT2A 1U3AA 1O6JA 2IPAA 2OADA 3UOMA 4MJEA 2H73A 2ON7A 3E9JB 5DAKB 1HYUA 2KP2A 1ON4A 3QR6A 5EVOA 2VM2A 4N0VA 4K2DA 3ZTLA 2L5LA 3M3MA 3C8EA 1XBSA 2X8CA 3GL5A 4GLTA 3LXZA 17GSA 3PGTA 4L5OA 1UA5A 1HQOA 2L4QA 3FYGA 1FG4A 2CX3A 2K8SA 3ZVJA 2KHPA 4Q5QA 5A5KA 3OR5A 3UJ1A 4HI7A 3LFLA 3DKSA 2LQOA 2H8LA 3VLNA 4KGIA 2OBKA 1G7EA 2HRAA 3TJFA 2DBCA 5DCHA 3IC8A 1GULA 4ML1A 3LSZA 2R37A 2JSYA 3CBUA 2K9FA 1EGRA 1E2YA 2VO4A 3QMXA 4NMUA 3A2WA 2H71A 2H66A 3SBCA 2I9HA 1C72A 1X9SB 5IOXA 2OJLA 2V2GA 2YWIA 5EPFA 2EIQA 3KM6A 2OA7A 5FWGA 3M9JA 1O8XA 3PR8A 3EWLA 2C8UA 2YP6A 1K3YA 4IW9A 2ZCTA 4PQHA 1JLWA 2H0HA 3R2QA 3F4SA 1T7PB 5GAND 2JSZA 2DC5A 2YWNA 4ZL9A 3TRQA 2O8VB 2DIYA 3ZFLA 1W4VA 2V41A 4TR3A 4H86A 3DYRA 3TOUA 2YV9A 3ERGA 3EURA 1DBYA 1X0RA 1A2LA 3IK7A 4KE3A 3IBHA 1PRXA 3A2XA 3TCOA 3CRUA 4NHZA 5ECLB 3FR3A 3F4TA 5CRDA 4O32A 2L6CA 2NDOA 2OE0A 1THXA 2E0QA 1PKZA 1BX9A 2C3QA 2MMZA 1GNWA 3O6TA 3GA4A 2PGTA 1WPIA 1EWXA 4G0KA 5E59A 2CZ2A 1DE1A 1JLVA 4G0LA 1K3OA 4ML6A 1K0CA 1WRYA 3GV1A 5J41A 1V58A 3KTLA 5HR2A 4CW9A 2E2GA 1GSSA 3ZREA 1URMA 16GSA 4BL7B 1V9WA 2DJ2A 2B5YA 2YNXA 2H30A 2HQTA 1SKSB 4ZXGA 3HJPA 1E6BA 4OWYA 4JBBA 2P31A 4ZB8A 4X1UA 3D5JA 5ECNB 3GKMA 3FZAA 2VL2C 2ZUPA 4GWRA 3H8QA 2IMFA 2HZEB 3KTBA 1B9XC 5HR1A 1QUWA 2FD3A 2ON5A 4ZBBA 3HJOA 2B7JA 5GZZB 4HDEA 2PERA 2CV4A 1SL2B 1AQVA 2N5AA 1F6MC 2IFQB 2FHEA 2L4CA 4WR4A 3H1NA 1YKCA 2GT6A 3L9SA 5IO2A 3D0ZA 5DJMA 1EP8A 4MH3A 4KSOA 1B4QA 1PKWA 5ECIB 1XOAA 2A4VA 2WZ9A 6GSSA 2GSRA 5IIZA 4XS4A 3GX0A 2DJKA 1ZGNA 4DSSA 2TIRA 3GTUB 3J7Yb 4EDZA 4L8EA 3L0HA 5FT3A 2J23A 1XWGA 1YZXA 2F9SA 5KN1A 4V1Ap 3GL3A 2V1MA 1AUCA 4POKA 2LRNA 3P8WA 2ZNMA 2H76A 1S3AA 1M99A 2YZHA 5G30A 1VGLA 2CA8A 3RDWA 2DIZA 2IJYA 4N10A 4KSMA 3I9V2 3APQA 5ELAA 2C3NA 5CAXA 3HD5A 4EC0A 1X9WB 2I4AA 1N2AA 2CQ9A 1SENA 4TN8A 4JEDA 5D73A 2LKUA 1GUKA 3KP9A 2VD0A 2HRNA 1X5DA 5DBQA 1X9MB 2CX4A 2NBSA 5IMCA 4KCAA 1M9AA 3EMXA 1OYJA 2QSIA 4ECJA 4LL1B 4MF6A 3GKKA 3F63A 2VCZA 1GUMA 3ERWA 1O81A 4F0CA 13GSA 4F0BA 2F8FA 2JACA 2L57A 1VF1A 3CMIA 3DD3A 4MZCA 3F0IA 3UEMA 3TB2A 4IN0A 1FW1A 2YOIA 4TR1A 1FB6A 1XW6A 4JE1A 19GSA 4YQMA 4OCFA 2WGRA 1KNGA 3GN3A 3HDCA 1CQHA 4JR6A 5DVBA 3EMPA 4HZ4A 1SD9A 1JZWA 2HRKB 2G0FA 3IK9A 1SJ6A 2IN3A 4K6XA 2HE3A 4NXIA 1GUHA 3ZYWA 4IGJA 2MMAA 3Q18A 5CO3A 3QFBC 2HRFA 1TI3A 4HOJA 1T1VA 2JU5A 3F6FA 4ECIA 18GSA 3KP8A 3I6AA 3GRXA 4BVXB 5JCGA 3FHKA 2LNTA 4RI6A 4YH2A 1EZKA 2XHFA 2P0GA 2GSTA 2YANA 2QKEA 2H0GA 4HJ2A 1GSEA 5ECOB 1HNAA 3TKRA 1Z6MA 3F8UA 4AF2A 5H5QA 10GSA 5HR0A 1S3CA 2GTUA 1SJZA 2CVKA 4Z7XA 4TRXA 1M2AA 3DGQA 4DEJA 2PVOC 4ZB6A 1G6YA 4HEA2 3E0UA 4USSA 5AN1A 2FWEA 4KAEA 3HVXA 1CQGA 1T00A 3G7YA 2MBTA 5J9CA 1TI1A 3GMFA 1OC9A 3A2VA 5AISA 4FQUA 2RUEA 2DMLA 4IP6A 2F3MA 2F51A 1A8YA 5J4UA 4AJ6A 3UBKA 2HSMA 4GQCA 1GTBA 1M9BA 2OE3A 2FWFA 1XFLA 2H19A 4WBJA 1B48A 2GT5A 4E8EA 4TXOA 4GSNA 4HJMA 3HA9A 5JWRB 2HZFA 1GLPA 5A4UA 6GSWA 5ECRB 9GSSA 2LSTA 4V2NA 3P90A 4EL1A 3VK9A 4MCUA 3TKSE 3GIXA 2LQQA 2DJ1A 2C0DA 5IOWA 4PTSA 4I2UA 4TR0A 3WGDA 3VWWA 1XIYA 5G1KA 2CVDA 1XPVA 4IELA 4ACSA 5ABRA 3UMAA 1AXDA 4ZL7A 3M1GA 5GAPD 3VWVA 5IMFA 2I3YA 3VPTA 3RAZA 1K0NA 1SYRA 1RW1A 3H93A 3BD2A 1MDIA 2J9HA 1GTUA 2GDRA 2FCHA 4D73A 4XS6A 3J7Yk 2PUKC 3QAGA 2O89A 4NAXA 1GTIA 1X5EA 1JZDA 4ZBDA 4MPFA 4MA9A 1K0DA 5KN0A 4K0GA 4KNDA 5DQSA 5ECQB 2LRTA 3EINA 1B9YC 2M80A 2KP1A 6GSVA 3IXRA 3ZVJD 5ECKB 4NV2A 1V57A 3IV4A 2IMEA 2DLXA 2NVLA 2GQKA 2GZYA 2IWTA 2YWOA 3RHCA 1J9BA 1BEDA 3TRPA 3VWUA 1R4WA 2YV7A 2C3TA 1IYIA 3HJMA 3LXTA 3ZIVA 1GSQA 4YAVA 1YF0A 3RBTA 3NIVA 2A2RA 1EEMA 3EVIA 3DVXA 2RM5A 4MABA 3CSJA 1NSWA 4FIWA 2PWJA 1XZOA 4WXTA 1RQMA 5HR3A 2L6DA 5D9XA 1GSDA 2HLSA 3EU4A 5EL8A 1ZMAA 1A8LA 3TJKA 4IS0A 5J5NA 1TJDA 5A4WA 2HI7A 2LEGA 1MD4A 3IAM2 1HD2A 3NOFA 5LCZA 1M7TA 4ZBAA 4BWSA 2VL2A 2FWGA 1M0UA 2CZ3A 1ML6A 2PPTA 2RIIA 1J0FA 3FKFA 1AQWA 2VCWA 3WYWA 1UC7A 2LTKA 2B5EA 3GKNA 1MTCA 2GS3A 1U88A 4KH7A 2TRCP 3W8SA 2X8GA 4FH8A 3GH9A 4HU9A 1IYHA 1I5GA 2YPMA 3C71A 2DJ3A 2OKAA 1XWBA 5KN3A 1EV9A 1XWAA 4FYCA 2PN8A 2B6MA 1VRSD 2E7PA 1ZL9A 1WE0A 1AW9A 2O7KA 2REMA 1TK0B 1A24A 3QCPA 2YJHA 5D96A 2PBJA 2IL3A 3CSHA 4XHMA 4QQ7A 3ZZXA 4MH2A 2BTOT 3KJYA 5B6MA 2YWMA 1V40A 3LYPA 4EXJA 4BPYA 5LNKe 1MDJA 2NTOA 2OBIA 2VUPA 3M8NA 4IJIA 5G5EA 1QFNA 3RPPA 4K7OA 4EF0A 1T3BA 4K7IA 3FR6A 3LWAA 2FA4A 4NPBA 3US3A 4J57E 2K8VA 1GL8A 3KIJA 1Y25A 4EVMA 3WD6A 3VI7A 2V6KA 2A2SA 1GSFA 2AHEA 3PPUA 1YEPA 5ID2B 2JADA 5CRWA 1JZOA 4XIHA 3DIEA 2HYXA 4IHUA 4X0XA 3KH9A 2HSNB 3ED3A 1WOUA 3G9BA 3HVSA 1EGOA 2PU9C 2LJAA 4IJ3A 2P5QA 2DJJA 4IQAA 4GCIA 2GSQA 1F3AA 2H1GA 1WP0A 3F9UA 3KD0A 4DVCA 4L0WA 3IDVA 1R5AA 2B7KA 5AIVA 3TOTA 5LD0A 4IKHA 3ZRDA 1WJKA 4KCEA 3FW2A 4RQRA 3KH7A 2H6ZA 2AB6A 2B1KA 2K6VA 1BAYA 5CYYA 4K1FA 4ZB9A 2E2MA 3L9UA 4WEYA 3TKPA 4HU7A 4E8HA 5JWOB 4KB3A 1GP1A 3ZIJA 5CNWA 1O85A 3HVVA 2C80A 5AGYA 1Z5YE 3PINA 3ERFA 2MMOA 4V2LA 4ECBA 3SWLA 2AUVA 5G2ZA 2WRTA 2V6OA 5E4WA 1A2MA 4LLRA 3HZ8A 1O8WA 1GNEA 2VCQA 2XBIA 5H5SA 4KDXA 1EEJA 5ECSA 5DDLA 4TKYA 3LQ7A 3IOSA 3MAKA 5B8AA 5D93A 4IVFA 1R26A 1XOBA 1U6TA 1GH2A 4EDYA 5J9BA 3DEXA 1K3LA 3TJJA 1PN9A 2OACA 3Q6OA 1JHBA 3LORA 3L4NA 1Q98A 1PL1A 4ID0A 5ELGA 4EKZA 4NV5A 5IM9A 3QAWA 5HFKA 3KGKA 5CP1A 3QDNA 5DJLA 4G0IA 1SL0B 1YY7A 5G31A 5D9VA 1A2JA 2DMMA 3I69A 4FYBA 3TKQA 3G7IA 3RPNA 1JZRA 3QPMA 2N5FA 2EIRA 3TJGA 4BL7A 1SK2A 2CVBA 4KX4A 2EC4A 2FNOA 2MBSA 5DALA 2G2QA 1F3BA 4G10A 2VAFA 5HQPA 3LJRA 1EV4A 4MP4A 4K7NA 3E3EA 1YEXA 4I6XA 7GSSA 4MZWA 1K0BA 2HZEA 1PL2A 6GSTA 3P2AA 5ECHB 5CRGA 4RQXA 5CREA 4KF9A 1SU9A 1G6WA 3KMNA 3EYTA 2EIOA 2R2JA 2IFQA 1PGTA 3BOAA 1XVQA 3FY7A 1EOGA 2CAQA 2H1DA 3BCIA 2FGXA 4Q5NA 2JZRA 2MMNA 2VOCA 2R4VA 4HQSA 1OKTA 4MK3A 3UVTA 4G19A 3W6GA 3DWVA 2FWHA 3DMLA 4MF7A 1SK0A 5JCUA 1ABAA 2C0FA 2VL9A 2WULA 4I8BA 5G5FA 1Z7RA 1R5PA 4GF0A 1Z6NA 2LJKA 1V98A 1THOA 2WDUA 3ZMKA 5AIXA 3KEBA 3GTUA 3GUSA 1K0MA 3GNJA 3MWHA 4WBRD 2FA8A 1A0FA 4POLA 4JR4A 1SKRB 4CHSA 3CSIA 1FVKA 1NHOA 4YQUA 2AJQB 1W89A 3TDGA 4GXZA 1ZYQB 1WWJA 3HKRA 1SL1B 4PUAA 1T8EB 1ZCPA 2JZSA 1U3IA 3UL3A 5JWQB 5IPGA 1YF1A 2VLUA 1XWCA 1ERWA 4EUYA 4OFNA 4XTSA 4G9HA 2HT9A 1PX6A 5IMVA 4Q5FA 3NZNA 1SK1A 3F3QA 3TUEA 3GX8A 4TR4A 20GSA 3ZMLA 2FUG2 2M46A 2D2ZA 3RHBA 4YQVA 5H5RA 1B8XA 5D9TA 4OCEA 1AC1A 2LRCA 5GSTA 3HXSA 5D9WA 1YKAA 5A4VA 1TRWA 2PMTA 1KBNA 3JCML 3Q19A 1TRVA 2X64A 4ULXA 2M72A 4JZQA 2NPBA 3EC3A 1OC8A 1DSBA 2HRKA 2R3XA 1ILOA 3CXGA 4MJAA 4MDCA 2F8AA 1OC3A 3WGXA 3I43A 3O3TA 3C73A 3DXBA 1G0TA 4TW5A 3GSTA 2CT6A 4N0ZA 3QOUA 4MMMA 4L5LA 1TK5B 3APOA 2HSHA 3FEUA 5CRHA 1F9MA 6GSUA 3TKSC 2FY6A 4RI7A 4BVXA 4ECCA 2X99A 1BYEA 1TXXA 4I5QA 2QC7A 1JFUA 3ZL5A 4NWYA 1SJIA 1BJXA 1KEBA 5GSSA 1PD21 1T4ZA 1XCCA 2YJ7A 4OO4A 3ISOA 1QK8A 3M9KA 1YDKA 2BMXA 1RK4A 5EY6A 3VI5A 5INYA 5FHIA 4PURA 1OVNA 4IBPA 1ERVA 1XXUA 1F2EA 3CRTA 3FZ5A 1V2AA 2LV3A 3KCMA 4JRRA 2C0EA 1Z3EA 4XRDA 2B1LA 1BQ7A 2IMDA 3GYKA 1GRXA 5B6NA 2YZUA 1NM3A 1LU4A 2IMIA 4LA1A 4AJ8A 2CAIA 2DSAA 2LS5A 1DE2A 4CDOA 4DSRA 3D22A 1PMTA 5F06A 3UARA 1YQ1A 4BWQA 2B3SA 3UAPA 4POMA 5DCGA 4XS4B 3EU3A 4HS1A 1SD8A 4QL9A 4DSSB 4GRFA 1M2DA 3MSZA 3FZ4A 3TRXA 2QGVA 5KEJA 3R3EA 4XS1A 4WF4A 4EE0A 3BJ5A 6GSXA 2O87A 2H6XA 2VIMA 1BG5A 2OE1A 1TKDB 4GTUA 3ZLPA 2HSYA 2WFCA 1XW5A 1WIKA 3VPQA 2VCXA 1ERTA 4TOPA 3F3RA 4OFMA 3HHVA 4RUVA 2N5BA 3H4KA 4F2IA 1K0OA 1TOFA 1I9DA 1YJ6A 4EO3A 4OMVA 4OD7A 4BVYA 2DJ0A 3QD9A 1S3DA 2H01A 3FZ9A 1EOHA 4P3YB 4PUFC 1O73A 2H1AA 4V2MA 1FHEA 2KUCA 5DAKA 2R6KA 1N8JA 3QFAC 5IMDA 2I81A 3FK8A 1HNCA 3PH9A 4K0NA 1TU8A 1ZYEA 1GSUA 1AAZA 2WS2A 2LJRA 5F07A 2VL3A 4K8MA 5ECPB 4HZ2A 1USBA 2WB9A 3DVWA 4PGTA 4GQFA 3KMOA 3QAVA 5F0GA 4I97A 5HFGA 3HYPA 3G7JA 2VCTA 2FLSA 1A23A 3L78A 4WKWA 4TR1B 1XWKA 1OKDA 4N30A 1SYXA 2XC2A 5DALB 2H72A 2RLIA 3D21A 1QXHA 4ZIJA 4TXVA 3MDKA 1GTAA 4FYUA 4KDUA 1U87A 3N9JA 2GQLA 4ZILA 1XW9A 3Q74A 2GZZA 4XRAA 2RM6A 3K8NA 4HUAA 2KLXA 1GLQA 1XVWA 4MF5A 2AV4A 2HNLA 3IA1A 4IP1A 1GWCA 4F9ZA 3UBLA 3ME8A 5HFIA 5KN2A 3D6IA 2KOKA 2C1YA 1NW2A 2LUSA 3VFIA 2XPDA 1K0AA 1TP9A 3C1SA 2C4JA 5IQYA 3IR4A 5B7CA 4J2FA 1EP7A 3H79A 4F03A 4PNFA 2V32A 4KDYA 3LGCA 1UN2A 2MZCA 2GQMA 3IC4A 4TVEA 3GSSA 4PNGA 6GSYA 5B8BA 2H74A 2JZTA 1PA3A 2YN1A 4QL7A 1FVJA 4GSTA 1R7HA 1ST9A 4PQ1A 3AY8A 3ZITA 3W8JA 3IHQA 5ENUA 1PSQA 4GSSA 1MDKA 3A5WA 2XBQA 2VCVA 4K9ZA 1OC9B 1X5CA 2YCDA 5F8BA 2ALBA 4Q5RA 5L71A 1QQ2A 2XPEA 1TU7A 1OAZA 3C1RA 3VWXA 11GSA 2AAWA 2HSMB 1O7UA 4I2TA 3GKXA 4POBA 5COHA 1B4PA 4TXOB 4L0UA 1H4OA 1GSYA 4FO5A 2K18A 2VLTA 4LMWA 3F4RA 4O7HA 1LBKA 2VLVA 2AYTA 1MEKA 2L5OA 4NHWA 2P5RA 1G7OA 2MYGA 2H70A 4JU5A 3IE3A 3ZFBA 5G1LA 2HFDA 1SKWB 5F05A 1TK8B 3L9VA 2L59A 1TW9A 4MZBA 3BBYA 1KTEA 3IAS2 5ID2A 2WCIA 4ZL8A 1VF4A 1ERUA 4PX1A 1QGVA 1F37A 3FR9A 4LMVA 3EE2A 14GSA 8GSSA 2ES7A 5IMZA 2I1UA 2R5GA 1M2BA 1H75A 4V1Ag 1LJRA 5IPHA 3U6VA 1FAAA 4N11A 4D73B 3VURA 1UVZA 4KUNA 5DQYA 2GZPA 2HXKA 4O5RA 4BA7A 3GFKA 3HCZA 3TJBA 4AGSA 3UVHA 4X43A 4MPGA 2Z9SA 5BMUA 1A0RP 4WETA 2JL4A 4XCSA 2GSSA 3V1WA 2X8HA 5C04A 1ACVA 2H6YA 1J08A 3D4TA 2H0IA 1AQXA 1Z9HA 4IQ1A 2VD1A 5J3RA 3P7XA 3A3TA 2WJUA 3D4MA 4WR5A 3IRAA 3C7MA 1WMJA 3GHAA 2IIYA 3WT1A 2BJXA 3CYNA 2GLRA 2GVPA 2H1BA 3WGEA 4KA0A 2H75A 2B5XA 5JCWA 1OE7A 4ISDA 1TTZA 3APSA 3N5OA 1PQNA 4PXOA 3LYKA 4WF5A 3TKSA 3HZ4A 3KZQA 3O76A 4OFTA 1TDIA 3UIWA 2PVQA 2O85A 2UZ8A 1T4YA 3U5RE 3BCKA 1Y6EA 3TGZA 3ME7A 2TRXA 1ZZYA 2C0GA 5IMAA 1Z7PA 4MJCA 1QMVA 1NHYA 1MD3A 3HY2A 4OO5A 2VM1A 4DSQA 4MLYA 1Q4JA 1FO5A 4J56E 1AIUA 3LG6A 1ZOFA 4HQZA 1FOVA 4LL4B 3GH6A 2LNSA 5C00A 1PX7A 3CTGA 1TRSA 3S9FA 4PQIA 3DRNA 4F82A 2GGTA 4ILFA 1DUGA 1VF3A
chains in the Genus database with same CATH superfamily
2RUFA 5D8IA 4MJBA 1FB0A 3LEFA 12GSA 3FRCA 4O92A 2IMKA 3CTFA 3MNGA 1TRUA 3M0FA 1VF2A 4AJ7A 1OE8A 5IO0A 3IPZA 22GSA 3KXOA 1HNBA 5ECMB 4KW6A 4BVYB 4G2EA 3F6DA 3GURA 4YAPA 3WT2A 1U3AA 1O6JA 2IPAA 2OADA 3UOMA 4MJEA 2H73A 2ON7A 3E9JB 4K5RA 5DAKB 1HYUA 2KP2A 2OT3A 1ON4A 2O5VA 3QR6A 5EVOA 2VM2A 4N0VA 4K2DA 3ZTLA 2L5LA 3M3MA 2X8CA 3C8EA 1XBSA 3GL5A 4GLTA 3LXZA 17GSA 3PGTA 4L5OA 1UA5A 1HQOA 2L4QA 3FYGA 1FG4A 2CX3A 2K8SA 3ZVJA 2KHPA 4Q5QA 5A5KA 3OR5A 4PI2C 3UJ1A 4HI7A 3LFLA 3DKSA 2LQOA 2H8LA 3VLNA 4KGIA 2OBKA 1G7EA 2HRAA 3TJFA 2DBCA 5DCHA 3IC8A 1GULA 4ML1A 3LSZA 2R37A 2JSYA 3CBUA 2K9FA 1EGRA 1E2YA 2VO4A 3QMXA 4NMUA 3A2WA 2H71A 2H66A 3SBCA 2I9HA 1C72A 1X9SB 5IOXA 2QA2A 2OJLA 2V2GA 2YWIA 5EPFA 2EIQA 3KM6A 2OA7A 5FWGA 3M9JA 1O8XA 3PR8A 3EWLA 2C8UA 2YP6A 1K3YA 4IW9A 2ZCTA 4PQHA 1JLWA 2H0HA 3R2QA 3F4SA 1T7PB 5GAND 2JSZA 2DC5A 2YWNA 4ZL9A 3TRQA 2O8VB 2DIYA 3ZFLA 1W4VA 2V41A 4TR3A 4H86A 3DYRA 3TOUA 2YV9A 4PHZC 3ERGA 3EURA 1DBYA 1X0RA 1A2LA 3IK7A 4KE3A 3IBHA 1PRXA 3A2XA 3TCOA 3CRUA 4NHZA 5ECLB 3FR3A 3F4TA 4YKGA 5CRDA 4O32A 2L6CA 2NDOA 3IHGA 2OE0A 1THXA 2E0QA 1PKZA 1BX9A 2C3QA 2MMZA 1YVLA 1GNWA 3O6TA 3GA4A 2PGTA 1WPIA 1EWXA 4G0KA 1M3IA 5E59A 2CZ2A 1DE1A 1PN0A 1JLVA 4G0LA 4O5QA 1K3OA 4ML6A 1K0CA 1WRYA 3GV1A 5J41A 1V58A 3KTLA 5HR2A 4CW9A 2E2GA 1GSSA 3ZREA 2WW1A 1URMA 16GSA 4BL7B 5A1NA 1V9WA 2DJ2A 2B5YA 2YNXA 2H30A 2HQTA 1SKSB 4ZXGA 3HJPA 1E6BA 4OWYA 4JBBA 2P31A 4ZB8A 4X1UA 3D5JA 5ECNB 3GKMA 3FZAA 2VL2C 2ZUPA 4GWRA 3H8QA 2IMFA 2HZEB 3KTBA 1B9XC 5HR1A 1QUWA 2FD3A 2ON5A 4ZBBA 4K2XA 3HJOA 2B7JA 5GZZB 4HDEA 2PERA 2CV4A 1SL2B 1AQVA 2N5AA 1F6MC 2IFQB 2FHEA 2L4CA 4WR4A 3H1NA 1YKCA 1I1IP 2UV8G 2GT6A 3L9SA 5IO2A 3D0ZA 5DJMA 2X49A 1EP8A 4MH3A 4KSOA 1B4QA 1PKWA 5ECIB 1XOAA 2A4VA 2WZ9A 6GSSA 2GSRA 5IIZA 4XS4A 3GX0A 2DJKA 1ZGNA 4DSSA 2TIRA 3GTUB 3J7Yb 4EDZA 4L8EA 3L0HA 5FT3A 2J23A 1XWGA 1YZXA 2F9SA 5KN1A 4V1Ap 3GL3A 2V1MA 1AUCA 4POKA 2LRNA 3P8WA 2ZNMA 2H76A 1S3AA 1M99A 2YZHA 5G30A 1VGLA 2CA8A 3RDWA 2DIZA 2IJYA 4N10A 4KSMA 3I9V2 3APQA 5ELAA 2C3NA 5CAXA 3HD5A 4EC0A 1X9WB 2I4AA 1N2AA 2CQ9A 1SENA 4TN8A 4JEDA 5D73A 2LKUA 1GUKA 3KP9A 2VD0A 2HRNA 1X5DA 5DBQA 1X9MB 2CX4A 2NBSA 5IMCA 4KCAA 1M9AA 3EMXA 1OYJA 2QSIA 4ECJA 4LL1B 4MF6A 3GKKA 3F63A 2VCZA 1GUMA 3ERWA 1O81A 4F0CA 13GSA 4F0BA 2F8FA 4A5PA 2JACA 2L57A 1VF1A 3CMIA 3DD3A 4MZCA 3F0IA 3UEMA 3TB2A 4IN0A 1FW1A 2YOIA 4TR1A 1FB6A 1XW6A 4JE1A 19GSA 4YQMA 4OCFA 2WGRA 1KNGA 3GN3A 3HDCA 1CQHA 4JR6A 5DVBA 3EMPA 4HZ4A 1SD9A 1JZWA 2EFDA 2HRKB 2G0FA 3IK9A 1SJ6A 3EPTA 2IN3A 4K6XA 2HE3A 4NXIA 1GUHA 3ZYWA 4IGJA 2MMAA 3Q18A 5CO3A 3QFBC 2HRFA 1TI3A 4HOJA 1T1VA 2JU5A 3F6FA 4ECIA 2VKZG 18GSA 3KP8A 3I6AA 3GRXA 4BVXB 5JCGA 3FHKA 2LNTA 2EFEA 4RI6A 4YH2A 1EZKA 2XHFA 2P0GA 2GSTA 2WW2A 2YANA 2QKEA 2H0GA 4HJ2A 1GSEA 5ECOB 1HNAA 3TKRA 1Z6MA 4AKGA 3F8UA 4AF2A 5H5QA 10GSA 4E68A 5HR0A 4ZB7A 1S3CA 2GTUA 1SJZA 2CVKA 4Z7XA 2H1LA 4TRXA 1M2AA 3DGQA 4DEJA 2PVOC 4ZB6A 1G6YA 4HEA2 3E0UA 4USSA 5AN1A 2FWEA 4KAEA 3HVXA 1CQGA 1T00A 3G7YA 2MBTA 5J9CA 1TI1A 3GMFA 1OC9A 3A2VA 5AISA 4FQUA 2RUEA 2DMLA 4IP6A 2F3MA 2F51A 1A8YA 2QA1A 5J4UA 4AJ6A 3UBKA 2HSMA 4GQCA 1GTBA 1M9BA 2OE3A 2FWFA 1XFLA 2H19A 4WBJA 1B48A 2GT5A 4E8EA 4TXOA 4GSNA 4HJMA 3HA9A 5JWRB 2HZFA 3MIXA 1GLPA 5A4UA 6GSWA 5ECRB 9GSSA 2LSTA 4V2NA 2A2PA 3P90A 4EL1A 4CY8A 3VK9A 4MCUA 3TKSE 3GIXA 2LQQA 2DJ1A 2C0DA 5IOWA 5A34A 1ZYPA 4PTSA 4I2UA 2O3EA 4TR0A 3WGDA 3VWWA 1XIYA 5G1KA 2CVDA 1XPVA 4IELA 4ACSA 5ABRA 3UMAA 1AXDA 4ZL7A 3M1GA 5GAPD 3VWVA 5IMFA 2I3YA 3VPTA 3RAZA 1K0NA 1SYRA 1RW1A 3H93A 3BD2A 1MDIA 2J9HA 1GTUA 2GDRA 2FCHA 4D73A 4XS6A 3J7Yk 2PUKC 3QAGA 2O89A 4NAXA 1GTIA 1X5EA 1JZDA 4ZBDA 4MPFA 4MA9A 1K0DA 5KN0A 4K0GA 4KNDA 5DQSA 5ECQB 2LRTA 3EINA 1B9YC 2M80A 2KP1A 6GSVA 2WZSA 3IXRA 3ZVJD 5ECKB 4NV2A 1V57A 3IV4A 2IMEA 2DLXA 2NVLA 3HVNA 2GQKA 2GZYA 2IWTA 2YWOA 4AI6A 2WVXB 3RHCA 1J9BA 1BEDA 3TRPA 3VWUA 2WVZA 1S3RA 1R4WA 2YV7A 2C3TA 1IYIA 3HJMA 3LXTA 3ZIVA 1GSQA 4YAVA 1YF0A 3RBTA 4O5UA 3NIVA 5J4VA 2A2RA 1EEMA 3EVIA 3DVXA 2RM5A 4MABA 3CSJA 1NSWA 3FMWA 4FIWA 2PWJA 1XZOA 4WXTA 1RQMA 5HR3A 2L6DA 5D9XA 1GSDA 2HLSA 3EU4A 5EL8A 1ZMAA 1A8LA 3TJKA 4IS0A 5J5NA 1TJDA 1FOHA 5A4WA 2HI7A 2LEGA 1MD4A 4PI0C 3IAM2 1HD2A 3NOFA 5LCZA 3RGBC 1M7TA 4ZBAA 4BWSA 5A5HB 2VL2A 2FWGA 1M0UA 2CZ3A 1ML6A 2PPTA 2RIIA 1J0FA 3FKFA 1AQWA 2VCWA 3WYWA 1UC7A 2LTKA 2B5EA 3GKNA 1MTCA 2GS3A 1U88A 4KH7A 2TRCP 3W8SA 2X8GA 4FH8A 3GH9A 4HU9A 1IYHA 1I5GA 2YPMA 3C71A 2DJ3A 2OKAA 1XWBA 5KN3A 1EV9A 1XWAA 4FYCA 2PN8A 2B6MA 1VRSD 2E7PA 1ZL9A 1WE0A 1AW9A 2O7KA 2REMA 1TK0B 1A24A 3QCPA 2YJHA 5D96A 2PBJA 2IL3A 3CSHA 4XHMA 4QQ7A 3ZZXA 4MH2A 2BTOT 3KJYA 5B6MA 1SVMA 2YWMA 1V40A 3LYPA 1N25A 4EXJA 4BPYA 5LNKe 1MDJA 2NTOA 2OBIA 2VUPA 3M8NA 4IJIA 5G5EA 1QFNA 3RPPA 4K7OA 4EF0A 1T3BA 4K7IA 3FR6A 3LWAA 2FA4A 4NPBA 3US3A 4J57E 2K8VA 1GL8A 3KIJA 1Y25A 4EVMA 4K5SA 3WD6A 3VI7A 2V6KA 2A2SA 1GSFA 2AHEA 3PPUA 1YEPA 5ID2B 2JADA 5CRWA 1JZOA 4XIHA 3DIEA 2HYXA 4IHUA 4X0XA 3KH9A 2EFHA 2HSNB 3ED3A 4AKXB 3HMJG 1WOUA 3G9BA 3HVSA 1EGOA 2PU9C 2LJAA 4IJ3A 2P5QA 2DJJA 4IQAA 4GCIA 2GSQA 1F3AA 2H1GA 1WP0A 3F9UA 3KD0A 4DVCA 4L0WA 5BMUB 3IDVA 1R5AA 2B7KA 1SVLA 5AIVA 3TOTA 5LD0A 4IKHA 3ZRDA 1WJKA 4KCEA 3FW2A 4RQRA 3KH7A 2H6ZA 2AB6A 2B1KA 2K6VA 1BAYA 5CYYA 4K1FA 4ZB9A 2E2MA 3L9UA 4WEYA 3TKPA 4HU7A 4E8HA 5JWOB 4KB3A 1GP1A 3ZIJA 5CNWA 1O85A 3HVVA 2C80A 5AGYA 1Z5YE 3PINA 3ERFA 2MMOA 4V2LA 4ECBA 3SWLA 2AUVA 5G2ZA 2WRTA 2V6OA 5E4WA 1A2MA 4LLRA 3HZ8A 1O8WA 1GNEA 2VCQA 2XBIA 5H5SA 4KDXA 1EEJA 5ECSA 5DDLA 4TKYA 3LQ7A 3IOSA 3MAKA 5B8AA 5D93A 4IVFA 1R26A 1XOBA 1U6TA 1GH2A 4EDYA 5J9BA 3DEXA 1K3LA 3TJJA 1PN9A 2OACA 5J47A 3Q6OA 1JHBA 3LORA 3L4NA 1Q98A 1PL1A 4ID0A 5ELGA 3CHXC 4EKZA 4NV5A 5IM9A 3QAWA 5KOWA 5HFKA 2R0GA 3KGKA 5CP1A 3QDNA 5DJLA 4G0IA 1SL0B 1YY7A 5G31A 5D9VA 1A2JA 2DMMA 4Z2RA 3I69A 4FYBA 3TKQA 3G7IA 3RPNA 1JZRA 3QPMA 2N5FA 2EIRA 3TJGA 4BL7A 1YEWC 1SK2A 2CVBA 4KX4A 2EC4A 2FNOA 2MBSA 5DALA 2G2QA 1F3BA 4G10A 2VAFA 5HQPA 3LJRA 1EV4A 5J40A 4MP4A 4K7NA 3E3EA 1YEXA 1ZYNA 4I6XA 7GSSA 1XG8A 4MZWA 1K0BA 2WW3A 2HZEA 1PL2A 6GSTA 3P2AA 5ECHB 5CRGA 4RQXA 5CREA 4KF9A 1Y1UA 1SU9A 1G6WA 3KMNA 3EYTA 2EIOA 2R2JA 2IFQA 1PGTA 3BOAA 1XVQA 3FY7A 1EOGA 5KOXA 2CAQA 2H1DA 3BCIA 2FGXA 4Q5NA 2JZRA 2MMNA 2VOCA 2R4VA 4HQSA 1OKTA 4MK3A 3UVTA 4MNNA 4G19A 3W6GA 3DWVA 2FWHA 3DMLA 4MF7A 1SK0A 5JCUA 1ABAA 2C0FA 2VL9A 2WULA 4I8BA 5G5FA 1Z7RA 1R5PA 4GF0A 1Z6NA 2LJKA 1V98A 1THOA 2WDUA 3ZMKA 5AIXA 3KEBA 3GTUA 3GUSA 1K0MA 3GNJA 3MWHA 4WBRD 2FA8A 1A0FA 4POLA 4JR4A 1SKRB 4CHSA 3CSIA 1FVKA 1NHOA 4YQUA 2AJQB 1W89A 3TDGA 4GXZA 1ZYQB 1WWJA 3HKRA 1SL1B 3A5IA 4PUAA 1T8EB 1ZCPA 2JZSA 1U3IA 3UL3A 5JWQB 5IPGA 1YF1A 4N3ZA 2VLUA 1XWCA 1ERWA 4EUYA 4OFNA 4XTSA 5BRTA 4G9HA 4AKIA 2HT9A 1PX6A 5IMVA 4Q5FA 3NZNA 1SK1A 3F3QA 3TUEA 3GX8A 4Z2UA 4TR4A 20GSA 3ZMLA 2FUG2 2M46A 2D2ZA 3RHBA 4YQVA 5H5RA 1B8XA 1TXUA 5D9TA 4OCEA 1AC1A 4X4JA 2LRCA 5GSTA 3HXSA 5D9WA 1YKAA 5A4VA 1TRWA 2PMTA 1KBNA 3JCML 3Q19A 1TRVA 2X64A 4ULXA 2M72A 4JZQA 2NPBA 3EC3A 1OC8A 1DSBA 2HRKA 2R3XA 1ILOA 3CXGA 4MJAA 4MDCA 2F8AA 1OC3A 3WGXA 3I43A 3O3TA 3C73A 3DXBA 1G0TA 4TW5A 3GSTA 2CT6A 4N0ZA 3QOUA 4MMMA 4L5LA 2DKHA 1TK5B 3APOA 2HSHA 3FEUA 5CRHA 1F9MA 6GSUA 3TKSC 2FY6A 4RI7A 4BVXA 4ECCA 2X99A 1BYEA 1TXXA 4I5QA 2X4AA 5A1NB 2QC7A 1JFUA 3ZL5A 4NWYA 1SJIA 1BJXA 1KEBA 5GSSA 1PD21 1T4ZA 1XCCA 2YJ7A 4OO4A 3ISOA 1QK8A 3M9KA 1YDKA 2BMXA 1RK4A 5EY6A 3VI5A 5INYA 4GDFA 5FHIA 4PURA 1OVNA 4IBPA 4G01A 1ERVA 1XXUA 1F2EA 3CRTA 3FZ5A 1V2AA 2LV3A 3KCMA 4JRRA 2C0EA 1Z3EA 4XRDA 2B1LA 1BQ7A 2IMDA 3GYKA 1GRXA 5B6NA 2YZUA 1NM3A 1LU4A 2IMIA 4LA1A 4AJ8A 2CAIA 2DSAA 2LS5A 1DE2A 1M3JA 4CDOA 4DSRA 3D22A 1PMTA 5F06A 3UARA 1YQ1A 4BWQA 2B3SA 3UAPA 4POMA 5DCGA 4XS4B 3EU3A 4HS1A 1SD8A 4QL9A 4DSSB 4GRFA 1M2DA 3MSZA 3FZ4A 3TRXA 2QGVA 5KEJA 3R3EA 4XS1A 4WF4A 4EE0A 3BJ5A 6GSXA 2O87A 2H6XA 2VIMA 1BG5A 2OE1A 1TKDB 4GTUA 3ZLPA 2HSYA 2WFCA 1XW5A 1WIKA 3VPQA 2VCXA 1ERTA 4TOPA 3F3RA 4OFMA 3HHVA 4RUVA 1S4BP 2N5BA 3H4KA 4F2IA 1K0OA 1TOFA 1I9DA 1YJ6A 2EFCA 4EO3A 4OMVA 4ICYA 4OD7A 4BVYA 2DJ0A 3QD9A 1S3DA 2H01A 3FZ9A 1EOHA 4P3YB 4PUFC 1O73A 2H1AA 4YKFA 4V2MA 1FHEA 2A4HA 2KUCA 5DAKA 4QMKA 2R6KA 1N8JA 3QFAC 4W66A 5IMDA 2I81A 3FK8A 1HNCA 3PH9A 4K0NA 1TU8A 1ZYEA 1GSUA 1AAZA 1BG1A 2WS2A 2LJRA 5F07A 2VL3A 4K8MA 5ECPB 4HZ2A 1USBA 2WB9A 3DVWA 4PGTA 4GQFA 3KMOA 3QAVA 5F0GA 4I97A 5HFGA 3HYPA 3G7JA 2VCTA 2FLSA 1A23A 3L78A 4WKWA 4TR1B 1XWKA 1OKDA 4N30A 1SYXA 2XC2A 5DALB 2O36A 2H72A 2RLIA 3D21A 2WVXA 1QXHA 4ZIJA 4TXVA 3MDKA 1GTAA 4FYUA 4KDUA 1U87A 3N9JA 1BF5A 2GQLA 4ZILA 1XW9A 3Q74A 2GZZA 4XRAA 2RM6A 3K8NA 4HUAA 2KLXA 1GLQA 1XVWA 4MF5A 2AV4A 2HNLA 3IA1A 4IP1A 1GWCA 4F9ZA 3UBLA 3ME8A 5HFIA 2WW0A 5KN2A 3D6IA 2KOKA 2C1YA 1NW2A 2LUSA 3VFIA 2XPDA 1K0AA 1TP9A 3C1SA 2C4JA 5IQYA 3IR4A 3RFRC 5B7CA 4J2FA 1EP7A 1PFOA 3H79A 4F03A 4PNFA 2V32A 4KDYA 3LGCA 1UN2A 2MZCA 2GQMA 3IC4A 4TVEA 5A5HA 3GSSA 4PNGA 6GSYA 5B8BA 2H74A 2JZTA 1PA3A 2YN1A 4QL7A 1FVJA 4GSTA 1R7HA 1ST9A 4PQ1A 2WVYA 3AY8A 2DKIA 3ZITA 3W8JA 3IHQA 5ENUA 3TU3B 1PSQA 4GSSA 1MDKA 3A5WA 3CWGA 2XBQA 2VCVA 4K9ZA 1OC9B 1X5CA 2YCDA 5F8BA 2ALBA 4Q5RA 5L71A 1QQ2A 2XPEA 1TU7A 1OAZA 3C1RA 3VWXA 11GSA 2AAWA 2HSMB 1O7UA 4I2TA 3GKXA 4POBA 5COHA 1B4PA 4TXOB 4L0UA 1H4OA 1GSYA 4FO5A 2K18A 2VLTA 4LMWA 3F4RA 4O7HA 1LBKA 2VLVA 2AYTA 1MEKA 2L5OA 4NHWA 2P5RA 1G7OA 2MYGA 2H70A 4JU5A 3IE3A 5A34B 4EIPA 3ZFBA 5G1LA 2HFDA 1SKWB 5F05A 1TK8B 3L9VA 2L59A 1TW9A 4MZBA 3BBYA 4EIQA 1KTEA 3IAS2 5ID2A 2WCIA 4ZL8A 1VF4A 1ERUA 4PX1A 1QGVA 1F37A 3FR9A 4LMVA 3EE2A 14GSA 8GSSA 2ES7A 5IMZA 2I1UA 2R5GA 1M2BA 1H75A 4V1Ag 2HSNA 1LJRA 3CQFA 5IPHA 3U6VA 1FAAA 4N11A 4D73B 3VURA 1UVZA 4KUNA 5DQYA 2GZPA 2HXKA 4O5RA 4BA7A 3GFKA 3HCZA 3TJBA 4AGSA 3UVHA 4X43A 4MPGA 2Z9SA 4CY6A 5BMUA 3MYDA 4Z2TA 1A0RP 4WETA 2JL4A 4XCSA 2GSSA 3V1WA 1SVOA 2X8HA 5C04A 1ACVA 2H6YA 1J08A 3D4TA 2H0IA 1AQXA 4HSCX 1Z9HA 4IQ1A 2VD1A 5J3RA 3P7XA 3A3TA 2WJUA 3D4MA 4WR5A 3IRAA 3C7MA 1WMJA 3GHAA 2IIYA 3WT1A 2BJXA 3CYNA 2GLRA 2R0CA 2GVPA 4AKHA 2H1BA 3WGEA 4KA0A 2H75A 2B5XA 5JCWA 1OE7A 4ISDA 1TTZA 3APSA 3N5OA 1PQNA 4PXOA 3LYKA 4WF5A 3TKSA 3HZ4A 3KZQA 3O76A 4OFTA 4BIKA 1TDIA 3UIWA 2PVQA 2O85A 2R0PA 2UZ8A 1T4YA 3U5RE 3BCKA 3LW9A 1Y6EA 3TGZA 3ME7A 2TRXA 1ZZYA 2C0GA 5IMAA 1Z7PA 4MJCA 1QMVA 1NHYA 1MD3A 3HY2A 4OO5A 2VM1A 4DSQA 4MLYA 5J4YA 1Q4JA 1FO5A 4J56E 1AIUA 4FXYP 3LG6A 1ZOFA 4HQZA 1FOVA 4LL4B 3GH6A 2LNSA 5C00A 1PX7A 3CTGA 1TRSA 3S9FA 4PQIA 3DRNA 4F82A 2GGTA 4ILFA 1DUGA 1VF3A
chains in the Genus database with same CATH topology
2RUFA 5D8IA 4MJBA 1FB0A 3LEFA 12GSA 3FRCA 4O92A 2IMKA 3CTFA 3MNGA 1TRUA 3M0FA 1VF2A 4AJ7A 1OE8A 5IO0A 3IPZA 22GSA 3KXOA 1HNBA 5ECMB 4KW6A 4BVYB 4G2EA 3F6DA 3GURA 4YAPA 3WT2A 1U3AA 1O6JA 2IPAA 2OADA 3UOMA 4MJEA 2H73A 2ON7A 3E9JB 4K5RA 5DAKB 1HYUA 2KP2A 2OT3A 1ON4A 2O5VA 3QR6A 5EVOA 2VM2A 4N0VA 4K2DA 3ZTLA 2L5LA 3M3MA 2X8CA 3C8EA 1XBSA 3GL5A 4GLTA 3LXZA 17GSA 3PGTA 4L5OA 1UA5A 1HQOA 2L4QA 3FYGA 1FG4A 2CX3A 2K8SA 3ZVJA 2KHPA 4Q5QA 5A5KA 3OR5A 3UJ1A 4HI7A 3LFLA 3DKSA 2LQOA 2H8LA 3VLNA 4KGIA 2OBKA 1G7EA 2HRAA 3TJFA 2DBCA 5DCHA 3IC8A 1GULA 4ML1A 3LSZA 2R37A 2JSYA 3CBUA 2K9FA 1EGRA 1E2YA 2VO4A 3QMXA 4NMUA 3A2WA 2H71A 2H66A 3SBCA 2I9HA 1C72A 1X9SB 5IOXA 2QA2A 2OJLA 2V2GA 2YWIA 5EPFA 2EIQA 3KM6A 2OA7A 5FWGA 3M9JA 1O8XA 3PR8A 3EWLA 2C8UA 2YP6A 1K3YA 4IW9A 2ZCTA 4PQHA 1JLWA 2H0HA 3R2QA 3F4SA 1T7PB 5GAND 2JSZA 2DC5A 2YWNA 4ZL9A 3TRQA 2O8VB 2DIYA 3ZFLA 1W4VA 2V41A 4TR3A 4H86A 3DYRA 3TOUA 2YV9A 3ERGA 3EURA 1DBYA 1X0RA 1A2LA 3IK7A 4KE3A 3IBHA 1PRXA 3A2XA 3TCOA 3CRUA 4NHZA 5ECLB 3FR3A 3F4TA 4YKGA 5CRDA 4O32A 2L6CA 2NDOA 3IHGA 2OE0A 1THXA 2E0QA 1PKZA 1BX9A 2C3QA 2MMZA 1YVLA 1GNWA 3O6TA 3GA4A 2PGTA 1WPIA 1EWXA 4G0KA 5E59A 2CZ2A 1DE1A 1PN0A 1JLVA 4G0LA 4O5QA 1K3OA 4ML6A 1K0CA 1WRYA 3GV1A 5J41A 1V58A 3KTLA 5HR2A 4CW9A 2E2GA 1GSSA 3ZREA 1URMA 16GSA 4BL7B 5A1NA 1V9WA 2DJ2A 2B5YA 2YNXA 2H30A 2HQTA 1SKSB 4ZXGA 3HJPA 1E6BA 4OWYA 4JBBA 2P31A 4ZB8A 4X1UA 3D5JA 5ECNB 3GKMA 3FZAA 2VL2C 2ZUPA 4GWRA 3H8QA 2IMFA 2HZEB 3KTBA 1B9XC 5HR1A 1QUWA 2FD3A 2ON5A 4ZBBA 4K2XA 3HJOA 2B7JA 5GZZB 4HDEA 2PERA 2CV4A 1SL2B 1AQVA 2N5AA 1F6MC 2IFQB 2FHEA 2L4CA 4WR4A 3H1NA 1YKCA 2UV8G 2GT6A 3L9SA 5IO2A 3D0ZA 5DJMA 2X49A 1EP8A 4MH3A 4KSOA 1B4QA 1PKWA 5ECIB 1XOAA 2A4VA 2WZ9A 6GSSA 2GSRA 5IIZA 4XS4A 3GX0A 2DJKA 1ZGNA 4DSSA 2TIRA 3GTUB 3J7Yb 4EDZA 4L8EA 3L0HA 5FT3A 2J23A 1XWGA 1YZXA 2F9SA 5KN1A 4V1Ap 3GL3A 2V1MA 1AUCA 4POKA 2LRNA 3P8WA 2ZNMA 2H76A 1S3AA 1M99A 2YZHA 5G30A 1VGLA 2CA8A 3RDWA 2DIZA 2IJYA 4N10A 4KSMA 3I9V2 3APQA 5ELAA 2C3NA 5CAXA 3HD5A 4EC0A 1X9WB 2I4AA 1N2AA 2CQ9A 1SENA 4TN8A 4JEDA 5D73A 2LKUA 1GUKA 3KP9A 2VD0A 2HRNA 1X5DA 5DBQA 1X9MB 2CX4A 2NBSA 5IMCA 4KCAA 1M9AA 3EMXA 1OYJA 2QSIA 4ECJA 4LL1B 4MF6A 3GKKA 3F63A 2VCZA 1GUMA 3ERWA 1O81A 4F0CA 13GSA 4F0BA 2F8FA 4A5PA 2JACA 2L57A 1VF1A 3CMIA 3DD3A 4MZCA 3F0IA 3UEMA 3TB2A 4IN0A 1FW1A 2YOIA 4TR1A 1FB6A 1XW6A 4JE1A 19GSA 4YQMA 4OCFA 2WGRA 1KNGA 3GN3A 3HDCA 1CQHA 4JR6A 5DVBA 3EMPA 4HZ4A 1SD9A 1JZWA 2EFDA 2HRKB 2G0FA 3IK9A 1SJ6A 3EPTA 2IN3A 4K6XA 2HE3A 4NXIA 1GUHA 3ZYWA 4IGJA 2MMAA 3Q18A 5CO3A 3QFBC 2HRFA 1TI3A 4HOJA 1T1VA 2JU5A 3F6FA 4ECIA 2VKZG 18GSA 3KP8A 3I6AA 3GRXA 4BVXB 5JCGA 3FHKA 2LNTA 2EFEA 4RI6A 4YH2A 1EZKA 2XHFA 2P0GA 2GSTA 2YANA 2QKEA 2H0GA 4HJ2A 1GSEA 5ECOB 1HNAA 3TKRA 1Z6MA 4AKGA 3F8UA 4AF2A 5H5QA 10GSA 4E68A 5HR0A 4ZB7A 1S3CA 2GTUA 1SJZA 2CVKA 4Z7XA 2H1LA 4TRXA 1M2AA 3DGQA 4DEJA 2PVOC 4ZB6A 1G6YA 4HEA2 3E0UA 4USSA 5AN1A 2FWEA 4KAEA 3HVXA 1CQGA 1T00A 3G7YA 2MBTA 5J9CA 1TI1A 3GMFA 1OC9A 3A2VA 5AISA 4FQUA 2RUEA 2DMLA 4IP6A 2F3MA 2F51A 1A8YA 2QA1A 5J4UA 4AJ6A 3UBKA 2HSMA 4GQCA 1GTBA 1M9BA 2OE3A 2FWFA 1XFLA 2H19A 4WBJA 1B48A 2GT5A 4E8EA 4TXOA 4GSNA 4HJMA 3HA9A 5JWRB 2HZFA 3MIXA 1GLPA 5A4UA 6GSWA 5ECRB 9GSSA 2LSTA 4V2NA 2A2PA 3P90A 4EL1A 4CY8A 3VK9A 4MCUA 3TKSE 3GIXA 2LQQA 2DJ1A 2C0DA 5IOWA 5A34A 1ZYPA 4PTSA 4I2UA 4TR0A 3WGDA 3VWWA 1XIYA 5G1KA 2CVDA 1XPVA 4IELA 4ACSA 5ABRA 3UMAA 1AXDA 4ZL7A 3M1GA 5GAPD 3VWVA 5IMFA 2I3YA 3VPTA 3RAZA 1K0NA 1SYRA 1RW1A 3H93A 3BD2A 1MDIA 2J9HA 1GTUA 2GDRA 2FCHA 4D73A 4XS6A 3J7Yk 2PUKC 3QAGA 2O89A 4NAXA 1GTIA 1X5EA 1JZDA 4ZBDA 4MPFA 4MA9A 1K0DA 5KN0A 4K0GA 4KNDA 5DQSA 5ECQB 2LRTA 3EINA 1B9YC 2M80A 2KP1A 6GSVA 3IXRA 3ZVJD 5ECKB 4NV2A 1V57A 3IV4A 2IMEA 2DLXA 2NVLA 2GQKA 2GZYA 2IWTA 2YWOA 4AI6A 3RHCA 1J9BA 1BEDA 3TRPA 3VWUA 1R4WA 2YV7A 2C3TA 1IYIA 3HJMA 3LXTA 3ZIVA 1GSQA 4YAVA 1YF0A 3RBTA 4O5UA 3NIVA 5J4VA 2A2RA 1EEMA 3EVIA 3DVXA 2RM5A 4MABA 3CSJA 1NSWA 3FMWA 4FIWA 2PWJA 1XZOA 4WXTA 1RQMA 5HR3A 2L6DA 5D9XA 1GSDA 2HLSA 3EU4A 5EL8A 1ZMAA 1A8LA 3TJKA 4IS0A 5J5NA 1TJDA 1FOHA 5A4WA 2HI7A 2LEGA 1MD4A 3IAM2 1HD2A 3NOFA 5LCZA 1M7TA 4ZBAA 4BWSA 5A5HB 2VL2A 2FWGA 1M0UA 2CZ3A 1ML6A 2PPTA 2RIIA 1J0FA 3FKFA 1AQWA 2VCWA 3WYWA 1UC7A 2LTKA 2B5EA 3GKNA 1MTCA 2GS3A 1U88A 4KH7A 2TRCP 3W8SA 2X8GA 4FH8A 3GH9A 4HU9A 1IYHA 1I5GA 2YPMA 3C71A 2DJ3A 2OKAA 1XWBA 5KN3A 1EV9A 1XWAA 4FYCA 2PN8A 2B6MA 1VRSD 2E7PA 1ZL9A 1WE0A 1AW9A 2O7KA 2REMA 1TK0B 1A24A 3QCPA 2YJHA 5D96A 2PBJA 2IL3A 3CSHA 4XHMA 4QQ7A 3ZZXA 4MH2A 2BTOT 3KJYA 5B6MA 1SVMA 2YWMA 1V40A 3LYPA 1N25A 4EXJA 4BPYA 5LNKe 1MDJA 2NTOA 2OBIA 2VUPA 3M8NA 4IJIA 5G5EA 1QFNA 3RPPA 4K7OA 4EF0A 1T3BA 4K7IA 3FR6A 3LWAA 2FA4A 4NPBA 3US3A 4J57E 2K8VA 1GL8A 3KIJA 1Y25A 4EVMA 4K5SA 3WD6A 3VI7A 2V6KA 2A2SA 1GSFA 2AHEA 3PPUA 1YEPA 5ID2B 2JADA 5CRWA 1JZOA 4XIHA 3DIEA 2HYXA 4IHUA 4X0XA 3KH9A 2EFHA 2HSNB 3ED3A 4AKXB 3HMJG 1WOUA 3G9BA 3HVSA 1EGOA 2PU9C 2LJAA 4IJ3A 2P5QA 2DJJA 4IQAA 4GCIA 2GSQA 1F3AA 2H1GA 1WP0A 3F9UA 3KD0A 4DVCA 4L0WA 5BMUB 3IDVA 1R5AA 2B7KA 1SVLA 5AIVA 3TOTA 5LD0A 4IKHA 3ZRDA 1WJKA 4KCEA 3FW2A 4RQRA 3KH7A 2H6ZA 2AB6A 2B1KA 2K6VA 1BAYA 5CYYA 4K1FA 4ZB9A 2E2MA 3L9UA 4WEYA 3TKPA 4HU7A 4E8HA 5JWOB 4KB3A 1GP1A 3ZIJA 5CNWA 1O85A 3HVVA 2C80A 5AGYA 1Z5YE 3PINA 3ERFA 2MMOA 4V2LA 4ECBA 3SWLA 2AUVA 5G2ZA 2WRTA 2V6OA 5E4WA 1A2MA 4LLRA 3HZ8A 1O8WA 1GNEA 2VCQA 2XBIA 5H5SA 4KDXA 1EEJA 5ECSA 5DDLA 4TKYA 3LQ7A 3IOSA 3MAKA 5B8AA 5D93A 4IVFA 1R26A 1XOBA 1U6TA 1GH2A 4EDYA 5J9BA 3DEXA 1K3LA 3TJJA 1PN9A 2OACA 5J47A 3Q6OA 1JHBA 3LORA 3L4NA 1Q98A 1PL1A 4ID0A 5ELGA 4EKZA 4NV5A 5IM9A 3QAWA 5KOWA 5HFKA 2R0GA 3KGKA 5CP1A 3QDNA 5DJLA 4G0IA 1SL0B 1YY7A 5G31A 5D9VA 1A2JA 2DMMA 4Z2RA 3I69A 4FYBA 3TKQA 3G7IA 3RPNA 1JZRA 3QPMA 2N5FA 2EIRA 3TJGA 4BL7A 1SK2A 2CVBA 4KX4A 2EC4A 2FNOA 2MBSA 5DALA 2G2QA 1F3BA 4G10A 2VAFA 5HQPA 3LJRA 1EV4A 5J40A 4MP4A 4K7NA 3E3EA 1YEXA 1ZYNA 4I6XA 7GSSA 4MZWA 1K0BA 2HZEA 1PL2A 6GSTA 3P2AA 5ECHB 5CRGA 4RQXA 5CREA 4KF9A 1Y1UA 1SU9A 1G6WA 3KMNA 3EYTA 2EIOA 2R2JA 2IFQA 1PGTA 3BOAA 1XVQA 3FY7A 1EOGA 5KOXA 2CAQA 2H1DA 3BCIA 2FGXA 4Q5NA 2JZRA 2MMNA 2VOCA 2R4VA 4HQSA 1OKTA 4MK3A 3UVTA 4MNNA 4G19A 3W6GA 3DWVA 2FWHA 3DMLA 4MF7A 1SK0A 5JCUA 1ABAA 2C0FA 2VL9A 2WULA 4I8BA 5G5FA 1Z7RA 1R5PA 4GF0A 1Z6NA 2LJKA 1V98A 1THOA 2WDUA 3ZMKA 5AIXA 3KEBA 3GTUA 3GUSA 1K0MA 3GNJA 3MWHA 4WBRD 2FA8A 1A0FA 4POLA 4JR4A 1SKRB 4CHSA 3CSIA 1FVKA 1NHOA 4YQUA 2AJQB 1W89A 3TDGA 4GXZA 1ZYQB 1WWJA 3HKRA 1SL1B 3A5IA 4PUAA 1T8EB 1ZCPA 2JZSA 1U3IA 3UL3A 5JWQB 5IPGA 1YF1A 4N3ZA 2VLUA 1XWCA 1ERWA 4EUYA 4OFNA 4XTSA 5BRTA 4G9HA 4AKIA 2HT9A 1PX6A 5IMVA 4Q5FA 3NZNA 1SK1A 3F3QA 3TUEA 3GX8A 4Z2UA 4TR4A 20GSA 3ZMLA 2FUG2 2M46A 2D2ZA 3RHBA 4YQVA 5H5RA 1B8XA 1TXUA 5D9TA 4OCEA 1AC1A 4X4JA 2LRCA 5GSTA 3HXSA 5D9WA 1YKAA 5A4VA 1TRWA 2PMTA 1KBNA 3JCML 3Q19A 1TRVA 2X64A 4ULXA 2M72A 4JZQA 2NPBA 3EC3A 1OC8A 1DSBA 2HRKA 2R3XA 1ILOA 3CXGA 4MJAA 4MDCA 2F8AA 1OC3A 3WGXA 3I43A 3O3TA 3C73A 3DXBA 1G0TA 4TW5A 3GSTA 2CT6A 4N0ZA 3QOUA 4MMMA 4L5LA 2DKHA 1TK5B 3APOA 2HSHA 3FEUA 5CRHA 1F9MA 6GSUA 3TKSC 2FY6A 4RI7A 4BVXA 4ECCA 2X99A 1BYEA 1TXXA 4I5QA 2X4AA 5A1NB 2QC7A 1JFUA 3ZL5A 4NWYA 1SJIA 1BJXA 1KEBA 5GSSA 1PD21 1T4ZA 1XCCA 2YJ7A 4OO4A 3ISOA 1QK8A 3M9KA 1YDKA 2BMXA 1RK4A 5EY6A 3VI5A 5INYA 4GDFA 5FHIA 4PURA 1OVNA 4IBPA 4G01A 1ERVA 1XXUA 1F2EA 3CRTA 3FZ5A 1V2AA 2LV3A 3KCMA 4JRRA 2C0EA 1Z3EA 4XRDA 2B1LA 1BQ7A 2IMDA 3GYKA 1GRXA 5B6NA 2YZUA 1NM3A 1LU4A 2IMIA 4LA1A 4AJ8A 2CAIA 2DSAA 2LS5A 1DE2A 4CDOA 4DSRA 3D22A 1PMTA 5F06A 3UARA 1YQ1A 4BWQA 2B3SA 3UAPA 4POMA 5DCGA 4XS4B 3EU3A 4HS1A 1SD8A 4QL9A 4DSSB 4GRFA 1M2DA 3MSZA 3FZ4A 3TRXA 2QGVA 5KEJA 3R3EA 4XS1A 4WF4A 4EE0A 3BJ5A 6GSXA 2O87A 2H6XA 2VIMA 1BG5A 2OE1A 1TKDB 4GTUA 3ZLPA 2HSYA 2WFCA 1XW5A 1WIKA 3VPQA 2VCXA 1ERTA 4TOPA 3F3RA 4OFMA 3HHVA 4RUVA 2N5BA 3H4KA 4F2IA 1K0OA 1TOFA 1I9DA 1YJ6A 2EFCA 4EO3A 4OMVA 4ICYA 4OD7A 4BVYA 2DJ0A 3QD9A 1S3DA 2H01A 3FZ9A 1EOHA 4P3YB 4PUFC 1O73A 2H1AA 4YKFA 4V2MA 1FHEA 2A4HA 2KUCA 5DAKA 4QMKA 2R6KA 1N8JA 3QFAC 4W66A 5IMDA 2I81A 3FK8A 1HNCA 3PH9A 4K0NA 1TU8A 1ZYEA 1GSUA 1AAZA 1BG1A 2WS2A 2LJRA 5F07A 2VL3A 4K8MA 5ECPB 4HZ2A 1USBA 2WB9A 3DVWA 4PGTA 4GQFA 3KMOA 3QAVA 5F0GA 4I97A 5HFGA 3HYPA 3G7JA 2VCTA 2FLSA 1A23A 3L78A 4WKWA 4TR1B 1XWKA 1OKDA 4N30A 1SYXA 2XC2A 5DALB 2H72A 2RLIA 3D21A 1QXHA 4ZIJA 4TXVA 3MDKA 1GTAA 4FYUA 4KDUA 1U87A 3N9JA 1BF5A 2GQLA 4ZILA 1XW9A 3Q74A 2GZZA 4XRAA 2RM6A 3K8NA 4HUAA 2KLXA 1GLQA 1XVWA 4MF5A 2AV4A 2HNLA 3IA1A 4IP1A 1GWCA 4F9ZA 3UBLA 3ME8A 5HFIA 5KN2A 3D6IA 2KOKA 2C1YA 1NW2A 2LUSA 3VFIA 2XPDA 1K0AA 1TP9A 3C1SA 2C4JA 5IQYA 3IR4A 5B7CA 4J2FA 1EP7A 3H79A 4F03A 4PNFA 2V32A 4KDYA 3LGCA 1UN2A 2MZCA 2GQMA 3IC4A 4TVEA 5A5HA 3GSSA 4PNGA 6GSYA 5B8BA 2H74A 2JZTA 1PA3A 2YN1A 4QL7A 1FVJA 4GSTA 1R7HA 1ST9A 4PQ1A 3AY8A 2DKIA 3ZITA 3W8JA 3IHQA 5ENUA 3TU3B 1PSQA 4GSSA 1MDKA 3A5WA 3CWGA 2XBQA 2VCVA 4K9ZA 1OC9B 1X5CA 2YCDA 5F8BA 2ALBA 4Q5RA 5L71A 1QQ2A 2XPEA 1TU7A 1OAZA 3C1RA 3VWXA 11GSA 2AAWA 2HSMB 1O7UA 4I2TA 3GKXA 4POBA 5COHA 1B4PA 4TXOB 4L0UA 1H4OA 1GSYA 4FO5A 2K18A 2VLTA 4LMWA 3F4RA 4O7HA 1LBKA 2VLVA 2AYTA 1MEKA 2L5OA 4NHWA 2P5RA 1G7OA 2MYGA 2H70A 4JU5A 3IE3A 5A34B 4EIPA 3ZFBA 5G1LA 2HFDA 1SKWB 5F05A 1TK8B 3L9VA 2L59A 1TW9A 4MZBA 3BBYA 4EIQA 1KTEA 3IAS2 5ID2A 2WCIA 4ZL8A 1VF4A 1ERUA 4PX1A 1QGVA 1F37A 3FR9A 4LMVA 3EE2A 14GSA 8GSSA 2ES7A 5IMZA 2I1UA 2R5GA 1M2BA 1H75A 4V1Ag 2HSNA 1LJRA 5IPHA 3U6VA 1FAAA 4N11A 4D73B 3VURA 1UVZA 4KUNA 5DQYA 2GZPA 2HXKA 4O5RA 4BA7A 3GFKA 3HCZA 3TJBA 4AGSA 3UVHA 4X43A 4MPGA 2Z9SA 4CY6A 5BMUA 3MYDA 4Z2TA 1A0RP 4WETA 2JL4A 4XCSA 2GSSA 3V1WA 1SVOA 2X8HA 5C04A 1ACVA 2H6YA 1J08A 3D4TA 2H0IA 1AQXA 1Z9HA 4IQ1A 2VD1A 5J3RA 3P7XA 3A3TA 2WJUA 3D4MA 4WR5A 3IRAA 3C7MA 1WMJA 3GHAA 2IIYA 3WT1A 2BJXA 3CYNA 2GLRA 2R0CA 2GVPA 4AKHA 2H1BA 3WGEA 4KA0A 2H75A 2B5XA 5JCWA 1OE7A 4ISDA 1TTZA 3APSA 3N5OA 1PQNA 4PXOA 3LYKA 4WF5A 3TKSA 3HZ4A 3KZQA 3O76A 4OFTA 1TDIA 3UIWA 2PVQA 2O85A 2R0PA 2UZ8A 1T4YA 3U5RE 3BCKA 3LW9A 1Y6EA 3TGZA 3ME7A 2TRXA 1ZZYA 2C0GA 5IMAA 1Z7PA 4MJCA 1QMVA 1NHYA 1MD3A 3HY2A 4OO5A 2VM1A 4DSQA 4MLYA 5J4YA 1Q4JA 1FO5A 4J56E 1AIUA 3LG6A 1ZOFA 4HQZA 1FOVA 4LL4B 3GH6A 2LNSA 5C00A 1PX7A 3CTGA 1TRSA 3S9FA 4PQIA 3DRNA 4F82A 2GGTA 4ILFA 1DUGA 1VF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUF A;  5D8I A;  4MJB A;  1FB0 A;  3LEF A;  12GS A;  3FRC A;  4O92 A;  2IMK A;  3CTF A;  3MNG A;  1TRU A;  3M0F A;  1VF2 A;  4AJ7 A;  1OE8 A;  5IO0 A;  3IPZ A;  22GS A;  3KXO A;  1HNB A;  5ECM B;  4KW6 A;  4BVY B;  4G2E A;  3F6D A;  3GUR A;  4YAP A;  3WT2 A;  1U3A A;  1O6J A;  2IPA A;  2OAD A;  3UOM A;  4MJE A;  2H73 A;  2ON7 A;  3E9J B;  5DAK B;  1HYU A;  2KP2 A;  1ON4 A;  3QR6 A;  5EVO A;  2VM2 A;  4N0V A;  4K2D A;  3ZTL A;  2L5L A;  3M3M A;  3C8E A;  1XBS A;  2X8C A;  3GL5 A;  4GLT A;  3LXZ A;  17GS A;  3PGT A;  4L5O A;  1UA5 A;  1HQO A;  2L4Q A;  3FYG A;  1FG4 A;  2CX3 A;  2K8S A;  3ZVJ A;  2KHP A;  4Q5Q A;  5A5K A;  3OR5 A;  3UJ1 A;  4HI7 A;  3LFL A;  3DKS A;  2LQO A;  2H8L A;  3VLN A;  4KGI A;  2OBK A;  1G7E A;  2HRA A;  3TJF A;  2DBC A;  5DCH A;  3IC8 A;  1GUL A;  4ML1 A;  3LSZ A;  2R37 A;  2JSY A;  3CBU A;  2K9F A;  1EGR A;  1E2Y A;  2VO4 A;  3QMX A;  4NMU A;  3A2W A;  2H71 A;  2H66 A;  3SBC A;  2I9H A;  1C72 A;  1X9S B;  5IOX A;  2OJL A;  2V2G A;  2YWI A;  5EPF A;  2EIQ A;  3KM6 A;  2OA7 A;  5FWG A;  3M9J A;  1O8X A;  3PR8 A;  3EWL A;  2C8U A;  2YP6 A;  1K3Y A;  4IW9 A;  2ZCT A;  4PQH A;  1JLW A;  2H0H A;  3R2Q A;  3F4S A;  1T7P B;  5GAN D;  2JSZ A;  2DC5 A;  2YWN A;  4ZL9 A;  3TRQ A;  2O8V B;  2DIY A;  3ZFL A;  1W4V A;  2V41 A;  4TR3 A;  4H86 A;  3DYR A;  3TOU A;  2YV9 A;  3ERG A;  3EUR A;  1DBY A;  1X0R A;  1A2L A;  3IK7 A;  4KE3 A;  3IBH A;  1PRX A;  3A2X A;  3TCO A;  3CRU A;  4NHZ A;  5ECL B;  3FR3 A;  3F4T A;  5CRD A;  4O32 A;  2L6C A;  2NDO A;  2OE0 A;  1THX A;  2E0Q A;  1PKZ A;  1BX9 A;  2C3Q A;  2MMZ A;  1GNW A;  3O6T A;  3GA4 A;  2PGT A;  1WPI A;  1EWX A;  4G0K A;  5E59 A;  2CZ2 A;  1DE1 A;  1JLV A;  4G0L A;  1K3O A;  4ML6 A;  1K0C A;  1WRY A;  3GV1 A;  5J41 A;  1V58 A;  3KTL A;  5HR2 A;  4CW9 A;  2E2G A;  1GSS A;  3ZRE A;  1URM A;  16GS A;  4BL7 B;  1V9W A;  2DJ2 A;  2B5Y A;  2YNX A;  2H30 A;  2HQT A;  1SKS B;  4ZXG A;  3HJP A;  1E6B A;  4OWY A;  4JBB A;  2P31 A;  4ZB8 A;  4X1U A;  3D5J A;  5ECN B;  3GKM A;  3FZA A;  2VL2 C;  2ZUP A;  4GWR A;  3H8Q A;  2IMF A;  2HZE B;  3KTB A;  1B9X C;  5HR1 A;  1QUW A;  2FD3 A;  2ON5 A;  4ZBB A;  3HJO A;  2B7J A;  5GZZ B;  4HDE A;  2PER A;  2CV4 A;  1SL2 B;  1AQV A;  2N5A A;  1F6M C;  2IFQ B;  2FHE A;  2L4C A;  4WR4 A;  3H1N A;  1YKC A;  2GT6 A;  3L9S A;  5IO2 A;  3D0Z A;  5DJM A;  1EP8 A;  4MH3 A;  4KSO A;  1B4Q A;  1PKW A;  5ECI B;  1XOA A;  2A4V A;  2WZ9 A;  6GSS A;  2GSR A;  5IIZ A;  4XS4 A;  3GX0 A;  2DJK A;  1ZGN A;  4DSS A;  2TIR A;  3GTU B;  3J7Y b;  4EDZ A;  4L8E A;  3L0H A;  5FT3 A;  2J23 A;  1XWG A;  1YZX A;  2F9S A;  5KN1 A;  4V1A p;  3GL3 A;  2V1M A;  1AUC A;  4POK A;  2LRN A;  3P8W A;  2ZNM A;  2H76 A;  1S3A A;  1M99 A;  2YZH A;  5G30 A;  1VGL A;  2CA8 A;  3RDW A;  2DIZ A;  2IJY A;  4N10 A;  4KSM A;  3I9V 2;  3APQ A;  5ELA A;  2C3N A;  5CAX A;  3HD5 A;  4EC0 A;  1X9W B;  2I4A A;  1N2A A;  2CQ9 A;  1SEN A;  4TN8 A;  4JED A;  5D73 A;  2LKU A;  1GUK A;  3KP9 A;  2VD0 A;  2HRN A;  1X5D A;  5DBQ A;  1X9M B;  2CX4 A;  2NBS A;  5IMC A;  4KCA A;  1M9A A;  3EMX A;  1OYJ A;  2QSI A;  4ECJ A;  4LL1 B;  4MF6 A;  3GKK A;  3F63 A;  2VCZ A;  1GUM A;  3ERW A;  1O81 A;  4F0C A;  13GS A;  4F0B A;  2F8F A;  2JAC A;  2L57 A;  1VF1 A;  3CMI A;  3DD3 A;  4MZC A;  3F0I A;  3UEM A;  3TB2 A;  4IN0 A;  1FW1 A;  2YOI A;  4TR1 A;  1FB6 A;  1XW6 A;  4JE1 A;  19GS A;  4YQM A;  4OCF A;  2WGR A;  1KNG A;  3GN3 A;  3HDC A;  1CQH A;  4JR6 A;  5DVB A;  3EMP A;  4HZ4 A;  1SD9 A;  1JZW A;  2HRK B;  2G0F A;  3IK9 A;  1SJ6 A;  2IN3 A;  4K6X A;  2HE3 A;  4NXI A;  1GUH A;  3ZYW A;  4IGJ A;  2MMA A;  3Q18 A;  5CO3 A;  3QFB C;  2HRF A;  1TI3 A;  4HOJ A;  1T1V A;  2JU5 A;  3F6F A;  4ECI A;  18GS A;  3KP8 A;  3I6A A;  3GRX A;  4BVX B;  5JCG A;  3FHK A;  2LNT A;  4RI6 A;  4YH2 A;  1EZK A;  2XHF A;  2P0G A;  2GST A;  2YAN A;  2QKE A;  2H0G A;  4HJ2 A;  1GSE A;  5ECO B;  1HNA A;  3TKR A;  1Z6M A;  3F8U A;  4AF2 A;  5H5Q A;  10GS A;  5HR0 A;  1S3C A;  2GTU A;  1SJZ A;  2CVK A;  4Z7X A;  4TRX A;  1M2A A;  3DGQ A;  4DEJ A;  2PVO C;  4ZB6 A;  1G6Y A;  4HEA 2;  3E0U A;  4USS A;  5AN1 A;  2FWE A;  4KAE A;  3HVX A;  1CQG A;  1T00 A;  3G7Y A;  2MBT A;  5J9C A;  1TI1 A;  3GMF A;  1OC9 A;  3A2V A;  5AIS A;  4FQU A;  2RUE A;  2DML A;  4IP6 A;  2F3M A;  2F51 A;  1A8Y A;  5J4U A;  4AJ6 A;  3UBK A;  2HSM A;  4GQC A;  1GTB A;  1M9B A;  2OE3 A;  2FWF A;  1XFL A;  2H19 A;  4WBJ A;  1B48 A;  2GT5 A;  4E8E A;  4TXO A;  4GSN A;  4HJM A;  3HA9 A;  5JWR B;  2HZF A;  1GLP A;  5A4U A;  6GSW A;  5ECR B;  9GSS A;  2LST A;  4V2N A;  3P90 A;  4EL1 A;  3VK9 A;  4MCU A;  3TKS E;  3GIX A;  2LQQ A;  2DJ1 A;  2C0D A;  5IOW A;  4PTS A;  4I2U A;  4TR0 A;  3WGD A;  3VWW A;  1XIY A;  5G1K A;  2CVD A;  1XPV A;  4IEL A;  4ACS A;  5ABR A;  3UMA A;  1AXD A;  4ZL7 A;  3M1G A;  5GAP D;  3VWV A;  5IMF A;  2I3Y A;  3VPT A;  3RAZ A;  1K0N A;  1SYR A;  1RW1 A;  3H93 A;  3BD2 A;  1MDI A;  2J9H A;  1GTU A;  2GDR A;  2FCH A;  4D73 A;  4XS6 A;  3J7Y k;  2PUK C;  3QAG A;  2O89 A;  4NAX A;  1GTI A;  1X5E A;  1JZD A;  4ZBD A;  4MPF A;  4MA9 A;  1K0D A;  5KN0 A;  4K0G A;  4KND A;  5DQS A;  5ECQ B;  2LRT A;  3EIN A;  1B9Y C;  2M80 A;  2KP1 A;  6GSV A;  3IXR A;  3ZVJ D;  5ECK B;  4NV2 A;  1V57 A;  3IV4 A;  2IME A;  2DLX A;  2NVL A;  2GQK A;  2GZY A;  2IWT A;  2YWO A;  3RHC A;  1J9B A;  1BED A;  3TRP A;  3VWU A;  1R4W A;  2YV7 A;  2C3T A;  1IYI A;  3HJM A;  3LXT A;  3ZIV A;  1GSQ A;  4YAV A;  1YF0 A;  3RBT A;  3NIV A;  2A2R A;  1EEM A;  3EVI A;  3DVX A;  2RM5 A;  4MAB A;  3CSJ A;  1NSW A;  4FIW A;  2PWJ A;  1XZO A;  4WXT A;  1RQM A;  5HR3 A;  2L6D A;  5D9X A;  1GSD A;  2HLS A;  3EU4 A;  5EL8 A;  1ZMA A;  1A8L A;  3TJK A;  4IS0 A;  5J5N A;  1TJD A;  5A4W A;  2HI7 A;  2LEG A;  1MD4 A;  3IAM 2;  1HD2 A;  3NOF A;  5LCZ A;  1M7T A;  4ZBA A;  4BWS A;  2VL2 A;  2FWG A;  1M0U A;  2CZ3 A;  1ML6 A;  2PPT A;  2RII A;  1J0F A;  3FKF A;  1AQW A;  2VCW A;  3WYW A;  1UC7 A;  2LTK A;  2B5E A;  3GKN A;  1MTC A;  2GS3 A;  1U88 A;  4KH7 A;  2TRC P;  3W8S A;  2X8G A;  4FH8 A;  3GH9 A;  4HU9 A;  1IYH A;  1I5G A;  2YPM A;  3C71 A;  2DJ3 A;  2OKA A;  1XWB A;  5KN3 A;  1EV9 A;  1XWA A;  4FYC A;  2PN8 A;  2B6M A;  1VRS D;  2E7P A;  1ZL9 A;  1WE0 A;  1AW9 A;  2O7K A;  2REM A;  1TK0 B;  1A24 A;  3QCP A;  2YJH A;  5D96 A;  2PBJ A;  2IL3 A;  3CSH A;  4XHM A;  4QQ7 A;  3ZZX A;  4MH2 A;  2BTO T;  3KJY A;  5B6M A;  2YWM A;  1V40 A;  3LYP A;  4EXJ A;  4BPY A;  5LNK e;  1MDJ A;  2NTO A;  2OBI A;  2VUP A;  3M8N A;  4IJI A;  5G5E A;  1QFN A;  3RPP A;  4K7O A;  4EF0 A;  1T3B A;  4K7I A;  3FR6 A;  3LWA A;  2FA4 A;  4NPB A;  3US3 A;  4J57 E;  2K8V A;  1GL8 A;  3KIJ A;  1Y25 A;  4EVM A;  3WD6 A;  3VI7 A;  2V6K A;  2A2S A;  1GSF A;  2AHE A;  3PPU A;  1YEP A;  5ID2 B;  2JAD A;  5CRW A;  1JZO A;  4XIH A;  3DIE A;  2HYX A;  4IHU A;  4X0X A;  3KH9 A;  2HSN B;  3ED3 A;  1WOU A;  3G9B A;  3HVS A;  1EGO A;  2PU9 C;  2LJA A;  4IJ3 A;  2P5Q A;  2DJJ A;  4IQA A;  4GCI A;  2GSQ A;  1F3A A;  2H1G A;  1WP0 A;  3F9U A;  3KD0 A;  4DVC A;  4L0W A;  3IDV A;  1R5A A;  2B7K A;  5AIV A;  3TOT A;  5LD0 A;  4IKH A;  3ZRD A;  1WJK A;  4KCE A;  3FW2 A;  4RQR A;  3KH7 A;  2H6Z A;  2AB6 A;  2B1K A;  2K6V A;  1BAY A;  5CYY A;  4K1F A;  4ZB9 A;  2E2M A;  3L9U A;  4WEY A;  3TKP A;  4HU7 A;  4E8H A;  5JWO B;  4KB3 A;  1GP1 A;  3ZIJ A;  5CNW A;  1O85 A;  3HVV A;  2C80 A;  5AGY A;  1Z5Y E;  3PIN A;  3ERF A;  2MMO A;  4V2L A;  4ECB A;  3SWL A;  2AUV A;  5G2Z A;  2WRT A;  2V6O A;  5E4W A;  1A2M A;  4LLR A;  3HZ8 A;  1O8W A;  1GNE A;  2VCQ A;  2XBI A;  5H5S A;  4KDX A;  1EEJ A;  5ECS A;  5DDL A;  4TKY A;  3LQ7 A;  3IOS A;  3MAK A;  5B8A A;  5D93 A;  4IVF A;  1R26 A;  1XOB A;  1U6T A;  1GH2 A;  4EDY A;  5J9B A;  3DEX A;  1K3L A;  3TJJ A;  1PN9 A;  2OAC A;  3Q6O A;  1JHB A;  3LOR A;  3L4N A;  1Q98 A;  1PL1 A;  4ID0 A;  5ELG A;  4EKZ A;  4NV5 A;  5IM9 A;  3QAW A;  5HFK A;  3KGK A;  5CP1 A;  3QDN A;  5DJL A;  4G0I A;  1SL0 B;  1YY7 A;  5G31 A;  5D9V A;  1A2J A;  2DMM A;  3I69 A;  4FYB A;  3TKQ A;  3G7I A;  3RPN A;  1JZR A;  3QPM A;  2N5F A;  2EIR A;  3TJG A;  4BL7 A;  1SK2 A;  2CVB A;  4KX4 A;  2EC4 A;  2FNO A;  2MBS A;  5DAL A;  2G2Q A;  1F3B A;  4G10 A;  2VAF A;  5HQP A;  3LJR A;  1EV4 A;  4MP4 A;  4K7N A;  3E3E A;  1YEX A;  4I6X A;  7GSS A;  4MZW A;  1K0B A;  2HZE A;  1PL2 A;  6GST A;  3P2A A;  5ECH B;  5CRG A;  4RQX A;  5CRE A;  4KF9 A;  1SU9 A;  1G6W A;  3KMN A;  3EYT A;  2EIO A;  2R2J A;  2IFQ A;  1PGT A;  3BOA A;  1XVQ A;  3FY7 A;  1EOG A;  2CAQ A;  2H1D A;  3BCI A;  2FGX A;  4Q5N A;  2JZR A;  2MMN A;  2VOC A;  2R4V A;  4HQS A;  1OKT A;  4MK3 A;  3UVT A;  4G19 A;  3W6G A;  3DWV A;  2FWH A;  3DML A;  4MF7 A;  1SK0 A;  5JCU A;  1ABA A;  2C0F A;  2VL9 A;  2WUL A;  4I8B A;  5G5F A;  1Z7R A;  1R5P A;  4GF0 A;  1Z6N A;  2LJK A;  1V98 A;  1THO A;  2WDU A;  3ZMK A;  5AIX A;  3KEB A;  3GTU A;  3GUS A;  1K0M A;  3GNJ A;  3MWH A;  4WBR D;  2FA8 A;  1A0F A;  4POL A;  4JR4 A;  1SKR B;  4CHS A;  3CSI A;  1FVK A;  1NHO A;  4YQU A;  2AJQ B;  1W89 A;  3TDG A;  4GXZ A;  1ZYQ B;  1WWJ A;  3HKR A;  1SL1 B;  4PUA A;  1T8E B;  1ZCP A;  2JZS A;  1U3I A;  3UL3 A;  5JWQ B;  5IPG A;  1YF1 A;  2VLU A;  1XWC A;  1ERW A;  4EUY A;  4OFN A;  4XTS A;  4G9H A;  2HT9 A;  1PX6 A;  5IMV A;  4Q5F A;  3NZN A;  1SK1 A;  3F3Q A;  3TUE A;  3GX8 A;  4TR4 A;  20GS A;  3ZML A;  2FUG 2;  2M46 A;  2D2Z A;  3RHB A;  4YQV A;  5H5R A;  1B8X A;  5D9T A;  4OCE A;  1AC1 A;  2LRC A;  5GST A;  3HXS A;  5D9W A;  1YKA A;  5A4V A;  1TRW A;  2PMT A;  1KBN A;  3JCM L;  3Q19 A;  1TRV A;  2X64 A;  4ULX A;  2M72 A;  4JZQ A;  2NPB A;  3EC3 A;  1OC8 A;  1DSB A;  2HRK A;  2R3X A;  1ILO A;  3CXG A;  4MJA A;  4MDC A;  2F8A A;  1OC3 A;  3WGX A;  3I43 A;  3O3T A;  3C73 A;  3DXB A;  1G0T A;  4TW5 A;  3GST A;  2CT6 A;  4N0Z A;  3QOU A;  4MMM A;  4L5L A;  1TK5 B;  3APO A;  2HSH A;  3FEU A;  5CRH A;  1F9M A;  6GSU A;  3TKS C;  2FY6 A;  4RI7 A;  4BVX A;  4ECC A;  2X99 A;  1BYE A;  1TXX A;  4I5Q A;  2QC7 A;  1JFU A;  3ZL5 A;  4NWY A;  1SJI A;  1BJX A;  1KEB A;  5GSS A;  1PD2 1;  1T4Z A;  1XCC A;  2YJ7 A;  4OO4 A;  3ISO A;  1QK8 A;  3M9K A;  1YDK A;  2BMX A;  1RK4 A;  5EY6 A;  3VI5 A;  5INY A;  5FHI A;  4PUR A;  1OVN A;  4IBP A;  1ERV A;  1XXU A;  1F2E A;  3CRT A;  3FZ5 A;  1V2A A;  2LV3 A;  3KCM A;  4JRR A;  2C0E A;  1Z3E A;  4XRD A;  2B1L A;  1BQ7 A;  2IMD A;  3GYK A;  1GRX A;  5B6N A;  2YZU A;  1NM3 A;  1LU4 A;  2IMI A;  4LA1 A;  4AJ8 A;  2CAI A;  2DSA A;  2LS5 A;  1DE2 A;  4CDO A;  4DSR A;  3D22 A;  1PMT A;  5F06 A;  3UAR A;  1YQ1 A;  4BWQ A;  2B3S A;  3UAP A;  4POM A;  5DCG A;  4XS4 B;  3EU3 A;  4HS1 A;  1SD8 A;  4QL9 A;  4DSS B;  4GRF A;  1M2D A;  3MSZ A;  3FZ4 A;  3TRX A;  2QGV A;  5KEJ A;  3R3E A;  4XS1 A;  4WF4 A;  4EE0 A;  3BJ5 A;  6GSX A;  2O87 A;  2H6X A;  2VIM A;  1BG5 A;  2OE1 A;  1TKD B;  4GTU A;  3ZLP A;  2HSY A;  2WFC A;  1XW5 A;  1WIK A;  3VPQ A;  2VCX A;  1ERT A;  4TOP A;  3F3R A;  4OFM A;  3HHV A;  4RUV A;  2N5B A;  3H4K A;  4F2I A;  1K0O A;  1TOF A;  1I9D A;  1YJ6 A;  4EO3 A;  4OMV A;  4OD7 A;  4BVY A;  2DJ0 A;  3QD9 A;  1S3D A;  2H01 A;  3FZ9 A;  1EOH A;  4P3Y B;  4PUF C;  1O73 A;  2H1A A;  4V2M A;  1FHE A;  2KUC A;  5DAK A;  2R6K A;  1N8J A;  3QFA C;  5IMD A;  2I81 A;  3FK8 A;  1HNC A;  3PH9 A;  4K0N A;  1TU8 A;  1ZYE A;  1GSU A;  1AAZ A;  2WS2 A;  2LJR A;  5F07 A;  2VL3 A;  4K8M A;  5ECP B;  4HZ2 A;  1USB A;  2WB9 A;  3DVW A;  4PGT A;  4GQF A;  3KMO A;  3QAV A;  5F0G A;  4I97 A;  5HFG A;  3HYP A;  3G7J A;  2VCT A;  2FLS A;  1A23 A;  3L78 A;  4WKW A;  4TR1 B;  1XWK A;  1OKD A;  4N30 A;  1SYX A;  2XC2 A;  5DAL B;  2H72 A;  2RLI A;  3D21 A;  1QXH A;  4ZIJ A;  4TXV A;  3MDK A;  1GTA A;  4FYU A;  4KDU A;  1U87 A;  3N9J A;  2GQL A;  4ZIL A;  1XW9 A;  3Q74 A;  2GZZ A;  4XRA A;  2RM6 A;  3K8N A;  4HUA A;  2KLX A;  1GLQ A;  1XVW A;  4MF5 A;  2AV4 A;  2HNL A;  3IA1 A;  4IP1 A;  1GWC A;  4F9Z A;  3UBL A;  3ME8 A;  5HFI A;  5KN2 A;  3D6I A;  2KOK A;  2C1Y A;  1NW2 A;  2LUS A;  3VFI A;  2XPD A;  1K0A A;  1TP9 A;  3C1S A;  2C4J A;  5IQY A;  3IR4 A;  5B7C A;  4J2F A;  1EP7 A;  3H79 A;  4F03 A;  4PNF A;  2V32 A;  4KDY A;  3LGC A;  1UN2 A;  2MZC A;  2GQM A;  3IC4 A;  4TVE A;  3GSS A;  4PNG A;  6GSY A;  5B8B A;  2H74 A;  2JZT A;  1PA3 A;  2YN1 A;  4QL7 A;  1FVJ A;  4GST A;  1R7H A;  1ST9 A;  4PQ1 A;  3AY8 A;  3ZIT A;  3W8J A;  3IHQ A;  5ENU A;  1PSQ A;  4GSS A;  1MDK A;  3A5W A;  2XBQ A;  2VCV A;  4K9Z A;  1OC9 B;  1X5C A;  2YCD A;  5F8B A;  2ALB A;  4Q5R A;  5L71 A;  1QQ2 A;  2XPE A;  1TU7 A;  1OAZ A;  3C1R A;  3VWX A;  11GS A;  2AAW A;  2HSM B;  1O7U A;  4I2T A;  3GKX A;  4POB A;  5COH A;  1B4P A;  4TXO B;  4L0U A;  1H4O A;  1GSY A;  4FO5 A;  2K18 A;  2VLT A;  4LMW A;  3F4R A;  4O7H A;  1LBK A;  2VLV A;  2AYT A;  1MEK A;  2L5O A;  4NHW A;  2P5R A;  1G7O A;  2MYG A;  2H70 A;  4JU5 A;  3IE3 A;  3ZFB A;  5G1L A;  2HFD A;  1SKW B;  5F05 A;  1TK8 B;  3L9V A;  2L59 A;  1TW9 A;  4MZB A;  3BBY A;  1KTE A;  3IAS 2;  5ID2 A;  2WCI A;  4ZL8 A;  1VF4 A;  1ERU A;  4PX1 A;  1QGV A;  1F37 A;  3FR9 A;  4LMV A;  3EE2 A;  14GS A;  8GSS A;  2ES7 A;  5IMZ A;  2I1U A;  2R5G A;  1M2B A;  1H75 A;  4V1A g;  1LJR A;  5IPH A;  3U6V A;  1FAA A;  4N11 A;  4D73 B;  3VUR A;  1UVZ A;  4KUN A;  5DQY A;  2GZP A;  2HXK A;  4O5R A;  4BA7 A;  3GFK A;  3HCZ A;  3TJB A;  4AGS A;  3UVH A;  4X43 A;  4MPG A;  2Z9S A;  5BMU A;  1A0R P;  4WET A;  2JL4 A;  4XCS A;  2GSS A;  3V1W A;  2X8H A;  5C04 A;  1ACV A;  2H6Y A;  1J08 A;  3D4T A;  2H0I A;  1AQX A;  1Z9H A;  4IQ1 A;  2VD1 A;  5J3R A;  3P7X A;  3A3T A;  2WJU A;  3D4M A;  4WR5 A;  3IRA A;  3C7M A;  1WMJ A;  3GHA A;  2IIY A;  3WT1 A;  2BJX A;  3CYN A;  2GLR A;  2GVP A;  2H1B A;  3WGE A;  4KA0 A;  2H75 A;  2B5X A;  5JCW A;  1OE7 A;  4ISD A;  1TTZ A;  3APS A;  3N5O A;  1PQN A;  4PXO A;  3LYK A;  4WF5 A;  3TKS A;  3HZ4 A;  3KZQ A;  3O76 A;  4OFT A;  1TDI A;  3UIW A;  2PVQ A;  2O85 A;  2UZ8 A;  1T4Y A;  3U5R E;  3BCK A;  1Y6E A;  3TGZ A;  3ME7 A;  2TRX A;  1ZZY A;  2C0G A;  5IMA A;  1Z7P A;  4MJC A;  1QMV A;  1NHY A;  1MD3 A;  3HY2 A;  4OO5 A;  2VM1 A;  4DSQ A;  4MLY A;  1Q4J A;  1FO5 A;  4J56 E;  1AIU A;  3LG6 A;  1ZOF A;  4HQZ A;  1FOV A;  4LL4 B;  3GH6 A;  2LNS A;  5C00 A;  1PX7 A;  3CTG A;  1TRS A;  3S9F A;  4PQI A;  3DRN A;  4F82 A;  2GGT A;  4ILF A;  1DUG A;  1VF3 A; 
#chains in the Genus database with same CATH topology
 2RUF A;  5D8I A;  4MJB A;  1FB0 A;  3LEF A;  12GS A;  3FRC A;  4O92 A;  2IMK A;  3CTF A;  3MNG A;  1TRU A;  3M0F A;  1VF2 A;  4AJ7 A;  1OE8 A;  5IO0 A;  3IPZ A;  22GS A;  3KXO A;  1HNB A;  5ECM B;  4KW6 A;  4BVY B;  4G2E A;  3F6D A;  3GUR A;  4YAP A;  3WT2 A;  1U3A A;  1O6J A;  2IPA A;  2OAD A;  3UOM A;  4MJE A;  2H73 A;  2ON7 A;  3E9J B;  4K5R A;  5DAK B;  1HYU A;  2KP2 A;  2OT3 A;  1ON4 A;  2O5V A;  3QR6 A;  5EVO A;  2VM2 A;  4N0V A;  4K2D A;  3ZTL A;  2L5L A;  3M3M A;  2X8C A;  3C8E A;  1XBS A;  3GL5 A;  4GLT A;  3LXZ A;  17GS A;  3PGT A;  4L5O A;  1UA5 A;  1HQO A;  2L4Q A;  3FYG A;  1FG4 A;  2CX3 A;  2K8S A;  3ZVJ A;  2KHP A;  4Q5Q A;  5A5K A;  3OR5 A;  4PI2 C;  3UJ1 A;  4HI7 A;  3LFL A;  3DKS A;  2LQO A;  2H8L A;  3VLN A;  4KGI A;  2OBK A;  1G7E A;  2HRA A;  3TJF A;  2DBC A;  5DCH A;  3IC8 A;  1GUL A;  4ML1 A;  3LSZ A;  2R37 A;  2JSY A;  3CBU A;  2K9F A;  1EGR A;  1E2Y A;  2VO4 A;  3QMX A;  4NMU A;  3A2W A;  2H71 A;  2H66 A;  3SBC A;  2I9H A;  1C72 A;  1X9S B;  5IOX A;  2QA2 A;  2OJL A;  2V2G A;  2YWI A;  5EPF A;  2EIQ A;  3KM6 A;  2OA7 A;  5FWG A;  3M9J A;  1O8X A;  3PR8 A;  3EWL A;  2C8U A;  2YP6 A;  1K3Y A;  4IW9 A;  2ZCT A;  4PQH A;  1JLW A;  2H0H A;  3R2Q A;  3F4S A;  1T7P B;  5GAN D;  2JSZ A;  2DC5 A;  2YWN A;  4ZL9 A;  3TRQ A;  2O8V B;  2DIY A;  3ZFL A;  1W4V A;  2V41 A;  4TR3 A;  4H86 A;  3DYR A;  3TOU A;  2YV9 A;  4PHZ C;  3ERG A;  3EUR A;  1DBY A;  1X0R A;  1A2L A;  3IK7 A;  4KE3 A;  3IBH A;  1PRX A;  3A2X A;  3TCO A;  3CRU A;  4NHZ A;  5ECL B;  3FR3 A;  3F4T A;  4YKG A;  5CRD A;  4O32 A;  2L6C A;  2NDO A;  3IHG A;  2OE0 A;  1THX A;  2E0Q A;  1PKZ A;  1BX9 A;  2C3Q A;  2MMZ A;  1YVL A;  1GNW A;  3O6T A;  3GA4 A;  2PGT A;  1WPI A;  1EWX A;  4G0K A;  1M3I A;  5E59 A;  2CZ2 A;  1DE1 A;  1PN0 A;  1JLV A;  4G0L A;  4O5Q A;  1K3O A;  4ML6 A;  1K0C A;  1WRY A;  3GV1 A;  5J41 A;  1V58 A;  3KTL A;  5HR2 A;  4CW9 A;  2E2G A;  1GSS A;  3ZRE A;  2WW1 A;  1URM A;  16GS A;  4BL7 B;  5A1N A;  1V9W A;  2DJ2 A;  2B5Y A;  2YNX A;  2H30 A;  2HQT A;  1SKS B;  4ZXG A;  3HJP A;  1E6B A;  4OWY A;  4JBB A;  2P31 A;  4ZB8 A;  4X1U A;  3D5J A;  5ECN B;  3GKM A;  3FZA A;  2VL2 C;  2ZUP A;  4GWR A;  3H8Q A;  2IMF A;  2HZE B;  3KTB A;  1B9X C;  5HR1 A;  1QUW A;  2FD3 A;  2ON5 A;  4ZBB A;  4K2X A;  3HJO A;  2B7J A;  5GZZ B;  4HDE A;  2PER A;  2CV4 A;  1SL2 B;  1AQV A;  2N5A A;  1F6M C;  2IFQ B;  2FHE A;  2L4C A;  4WR4 A;  3H1N A;  1YKC A;  1I1I P;  2UV8 G;  2GT6 A;  3L9S A;  5IO2 A;  3D0Z A;  5DJM A;  2X49 A;  1EP8 A;  4MH3 A;  4KSO A;  1B4Q A;  1PKW A;  5ECI B;  1XOA A;  2A4V A;  2WZ9 A;  6GSS A;  2GSR A;  5IIZ A;  4XS4 A;  3GX0 A;  2DJK A;  1ZGN A;  4DSS A;  2TIR A;  3GTU B;  3J7Y b;  4EDZ A;  4L8E A;  3L0H A;  5FT3 A;  2J23 A;  1XWG A;  1YZX A;  2F9S A;  5KN1 A;  4V1A p;  3GL3 A;  2V1M A;  1AUC A;  4POK A;  2LRN A;  3P8W A;  2ZNM A;  2H76 A;  1S3A A;  1M99 A;  2YZH A;  5G30 A;  1VGL A;  2CA8 A;  3RDW A;  2DIZ A;  2IJY A;  4N10 A;  4KSM A;  3I9V 2;  3APQ A;  5ELA A;  2C3N A;  5CAX A;  3HD5 A;  4EC0 A;  1X9W B;  2I4A A;  1N2A A;  2CQ9 A;  1SEN A;  4TN8 A;  4JED A;  5D73 A;  2LKU A;  1GUK A;  3KP9 A;  2VD0 A;  2HRN A;  1X5D A;  5DBQ A;  1X9M B;  2CX4 A;  2NBS A;  5IMC A;  4KCA A;  1M9A A;  3EMX A;  1OYJ A;  2QSI A;  4ECJ A;  4LL1 B;  4MF6 A;  3GKK A;  3F63 A;  2VCZ A;  1GUM A;  3ERW A;  1O81 A;  4F0C A;  13GS A;  4F0B A;  2F8F A;  4A5P A;  2JAC A;  2L57 A;  1VF1 A;  3CMI A;  3DD3 A;  4MZC A;  3F0I A;  3UEM A;  3TB2 A;  4IN0 A;  1FW1 A;  2YOI A;  4TR1 A;  1FB6 A;  1XW6 A;  4JE1 A;  19GS A;  4YQM A;  4OCF A;  2WGR A;  1KNG A;  3GN3 A;  3HDC A;  1CQH A;  4JR6 A;  5DVB A;  3EMP A;  4HZ4 A;  1SD9 A;  1JZW A;  2EFD A;  2HRK B;  2G0F A;  3IK9 A;  1SJ6 A;  3EPT A;  2IN3 A;  4K6X A;  2HE3 A;  4NXI A;  1GUH A;  3ZYW A;  4IGJ A;  2MMA A;  3Q18 A;  5CO3 A;  3QFB C;  2HRF A;  1TI3 A;  4HOJ A;  1T1V A;  2JU5 A;  3F6F A;  4ECI A;  2VKZ G;  18GS A;  3KP8 A;  3I6A A;  3GRX A;  4BVX B;  5JCG A;  3FHK A;  2LNT A;  2EFE A;  4RI6 A;  4YH2 A;  1EZK A;  2XHF A;  2P0G A;  2GST A;  2WW2 A;  2YAN A;  2QKE A;  2H0G A;  4HJ2 A;  1GSE A;  5ECO B;  1HNA A;  3TKR A;  1Z6M A;  4AKG A;  3F8U A;  4AF2 A;  5H5Q A;  10GS A;  4E68 A;  5HR0 A;  4ZB7 A;  1S3C A;  2GTU A;  1SJZ A;  2CVK A;  4Z7X A;  2H1L A;  4TRX A;  1M2A A;  3DGQ A;  4DEJ A;  2PVO C;  4ZB6 A;  1G6Y A;  4HEA 2;  3E0U A;  4USS A;  5AN1 A;  2FWE A;  4KAE A;  3HVX A;  1CQG A;  1T00 A;  3G7Y A;  2MBT A;  5J9C A;  1TI1 A;  3GMF A;  1OC9 A;  3A2V A;  5AIS A;  4FQU A;  2RUE A;  2DML A;  4IP6 A;  2F3M A;  2F51 A;  1A8Y A;  2QA1 A;  5J4U A;  4AJ6 A;  3UBK A;  2HSM A;  4GQC A;  1GTB A;  1M9B A;  2OE3 A;  2FWF A;  1XFL A;  2H19 A;  4WBJ A;  1B48 A;  2GT5 A;  4E8E A;  4TXO A;  4GSN A;  4HJM A;  3HA9 A;  5JWR B;  2HZF A;  3MIX A;  1GLP A;  5A4U A;  6GSW A;  5ECR B;  9GSS A;  2LST A;  4V2N A;  2A2P A;  3P90 A;  4EL1 A;  4CY8 A;  3VK9 A;  4MCU A;  3TKS E;  3GIX A;  2LQQ A;  2DJ1 A;  2C0D A;  5IOW A;  5A34 A;  1ZYP A;  4PTS A;  4I2U A;  2O3E A;  4TR0 A;  3WGD A;  3VWW A;  1XIY A;  5G1K A;  2CVD A;  1XPV A;  4IEL A;  4ACS A;  5ABR A;  3UMA A;  1AXD A;  4ZL7 A;  3M1G A;  5GAP D;  3VWV A;  5IMF A;  2I3Y A;  3VPT A;  3RAZ A;  1K0N A;  1SYR A;  1RW1 A;  3H93 A;  3BD2 A;  1MDI A;  2J9H A;  1GTU A;  2GDR A;  2FCH A;  4D73 A;  4XS6 A;  3J7Y k;  2PUK C;  3QAG A;  2O89 A;  4NAX A;  1GTI A;  1X5E A;  1JZD A;  4ZBD A;  4MPF A;  4MA9 A;  1K0D A;  5KN0 A;  4K0G A;  4KND A;  5DQS A;  5ECQ B;  2LRT A;  3EIN A;  1B9Y C;  2M80 A;  2KP1 A;  6GSV A;  2WZS A;  3IXR A;  3ZVJ D;  5ECK B;  4NV2 A;  1V57 A;  3IV4 A;  2IME A;  2DLX A;  2NVL A;  3HVN A;  2GQK A;  2GZY A;  2IWT A;  2YWO A;  4AI6 A;  2WVX B;  3RHC A;  1J9B A;  1BED A;  3TRP A;  3VWU A;  2WVZ A;  1S3R A;  1R4W A;  2YV7 A;  2C3T A;  1IYI A;  3HJM A;  3LXT A;  3ZIV A;  1GSQ A;  4YAV A;  1YF0 A;  3RBT A;  4O5U A;  3NIV A;  5J4V A;  2A2R A;  1EEM A;  3EVI A;  3DVX A;  2RM5 A;  4MAB A;  3CSJ A;  1NSW A;  3FMW A;  4FIW A;  2PWJ A;  1XZO A;  4WXT A;  1RQM A;  5HR3 A;  2L6D A;  5D9X A;  1GSD A;  2HLS A;  3EU4 A;  5EL8 A;  1ZMA A;  1A8L A;  3TJK A;  4IS0 A;  5J5N A;  1TJD A;  1FOH A;  5A4W A;  2HI7 A;  2LEG A;  1MD4 A;  4PI0 C;  3IAM 2;  1HD2 A;  3NOF A;  5LCZ A;  3RGB C;  1M7T A;  4ZBA A;  4BWS A;  5A5H B;  2VL2 A;  2FWG A;  1M0U A;  2CZ3 A;  1ML6 A;  2PPT A;  2RII A;  1J0F A;  3FKF A;  1AQW A;  2VCW A;  3WYW A;  1UC7 A;  2LTK A;  2B5E A;  3GKN A;  1MTC A;  2GS3 A;  1U88 A;  4KH7 A;  2TRC P;  3W8S A;  2X8G A;  4FH8 A;  3GH9 A;  4HU9 A;  1IYH A;  1I5G A;  2YPM A;  3C71 A;  2DJ3 A;  2OKA A;  1XWB A;  5KN3 A;  1EV9 A;  1XWA A;  4FYC A;  2PN8 A;  2B6M A;  1VRS D;  2E7P A;  1ZL9 A;  1WE0 A;  1AW9 A;  2O7K A;  2REM A;  1TK0 B;  1A24 A;  3QCP A;  2YJH A;  5D96 A;  2PBJ A;  2IL3 A;  3CSH A;  4XHM A;  4QQ7 A;  3ZZX A;  4MH2 A;  2BTO T;  3KJY A;  5B6M A;  1SVM A;  2YWM A;  1V40 A;  3LYP A;  1N25 A;  4EXJ A;  4BPY A;  5LNK e;  1MDJ A;  2NTO A;  2OBI A;  2VUP A;  3M8N A;  4IJI A;  5G5E A;  1QFN A;  3RPP A;  4K7O A;  4EF0 A;  1T3B A;  4K7I A;  3FR6 A;  3LWA A;  2FA4 A;  4NPB A;  3US3 A;  4J57 E;  2K8V A;  1GL8 A;  3KIJ A;  1Y25 A;  4EVM A;  4K5S A;  3WD6 A;  3VI7 A;  2V6K A;  2A2S A;  1GSF A;  2AHE A;  3PPU A;  1YEP A;  5ID2 B;  2JAD A;  5CRW A;  1JZO A;  4XIH A;  3DIE A;  2HYX A;  4IHU A;  4X0X A;  3KH9 A;  2EFH A;  2HSN B;  3ED3 A;  4AKX B;  3HMJ G;  1WOU A;  3G9B A;  3HVS A;  1EGO A;  2PU9 C;  2LJA A;  4IJ3 A;  2P5Q A;  2DJJ A;  4IQA A;  4GCI A;  2GSQ A;  1F3A A;  2H1G A;  1WP0 A;  3F9U A;  3KD0 A;  4DVC A;  4L0W A;  5BMU B;  3IDV A;  1R5A A;  2B7K A;  1SVL A;  5AIV A;  3TOT A;  5LD0 A;  4IKH A;  3ZRD A;  1WJK A;  4KCE A;  3FW2 A;  4RQR A;  3KH7 A;  2H6Z A;  2AB6 A;  2B1K A;  2K6V A;  1BAY A;  5CYY A;  4K1F A;  4ZB9 A;  2E2M A;  3L9U A;  4WEY A;  3TKP A;  4HU7 A;  4E8H A;  5JWO B;  4KB3 A;  1GP1 A;  3ZIJ A;  5CNW A;  1O85 A;  3HVV A;  2C80 A;  5AGY A;  1Z5Y E;  3PIN A;  3ERF A;  2MMO A;  4V2L A;  4ECB A;  3SWL A;  2AUV A;  5G2Z A;  2WRT A;  2V6O A;  5E4W A;  1A2M A;  4LLR A;  3HZ8 A;  1O8W A;  1GNE A;  2VCQ A;  2XBI A;  5H5S A;  4KDX A;  1EEJ A;  5ECS A;  5DDL A;  4TKY A;  3LQ7 A;  3IOS A;  3MAK A;  5B8A A;  5D93 A;  4IVF A;  1R26 A;  1XOB A;  1U6T A;  1GH2 A;  4EDY A;  5J9B A;  3DEX A;  1K3L A;  3TJJ A;  1PN9 A;  2OAC A;  5J47 A;  3Q6O A;  1JHB A;  3LOR A;  3L4N A;  1Q98 A;  1PL1 A;  4ID0 A;  5ELG A;  3CHX C;  4EKZ A;  4NV5 A;  5IM9 A;  3QAW A;  5KOW A;  5HFK A;  2R0G A;  3KGK A;  5CP1 A;  3QDN A;  5DJL A;  4G0I A;  1SL0 B;  1YY7 A;  5G31 A;  5D9V A;  1A2J A;  2DMM A;  4Z2R A;  3I69 A;  4FYB A;  3TKQ A;  3G7I A;  3RPN A;  1JZR A;  3QPM A;  2N5F A;  2EIR A;  3TJG A;  4BL7 A;  1YEW C;  1SK2 A;  2CVB A;  4KX4 A;  2EC4 A;  2FNO A;  2MBS A;  5DAL A;  2G2Q A;  1F3B A;  4G10 A;  2VAF A;  5HQP A;  3LJR A;  1EV4 A;  5J40 A;  4MP4 A;  4K7N A;  3E3E A;  1YEX A;  1ZYN A;  4I6X A;  7GSS A;  1XG8 A;  4MZW A;  1K0B A;  2WW3 A;  2HZE A;  1PL2 A;  6GST A;  3P2A A;  5ECH B;  5CRG A;  4RQX A;  5CRE A;  4KF9 A;  1Y1U A;  1SU9 A;  1G6W A;  3KMN A;  3EYT A;  2EIO A;  2R2J A;  2IFQ A;  1PGT A;  3BOA A;  1XVQ A;  3FY7 A;  1EOG A;  5KOX A;  2CAQ A;  2H1D A;  3BCI A;  2FGX A;  4Q5N A;  2JZR A;  2MMN A;  2VOC A;  2R4V A;  4HQS A;  1OKT A;  4MK3 A;  3UVT A;  4MNN A;  4G19 A;  3W6G A;  3DWV A;  2FWH A;  3DML A;  4MF7 A;  1SK0 A;  5JCU A;  1ABA A;  2C0F A;  2VL9 A;  2WUL A;  4I8B A;  5G5F A;  1Z7R A;  1R5P A;  4GF0 A;  1Z6N A;  2LJK A;  1V98 A;  1THO A;  2WDU A;  3ZMK A;  5AIX A;  3KEB A;  3GTU A;  3GUS A;  1K0M A;  3GNJ A;  3MWH A;  4WBR D;  2FA8 A;  1A0F A;  4POL A;  4JR4 A;  1SKR B;  4CHS A;  3CSI A;  1FVK A;  1NHO A;  4YQU A;  2AJQ B;  1W89 A;  3TDG A;  4GXZ A;  1ZYQ B;  1WWJ A;  3HKR A;  1SL1 B;  3A5I A;  4PUA A;  1T8E B;  1ZCP A;  2JZS A;  1U3I A;  3UL3 A;  5JWQ B;  5IPG A;  1YF1 A;  4N3Z A;  2VLU A;  1XWC A;  1ERW A;  4EUY A;  4OFN A;  4XTS A;  5BRT A;  4G9H A;  4AKI A;  2HT9 A;  1PX6 A;  5IMV A;  4Q5F A;  3NZN A;  1SK1 A;  3F3Q A;  3TUE A;  3GX8 A;  4Z2U A;  4TR4 A;  20GS A;  3ZML A;  2FUG 2;  2M46 A;  2D2Z A;  3RHB A;  4YQV A;  5H5R A;  1B8X A;  1TXU A;  5D9T A;  4OCE A;  1AC1 A;  4X4J A;  2LRC A;  5GST A;  3HXS A;  5D9W A;  1YKA A;  5A4V A;  1TRW A;  2PMT A;  1KBN A;  3JCM L;  3Q19 A;  1TRV A;  2X64 A;  4ULX A;  2M72 A;  4JZQ A;  2NPB A;  3EC3 A;  1OC8 A;  1DSB A;  2HRK A;  2R3X A;  1ILO A;  3CXG A;  4MJA A;  4MDC A;  2F8A A;  1OC3 A;  3WGX A;  3I43 A;  3O3T A;  3C73 A;  3DXB A;  1G0T A;  4TW5 A;  3GST A;  2CT6 A;  4N0Z A;  3QOU A;  4MMM A;  4L5L A;  2DKH A;  1TK5 B;  3APO A;  2HSH A;  3FEU A;  5CRH A;  1F9M A;  6GSU A;  3TKS C;  2FY6 A;  4RI7 A;  4BVX A;  4ECC A;  2X99 A;  1BYE A;  1TXX A;  4I5Q A;  2X4A A;  5A1N B;  2QC7 A;  1JFU A;  3ZL5 A;  4NWY A;  1SJI A;  1BJX A;  1KEB A;  5GSS A;  1PD2 1;  1T4Z A;  1XCC A;  2YJ7 A;  4OO4 A;  3ISO A;  1QK8 A;  3M9K A;  1YDK A;  2BMX A;  1RK4 A;  5EY6 A;  3VI5 A;  5INY A;  4GDF A;  5FHI A;  4PUR A;  1OVN A;  4IBP A;  4G01 A;  1ERV A;  1XXU A;  1F2E A;  3CRT A;  3FZ5 A;  1V2A A;  2LV3 A;  3KCM A;  4JRR A;  2C0E A;  1Z3E A;  4XRD A;  2B1L A;  1BQ7 A;  2IMD A;  3GYK A;  1GRX A;  5B6N A;  2YZU A;  1NM3 A;  1LU4 A;  2IMI A;  4LA1 A;  4AJ8 A;  2CAI A;  2DSA A;  2LS5 A;  1DE2 A;  1M3J A;  4CDO A;  4DSR A;  3D22 A;  1PMT A;  5F06 A;  3UAR A;  1YQ1 A;  4BWQ A;  2B3S A;  3UAP A;  4POM A;  5DCG A;  4XS4 B;  3EU3 A;  4HS1 A;  1SD8 A;  4QL9 A;  4DSS B;  4GRF A;  1M2D A;  3MSZ A;  3FZ4 A;  3TRX A;  2QGV A;  5KEJ A;  3R3E A;  4XS1 A;  4WF4 A;  4EE0 A;  3BJ5 A;  6GSX A;  2O87 A;  2H6X A;  2VIM A;  1BG5 A;  2OE1 A;  1TKD B;  4GTU A;  3ZLP A;  2HSY A;  2WFC A;  1XW5 A;  1WIK A;  3VPQ A;  2VCX A;  1ERT A;  4TOP A;  3F3R A;  4OFM A;  3HHV A;  4RUV A;  1S4B P;  2N5B A;  3H4K A;  4F2I A;  1K0O A;  1TOF A;  1I9D A;  1YJ6 A;  2EFC A;  4EO3 A;  4OMV A;  4ICY A;  4OD7 A;  4BVY A;  2DJ0 A;  3QD9 A;  1S3D A;  2H01 A;  3FZ9 A;  1EOH A;  4P3Y B;  4PUF C;  1O73 A;  2H1A A;  4YKF A;  4V2M A;  1FHE A;  2A4H A;  2KUC A;  5DAK A;  4QMK A;  2R6K A;  1N8J A;  3QFA C;  4W66 A;  5IMD A;  2I81 A;  3FK8 A;  1HNC A;  3PH9 A;  4K0N A;  1TU8 A;  1ZYE A;  1GSU A;  1AAZ A;  1BG1 A;  2WS2 A;  2LJR A;  5F07 A;  2VL3 A;  4K8M A;  5ECP B;  4HZ2 A;  1USB A;  2WB9 A;  3DVW A;  4PGT A;  4GQF A;  3KMO A;  3QAV A;  5F0G A;  4I97 A;  5HFG A;  3HYP A;  3G7J A;  2VCT A;  2FLS A;  1A23 A;  3L78 A;  4WKW A;  4TR1 B;  1XWK A;  1OKD A;  4N30 A;  1SYX A;  2XC2 A;  5DAL B;  2O36 A;  2H72 A;  2RLI A;  3D21 A;  2WVX A;  1QXH A;  4ZIJ A;  4TXV A;  3MDK A;  1GTA A;  4FYU A;  4KDU A;  1U87 A;  3N9J A;  1BF5 A;  2GQL A;  4ZIL A;  1XW9 A;  3Q74 A;  2GZZ A;  4XRA A;  2RM6 A;  3K8N A;  4HUA A;  2KLX A;  1GLQ A;  1XVW A;  4MF5 A;  2AV4 A;  2HNL A;  3IA1 A;  4IP1 A;  1GWC A;  4F9Z A;  3UBL A;  3ME8 A;  5HFI A;  2WW0 A;  5KN2 A;  3D6I A;  2KOK A;  2C1Y A;  1NW2 A;  2LUS A;  3VFI A;  2XPD A;  1K0A A;  1TP9 A;  3C1S A;  2C4J A;  5IQY A;  3IR4 A;  3RFR C;  5B7C A;  4J2F A;  1EP7 A;  1PFO A;  3H79 A;  4F03 A;  4PNF A;  2V32 A;  4KDY A;  3LGC A;  1UN2 A;  2MZC A;  2GQM A;  3IC4 A;  4TVE A;  5A5H A;  3GSS A;  4PNG A;  6GSY A;  5B8B A;  2H74 A;  2JZT A;  1PA3 A;  2YN1 A;  4QL7 A;  1FVJ A;  4GST A;  1R7H A;  1ST9 A;  4PQ1 A;  2WVY A;  3AY8 A;  2DKI A;  3ZIT A;  3W8J A;  3IHQ A;  5ENU A;  3TU3 B;  1PSQ A;  4GSS A;  1MDK A;  3A5W A;  3CWG A;  2XBQ A;  2VCV A;  4K9Z A;  1OC9 B;  1X5C A;  2YCD A;  5F8B A;  2ALB A;  4Q5R A;  5L71 A;  1QQ2 A;  2XPE A;  1TU7 A;  1OAZ A;  3C1R A;  3VWX A;  11GS A;  2AAW A;  2HSM B;  1O7U A;  4I2T A;  3GKX A;  4POB A;  5COH A;  1B4P A;  4TXO B;  4L0U A;  1H4O A;  1GSY A;  4FO5 A;  2K18 A;  2VLT A;  4LMW A;  3F4R A;  4O7H A;  1LBK A;  2VLV A;  2AYT A;  1MEK A;  2L5O A;  4NHW A;  2P5R A;  1G7O A;  2MYG A;  2H70 A;  4JU5 A;  3IE3 A;  5A34 B;  4EIP A;  3ZFB A;  5G1L A;  2HFD A;  1SKW B;  5F05 A;  1TK8 B;  3L9V A;  2L59 A;  1TW9 A;  4MZB A;  3BBY A;  4EIQ A;  1KTE A;  3IAS 2;  5ID2 A;  2WCI A;  4ZL8 A;  1VF4 A;  1ERU A;  4PX1 A;  1QGV A;  1F37 A;  3FR9 A;  4LMV A;  3EE2 A;  14GS A;  8GSS A;  2ES7 A;  5IMZ A;  2I1U A;  2R5G A;  1M2B A;  1H75 A;  4V1A g;  2HSN A;  1LJR A;  3CQF A;  5IPH A;  3U6V A;  1FAA A;  4N11 A;  4D73 B;  3VUR A;  1UVZ A;  4KUN A;  5DQY A;  2GZP A;  2HXK A;  4O5R A;  4BA7 A;  3GFK A;  3HCZ A;  3TJB A;  4AGS A;  3UVH A;  4X43 A;  4MPG A;  2Z9S A;  4CY6 A;  5BMU A;  3MYD A;  4Z2T A;  1A0R P;  4WET A;  2JL4 A;  4XCS A;  2GSS A;  3V1W A;  1SVO A;  2X8H A;  5C04 A;  1ACV A;  2H6Y A;  1J08 A;  3D4T A;  2H0I A;  1AQX A;  4HSC X;  1Z9H A;  4IQ1 A;  2VD1 A;  5J3R A;  3P7X A;  3A3T A;  2WJU A;  3D4M A;  4WR5 A;  3IRA A;  3C7M A;  1WMJ A;  3GHA A;  2IIY A;  3WT1 A;  2BJX A;  3CYN A;  2GLR A;  2R0C A;  2GVP A;  4AKH A;  2H1B A;  3WGE A;  4KA0 A;  2H75 A;  2B5X A;  5JCW A;  1OE7 A;  4ISD A;  1TTZ A;  3APS A;  3N5O A;  1PQN A;  4PXO A;  3LYK A;  4WF5 A;  3TKS A;  3HZ4 A;  3KZQ A;  3O76 A;  4OFT A;  4BIK A;  1TDI A;  3UIW A;  2PVQ A;  2O85 A;  2R0P A;  2UZ8 A;  1T4Y A;  3U5R E;  3BCK A;  3LW9 A;  1Y6E A;  3TGZ A;  3ME7 A;  2TRX A;  1ZZY A;  2C0G A;  5IMA A;  1Z7P A;  4MJC A;  1QMV A;  1NHY A;  1MD3 A;  3HY2 A;  4OO5 A;  2VM1 A;  4DSQ A;  4MLY A;  5J4Y A;  1Q4J A;  1FO5 A;  4J56 E;  1AIU A;  4FXY P;  3LG6 A;  1ZOF A;  4HQZ A;  1FOV A;  4LL4 B;  3GH6 A;  2LNS A;  5C00 A;  1PX7 A;  3CTG A;  1TRS A;  3S9F A;  4PQI A;  3DRN A;  4F82 A;  2GGT A;  4ILF A;  1DUG A;  1VF3 A; 
#chains in the Genus database with same CATH homology
 2RUF A;  5D8I A;  4MJB A;  1FB0 A;  3LEF A;  12GS A;  3FRC A;  4O92 A;  2IMK A;  3CTF A;  3MNG A;  1TRU A;  3M0F A;  1VF2 A;  4AJ7 A;  1OE8 A;  5IO0 A;  3IPZ A;  22GS A;  3KXO A;  1HNB A;  5ECM B;  4KW6 A;  4BVY B;  4G2E A;  3F6D A;  3GUR A;  4YAP A;  3WT2 A;  1U3A A;  1O6J A;  2IPA A;  2OAD A;  3UOM A;  4MJE A;  2H73 A;  2ON7 A;  3E9J B;  4K5R A;  5DAK B;  1HYU A;  2KP2 A;  2OT3 A;  1ON4 A;  2O5V A;  3QR6 A;  5EVO A;  2VM2 A;  4N0V A;  4K2D A;  3ZTL A;  2L5L A;  3M3M A;  2X8C A;  3C8E A;  1XBS A;  3GL5 A;  4GLT A;  3LXZ A;  17GS A;  3PGT A;  4L5O A;  1UA5 A;  1HQO A;  2L4Q A;  3FYG A;  1FG4 A;  2CX3 A;  2K8S A;  3ZVJ A;  2KHP A;  4Q5Q A;  5A5K A;  3OR5 A;  3UJ1 A;  4HI7 A;  3LFL A;  3DKS A;  2LQO A;  2H8L A;  3VLN A;  4KGI A;  2OBK A;  1G7E A;  2HRA A;  3TJF A;  2DBC A;  5DCH A;  3IC8 A;  1GUL A;  4ML1 A;  3LSZ A;  2R37 A;  2JSY A;  3CBU A;  2K9F A;  1EGR A;  1E2Y A;  2VO4 A;  3QMX A;  4NMU A;  3A2W A;  2H71 A;  2H66 A;  3SBC A;  2I9H A;  1C72 A;  1X9S B;  5IOX A;  2QA2 A;  2OJL A;  2V2G A;  2YWI A;  5EPF A;  2EIQ A;  3KM6 A;  2OA7 A;  5FWG A;  3M9J A;  1O8X A;  3PR8 A;  3EWL A;  2C8U A;  2YP6 A;  1K3Y A;  4IW9 A;  2ZCT A;  4PQH A;  1JLW A;  2H0H A;  3R2Q A;  3F4S A;  1T7P B;  5GAN D;  2JSZ A;  2DC5 A;  2YWN A;  4ZL9 A;  3TRQ A;  2O8V B;  2DIY A;  3ZFL A;  1W4V A;  2V41 A;  4TR3 A;  4H86 A;  3DYR A;  3TOU A;  2YV9 A;  3ERG A;  3EUR A;  1DBY A;  1X0R A;  1A2L A;  3IK7 A;  4KE3 A;  3IBH A;  1PRX A;  3A2X A;  3TCO A;  3CRU A;  4NHZ A;  5ECL B;  3FR3 A;  3F4T A;  4YKG A;  5CRD A;  4O32 A;  2L6C A;  2NDO A;  3IHG A;  2OE0 A;  1THX A;  2E0Q A;  1PKZ A;  1BX9 A;  2C3Q A;  2MMZ A;  1YVL A;  1GNW A;  3O6T A;  3GA4 A;  2PGT A;  1WPI A;  1EWX A;  4G0K A;  5E59 A;  2CZ2 A;  1DE1 A;  1PN0 A;  1JLV A;  4G0L A;  4O5Q A;  1K3O A;  4ML6 A;  1K0C A;  1WRY A;  3GV1 A;  5J41 A;  1V58 A;  3KTL A;  5HR2 A;  4CW9 A;  2E2G A;  1GSS A;  3ZRE A;  1URM A;  16GS A;  4BL7 B;  5A1N A;  1V9W A;  2DJ2 A;  2B5Y A;  2YNX A;  2H30 A;  2HQT A;  1SKS B;  4ZXG A;  3HJP A;  1E6B A;  4OWY A;  4JBB A;  2P31 A;  4ZB8 A;  4X1U A;  3D5J A;  5ECN B;  3GKM A;  3FZA A;  2VL2 C;  2ZUP A;  4GWR A;  3H8Q A;  2IMF A;  2HZE B;  3KTB A;  1B9X C;  5HR1 A;  1QUW A;  2FD3 A;  2ON5 A;  4ZBB A;  4K2X A;  3HJO A;  2B7J A;  5GZZ B;  4HDE A;  2PER A;  2CV4 A;  1SL2 B;  1AQV A;  2N5A A;  1F6M C;  2IFQ B;  2FHE A;  2L4C A;  4WR4 A;  3H1N A;  1YKC A;  2UV8 G;  2GT6 A;  3L9S A;  5IO2 A;  3D0Z A;  5DJM A;  2X49 A;  1EP8 A;  4MH3 A;  4KSO A;  1B4Q A;  1PKW A;  5ECI B;  1XOA A;  2A4V A;  2WZ9 A;  6GSS A;  2GSR A;  5IIZ A;  4XS4 A;  3GX0 A;  2DJK A;  1ZGN A;  4DSS A;  2TIR A;  3GTU B;  3J7Y b;  4EDZ A;  4L8E A;  3L0H A;  5FT3 A;  2J23 A;  1XWG A;  1YZX A;  2F9S A;  5KN1 A;  4V1A p;  3GL3 A;  2V1M A;  1AUC A;  4POK A;  2LRN A;  3P8W A;  2ZNM A;  2H76 A;  1S3A A;  1M99 A;  2YZH A;  5G30 A;  1VGL A;  2CA8 A;  3RDW A;  2DIZ A;  2IJY A;  4N10 A;  4KSM A;  3I9V 2;  3APQ A;  5ELA A;  2C3N A;  5CAX A;  3HD5 A;  4EC0 A;  1X9W B;  2I4A A;  1N2A A;  2CQ9 A;  1SEN A;  4TN8 A;  4JED A;  5D73 A;  2LKU A;  1GUK A;  3KP9 A;  2VD0 A;  2HRN A;  1X5D A;  5DBQ A;  1X9M B;  2CX4 A;  2NBS A;  5IMC A;  4KCA A;  1M9A A;  3EMX A;  1OYJ A;  2QSI A;  4ECJ A;  4LL1 B;  4MF6 A;  3GKK A;  3F63 A;  2VCZ A;  1GUM A;  3ERW A;  1O81 A;  4F0C A;  13GS A;  4F0B A;  2F8F A;  4A5P A;  2JAC A;  2L57 A;  1VF1 A;  3CMI A;  3DD3 A;  4MZC A;  3F0I A;  3UEM A;  3TB2 A;  4IN0 A;  1FW1 A;  2YOI A;  4TR1 A;  1FB6 A;  1XW6 A;  4JE1 A;  19GS A;  4YQM A;  4OCF A;  2WGR A;  1KNG A;  3GN3 A;  3HDC A;  1CQH A;  4JR6 A;  5DVB A;  3EMP A;  4HZ4 A;  1SD9 A;  1JZW A;  2EFD A;  2HRK B;  2G0F A;  3IK9 A;  1SJ6 A;  3EPT A;  2IN3 A;  4K6X A;  2HE3 A;  4NXI A;  1GUH A;  3ZYW A;  4IGJ A;  2MMA A;  3Q18 A;  5CO3 A;  3QFB C;  2HRF A;  1TI3 A;  4HOJ A;  1T1V A;  2JU5 A;  3F6F A;  4ECI A;  2VKZ G;  18GS A;  3KP8 A;  3I6A A;  3GRX A;  4BVX B;  5JCG A;  3FHK A;  2LNT A;  2EFE A;  4RI6 A;  4YH2 A;  1EZK A;  2XHF A;  2P0G A;  2GST A;  2YAN A;  2QKE A;  2H0G A;  4HJ2 A;  1GSE A;  5ECO B;  1HNA A;  3TKR A;  1Z6M A;  4AKG A;  3F8U A;  4AF2 A;  5H5Q A;  10GS A;  4E68 A;  5HR0 A;  4ZB7 A;  1S3C A;  2GTU A;  1SJZ A;  2CVK A;  4Z7X A;  2H1L A;  4TRX A;  1M2A A;  3DGQ A;  4DEJ A;  2PVO C;  4ZB6 A;  1G6Y A;  4HEA 2;  3E0U A;  4USS A;  5AN1 A;  2FWE A;  4KAE A;  3HVX A;  1CQG A;  1T00 A;  3G7Y A;  2MBT A;  5J9C A;  1TI1 A;  3GMF A;  1OC9 A;  3A2V A;  5AIS A;  4FQU A;  2RUE A;  2DML A;  4IP6 A;  2F3M A;  2F51 A;  1A8Y A;  2QA1 A;  5J4U A;  4AJ6 A;  3UBK A;  2HSM A;  4GQC A;  1GTB A;  1M9B A;  2OE3 A;  2FWF A;  1XFL A;  2H19 A;  4WBJ A;  1B48 A;  2GT5 A;  4E8E A;  4TXO A;  4GSN A;  4HJM A;  3HA9 A;  5JWR B;  2HZF A;  3MIX A;  1GLP A;  5A4U A;  6GSW A;  5ECR B;  9GSS A;  2LST A;  4V2N A;  2A2P A;  3P90 A;  4EL1 A;  4CY8 A;  3VK9 A;  4MCU A;  3TKS E;  3GIX A;  2LQQ A;  2DJ1 A;  2C0D A;  5IOW A;  5A34 A;  1ZYP A;  4PTS A;  4I2U A;  4TR0 A;  3WGD A;  3VWW A;  1XIY A;  5G1K A;  2CVD A;  1XPV A;  4IEL A;  4ACS A;  5ABR A;  3UMA A;  1AXD A;  4ZL7 A;  3M1G A;  5GAP D;  3VWV A;  5IMF A;  2I3Y A;  3VPT A;  3RAZ A;  1K0N A;  1SYR A;  1RW1 A;  3H93 A;  3BD2 A;  1MDI A;  2J9H A;  1GTU A;  2GDR A;  2FCH A;  4D73 A;  4XS6 A;  3J7Y k;  2PUK C;  3QAG A;  2O89 A;  4NAX A;  1GTI A;  1X5E A;  1JZD A;  4ZBD A;  4MPF A;  4MA9 A;  1K0D A;  5KN0 A;  4K0G A;  4KND A;  5DQS A;  5ECQ B;  2LRT A;  3EIN A;  1B9Y C;  2M80 A;  2KP1 A;  6GSV A;  3IXR A;  3ZVJ D;  5ECK B;  4NV2 A;  1V57 A;  3IV4 A;  2IME A;  2DLX A;  2NVL A;  2GQK A;  2GZY A;  2IWT A;  2YWO A;  4AI6 A;  3RHC A;  1J9B A;  1BED A;  3TRP A;  3VWU A;  1R4W A;  2YV7 A;  2C3T A;  1IYI A;  3HJM A;  3LXT A;  3ZIV A;  1GSQ A;  4YAV A;  1YF0 A;  3RBT A;  4O5U A;  3NIV A;  5J4V A;  2A2R A;  1EEM A;  3EVI A;  3DVX A;  2RM5 A;  4MAB A;  3CSJ A;  1NSW A;  3FMW A;  4FIW A;  2PWJ A;  1XZO A;  4WXT A;  1RQM A;  5HR3 A;  2L6D A;  5D9X A;  1GSD A;  2HLS A;  3EU4 A;  5EL8 A;  1ZMA A;  1A8L A;  3TJK A;  4IS0 A;  5J5N A;  1TJD A;  1FOH A;  5A4W A;  2HI7 A;  2LEG A;  1MD4 A;  3IAM 2;  1HD2 A;  3NOF A;  5LCZ A;  1M7T A;  4ZBA A;  4BWS A;  5A5H B;  2VL2 A;  2FWG A;  1M0U A;  2CZ3 A;  1ML6 A;  2PPT A;  2RII A;  1J0F A;  3FKF A;  1AQW A;  2VCW A;  3WYW A;  1UC7 A;  2LTK A;  2B5E A;  3GKN A;  1MTC A;  2GS3 A;  1U88 A;  4KH7 A;  2TRC P;  3W8S A;  2X8G A;  4FH8 A;  3GH9 A;  4HU9 A;  1IYH A;  1I5G A;  2YPM A;  3C71 A;  2DJ3 A;  2OKA A;  1XWB A;  5KN3 A;  1EV9 A;  1XWA A;  4FYC A;  2PN8 A;  2B6M A;  1VRS D;  2E7P A;  1ZL9 A;  1WE0 A;  1AW9 A;  2O7K A;  2REM A;  1TK0 B;  1A24 A;  3QCP A;  2YJH A;  5D96 A;  2PBJ A;  2IL3 A;  3CSH A;  4XHM A;  4QQ7 A;  3ZZX A;  4MH2 A;  2BTO T;  3KJY A;  5B6M A;  1SVM A;  2YWM A;  1V40 A;  3LYP A;  1N25 A;  4EXJ A;  4BPY A;  5LNK e;  1MDJ A;  2NTO A;  2OBI A;  2VUP A;  3M8N A;  4IJI A;  5G5E A;  1QFN A;  3RPP A;  4K7O A;  4EF0 A;  1T3B A;  4K7I A;  3FR6 A;  3LWA A;  2FA4 A;  4NPB A;  3US3 A;  4J57 E;  2K8V A;  1GL8 A;  3KIJ A;  1Y25 A;  4EVM A;  4K5S A;  3WD6 A;  3VI7 A;  2V6K A;  2A2S A;  1GSF A;  2AHE A;  3PPU A;  1YEP A;  5ID2 B;  2JAD A;  5CRW A;  1JZO A;  4XIH A;  3DIE A;  2HYX A;  4IHU A;  4X0X A;  3KH9 A;  2EFH A;  2HSN B;  3ED3 A;  4AKX B;  3HMJ G;  1WOU A;  3G9B A;  3HVS A;  1EGO A;  2PU9 C;  2LJA A;  4IJ3 A;  2P5Q A;  2DJJ A;  4IQA A;  4GCI A;  2GSQ A;  1F3A A;  2H1G A;  1WP0 A;  3F9U A;  3KD0 A;  4DVC A;  4L0W A;  5BMU B;  3IDV A;  1R5A A;  2B7K A;  1SVL A;  5AIV A;  3TOT A;  5LD0 A;  4IKH A;  3ZRD A;  1WJK A;  4KCE A;  3FW2 A;  4RQR A;  3KH7 A;  2H6Z A;  2AB6 A;  2B1K A;  2K6V A;  1BAY A;  5CYY A;  4K1F A;  4ZB9 A;  2E2M A;  3L9U A;  4WEY A;  3TKP A;  4HU7 A;  4E8H A;  5JWO B;  4KB3 A;  1GP1 A;  3ZIJ A;  5CNW A;  1O85 A;  3HVV A;  2C80 A;  5AGY A;  1Z5Y E;  3PIN A;  3ERF A;  2MMO A;  4V2L A;  4ECB A;  3SWL A;  2AUV A;  5G2Z A;  2WRT A;  2V6O A;  5E4W A;  1A2M A;  4LLR A;  3HZ8 A;  1O8W A;  1GNE A;  2VCQ A;  2XBI A;  5H5S A;  4KDX A;  1EEJ A;  5ECS A;  5DDL A;  4TKY A;  3LQ7 A;  3IOS A;  3MAK A;  5B8A A;  5D93 A;  4IVF A;  1R26 A;  1XOB A;  1U6T A;  1GH2 A;  4EDY A;  5J9B A;  3DEX A;  1K3L A;  3TJJ A;  1PN9 A;  2OAC A;  5J47 A;  3Q6O A;  1JHB A;  3LOR A;  3L4N A;  1Q98 A;  1PL1 A;  4ID0 A;  5ELG A;  4EKZ A;  4NV5 A;  5IM9 A;  3QAW A;  5KOW A;  5HFK A;  2R0G A;  3KGK A;  5CP1 A;  3QDN A;  5DJL A;  4G0I A;  1SL0 B;  1YY7 A;  5G31 A;  5D9V A;  1A2J A;  2DMM A;  4Z2R A;  3I69 A;  4FYB A;  3TKQ A;  3G7I A;  3RPN A;  1JZR A;  3QPM A;  2N5F A;  2EIR A;  3TJG A;  4BL7 A;  1SK2 A;  2CVB A;  4KX4 A;  2EC4 A;  2FNO A;  2MBS A;  5DAL A;  2G2Q A;  1F3B A;  4G10 A;  2VAF A;  5HQP A;  3LJR A;  1EV4 A;  5J40 A;  4MP4 A;  4K7N A;  3E3E A;  1YEX A;  1ZYN A;  4I6X A;  7GSS A;  4MZW A;  1K0B A;  2HZE A;  1PL2 A;  6GST A;  3P2A A;  5ECH B;  5CRG A;  4RQX A;  5CRE A;  4KF9 A;  1Y1U A;  1SU9 A;  1G6W A;  3KMN A;  3EYT A;  2EIO A;  2R2J A;  2IFQ A;  1PGT A;  3BOA A;  1XVQ A;  3FY7 A;  1EOG A;  5KOX A;  2CAQ A;  2H1D A;  3BCI A;  2FGX A;  4Q5N A;  2JZR A;  2MMN A;  2VOC A;  2R4V A;  4HQS A;  1OKT A;  4MK3 A;  3UVT A;  4MNN A;  4G19 A;  3W6G A;  3DWV A;  2FWH A;  3DML A;  4MF7 A;  1SK0 A;  5JCU A;  1ABA A;  2C0F A;  2VL9 A;  2WUL A;  4I8B A;  5G5F A;  1Z7R A;  1R5P A;  4GF0 A;  1Z6N A;  2LJK A;  1V98 A;  1THO A;  2WDU A;  3ZMK A;  5AIX A;  3KEB A;  3GTU A;  3GUS A;  1K0M A;  3GNJ A;  3MWH A;  4WBR D;  2FA8 A;  1A0F A;  4POL A;  4JR4 A;  1SKR B;  4CHS A;  3CSI A;  1FVK A;  1NHO A;  4YQU A;  2AJQ B;  1W89 A;  3TDG A;  4GXZ A;  1ZYQ B;  1WWJ A;  3HKR A;  1SL1 B;  3A5I A;  4PUA A;  1T8E B;  1ZCP A;  2JZS A;  1U3I A;  3UL3 A;  5JWQ B;  5IPG A;  1YF1 A;  4N3Z A;  2VLU A;  1XWC A;  1ERW A;  4EUY A;  4OFN A;  4XTS A;  5BRT A;  4G9H A;  4AKI A;  2HT9 A;  1PX6 A;  5IMV A;  4Q5F A;  3NZN A;  1SK1 A;  3F3Q A;  3TUE A;  3GX8 A;  4Z2U A;  4TR4 A;  20GS A;  3ZML A;  2FUG 2;  2M46 A;  2D2Z A;  3RHB A;  4YQV A;  5H5R A;  1B8X A;  1TXU A;  5D9T A;  4OCE A;  1AC1 A;  4X4J A;  2LRC A;  5GST A;  3HXS A;  5D9W A;  1YKA A;  5A4V A;  1TRW A;  2PMT A;  1KBN A;  3JCM L;  3Q19 A;  1TRV A;  2X64 A;  4ULX A;  2M72 A;  4JZQ A;  2NPB A;  3EC3 A;  1OC8 A;  1DSB A;  2HRK A;  2R3X A;  1ILO A;  3CXG A;  4MJA A;  4MDC A;  2F8A A;  1OC3 A;  3WGX A;  3I43 A;  3O3T A;  3C73 A;  3DXB A;  1G0T A;  4TW5 A;  3GST A;  2CT6 A;  4N0Z A;  3QOU A;  4MMM A;  4L5L A;  2DKH A;  1TK5 B;  3APO A;  2HSH A;  3FEU A;  5CRH A;  1F9M A;  6GSU A;  3TKS C;  2FY6 A;  4RI7 A;  4BVX A;  4ECC A;  2X99 A;  1BYE A;  1TXX A;  4I5Q A;  2X4A A;  5A1N B;  2QC7 A;  1JFU A;  3ZL5 A;  4NWY A;  1SJI A;  1BJX A;  1KEB A;  5GSS A;  1PD2 1;  1T4Z A;  1XCC A;  2YJ7 A;  4OO4 A;  3ISO A;  1QK8 A;  3M9K A;  1YDK A;  2BMX A;  1RK4 A;  5EY6 A;  3VI5 A;  5INY A;  4GDF A;  5FHI A;  4PUR A;  1OVN A;  4IBP A;  4G01 A;  1ERV A;  1XXU A;  1F2E A;  3CRT A;  3FZ5 A;  1V2A A;  2LV3 A;  3KCM A;  4JRR A;  2C0E A;  1Z3E A;  4XRD A;  2B1L A;  1BQ7 A;  2IMD A;  3GYK A;  1GRX A;  5B6N A;  2YZU A;  1NM3 A;  1LU4 A;  2IMI A;  4LA1 A;  4AJ8 A;  2CAI A;  2DSA A;  2LS5 A;  1DE2 A;  4CDO A;  4DSR A;  3D22 A;  1PMT A;  5F06 A;  3UAR A;  1YQ1 A;  4BWQ A;  2B3S A;  3UAP A;  4POM A;  5DCG A;  4XS4 B;  3EU3 A;  4HS1 A;  1SD8 A;  4QL9 A;  4DSS B;  4GRF A;  1M2D A;  3MSZ A;  3FZ4 A;  3TRX A;  2QGV A;  5KEJ A;  3R3E A;  4XS1 A;  4WF4 A;  4EE0 A;  3BJ5 A;  6GSX A;  2O87 A;  2H6X A;  2VIM A;  1BG5 A;  2OE1 A;  1TKD B;  4GTU A;  3ZLP A;  2HSY A;  2WFC A;  1XW5 A;  1WIK A;  3VPQ A;  2VCX A;  1ERT A;  4TOP A;  3F3R A;  4OFM A;  3HHV A;  4RUV A;  2N5B A;  3H4K A;  4F2I A;  1K0O A;  1TOF A;  1I9D A;  1YJ6 A;  2EFC A;  4EO3 A;  4OMV A;  4ICY A;  4OD7 A;  4BVY A;  2DJ0 A;  3QD9 A;  1S3D A;  2H01 A;  3FZ9 A;  1EOH A;  4P3Y B;  4PUF C;  1O73 A;  2H1A A;  4YKF A;  4V2M A;  1FHE A;  2A4H A;  2KUC A;  5DAK A;  4QMK A;  2R6K A;  1N8J A;  3QFA C;  4W66 A;  5IMD A;  2I81 A;  3FK8 A;  1HNC A;  3PH9 A;  4K0N A;  1TU8 A;  1ZYE A;  1GSU A;  1AAZ A;  1BG1 A;  2WS2 A;  2LJR A;  5F07 A;  2VL3 A;  4K8M A;  5ECP B;  4HZ2 A;  1USB A;  2WB9 A;  3DVW A;  4PGT A;  4GQF A;  3KMO A;  3QAV A;  5F0G A;  4I97 A;  5HFG A;  3HYP A;  3G7J A;  2VCT A;  2FLS A;  1A23 A;  3L78 A;  4WKW A;  4TR1 B;  1XWK A;  1OKD A;  4N30 A;  1SYX A;  2XC2 A;  5DAL B;  2H72 A;  2RLI A;  3D21 A;  1QXH A;  4ZIJ A;  4TXV A;  3MDK A;  1GTA A;  4FYU A;  4KDU A;  1U87 A;  3N9J A;  1BF5 A;  2GQL A;  4ZIL A;  1XW9 A;  3Q74 A;  2GZZ A;  4XRA A;  2RM6 A;  3K8N A;  4HUA A;  2KLX A;  1GLQ A;  1XVW A;  4MF5 A;  2AV4 A;  2HNL A;  3IA1 A;  4IP1 A;  1GWC A;  4F9Z A;  3UBL A;  3ME8 A;  5HFI A;  5KN2 A;  3D6I A;  2KOK A;  2C1Y A;  1NW2 A;  2LUS A;  3VFI A;  2XPD A;  1K0A A;  1TP9 A;  3C1S A;  2C4J A;  5IQY A;  3IR4 A;  5B7C A;  4J2F A;  1EP7 A;  3H79 A;  4F03 A;  4PNF A;  2V32 A;  4KDY A;  3LGC A;  1UN2 A;  2MZC A;  2GQM A;  3IC4 A;  4TVE A;  5A5H A;  3GSS A;  4PNG A;  6GSY A;  5B8B A;  2H74 A;  2JZT A;  1PA3 A;  2YN1 A;  4QL7 A;  1FVJ A;  4GST A;  1R7H A;  1ST9 A;  4PQ1 A;  3AY8 A;  2DKI A;  3ZIT A;  3W8J A;  3IHQ A;  5ENU A;  3TU3 B;  1PSQ A;  4GSS A;  1MDK A;  3A5W A;  3CWG A;  2XBQ A;  2VCV A;  4K9Z A;  1OC9 B;  1X5C A;  2YCD A;  5F8B A;  2ALB A;  4Q5R A;  5L71 A;  1QQ2 A;  2XPE A;  1TU7 A;  1OAZ A;  3C1R A;  3VWX A;  11GS A;  2AAW A;  2HSM B;  1O7U A;  4I2T A;  3GKX A;  4POB A;  5COH A;  1B4P A;  4TXO B;  4L0U A;  1H4O A;  1GSY A;  4FO5 A;  2K18 A;  2VLT A;  4LMW A;  3F4R A;  4O7H A;  1LBK A;  2VLV A;  2AYT A;  1MEK A;  2L5O A;  4NHW A;  2P5R A;  1G7O A;  2MYG A;  2H70 A;  4JU5 A;  3IE3 A;  5A34 B;  4EIP A;  3ZFB A;  5G1L A;  2HFD A;  1SKW B;  5F05 A;  1TK8 B;  3L9V A;  2L59 A;  1TW9 A;  4MZB A;  3BBY A;  4EIQ A;  1KTE A;  3IAS 2;  5ID2 A;  2WCI A;  4ZL8 A;  1VF4 A;  1ERU A;  4PX1 A;  1QGV A;  1F37 A;  3FR9 A;  4LMV A;  3EE2 A;  14GS A;  8GSS A;  2ES7 A;  5IMZ A;  2I1U A;  2R5G A;  1M2B A;  1H75 A;  4V1A g;  2HSN A;  1LJR A;  5IPH A;  3U6V A;  1FAA A;  4N11 A;  4D73 B;  3VUR A;  1UVZ A;  4KUN A;  5DQY A;  2GZP A;  2HXK A;  4O5R A;  4BA7 A;  3GFK A;  3HCZ A;  3TJB A;  4AGS A;  3UVH A;  4X43 A;  4MPG A;  2Z9S A;  4CY6 A;  5BMU A;  3MYD A;  4Z2T A;  1A0R P;  4WET A;  2JL4 A;  4XCS A;  2GSS A;  3V1W A;  1SVO A;  2X8H A;  5C04 A;  1ACV A;  2H6Y A;  1J08 A;  3D4T A;  2H0I A;  1AQX A;  1Z9H A;  4IQ1 A;  2VD1 A;  5J3R A;  3P7X A;  3A3T A;  2WJU A;  3D4M A;  4WR5 A;  3IRA A;  3C7M A;  1WMJ A;  3GHA A;  2IIY A;  3WT1 A;  2BJX A;  3CYN A;  2GLR A;  2R0C A;  2GVP A;  4AKH A;  2H1B A;  3WGE A;  4KA0 A;  2H75 A;  2B5X A;  5JCW A;  1OE7 A;  4ISD A;  1TTZ A;  3APS A;  3N5O A;  1PQN A;  4PXO A;  3LYK A;  4WF5 A;  3TKS A;  3HZ4 A;  3KZQ A;  3O76 A;  4OFT A;  1TDI A;  3UIW A;  2PVQ A;  2O85 A;  2R0P A;  2UZ8 A;  1T4Y A;  3U5R E;  3BCK A;  3LW9 A;  1Y6E A;  3TGZ A;  3ME7 A;  2TRX A;  1ZZY A;  2C0G A;  5IMA A;  1Z7P A;  4MJC A;  1QMV A;  1NHY A;  1MD3 A;  3HY2 A;  4OO5 A;  2VM1 A;  4DSQ A;  4MLY A;  5J4Y A;  1Q4J A;  1FO5 A;  4J56 E;  1AIU A;  3LG6 A;  1ZOF A;  4HQZ A;  1FOV A;  4LL4 B;  3GH6 A;  2LNS A;  5C00 A;  1PX7 A;  3CTG A;  1TRS A;  3S9F A;  4PQI A;  3DRN A;  4F82 A;  2GGT A;  4ILF A;  1DUG A;  1VF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...