5F8TA

The crystal structure of human plasma kallikrein in complex with its peptide inhibitor pkalin-2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor pkalin-2
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Plasma kallikrein light chain
total genus 53
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8tA01
2XWAA 1XUIA 1FY8E 1QL7A 1HDTH 4D8NA 5TJXA 1W3CA 3VB7A 3TK6A 1EATA 4FUGA 1TPSA 5LPEA 4K3JA 3A8AA 1QA7A 1GVLA 2BD2A 2TGAA 6GCHG 3UREA 1KDQB 3OTJE 1BTXA 3PMBB 2BY9X 4IMQA 1F0UA 4X6PA 1BTUA 1UHBB 1GI3A 5T6FA 1YPGH 1TONA 1C1WH 1P2NA 1QRXA 1ZJKA 1CU1A 1GBBA 3EAJA 1JRTA 1N6XA 2A7CA 2KAIA 1T8NA 2ZP0H 3A88A 1RXPA 4ZHAA 1BRAA 2NU3E 5EQRA 3GCOA 1AY6H 3PROA 5HM2A 1C1PA 4NGAH 2BY5X 2CF8H 1TNHA 2ZCHP 2BHGA 1C1UH 1L1JA 5T6DA 4M7GA 4DW2U 4AN7A 2I6SA 4UFGH 1PYTC 1UCYK 1P10A 1YPKH 2ZNKH 3O8RA 1TGTA 4KTUA 1GI9B 1TRNA 1YBWA 1BMMH 4X1NU 4KP0A 3EA7A 1IHTH 2A45B 4RKOB 5FBIA 1KLJH 3TJNA 3H5CB 2FP7B 5DP9A 1CGHA 1GBFA 1T4UH 3SV8A 3FZDA 3KQBA 3TNSA 1WBGB 1FONA 3RMNH 4BNRA 2AFQB 1ZTLA 1AIXH 2GDEH 3ATKA 1O0DH 3TK5A 3VB6A 1FZZA 1G37A 1G3EA 1OWJA 3KL6A 1DS2E 1ACBE 1XM1A 1XMNB 1GVKB 2Z9GA 2FTMA 4WH6A 1HJ8A 1LCYA 2PTCE 1KIGH 4D7FA 3O8DA 2ULLA 1VCWA 4NA9H 1G3CA 1J15A 2UUYA 3M36A 4Y6DA 3EDXB 4GPGA 4BAOB 4ABHA 1O2RA 4XBDA 1OSSA 1BBRK 4DIHH 1O3MA 2GZ9A 2ZFRH 1Y3UA 5LPRA 4A5TS 1Y59T 1SHYA 3CENA 2WPIS 3PLKA 1S0QA 1O39A 2BVRH 1EAIA 1TGBA 3URCA 5DP7A 3ZZBA 4WXIA 1OYQA 1NRQH 1A4WH 1TX8A 1Z8JB 2A1DB 3PLBA 1YCPK 1JIMA 3MNXA 1C5NH 5GPIB 1TMTH 3MMGA 4XE4A 2PHBA 3SU2A 1EOJA 5K7RA 2ZTXA 1P9SA 4A92A 1AMHA 1TNIA 1KDQA 2ZPSA 5SGAE 3UTUH 3FFGA 1GG6C 2ODPA 1MQ5A 1SFQB 3SU5A 3SZNA 1N6YA 1IQHA 3V13A 2AMQA 2XC5A 4DJZB 1GHZA 2AMPA 3MO9A 1P57B 2ZDMA 4I8LA 3F1SB 4ZXYH 2H2ZA 1O34A 2QC2A 3K6YA 1IQEA 1IQGA 1C5RA 3A8DA 3PMJA 5E0HA 4IC6A 1H1BA 2BZAA 1GJ7B 3IWMA 1JRSA 1LDTT 2CGAA 1GJAB 3E90B 1QCPA 4AB9A 1XXDA 4Y8XA 1GL1A 3RXEA 3IITA 2BQ6B 1YYY1 1C2JA 2ZDAH 1MAXA 1TPPA 1EP5A 2Z9KA 3BTTE 3PO1C 4U30A 4CRFA 5EGMA 2ESTE 4B2BA 2SGDE 4ABEA 3OX7U 2XCNA 2VVVA 4QT8C 1YPLH 3K6ZA 1IQJA 1THPB 1W7XH 1BCUH 5TCAA 4I8HA 3LGWA 3LGYA 1SSXA 1LVOA 1G3DA 3GY8A 2ZECA 1GBCA 1GMDG 7GCHG 4YOGA 1C1RA 5CHAC 4E05H 1RGQA 4FU8A 1THSH 1PFXC 2VIQA 4Y11E 1JBUH 3UPEA 3HATH 5JYIA 3S7HB 3ZZ5A 4DVAU 1GBTA 3GY7A 3T29A 1RJXB 4CR9A 1FN6A 1A7SA 2ALVA 4BANB 1O37A 3RXDA 5ETXA 4IC5A 3MH4A 2ZIQH 2P3UB 3FAOA 8GCHF 2XNIA 5C1YA 2WPKS 2C4FH 2FOMB 3ZZCA 5LH8A 1RFNA 1TIOA 2HPPH 2RDLA 2V0BA 3PV4A 4Y10E 3DD2H 1DXWA 3P8GA 1WV7H 1CQQA 2VWLA 1O3DA 1NT1A 2IJOB 2ZO3H 2G5NA 4INLA 1J17T 3RP2A 4OGYA 2UWLA 1C2KA 3BTWE 2P94A 2ZFSA 1LHGH 1B5GH 3WY8A 1LPZB 3EQ0H 3RXFA 3GY2A 5AFYH 1IQFA 4ZKRU 1Y5AT 2P95A 1Z6JH 2FLRH 2JH0D 5E0JA 4ISHH 5DP8A 2OTVA 2EI6A 1NRRH 3BTEE 2ZQ1A 1D3PB 1Z8GA 1Y3WA 1ZTKA 3RMOH 4BTIB 3BG4B 2PLXA 4H6TA 4I8KA 4B1TA 5C67A 5B6OA 1AO5A 4TPIZ 3U1JB 1GI5A 2BD4A 2QIQA 1CBWC 2AGGX 1O2LA 4X1RU 3ZVEA 2ZHDA 3A82A 1SMFE 1MD8A 2P59A 4ABGA 3ZVFA 2F3CE 2G81E 3LONA 1H9IE 3ZZ7A 1BUIA 1K1JA 4ASHA 5L2YH 2G4TA 3UFAA 1HLTH 1KLTA 2Z9LA 9ESTA 4X1PU 3SNEA 1HAOH 1ZMJA 1CA0C 5BPEA 1QR3E 2TIOA 3Q76A 2PSXA 4OS2A 4ABBA 1GDQA 1AFQB 1OP0A 2F9UA 2VVCA 2PGBB 4BOHA 3A81A 1O2KA 4BTUB 2A4RA 2ZF0H 3BEUA 4O97A 2ZHFH 3SU6A 2H9TH 1ZMLA 2CHAC 2Y80A 5A8YA 3TGKE 1PPEE 3SNDA 1HIAB 2J92A 2HRVA 2ZU2A 1C9TA 4CHAB 4A1XA 1AD8H 2GCTB 1SC8U 2XYAA 3T25A 7ESTE 1CBWB 1F5LA 3NKKA 1Q2WA 2HOBA 5GCHG 4WXVA 2WUCA 5ESTE 4WVPE 2ZGHA 3T28A 5C5OA 3UR9A 4AYVB 3RXOA 3ZYEA 3UNSA 1C1NA 1EZXC 1WTHD 1BMLA 5L6NH 1S6FA 2R2WU 4XBBA 4DGJA 1LO6A 4XOJA 1OYTH 1GHYH 2TGTA 4KTSA 4MVNA 3NWUA 3MNCA 1TQ0B 3LGIA 1XXFA 1GI2A 1O31A 4A1VA 3A87A 1HXEH 1OWDA 1ANDA 2PSYA 1Q31A 1SQAA 2BB4A 2ZFQH 3QGJA 2AMDA 2BLOA 1DT2A 3SJKA 1ZHMA 2V3OH 3PTBA 3PMHB 2G5VA 3B9FH 4I31A 4BAHB 1NTPA 1O2GH 1VITG 4UEHH 3A86A 2ZC9H 2G4UA 4Y7BA 3KGPA 4FUIA 3LOXA 1W11U 4CR5A 4NA7A 1MCVA 2ZU5A 1XUHA 1GBAA 4IN2A 4OS6A 2W7UA 4JZFH 1Y3XA 1ELBA 3L33A 2HVXA 3UOPA 2XBWA 4X6MA 3TU7H 4DG4A 3KQDA 1UVPA 4CBNA 2ZFTA 3SV6A 1E38B 2EEKA 2BXTH 1AE8H 2CHAB 4YESB 1TQ7B 2CV3A 4BXSA 2VIPA 1KY9A 1V2MT 2ALPA 2VH6A 4J2YB 1FUJA 1NFWA 3GCTG 4MLFB 1GMHF 1C5UA 1KSNA 3KHVA 3SORA 1FPHH 4AFZA 2FI3E 3I78A 1BOQA 1DLEA 5EPNA 3N7OA 2FIRH 1QB9A 5E2PA 3CP7A 5HXFA 3LC3A 5FHTA 4MTBA 3S9AA 4WJG2 5HYOA 1CT2E 1RIWB 1WAYB 1DSTA 3RXJA 1XVOA 3RXTA 1FV9A 3S0NA 2VWMA 2HNTF 3VXEH 5DP5A 1ZMNA 2J94A 2RG3A 3GCHC 3LPRA 2BDHA 1O5EH 1DXPA 3H7OA 3SQEE 5C1UA 1O2UA 1Z71A 4Z0KA 1O2WA 3ZVBA 2QAAA 1QY6A 2FLBH 3EE0B 4AYYB 1HAXB 4LZ1H 2ZGJA 2OC8A 1OKXA 2B0FA 1CGJE 1GI6A 1W2KH 5GIBA 3QN7A 4AORA 4IW4E 2ZFPH 1GHAF 1UVOA 2Y6TA 3Q77A 1EAXA 1GCTC 1LVMA 3RXCA 4X8SH 1GBKA 5F6MA 1SQOA 1GG6B 1LVBA 3PMAB 4Y8YA 4X2XA 2NU4E 4GAWA 1HAVB 4UD9H 3MH7A 4B75A 1RTKA 4JYTA 5FCKA 3GOVB 1ETTH 1WYKA 1A1RA 3A84A 2QXJA 3TIUA 4JZDH 2J4IA 3BTKE 1SOZA 2UWPA 1TRYA 3GISB 3M37A 1X7AC 4MQAA 2OC7A 3FZZA 1NRSH 1Q3XA 1B7XB 1PPFE 4MNXA 2EC9H 3H7TA 1CHOG 1HUTH 4J1YA 4FUDA 2GT8A 2ZDVH 4O3UA 3SHAH 2H1UA 4FU7A 3PTNA 1AKSA 1HAZB 4X1QU 1W0YH 4XFQA 3UNQA 3LGTA 1Y3YA 3QO6A 2C90B 2Q6FA 3A7TA 2ZU3A 3BIUH 2G52A 2QF0A 5DP6A 3EGKH 3PM3A 5IDKA 1K9OE 1PPGE 1HRTH 1MUEB 2ILNA 2AGEX 1SGFA 3RU4T 2FS8A 1O3HA 3MTYA 1T8MA 1SGIB 4UFFH 1Z8RA 2ZI2H 1EQ9A 2GX4A 3P70B 1UK3A 3HKIB 1YPHE 1DLKB 2VIOA 4CH8B 1KTSB 4YT7H 2J34A 3F9HA 4PROA 5A0CA 1DUAA 3ITIA 2VB0A 3Q3YA 4OS4A 3SV2H 2A7HA 4Y76A 3GDUA 4NG9H 3UR6A 1GBEA 1ESAA 1P01A 2F9BH 1XUKA 5ABWA 1AGJA 2BD3A 2GGVB 1DE7H 3RLWH 2D26C 1HIAA 1CSOE 5JBBS 2AERH 3MHWU 3ZZ4A 5C1XA 4MG3A 4IS5A 2ZWLH 1ZSJA 1MTNB 2HWLB 5E0GA 3HGPA 4X1SU 1P3EA 1AI8H 2F91A 3ATIA 3LKWA 3M5OA 1V2RT 5F8XA 3DA9B 1E35B 1O2PA 2W7SA 2AH4X 1EB1H 4R0IA 1L1GA 2B5TB 2ANMH 4Q80A 2PR3A 5PTPA 1TX6A 1UTJA 3FP6E 2HGTH 1C5QA 3URDA 1O3PB 2XBVA 4Y8ZA 3SU0A 2RA0A 2G00A 1B0FA 3E8LA 1F92A 5DO4H 1DWCH 3VXFH 2YNBA 5JBCS 2AEIH 1UTPA 1EZSC 5C20A 1ZRKA 3GY6A 3M7QA 4WMDA 3O8CA 3MO3A 3OSYA 5F03A 2B8OH 3BG8A 3QDZB 3ZZDA 2XTTB 1OXGA 3EA9A 3RXQA 2BZ6H 1FAXA 1AVXA 4UFEH 5JB9S 4ABDA 1TYNA 1DVAH 2HALA 1O30A 1NU9A 1MKWK 3QZRA 2GCTC 3SU3A 1TGNA 1HXFH 2ASUB 1O3IA 1CT4E 3DFLA 1EB2A 1AUTC 3NZIA 3B23B 2VWOA 3FP8E 1ZPCA 1MU6B 4UFDH 2OQ5A 1H8IH 1SGYE 1WCZA 3TH4H 1QB6A 2BOHB 2O8TA 3TNTA 3VB5A 1NY22 1A0HB 4MNWA 2VGCC 1NFXA 2FYQA 1NRNH 1C2HA 1TX7A 1EUFA 3RC5A 1LTOA 1VCQA 4WWYA 1P0SH 3CS0A 2YOLA 4O03A 1GHBF 9LPRA 4K5ZA 3LGVA 1PPCE 3LC5A 1C4U2 1QIXB 2XC4A 3ESTA 4U32A 1J9CH 3MU5A 5EG4A 1ESBA 1GJ8B 1UTNA 4XDEA 1ZYOA 4DIIH 2C3SA 4TWYA 5EQQA 2SGPE 5E2OA 1O5GH 1P9UA 3SJOA 1P09A 1BJUA 1P02A 2BVSH 1NROH 3E16B 5JPMH 1BDAA 4K1TA 2Z3CA 1F2SE 1VJAU 1SLVB 1NZQH 1A5IA 3E0PB 1WU1A 4OS5A 3TGJE 3GY5A 4XBCA 2J95A 2D8WA 5GJ4B 1O5DH 1FY4A 4K60A 1QJ1B 1SLXB 2A5IA 2BM2A 3ATWA 4X2VA 2BY8X 3A7XA 1BB0B 1TRMA 4X2WA 3IG6B 2SGQE 1Z7KA 3ZVAA 3MWIU 1AHTH 1O3EA 3BIVH 2FOBA 1QJ6B 3RMMH 2ZDKA 2FOCA 1W10U 4U01A 1P2OA 2ODYB 2ZGXH 4JK6A 3EA8A 3F9FA 4WMFA 2VJ1A 5AFZH 3U1IB 1HJAC 1PQAA 3QX5H 5JBTA 1V2OT 1IQKA 3TLOA 2VNTA 4MPWA 2LNCA 1WQSA 1SOTA 5HGGA 1LQDB 1DM4B 3TJOA 1ABIH 3T62A 1C5OH 1D6WA 5FBEA 1H4WA 1C5PA 1NFYA 1F0RA 2Y5FA 3MI4A 1K1LA 1W12U 3U8RH 4BXWA 2OCVB 1GI8B 2ZDNA 2STAE 4ISLA 3TITA 1BMNH 1O3GA 1J8AA 2BX3A 1EJMA 5DK1A 2ANYA 2BLWA 1WOFA 1O2MA 4YO9A 3U9AH 1C5VA 2BY6X 2D1JA 3W94A 3UY9A 3R0FA 3AAUA 1GHVH 4SGBE 3ZZAA 3SOSA 4ABIA 5C2ZA 1QJ7B 4JCNA 1UTKA 3GCNA 3KEEA 1ORFA 2OC1A 1O2JA 1G30B 1C5WB 1UTQA 1ELCA 1CVWH 1EP6A 2VGCB 1YPHC 2J38A 2QA9E 3RXLA 1SB1H 1SGDE 4MPVA 5AVDA 4NWLA 3MNBA 4ZHMU 1EAWA 1ZPBA 5C3NA 3FANA 1C4Y2 1E34B 1SL3A 1IQMA 3VGCB 1C1VH 1O3JA 3MNSA 2PW8H 3ZYDA 3NPSA 1TGSZ 1VITH 3RDZA 2NU2E 1IQIA 2A4QA 1AU8A 3UWJH 4O3TA 2BXUH 4ZKNU 1ZPZA 1DSUA 4HI3A 3P92A 1C2EA 2ZPQA 1C5SA 1T7CA 1EPTC 1KYNA 3MH5A 1TB6H 3HK3B 2TBSA 3DUXH 1L1NA 1G32B 4BAQB 6CHAC 3ZZ3A 1V2TT 4GHTA 4FVDA 2ZHQH 1V2NT 1C2GA 3NK8A 1QNJA 1MTWA 3LH3A 2WYGA 3SUGA 5ESBA 1NO9H 3E3TA 4INKA 1C2LA 3RXVA 3FP7E 4Y79A 4R8TB 1GMDF 7GCHF 1LVYA 2Y5GA 1TA6A 4AFQA 4X0WU 2VU8E 1WQVH 3RLYH 1AVWA 1K1IA 4ABAA 4X8TH 1XX9A 1SVPA 1TAWA 4K8BA 1CE5A 1C5XB 1JXPA 5FPTA 1GI4A 1FAKH 2Z9IA 1TOMH 1NPMA 1JWTA 2FS9A 3SUFA 1KXDA 1OWKA 1WTGH 1HB0B 2OC0A 4VGCB 3GICB 3T26A 1AQ7A 3VB4A 1O2XA 2W26A 4Q7YA 3EYDA 3VFEA 1C2FA 1ZGIA 3RXSA 2XW9A 3D62A 3M3SA 1QFKH 4RSPA 2G8TA 4TWWA 3SUDA 5A8XA 3U8TH 1ZTJA 3RXKA 4DT7B 1EJAA 1SGPE 1QHRB 2CMYA 2R9PA 1IOEA 1BZXE 2ZU4A 1LKAA 3G01A 1GJ6A 4IGDA 2AIQA 4Y71A 5EW2H 2QY0B 1GJBB 1MQ6A 4TYDA 3UUZA 2IPHA 5J4SA 3T5FH 2ZGBH 3SJIA 5CHAB 5A2MH 4MNYA 4NA8A 3A85A 1YLCA 1Y5BT 3NCLA 1A61H 2XC0A 1KTTB 4DURA 1VGCC 2GMTC 3TPIZ 1HAVA 1UK4A 1QGFA 5GDSH 1OOKB 3GY3A 5HM9A 3ODFA 3PB1E 5LGOA 5I46H 2BDYA 2P16A 1FLEE 3MH6A 2P8OC 1L4ZA 2ZCLP 2AGIX 1AUJA 1H8DH 1GHXH 1C5ZB 1LPKB 2FI5E 1MBQA 1KXCA 4AG1A 2KAIB 2Y82A 3A7ZA 4CHAC 3QZQA 4E06H 3M61U 1HBTH 1OWEA 1YM0A 2VWNA 5CE1A 1UVSH 4B76A 1O2VA 4JYUH 1TBQH 1SGRE 2VH0A 1P03A 4CBOA 1GBHA 1DITH 1GI0A 1CA0B 1GBJA 1AZ8A 2GTBA 1HAIH 5F8TA 4IMZA 5K0HA 3R3GB 5EODA 2OLGA 1O3KA 3F6UH 2BDBA 5LPFA 1PJPA 4Y7AA 4OS7A 2GCHG 1MTUA 2GT7A 5FPSA 2AYWA 5DP3A 1VZQH 4GVUA 3SBKA 1SQTA 1FPCH 2A32A 4ISOA 1PPHE 2C8XB 1L2EA 2FO9A 3S9CA 2F9PA 3SV7A 3VGCC 2BMGB 2O8MA 4FXGH 5E8EH 2O8LA 5EW1H 2GV6A 1SGEE 1CO7E 3SGBE 1GL0E 1K22H 4Q7XA 2UUJB 1TMBH 3SV9A 1F7ZA 4K1SA 1ID5H 2FOFA 4K2YA 2OP9A 4FUEA 1ELGA 1S85A 3ZZ9A 5L30H 1O5BB 2ZA5A 2V6NA 2PFEA 1O3CA 3FVFB 3SQHE 1W8BH 1ABJH 1SPJA 1AB9C 1J16A 1BTZA 2IOTA 2VINA 1IQLA 1G2MA 1GHAG 1UVTH 3RC4A 3MU4A 2A2QH 1F0SA 4X2YA 4JK5A 1CHGA 3GYLB 3LU9B 3SGQE 1V2JT 2TRMA 1E36B 4H42U 3C27B 1Z1IA 1YPEH 1C5MD 1A46H 4AZ2B 4D9RA 1L4DA 4NZLA 1TPOA 2H5DA 3RC6A 3K65B 3VB3A 4FUHA 1MAYA 4FVBA 5IYTA 4GUXA 2NU1E 5TCCA 1FQ3A 1HFDA 1GDNA 1P2QA 2GZ7A 3QTVH 2ANKH 2XBYA 1YPJH 1Y8TA 2B7DH 8LPRA 3AASA 3SU1A 2VIVA 1GJ9B 4VGCC 2R0KA 2R0LA 4F49A 1SGFG 1QA0A 1QBVH 2UUKB 1CA8B 3STJA 1PQ8A 3UOUA 1FJSA 1P8VC 2P8OB 3ENSB 1HYLA 3O8BA 1T8LA 1VCPA 5EOKA 1BBRH 1UO6A 2GZ8A 2UWOA 2FDAA 4H6SB 3GCTF 5DP4A 3KCGH 1ZJDA 3HK6B 1ETSH 1O2YA 4DCDA 2RA3A 1FMGA 4LZ4B 1BT7A 1EKBB 1K28D 3M3VA 2GKVE 3A8CA 3JZ1B 2FOAA 1HV7A 1XUGA 1QQ4A 1RS0A 2PKSB 1YP9A 1RIWC 1SHHB 4CRDA 1FY5A 1V6DA 4SGAE 3I29A 5EXMA 1TMUH 3ZVGA 2P3FH 2BOKA 4JMYA 2DE9A 3STIA 3M5LA 1O3OA 1XKAC 1PQ5A 4BAMB 4ZKOU 8KME2 2A7JA 2ZU1A 1EAUA 1C5YB 1F5RA 1ARBA 2A4GA 1S82A 1Y5UT 4B71A 2WPJS 2LPRA 1HAHH 1P3CA 1AZZA 2OUAA 1O3LA 1V2LT 5T6GA 1GJDB 2OQUA 3D65E 5JB8S 1RTFB 1GJCB 2J9NA 1O3BA 2TPIZ 1BHXB 1S5SA 4U2WA 2A2XH 2ANWA 3D49H 1ANEA 1S84A 3BN9A 3D23A 2ZTZA 1EZUC 1F5KU 1QBOA 4HGCA 1BA8B 1BJVA 1C1QA 4LXBH 1UCYE 4XSKU 7LPRA 5J4QA 4GLYA 2JH5D 5DGJA 2GVFA 2BDCA 3F9EA 1DFPA 2ZTYA 3VEQB 2Z94A 2XBXA 2FMJA 1AN1E 4JYVH 1LHDH 1V2QT 1GPZA 4NIXA 2C8WB 3QWCH 4TY6A 1GMCG 4B2AA 2JETB 1XUFA 5GWZA 1BTHH 2ZPRA 1FN8A 1V3XA 1ANCA 3BG4C 2Z7FE 4JZEH 2ZHEH 1LHCH 4ZHLU 5A0AE 2RCEA 3W95A 6GCHF 1GCDA 2PKAB 2ZG0H 4ABJA 4E7NA 1FIWA 3SGAE 2PKSC 1AWFH 2PWXA 1PQ7A 1O2SA 1INCA 3M5NA 5FXLA 2GDDA 3E91A 2DE8A 1TFXA 2OBOA 3U98H 1ZOMA 3E0NB 4RN6A 5FAHA 1A5GH 4KKDA 2BTCE 3QUMP 1FY1A 2W5EA 2C93B 4NCYA 1BRUP 2PUQH 4FU9A 5F8ZA 4ZROA 1QRWA 1GDUA 1BRBE 1LKBA 1CHOF 2WUBA 2QXGA 1BRCE 1MTSA 3M7TA 1YKTA 5DKMA 1MKWH 3UWIA 1V2UT 2VIWA 2WYJA 4K1EA 1QURH 1PYTD 2Q6GA 1ZZZA 1ZSKA 3BEIB 4I33A 1SFIA 1DDJA 1YC0A 1K1NA 3OU0A 1C5LH 3BTME 1G2LA 1V2PT 3F9GA 2IN2A 3V3MA 2WPLS 1SLWB 2P93A 3MFJA 2FZZA 3QK1A 1JMOH 1BQYA 2GMTB 1VJ9U 1O35A 1UVUH 4YZUA 2ZZUH 2BLQA 2FTLE 4CRBA 1SGQE 1MBMA 2V3HH 4KTCA 3DFJA 3VPKA 2A0QB 3GCHB 4E7RG 2BDGA 1JOUB 3UIRA 2W3KA 1UTOA 3ELAH 1GBLA 2H6MA 2FXRA 1AB9B 2Q6DA 3A7YA 1BTPA 1AKSB 1EPTA 1MZAA 3M5MA 1SI5H 1CGIE 1KXAA 1YF4A 1OP2A 4NFFA 4ISIH 1GVZA 3E6PH 6CHAB 1O2IA 2O9QA 1UK2A 4ZH8A 1M9UA 1C1TA 1ZSLA 2PUXB 2GP9B 2QV1A 3SJ8A 1BIOA 3B8JA 3ZV8A 2PTNA 3TVJB 1K1PA 4X6OA 1B0EA 1DOJA 2EI8A 4NZQA 1C9PA 5DG6A 1V2ST 1O38A 3ZZ8A 3OYPA 2GV7A 1NU7B 2FEQH 4AFSA 2XWBI 1NS3A 3K9XB 1NRPH 1OWHA 1GJ5H 1ZHRA 3S7KB 4IBLH 1XKBC 4X8UH 3LH1A 2FOHA 4YLUA 3RXRA 4GCHF 1H9HE 5AF9H 2XXLA 3RU4E 4H4FA 2CF9H 3V7TA 2XCFA 2SNVA 2G55A 2ZHWH 3RM0H 1RTLA 1FIZA 4I8GA 1O2NA 3UNRA 1L0ZA 3A7VA 2DUCA 1G3BA 1IQNA 2ZQ2A 1TOCB 4BAKB 4CREA 1AFQC 2H5CA 4OS1A 3RUOA 3A89A 8GCHG 1OPHB 1W0ZU 2BD7A 2FODA 3AW1A 3MO6A 5FX5A 1T4VH 1TNLA 3L6PA 4NIWA 4NSYA 3SHCH 3SNCA 4AFUA 3P8FA 2A31A 1MMJN 4CRGA 2H9EH 5JBAS 1HAGE 3MU0A 2Y81A 1O5AB 2QXHA 2YNAA 1YLDA 4AGJA 1MD7A 2JH6D 1QBNA 1AVGH 1SGTA 4X8VH 2G51A 1TBRH 2BDIA 5DJ7A 1TWXB 2BYAX 2O8UA 1OX1A 1GBIA 3LJJA 3HPTB 2V35A 1ZR0A 3AAVA 2A5AA 1TPAE 3TJVA 1DY8A 2AIPA 4WF8A 2ODQA 1MCTA 1EASA 1TALA 3F68H 4IN1A 2BD8A 1VGCB 1O5FH 3TGIE 3KF2A 3KQCA 2F83A 1OS8A 3MU1A 3SI4H 1BITA 4NWKA 4AOQA 3HKJB 3TK9A 1TABE 3SU4A 1ZRBA 1ELTA 2R2MB 2EI7A 1EXFA 2WPHS 1HCGA 1O2HA 1SR5C 4FUFA 1LHFH 1FXYA 3MYWA 1DX5M 1ZLRA 2Y7ZA 3OY5U 4RKJB 1YCPM 2WV4A 1D3DB 1ZGVA 2OBQA 1G9IE 4YOIA 4TY7A 1BTWA 1XUJA 5FX6A 1ELAA 4CRAA 2C8YB 3HGNA 1H9LB 2HLCA 1AE5A 1G36A 2QGRA 1DICA 1T31A 4B73A 1DANH 4K8YA 2WV5A 1GGDB 4AGKA 1Y3VA 2FM2A 4TPYA 1TNKA 2I6QA 3A8BA 4ZAEA 3SW2B 4LK4A 2CN0H 2ZDLA 1ELDE 2D2DA 1GMHG 1NFUA 4NIVA 3PWCA 3ATLA 1THRH 1TE0A 3BSQA 3GYMA 1TNGA 4Q2KA 2PKAA 4GHQA 2QYIA 3V12A 1LMWB 2FPZA 3RXAA 4KELA 1GHWH 5G4BA 5H4IB 3SJ9A 3DHKH 3C1KA 1UCYH 1MZDA 1O3NA 5JDUB 4OGXA 4DY7B 3LJOA 4AG2A 2O8WA 3RXHA 1U6QA 3RXPA 4UONA 2SGFE 2F9OA 2FI4E 3PO1B 2WINI 2NU0E 2Z6BD 1C1OA 2OD3B 2ZGCA 1Z6EA 1FDPA 1FNIA 1GGDC 3GDVA 1E37B 2C8ZB 1ARCA 1S83A 4I32A 5EU8A 1A5HA 1BTYA 3RXGA 3PWBA 1O36A 1ANBA 3S9BA 1HGTH 4MDSA 3KN2A 4JZ1A 4NIYA 3ZVDA 1QL9A 1CT0E 4Y0ZE 3U69H 3TJUA 5FPYA 1KXFA 3ZV9A 2PV9B 1Z1JA 1UTLM 5CMXH 3RXMA 3GY4A 1MU8B 2OINA 2BDAA 4FUBA 1W14U 2R3UA 1DPOA 1P12E 2ZKSA 4Y0YE 5BRRE 1V2KT 2PGQB 5AHGH 7KMEH 1MKXH 3LT3A 3SN8A 1EOLA 1LHEH 2FESH 1D9IA 4ZKSU 2FX6A 1V2WT 4GSOA 5GCHF 1SBWA 4WH8A 3SNBA 3BTDE 1P11E 4MNVA 2QN5T 1UJ1A 4UDWH 1P2IA 3ATMA 4CRCA 4GCHG 1D6RA 1FY3A 4ESTE 1OP8A 1SGNE 1QB1A 1QTFA 3AVZA 5EQSA 1Z8IB 1QL8A 2P3TB 3BTHE 3P8OA 1P04A 3RXUA 1TBZH 3A83A 1EX3A 2BD5A 2BQWB 2QXIA 4ISNA 4HTCH 1A3EH 2Z9JA 1V2VT 1XVMA 1K1OA 1O5CB 3P17H 1HPGA 4WMEA 2BVXH 5T3HA 2SFAA 6ESTA 1P2MA 1W13U 1C4V2 4YTAA 2SGEE 5EPYA 1HJAB 2QCYA 2Y5HA 2VVUA 1F0TA 4YLQH 2FX4A 3BTQE 3ODDA 5GXPA 1MTVA 1GBMA 1OWIA 3ZZ6A 4FUCA 2TGDA 1C1MA 1HNEE 2BX4A 1UMAH 3P6ZB 4BTTB 3M3TA 1NN6A 4WY3A 5A09A 3V0XA 1KXBA 1BHXF 3UQOA 1UTMA 1MKXK 1TGCA 2R3YA 1NM6A 1A0LA 5DPAA 3KNXA 1HJ9A 3Q3KA 4Z6AH 3LGUA 1O33A 1FI8A 1PPZA 1RD3B 1WSSH 4ZMAH 1K21H 1P2KA 1DWDH 3BEFB 1C5TA 3NUMA 4X6NA 1EJNA 3P8NA 2Q1JA 3I77A 3RXIA 2BLVA 1O2QA 4THNH 2ZCKP 1S6HA 4I7YH 4ZXXH 1O2TA 4KGAA 1GJ4H 1T32A 3A80A 2A4OA 3SUEA 1SGCA 2OXSA 3MOCA 3RXBA 2AS9A 2JETC 2M5TA 2ZEBA 1LPGB 3BV9B 3TH3H 3TH2H 4D76A 3LIWA 5FCRA 3U8OH 3PYHA 1MTNC 1HAYB 1DUEA 4D9QA 1N8OB 1VITF 4B74A 2HNTC 1O2OA 1O2ZA 1WUNH 4A6LA 2NWNA 1HAPH 1C1SA 4ZUHA 1D3QB 1TLDA 1EPTB 3KQEA 2SGAA 3BF6H 1QRZA 2W3IA 1A2CH 3A7WA 3E1XB 3AW0A 1EZQA 2Z3EA 4K69A 4A1TA 1GCTB 4NFEA 4Q7ZA 2HNTE 1GMCF 3SO3A 1ELEE 2FOEA 2SNWA 1C2DA 4AX9H 3Q00A 2JKHA 4YT6H 1SLUB 2WPMS 5I25A 1MH0A 4DOQA 3OY6U 1ELFA 5C5NA 1DWEH 1T8OA 3M35A 2F9NA 4AB8A 3S69A 2GCHF 1C2MA 3BTFE 3CS7A 4ABFA 1J14A 1LQEA 3MU8A 2HPQH 3PLPA 3RMLH 1E0FD 1UHBA 4YM9A 1O3FA 5EXNA 1PPBH 1NC6A 1P05A 3KIDU 1TNJA 4A7IB 5A8ZA 3LDXH 2CJIA 2FWWA 1N1LA 2F9VA 5L2ZH 1P2JA 4B2CA 2UUFB 1GI7B 2XRCA 1BMAA 1K1MA 2H9HA 4INHA 3BTGE 2STBE 4YOJA 3QLPH 6LPRA 2Y7XA 3GDSA 1YPMH 3JZ2B 1W7GH 1ZHPA 4JZIA 3SI3H 1KLIH 1AWHB 2EA3A 1SG8B 1K2I1 5EXLA 1ESTA 3P95A 4LOYH 5HMAA 1GBDA 2VIDA 1DY9A 3T2NA 2B9LA 2QF3A 1C2IA 5A0BA 2K1QA 3DT0H 2CXVA 1RRKA 1ETRH 2BD9A 1KXEA 1ELVA 1IHSH 1GI1A 8ESTE 1BBRE 3QTOH 2Z3DA 3RU4D 1O32A 4I8JA 1NESE 1O3AA 2FYRA 4FUJA 1QQUA 3K2UA 3SNAA 1YCPH 1D4PB 1GWAA 3L3TA 3Q3XA 4UE7H 2GD4B 2TGPZ 2FOGA 2A5KA 3RM2H 1S81A 1N8OC 2ZFFH 1IAUA 1A3BH 4HZHA 1A0JA 4CH2B 1GHBG 2BY7X 1S0RA 1TA2A 4O9VA 1AFEH 4F4OC 1D3TB 1VR1H 3M7UA 2BQ7B 3QGNB 4MPUA 4HFPB 3ZVCA 1JIRA 2J2UA 4NSVA 3T27A 1DWBH 1YGCH 1P06A 3NXPA 3UQVA 2THFB 4D7GA 4MPXA
chains in the Genus database with same CATH superfamily
2XWAA 1XUIA 1FY8E 1QL7A 1HDTH 4D8NA 5TJXA 1W3CA 3VB7A 3TK6A 1EATA 4FUGA 1TPSA 5LPEA 4K3JA 3A8AA 1QA7A 1GVLA 3NRLA 2BD2A 2TGAA 6GCHG 3UREA 1KDQB 3OTJE 1BTXA 3PMBB 2BY9X 4IMQA 1F0UA 4X6PA 1BTUA 3FN8A 1UHBB 1GI3A 5T6FA 1YPGH 1TONA 1C1WH 1P2NA 1QRXA 1ZJKA 1CU1A 1GBBA 3EAJA 1JRTA 1N6XA 2A7CA 2KAIA 1T8NA 2J5UA 2ZP0H 3A88A 1RXPA 2VBCA 5EJ1A 4ZHAA 1BRAA 2NU3E 5EQRA 3GCOA 1AY6H 3PROA 5HM2A 1C1PA 4NGAH 2BY5X 2CF8H 1TNHA 2ZCHP 2BHGA 1C1UH 1L1JA 5T6DA 4M7GA 2KCYA 4DW2U 4AN7A 2I6SA 4UFGH 1PYTC 1UCYK 1P10A 1YPKH 2ZNKH 3O8RA 1TGTA 4KTUA 1GI9B 1TRNA 1YBWA 1BMMH 5HKKD 4X1NU 4KP0A 3EA7A 1IHTH 2A45B 4RKOB 5FBIA 1KLJH 3TJNA 3H5CB 2FP7B 5DP9A 1CGHA 1GBFA 1T4UH 2J97A 3SV8A 3FZDA 3KQBA 3TNSA 1WBGB 1FONA 3RMNH 4BNRA 2AFQB 1ZTLA 1AIXH 2GDEH 3ATKA 1O0DH 3TK5A 3VB6A 1FZZA 1G37A 1G3EA 1OWJA 3KL6A 1DS2E 1ACBE 1XM1A 1XMNB 1GVKB 2Z9GA 2FTMA 4WH6A 1HJ8A 1LCYA 2PTCE 1KIGH 4D7FA 3O8DA 2ULLA 1VCWA 4NA9H 1G3CA 1J15A 3DSGA 2UUYA 3M36A 4Y6DA 3EDXB 4GPGA 4BAOB 4ABHA 1O2RA 4XBDA 5C0TA 3WWFA 1OSSA 1BBRK 4DIHH 1O3MA 2GZ9A 2ZFRH 1Y3UA 5LPRA 4A5TS 1Y59T 2V3MA 1SHYA 3CENA 2WPIS 3PLKA 1S0QA 1O39A 2BVRH 1EAIA 2KCAA 1TGBA 3URCA 5DP7A 3ZZBA 4WXIA 1OYQA 1NRQH 1A4WH 2IJD1 1TX8A 1Z8JB 2A1DB 3PLBA 1YCPK 1JIMA 3KYGA 3MNXA 1C5NH 5GPIB 1TMTH 3MMGA 4XE4A 2PHBA 3SU2A 1EOJA 5K7RA 2ZTXA 1P9SA 4A92A 1AMHA 1TNIA 1KDQA 2ZPSA 5SGAE 3UTUH 1SQRA 3FFGA 1GG6C 2ODPA 1MQ5A 1SFQB 3SU5A 3SZNA 1N6YA 1IQHA 3V13A 2AMQA 2XC5A 4DJZB 1GHZA 2AMPA 3MO9A 1P57B 2ZDMA 2HVYB 4I8LA 3F1SB 4ZXYH 2H2ZA 4ASUD 1O34A 2QC2A 3K6YA 1IQEA 1IQGA 1C5RA 3A8DA 3PMJA 5E0HA 4IC6A 1H1BA 2BZAA 1GJ7B 3IWMA 1JRSA 1LDTT 2CGAA 1GJAB 3E90B 1QCPA 4AB9A 1XXDA 4Y8XA 1GL1A 2KX4A 3RXEA 3IITA 2W6JD 2BQ6B 1YYY1 1C2JA 2ZDAH 1MAXA 1TPPA 1EP5A 2Z9KA 3BTTE 3PO1C 4U30A 4CRFA 5EGMA 2ESTE 4B2BA 2SGDE 4ABEA 3OX7U 2XCNA 2VVVA 4QT8C 1YPLH 3K6ZA 1IQJA 1THPB 1W7XH 1BCUH 5TCAA 4I8HA 3LGWA 3LGYA 1SSXA 1LVOA 1G3DA 3GY8A 2ZECA 1GBCA 1GMDG 7GCHG 4YOGA 1C1RA 5CHAC 4E05H 1RGQA 4FU8A 1THSH 1PFXC 2VIQA 4Y11E 1JBUH 3UPEA 5IK2D 3HATH 5JYIA 3S7HB 3ZZ5A 4DVAU 1GBTA 3GY7A 3T29A 1RJXB 4CR9A 1FN6A 1A7SA 2ALVA 4BANB 1O37A 3RXDA 5ETXA 4IC5A 3MH4A 2ZIQH 2P3UB 3FAOA 4ZCNA 8GCHF 2XNIA 5C1YA 4Z1MD 2WPKS 2C4FH 2FOMB 3ZZCA 2EQNA 5LH8A 1RFNA 1TIOA 2HPPH 2RDLA 2V0BA 2WV9A 3PV4A 4Y10E 3DD2H 1DXWA 3VG8A 3P8GA 1WV7H 1CQQA 2VWLA 1O3DA 1NT1A 2IJOB 2ZO3H 2G5NA 4INLA 1J17T 3RP2A 4OGYA 2UWLA 1C2KA 3BTWE 2WSSD 4RT1A 2P94A 2ZFSA 1LHGH 1B5GH 3WY8A 1LPZB 3EQ0H 3RXFA 3GY2A 4YXWD 1H8ED 5AFYH 1IQFA 4ZKRU 2EY4C 1Y5AT 2P95A 1Z6JH 2FLRH 2JH0D 5E0JA 4ISHH 5DP8A 2OTVA 2EI6A 1NRRH 3BTEE 2ZQ1A 1D3PB 1Z8GA 1Y3WA 1ZTKA 3RMOH 4BTIB 3BG4B 2PLXA 4H6TA 4I8KA 5GNDA 1W0JD 4B1TA 5C67A 5B6OA 1AO5A 4TPIZ 3U1JB 1GI5A 3OEED 2BD4A 2QIQA 1CBWC 2AGGX 1O2LA 4X1RU 3ZVEA 2ZHDA 3A82A 1SMFE 1MD8A 2P59A 4ABGA 3ZVFA 2F3CE 2G81E 3LONA 1H9IE 3ZZ7A 1BUIA 1K1JA 4ASHA 5L2YH 2G4TA 3UFAA 1HLTH 1KLTA 2Z9LA 9ESTA 4X1PU 3SNEA 1HAOH 1ZMJA 1CA0C 5BPEA 1QR3E 2TIOA 3Q76A 2PSXA 4OS2A 4ABBA 1GDQA 1AFQB 1OP0A 2F9UA 2VVCA 2PGBB 4BOHA 3A81A 1O2KA 4BTUB 2A4RA 2ZF0H 3BEUA 4O97A 2ZHFH 3SU6A 2H9TH 1ZMLA 2CHAC 2Y80A 5A8YA 3TGKE 1PPEE 3SNDA 1HIAB 2J92A 2HRVA 2ZU2A 1C9TA 4CHAB 4A1XA 1AD8H 2GCTB 1SC8U 2XYAA 3T25A 7ESTE 1CBWB 1F5LA 3NKKA 1Q2WA 2HOBA 5GCHG 4WXVA 5DN6D 2WUCA 5ESTE 4WVPE 2ZGHA 3T28A 5C5OA 3UR9A 4AYVB 3RXOA 1WXRA 3ZYEA 3UNSA 1C1NA 1EZXC 1WTHD 1BMLA 5L6NH 1S6FA 2R2WU 4XBBA 4DGJA 1LO6A 4XOJA 1OYTH 1GHYH 2TGTA 4KTSA 4MVNA 3NWUA 3MNCA 3PRBA 1TQ0B 3LGIA 1XXFA 1GI2A 1O31A 4A1VA 3A87A 1HXEH 1OWDA 1ANDA 2J98A 2PSYA 1Q31A 1SQAA 2BB4A 2ZFQH 3QGJA 2AMDA 2BLOA 1DT2A 3SJKA 1ZHMA 2V3OH 3PTBA 3PMHB 2G5VA 3B9FH 4I31A 4BAHB 1NTPA 1O2GH 1VITG 4UEHH 3A86A 2ZC9H 2JIZD 2G4UA 4Y7BA 3KGPA 4FUIA 3LOXA 4P02A 1W11U 4CR5A 4NA7A 1MCVA 2ZU5A 1XUHA 1GBAA 4IN2A 4OS6A 2W7UA 4JZFH 1Y3XA 1ELBA 3L33A 2HVXA 3UOPA 2XBWA 4X6MA 2M2AA 3TU7H 4DG4A 3KQDA 1UVPA 5FL7D 2ZFTA 4CBNA 3WWBA 3SV6A 1E38B 2EEKA 2JDID 2BXTH 1AE8H 2CHAB 2IPQX 4YESB 3DSPA 1TQ7B 2CV3A 4BXSA 2VIPA 1KY9A 3OFND 1V2MT 2ALPA 2VH6A 4J2YB 1FUJA 4I86A 1NFWA 3GCTG 1UW7A 4MLFB 1GMHF 1C5UA 1KSNA 3KHVA 3SORA 1FPHH 4AFZA 2FI3E 3I78A 1BOQA 1DLEA 5EPNA 3N7OA 2FIRH 1QB9A 5E2PA 3CP7A 5HXFA 3LC3A 4ACBA 5FHTA 4MTBA 3S9AA 4WJG2 5HYOA 1CT2E 2LP6A 1RIWB 1WAYB 1DSTA 3RXJA 1XVOA 3RXTA 1FV9A 3S0NA 2VWMA 2HNTF 3VXEH 5DP5A 1ZMNA 2J94A 2RG3A 3GCHC 3LPRA 2BDHA 1O5EH 1DXPA 5B6LA 3H7OA 3SQEE 5C1UA 1O2UA 1Z71A 4Z0KA 1O2WA 3ZVBA 2QAAA 1QY6A 2FLBH 3EE0B 4AYYB 1HAXB 4LZ1H 2ZGJA 2OC8A 1OKXA 2B0FA 1CGJE 1GI6A 1W2KH 5GIBA 3QN7A 4AORA 4IW4E 2ZFPH 1GHAF 1UVOA 2Y6TA 3Q77A 1EAXA 1GCTC 1LVMA 3RXCA 4X8SH 1GBKA 5F6MA 1SQOA 1GG6B 1LVBA 3PMAB 4Y8YA 4X2XA 2NU4E 4GAWA 1HAVB 4UD9H 3MH7A 4B75A 1RTKA 4JYTA 2K8IA 5FCKA 3GOVB 1ETTH 1WYKA 1A1RA 3A84A 2QXJA 3TIUA 4JZDH 2J4IA 3BTKE 1SOZA 2UWPA 1TRYA 3GISB 3M37A 1X7AC 4MQAA 2OC7A 3FZZA 1NRSH 1Q3XA 1B7XB 1PPFE 3PV2A 4MNXA 5EIYA 2EC9H 2CK3D 3H7TA 1E1QD 1CHOG 1HUTH 4J1YA 4FUDA 2GT8A 2ZDVH 4O3UA 3SHAH 2H1UA 1EFRD 4FU7A 3PTNA 2F4LA 1AKSA 1HAZB 4X1QU 1W0YH 4XFQA 3UNQA 3LGTA 2GJGA 1Y3YA 3QO6A 2C90B 2Q6FA 3A7TA 2ZU3A 3BIUH 2G52A 2QF0A 5DP6A 3EGKH 3PM3A 5IDKA 1K9OE 1PPGE 4ACAA 1HRTH 1MUEB 2ILNA 2AGEX 1E79D 1SGFA 3RU4T 2FS8A 1O3HA 3MTYA 1T8MA 1SGIB 4UFFH 1Z8RA 2ZI2H 1EQ9A 2GX4A 2RDEA 3P70B 1UK3A 3HKIB 1YPHE 1DLKB 2VIOA 4CH8B 1KTSB 4YT7H 2J34A 3F9HA 4PROA 5A0CA 1DUAA 3ITIA 2VB0A 3Q3YA 4OS4A 3SV2H 2A7HA 4Y76A 3GDUA 4NG9H 3UR6A 1GBEA 1ESAA 1P01A 2F9BH 1XUKA 5ABWA 1AGJA 2BD3A 2GGVB 1DE7H 3RLWH 2D26C 5HIYA 1HIAA 1CSOE 5JBBS 3PRDA 2AERH 3KQ5A 3MHWU 3ZZ4A 5C1XA 4MG3A 4IS5A 2ZWLH 1ZSJA 1MTNB 2HWLB 4XRNA 5E0GA 3HGPA 4X1SU 1P3EA 1AI8H 2F91A 3ATIA 3EE7A 3LKWA 3M5OA 1V2RT 5F8XA 3DA9B 1E35B 1O2PA 2W7SA 2AH4X 1EB1H 4R0IA 1L1GA 2B5TB 3OEHD 2ANMH 4Q80A 2PR3A 5PTPA 1TX6A 1UTJA 3FP6E 2L74A 2HGTH 1C5QA 3URDA 1O3PB 2XBVA 4Y8ZA 3SU0A 2RA0A 2G00A 1B0FA 3E8LA 1F92A 5DO4H 1DWCH 3VXFH 2YNBA 5JBCS 2AEIH 1UTPA 1EZSC 1COWD 5C20A 1ZRKA 3GY6A 3M7QA 4WMDA 3O8CA 3MO3A 3OSYA 5F03A 2B8OH 3BG8A 3QDZB 3ZZDA 2XTTB 1OXGA 5KECA 3EA9A 3RXQA 2BZ6H 1FAXA 1AVXA 4UFEH 5JB9S 4ABDA 1TYNA 1DVAH 2HALA 1O30A 1NU9A 1MKWK 3QZRA 3SYJA 2GCTC 3SU3A 1TGNA 1HXFH 2ASUB 1O3IA 1CT4E 3DFLA 1EB2A 1AUTC 1K0HA 3NZIA 3B23B 2VWOA 3FP8E 1ZPCA 1MU6B 4UFDH 2OQ5A 1H8IH 1SGYE 1WCZA 3TH4H 1QB6A 2BOHB 2O8TA 3TNTA 3VB5A 1NY22 1A0HB 4MNWA 2VGCC 1NFXA 2FYQA 1NRNH 1C2HA 1TX7A 1EUFA 4AC9A 3RC5A 3SZEA 1LTOA 1VCQA 4WWYA 1P0SH 3CS0A 2YOLA 4O03A 1GHBF 9LPRA 4K5ZA 3LGVA 1PPCE 3LC5A 1C4U2 1QIXB 2XC4A 3ESTA 4U32A 1J9CH 3MU5A 5EG4A 1ESBA 1GJ8B 1UTNA 4XDEA 1ZYOA 4DIIH 2C3SA 4TWYA 5EQQA 2SGPE 5E2OA 1O5GH 1P9UA 3SJOA 1P09A 1BJUA 1P02A 2BVSH 4OM9A 1NROH 3E16B 5JPMH 1BDAA 4K1TA 2Z3CA 2YMSD 1F2SE 1VJAU 1SLVB 1NZQH 1A5IA 3E0PB 1WU1A 4OS5A 3TGJE 3GY5A 4XBCA 2J95A 2D8WA 5GJ4B 1O5DH 1FY4A 4K60A 1QJ1B 1SLXB 2A5IA 2BM2A 3ATWA 4X2VA 2BY8X 3A7XA 1BB0B 1TRMA 4X2WA 3IG6B 2SGQE 1Z7KA 3ZVAA 3MWIU 1AHTH 1O3EA 3BIVH 2FOBA 1QJ6B 3RMMH 5C0UA 2ZDKA 2FOCA 1W10U 4U01A 1P2OA 2ODYB 2ZGXH 4JK6A 3EA8A 3F9FA 4WMFA 2VJ1A 5AFZH 3U1IB 1HJAC 1PQAA 3QX5H 5JBTA 1V2OT 1IQKA 3TLOA 2VNTA 4MPWA 2LNCA 1WQSA 1SOTA 5HGGA 1LQDB 1DM4B 3TJOA 1ABIH 3T62A 1C5OH 1D6WA 5FBEA 1H4WA 4F55A 1C5PA 1NFYA 1F0RA 2Y5FA 3MI4A 1K1LA 1W12U 3U8RH 4BXWA 2OCVB 1GI8B 2ZDNA 2OK5A 2STAE 4ISLA 3TITA 1W0KD 5KGOA 3GS9A 1BMNH 1O3GA 1J8AA 2BX3A 1EJMA 5DK1A 2ANYA 2BLWA 1WOFA 1O2MA 4YO9A 3U9AH 1C5VA 2BY6X 2D1JA 3W94A 3UY9A 3R0FA 3AAUA 3CNRA 1GHVH 4SGBE 3ZZAA 3SOSA 4ABIA 5C2ZA 1QJ7B 4JCNA 1UTKA 5T1VA 3GCNA 3KEEA 1ORFA 2OC1A 1O2JA 1G30B 1C5WB 1UTQA 1ELCA 1CVWH 1EP6A 2VGCB 1YPHC 2J38A 3AK5A 2QA9E 3RXLA 1SB1H 1SGDE 4MPVA 5AVDA 4NWLA 4F48B 3MNBA 4ZHMU 1EAWA 1ZPBA 5C3NA 3FANA 1C4Y2 1E34B 1SL3A 1IQMA 3VGCB 1C1VH 1O3JA 4B6FA 3MNSA 2PW8H 3ZYDA 4Q63A 3NPSA 1TGSZ 1VITH 3RDZA 3KYFA 2NU2E 1IQIA 2A4QA 1AU8A 3UWJH 4O3TA 2BXUH 4ZKNU 1ZPZA 1DSUA 4HI3A 3P92A 1C2EA 2ZPQA 1C5SA 1T7CA 1EPTC 1KYNA 3MH5A 1TB6H 3HK3B 2TBSA 3DUXH 2KCPA 1L1NA 1G32B 4BAQB 6CHAC 3ZZ3A 1V2TT 4GHTA 4FVDA 2ZHQH 1V2NT 1C2GA 3NK8A 1QNJA 1MTWA 3LH3A 2WYGA 3SUGA 5ESBA 1NO9H 3E3TA 4INKA 1C2LA 3RXVA 3FP7E 4Y79A 4R8TB 1GMDF 7GCHF 1LVYA 2Y5GA 1TA6A 4AFQA 3MQKC 4X0WU 2VU8E 1WQVH 3RLYH 1AVWA 1K1IA 4ABAA 4X8TH 1XX9A 1SVPA 1TAWA 4K8BA 1CE5A 1C5XB 1JXPA 1H8HD 5FPTA 1GI4A 1FAKH 2Z9IA 1TOMH 2K0QA 1NPMA 1JWTA 2FS9A 1BMFD 3SUFA 1KXDA 1OWKA 1WTGH 1HB0B 2OC0A 4VGCB 2AHME 3GICB 3T26A 1AQ7A 3VB4A 1O2XA 2W26A 4Q7YA 3EYDA 3VFEA 1C2FA 1ZGIA 3RXSA 2XW9A 3D62A 3M3SA 1QFKH 4RSPA 2G8TA 4TWWA 3SUDA 5A8XA 3U8TH 1ZTJA 3RXKA 4DT7B 1EJAA 1SGPE 1QHRB 2CMYA 2R9PA 3F2GA 1IOEA 1BZXE 2ZU4A 1LKAA 3G01A 1GJ6A 4IGDA 2AIQA 4Y71A 5EW2H 4DT4A 2QY0B 1GJBB 1MQ6A 4TYDA 3UUZA 2IPHA 5J4SA 3T5FH 2ZGBH 3SJIA 5CHAB 5A2MH 4MNYA 4NA8A 3A85A 1YLCA 1Y5BT 3NCLA 1A61H 2XC0A 1KTTB 4DURA 1VGCC 2GMTC 3TPIZ 1HAVA 1UK4A 1QGFA 5GDSH 1OOKB 3GY3A 5HM9A 3ODFA 3PB1E 5LGOA 5I46H 2BDYA 2P16A 1FLEE 3DSOA 3MH6A 2P8OC 1L4ZA 2ZCLP 2AGIX 1AUJA 1H8DH 1GHXH 1C5ZB 1LPKB 2FI5E 1MBQA 1KXCA 4AG1A 2KAIB 2Y82A 3A7ZA 4CHAC 3QZQA 4E06H 3M61U 1HBTH 1OWEA 1YM0A 2VWNA 5CE1A 1UVSH 4B76A 1O2VA 4JYUH 1TBQH 1SGRE 2VH0A 1P03A 4CBOA 1GBHA 1DITH 1GI0A 1CA0B 1GBJA 1AZ8A 2GTBA 1HAIH 5F8TA 4IMZA 5K0HA 3R3GB 5EODA 2OLGA 1O3KA 3F6UH 2BDBA 5LPFA 2KFWA 1PJPA 4Y7AA 4OS7A 1VKYA 2GCHG 1MTUA 2GT7A 5FPSA 2AYWA 5DP3A 1VZQH 4GVUA 3SBKA 1SQTA 1FPCH 2A32A 4ISOA 1PPHE 2C8XB 3DCLA 1L2EA 2FO9A 3S9CA 2F9PA 3SV7A 3VGCC 2BMGB 2O8MA 4FETA 4FXGH 5E8EH 2O8LA 5F53A 5EW1H 3ZIAD 2GV6A 1SGEE 1CO7E 3SGBE 1GL0E 2RFKC 1K22H 3N99A 4Q7XA 2UUJB 1TMBH 3SV9A 4TT3D 1F7ZA 4K1SA 1ID5H 2FOFA 4K2YA 2OP9A 4FUEA 1ELGA 1S85A 3ZZ9A 5L30H 1O5BB 1WDIA 2ZA5A 2V6NA 2WHXA 2PFEA 1O3CA 3FVFB 3SQHE 1W8BH 1ABJH 1SPJA 1AB9C 1J16A 1BTZA 2IOTA 2VINA 1IQLA 1G2MA 1GHAG 1UVTH 3RC4A 3MU4A 2A2QH 1F0SA 4X2YA 4JK5A 1CHGA 3GYLB 3LU9B 3SGQE 1V2JT 2TRMA 1E36B 4H42U 3C27B 1Z1IA 2QF5A 1YPEH 1C5MD 1A46H 4AZ2B 4D9RA 3OTPA 1L4DA 2JJ2D 4NZLA 1TPOA 2H5DA 3RC6A 3K65B 3VB3A 4FUHA 1MAYA 4FVBA 5IYTA 4GUXA 2NU1E 5TCCA 1FQ3A 1HFDA 1GDNA 1P2QA 2GZ7A 3QTVH 4B6EA 2ANKH 2XBYA 1YPJH 3W1EA 1Y8TA 2B7DH 8LPRA 3AASA 3SU1A 2VIVA 1GJ9B 2W6ID 4VGCC 2R0KA 2R0LA 4F49A 1SGFG 1QA0A 1QBVH 2UUKB 1CA8B 3STJA 1PQ8A 3UOUA 1FJSA 1P8VC 2P8OB 3ENSB 1HYLA 3O8BA 1T8LA 1VCPA 5EOKA 1BBRH 1UO6A 4RI0A 2GZ8A 2UWOA 2FDAA 4H6SB 3GCTF 5DP4A 3KCGH 1ZJDA 3HK6B 1ETSH 1O2YA 4DCDA 2RA3A 1FMGA 4LZ4B 1BT7A 1EKBB 1K28D 3M3VA 2GKVE 3A8CA 3JZ1B 2FOAA 1HV7A 1XUGA 1QQ4A 1RS0A 2PKSB 1YP9A 1RIWC 1SHHB 4CRDA 1FY5A 1V6DA 4SGAE 3I29A 5EXMA 1TMUH 3ZVGA 2P3FH 2BOKA 4JMYA 2DE9A 3STIA 3M5LA 1O3OA 1XKAC 1PQ5A 4BAMB 4ZKOU 8KME2 2A7JA 2ZU1A 1EAUA 1C5YB 1F5RA 1ARBA 2A4GA 1S82A 1Y5UT 4B71A 2WPJS 2LPRA 3F0OA 1HAHH 1P3CA 1AZZA 2OUAA 1O3LA 1V2LT 5T6GA 1GJDB 2OQUA 3D65E 5JB8S 1RTFB 1GJCB 2J9NA 1O3BA 2TPIZ 1BHXB 1S5SA 4U2WA 2A2XH 3WW7A 2ANWA 3FOAA 3D49H 1ANEA 1S6LA 1S84A 3BN9A 5EJLA 3D23A 2ZTZA 1EZUC 3U28C 1F5KU 1QBOA 4HGCA 1BA8B 1BJVA 1C1QA 4LXBH 1UCYE 4XSKU 7LPRA 5J4QA 4GLYA 2JH5D 5DGJA 2GVFA 2BDCA 5EJZA 3F9EA 1DFPA 2ZTYA 3VEQB 2Z94A 2XBXA 2FMJA 1AN1E 4JYVH 1LHDH 1V2QT 1GPZA 4NIXA 2C8WB 3QWCH 4TY6A 1GMCG 4B2AA 2JETB 1XUFA 5GWZA 1BTHH 2ZPRA 1FN8A 1V3XA 1YLNA 1ANCA 3BG4C 2Z7FE 4JZEH 5HIZA 2ZHEH 1LHCH 4ZHLU 5A0AE 2RCEA 3W95A 6GCHF 1GCDA 2PKAB 2ZG0H 4ABJA 4E7NA 1FIWA 3SGAE 2PKSC 1AWFH 1YY3A 2PWXA 2KM0A 1PQ7A 1O2SA 1INCA 3M5NA 5DSFA 5FXLA 2GDDA 3E91A 2DE8A 1TFXA 2OBOA 3U98H 1ZOMA 3E0NB 4RN6A 5FAHA 1A5GH 4KKDA 2BTCE 3QUMP 1FY1A 2W5EA 2C93B 4NCYA 1BRUP 2PUQH 4FU9A 5F8ZA 4ZROA 1QRWA 1GDUA 1BRBE 1LKBA 2YMSC 1CHOF 1BRCE 2QXGA 1MTSA 2WUBA 3M7TA 4TSFD 1YKTA 5DKMA 1MKWH 3UWIA 1V2UT 2VIWA 2WYJA 4K1EA 1QURH 1NBMD 1PYTD 2Q6GA 1ZZZA 2QF4A 1ZSKA 3BEIB 4I33A 1SFIA 1DDJA 1YC0A 1K1NA 3OU0A 1C5LH 3BTME 1G2LA 1V2PT 3F9GA 2IN2A 3V3MA 5C94A 2WPLS 1SLWB 2P93A 3MFJA 2FZZA 3QK1A 1JMOH 1BQYA 2GMTB 1VJ9U 1O35A 1UVUH 4YZUA 2ZZUH 2BLQA 2J98B 2FTLE 4CRBA 1SGQE 1MBMA 2V3HH 4KTCA 3DFJA 3VPKA 2A0QB 3GCHB 3FKSD 4E7RG 2BDGA 1JOUB 3UIRA 2W3KA 1UTOA 3ELAH 1GBLA 2H6MA 2FXRA 2Q6DA 1AB9B 1FX0B 3A7YA 1BTPA 1AKSB 1EPTA 1MZAA 3M5MA 1SI5H 1CGIE 1KXAA 1YF4A 1OP2A 4NFFA 4ISIH 1GVZA 3E6PH 6CHAB 1O2IA 2O9QA 1UK2A 4ZH8A 1M9UA 1C1TA 1ZSLA 2PUXB 2GP9B 2QV1A 3SJ8A 1BIOA 3B8JA 3ZV8A 2PTNA 3TVJB 1K1PA 5KEDA 3F3BA 4X6OA 1B0EA 1DOJA 2EI8A 4NZQA 1C9PA 4RT0A 1V2ST 1O38A 5DG6A 3ZZ8A 3OYPA 2GV7A 1NU7B 2FEQH 4AFSA 2XWBI 1NS3A 3K9XB 1NRPH 1OWHA 1GJ5H 1ZHRA 2L6OA 3S7KB 4IBLH 1XKBC 4X8UH 3LH1A 2FOHA 4YLUA 3RXRA 4GCHF 1H9HE 5AF9H 2XXLA 4FOUC 3RU4E 4H4FA 2CF9H 3V7TA 2XCFA 2SNVA 2G55A 2ZHWH 3RM0H 1RTLA 1FIZA 4I8GA 1O2NA 3UNRA 1L0ZA 3A7VA 2DUCA 1G3BA 1IQNA 2ZQ2A 1TOCB 4BAKB 4CREA 1AFQC 2H5CA 4OS1A 3RUOA 3A89A 8GCHG 1OPHB 1W0ZU 2BD7A 2FODA 3AW1A 3MO6A 5FX5A 1T4VH 1TNLA 4P00A 3L6PA 3N7DA 4NIWA 4NSYA 3SHCH 3SNCA 4AFUA 3P8FA 2A31A 1MMJN 4CRGA 2H9EH 5JBAS 1HAGE 3MU0A 2Y81A 1O5AB 2QXHA 2YNAA 1YLDA 4AGJA 1MD7A 3F2HA 2JH6D 1QBNA 1AVGH 1SGTA 4X8VH 2G51A 1TBRH 2BDIA 5DJ7A 1TWXB 2BYAX 2O8UA 1OX1A 1GBIA 3LJJA 3HPTB 2V35A 1ZR0A 3AAVA 2A5AA 1TPAE 3TJVA 1DY8A 2AIPA 4WF8A 2ODQA 1MCTA 1EASA 1TALA 3F68H 4IN1A 2BD8A 1VGCB 1O5FH 3TGIE 3KF2A 3KQCA 2F83A 1OS8A 3MU1A 3SI4H 1BITA 4NWKA 4AOQA 3HKJB 3TK9A 1TABE 3SU4A 1ZRBA 2V7QD 1ELTA 2R2MB 2EI7A 1EXFA 2WPHS 1HCGA 1O2HA 1SR5C 4FUFA 1LHFH 1FXYA 3MYWA 1DX5M 1ZLRA 2Y7ZA 3H09A 3OY5U 4RKJB 1YCPM 2KR7A 2WV4A 1D3DB 1ZGVA 2OBQA 1G9IE 4YOIA 4TY7A 1BTWA 1XUJA 5FX6A 1ELAA 4CRAA 2C8YB 3HGNA 1H9LB 2HLCA 1AE5A 1G36A 2QGRA 1DICA 1T31A 4B73A 1DANH 4K8YA 2WV5A 1GGDB 4AGKA 1Y3VA 2FM2A 4TPYA 1TNKA 2I6QA 3A8BA 4ZAEA 3SW2B 4LK4A 2CN0H 2ZDLA 1ELDE 2D2DA 1GMHG 1NFUA 4NIVA 3PWCA 3ATLA 1SKYE 1THRH 1TE0A 3BSQA 3GYMA 1TNGA 4Q2KA 2PKAA 4GHQA 2QYIA 3V12A 1LMWB 2FPZA 3RXAA 4KELA 1GHWH 5G4BA 5H4IB 3SJ9A 3DHKH 3C1KA 1UCYH 1MZDA 1O3NA 5JDUB 2KCOA 4OGXA 4DY7B 3LJOA 4AG2A 2O8WA 3RXHA 2LELA 1U6QA 3RXPA 4UONA 2SGFE 2F9OA 2JJ1D 2FI4E 3PO1B 2WINI 2NU0E 2Z6BD 1C1OA 2OD3B 2ZGCA 1Z6EA 1FDPA 1FNIA 1GGDC 3GDVA 1E37B 2C8ZB 1ARCA 1S83A 4I32A 5EU8A 1A5HA 1BTYA 3RXGA 3PWBA 1O36A 1ANBA 3S9BA 1HGTH 4MDSA 3KN2A 2YMSB 4JZ1A 4NIYA 3ZVDA 1QL9A 1CT0E 4Y0ZE 3U69H 3TJUA 5FPYA 1KXFA 3ZV9A 2PV9B 1Z1JA 1MABB 1UTLM 5CMXH 3RXMA 3N7EA 3GY4A 1MU8B 2OINA 1E1RD 2BDAA 4FUBA 1W14U 2R3UA 1DPOA 1P12E 2ZKSA 4Y0YE 5BRRE 1V2KT 2PGQB 5AHGH 7KMEH 3F0PA 1MKXH 3LT3A 3SN8A 1EOLA 1QZ8A 1LHEH 2F43B 2FESH 1D9IA 4ZKSU 2FX6A 1V2WT 4GSOA 5GCHF 1SBWA 4WH8A 3SNBA 3BTDE 1P11E 4MNVA 2QN5T 1UJ1A 2WZQA 4UDWH 1P2IA 3ATMA 4CRCA 4GCHG 1D6RA 1FY3A 4ESTE 1OP8A 1SGNE 1QB1A 1QTFA 3AVZA 4Q4LA 5EQSA 1Z8IB 1QL8A 2P3TB 3BTHE 3P8OA 1P04A 3RXUA 1TBZH 3A83A 1EX3A 2BD5A 2XNDD 2BQWB 2QXIA 4ISNA 4HTCH 1A3EH 2Z9JA 1V2VT 1XVMA 1K1OA 1O5CB 3P17H 1HPGA 4WMEA 2BVXH 5T3HA 2SFAA 6ESTA 1P2MA 1W13U 4XD7D 1C4V2 4YTAA 2SGEE 5EPYA 3UAIC 1HJAB 2QCYA 2Y5HA 2VVUA 1F0TA 4YLQH 2FX4A 3BTQE 3ODDA 5GXPA 1MTVA 1GBMA 1OWIA 3PV5A 3ZZ6A 4FUCA 2TGDA 1C1MA 1HNEE 2BX4A 1UMAH 3P6ZB 4BTTB 3M3TA 1NN6A 4WY3A 5A09A 3V0XA 1KXBA 1BHXF 3UQOA 1UTMA 1MKXK 1TGCA 2R3YA 1NM6A 1A0LA 5DPAA 3KNXA 1HJ9A 3Q3KA 4Z6AH 3LGUA 1O33A 1FI8A 1PPZA 1RD3B 1WSSH 4ZMAH 1K21H 1P2KA 1DWDH 3BEFB 1C5TA 3NUMA 4X6NA 1EJNA 3P8NA 5C17A 2Q1JA 3I77A 3RXIA 2BLVA 1O2QA 4THNH 2ZCKP 1S6HA 4I7YH 4ZXXH 2QE7D 1O2TA 4KGAA 1GJ4H 1T32A 3A80A 2A4OA 3SUEA 1SGCA 2OXSA 3MOCA 3RXBA 2AS9A 2JETC 2M5TA 2ZEBA 1LPGB 3BV9B 3TH3H 3TH2H 4D76A 3LIWA 5FCRA 3U8OH 3PYHA 5CHBA 1MTNC 4HG6A 1HAYB 1DUEA 4D9QA 1NBME 3UB0A 1N8OB 1VITF 4B74A 2HNTC 1O2OA 1O2ZA 1WUNH 4A6LA 2NWNA 1HAPH 1C1SA 4ZUHA 1D3QB 1TLDA 1EPTB 3KQEA 2SGAA 3BF6H 1QRZA 2W3IA 1A2CH 3A7WA 3E1XB 3AW0A 1EZQA 2XOKD 2Z3EA 4K69A 4A1TA 1GCTB 4NFEA 4Q7ZA 2HNTE 1GMCF 3SO3A 1ELEE 2FOEA 2SNWA 1C2DA 4AX9H 3Q00A 2JKHA 4YT6H 1SLUB 2WPMS 5I25A 1MH0A 4DOQA 3OY6U 2PP6A 1ELFA 5C5NA 1DWEH 1T8OA 3M35A 2F9NA 4AB8A 3S69A 2WPDD 2GCHF 1C2MA 3BTFE 3CS7A 4ABFA 1J14A 1LQEA 3MU8A 2HPQH 3PLPA 3RMLH 1E0FD 1UHBA 4YM9A 1O3FA 5EXNA 1PPBH 1NC6A 1P05A 3KIDU 1TNJA 4A7IB 5A8ZA 3LDXH 2CJIA 2FWWA 1N1LA 2F9VA 5L2ZH 1P2JA 4B2CA 2UUFB 1GI7B 2XRCA 1BMAA 1K1MA 2H9HA 4INHA 3BTGE 2STBE 4YOJA 3QLPH 6LPRA 2Y7XA 3GDSA 1YPMH 3JZ2B 1W7GH 1ZHPA 4JZIA 3OE7D 3SI3H 1KLIH 1AWHB 2EA3A 1SG8B 1K2I1 5EXLA 1OHHD 1ESTA 3P95A 4LOYH 5HMAA 1GBDA 1DY9A 2HLDD 2VIDA 3T2NA 2B9LA 2QF3A 1C2IA 5A0BA 2K1QA 3DT0H 2CXVA 1RRKA 1ETRH 2BD9A 5CDFE 1KXEA 1ELVA 1IHSH 1GI1A 8ESTE 1BBRE 4M9FA 3QTOH 2Z3DA 3RU4D 1O32A 4I8JA 3OAAD 1NESE 1O3AA 2FYRA 4FUJA 1QQUA 3K2UA 3SNAA 1YCPH 1D4PB 1GWAA 3L3TA 3Q3XA 4UE7H 2GD4B 2TGPZ 2FOGA 2A5KA 3RM2H 1S81A 1N8OC 2ZFFH 1IAUA 1A3BH 4HZHA 1A0JA 2KZ4A 1GHBG 4CH2B 2BY7X 1S0RA 1TA2A 4O9VA 1AFEH 3FO8D 4F4OC 1D3TB 1VR1H 3M7UA 2BQ7B 3QGNB 4MPUA 4HFPB 3ZVCA 1JIRA 2J2UA 4NSVA 3T27A 1YWUA 1DWBH 3F2FA 1YGCH 1P06A 3NXPA 3UQVA 2THFB 4D7GA 1KMHB 4MPXA
chains in the Genus database with same CATH topology
2XWAA 1XUIA 1FY8E 1QL7A 1HDTH 4D8NA 5TJXA 1W3CA 3VB7A 3TK6A 1EATA 4FUGA 1TPSA 5LPEA 4K3JA 3A8AA 1QA7A 1GVLA 2BD2A 2TGAA 6GCHG 3UREA 1KDQB 3OTJE 1BTXA 3PMBB 2BY9X 4IMQA 1F0UA 4X6PA 1BTUA 1UHBB 1GI3A 5T6FA 1YPGH 1TONA 1C1WH 1P2NA 1QRXA 1ZJKA 1CU1A 1GBBA 3EAJA 1JRTA 1N6XA 2A7CA 2KAIA 1T8NA 2ZP0H 3A88A 1RXPA 4ZHAA 1BRAA 2NU3E 5EQRA 3GCOA 1AY6H 3PROA 5HM2A 1C1PA 4NGAH 2BY5X 2CF8H 1TNHA 2ZCHP 2BHGA 1C1UH 1L1JA 5T6DA 4M7GA 4DW2U 4AN7A 2I6SA 4UFGH 1PYTC 1UCYK 1P10A 1YPKH 2ZNKH 3O8RA 1TGTA 4KTUA 1GI9B 1TRNA 1YBWA 1BMMH 4X1NU 4KP0A 3EA7A 1IHTH 2A45B 4RKOB 5FBIA 1KLJH 3TJNA 3H5CB 2FP7B 5DP9A 1CGHA 1GBFA 1T4UH 3SV8A 3FZDA 3KQBA 3TNSA 1WBGB 1FONA 3RMNH 4BNRA 2AFQB 1ZTLA 1AIXH 2GDEH 3ATKA 1O0DH 3TK5A 3VB6A 1FZZA 1G37A 1G3EA 1OWJA 3KL6A 1DS2E 1ACBE 1XM1A 1XMNB 1GVKB 2Z9GA 2FTMA 4WH6A 1HJ8A 1LCYA 2PTCE 1KIGH 4D7FA 3O8DA 2ULLA 1VCWA 4NA9H 1G3CA 1J15A 2UUYA 3M36A 4Y6DA 3EDXB 4GPGA 4BAOB 4ABHA 1O2RA 4XBDA 1OSSA 1BBRK 4DIHH 1O3MA 2GZ9A 2ZFRH 1Y3UA 5LPRA 4A5TS 1Y59T 1SHYA 3CENA 2WPIS 3PLKA 1S0QA 1O39A 2BVRH 1EAIA 1TGBA 3URCA 5DP7A 3ZZBA 4WXIA 1OYQA 1NRQH 1A4WH 1TX8A 1Z8JB 2A1DB 3PLBA 1YCPK 1JIMA 3MNXA 1C5NH 5GPIB 1TMTH 3MMGA 4XE4A 2PHBA 3SU2A 1EOJA 5K7RA 2ZTXA 1P9SA 4A92A 1AMHA 1TNIA 1KDQA 2ZPSA 5SGAE 3UTUH 3FFGA 1GG6C 2ODPA 1MQ5A 1SFQB 3SU5A 3SZNA 1N6YA 1IQHA 3V13A 2AMQA 2XC5A 4DJZB 1GHZA 2AMPA 3MO9A 1P57B 2ZDMA 4I8LA 3F1SB 4ZXYH 2H2ZA 1O34A 2QC2A 3K6YA 1IQEA 1IQGA 1C5RA 3A8DA 3PMJA 5E0HA 4IC6A 1H1BA 2BZAA 1GJ7B 3IWMA 1JRSA 1LDTT 2CGAA 1GJAB 3E90B 1QCPA 4AB9A 1XXDA 4Y8XA 1GL1A 3RXEA 3IITA 2BQ6B 1YYY1 1C2JA 2ZDAH 1MAXA 1TPPA 1EP5A 2Z9KA 3BTTE 3PO1C 4U30A 4CRFA 5EGMA 2ESTE 4B2BA 2SGDE 4ABEA 3OX7U 2XCNA 2VVVA 4QT8C 1YPLH 3K6ZA 1IQJA 1THPB 1W7XH 1BCUH 5TCAA 4I8HA 3LGWA 3LGYA 1SSXA 1LVOA 1G3DA 3GY8A 2ZECA 1GBCA 1GMDG 7GCHG 4YOGA 1C1RA 5CHAC 4E05H 1RGQA 4FU8A 1THSH 1PFXC 2VIQA 4Y11E 1JBUH 3UPEA 3HATH 5JYIA 3S7HB 3ZZ5A 4DVAU 1GBTA 3GY7A 3T29A 1RJXB 4CR9A 1FN6A 1A7SA 2ALVA 4BANB 1O37A 3RXDA 5ETXA 4IC5A 3MH4A 2ZIQH 2P3UB 3FAOA 8GCHF 2XNIA 5C1YA 2WPKS 2C4FH 2FOMB 3ZZCA 5LH8A 1RFNA 1TIOA 2HPPH 2RDLA 2V0BA 3PV4A 4Y10E 3DD2H 1DXWA 3P8GA 1WV7H 1CQQA 2VWLA 1O3DA 1NT1A 2IJOB 2ZO3H 2G5NA 4INLA 1J17T 3RP2A 4OGYA 2UWLA 1C2KA 3BTWE 2P94A 2ZFSA 1LHGH 1B5GH 3WY8A 1LPZB 3EQ0H 3RXFA 3GY2A 5AFYH 1IQFA 4ZKRU 1Y5AT 2P95A 1Z6JH 2FLRH 2JH0D 5E0JA 4ISHH 5DP8A 2OTVA 2EI6A 1NRRH 3BTEE 2ZQ1A 1D3PB 1Z8GA 1Y3WA 1ZTKA 3RMOH 4BTIB 3BG4B 2PLXA 4H6TA 4I8KA 4B1TA 5C67A 5B6OA 1AO5A 4TPIZ 3U1JB 1GI5A 2BD4A 2QIQA 1CBWC 2AGGX 1O2LA 4X1RU 3ZVEA 2ZHDA 3A82A 1SMFE 1MD8A 2P59A 4ABGA 3ZVFA 2F3CE 2G81E 3LONA 1H9IE 3ZZ7A 1BUIA 1K1JA 4ASHA 5L2YH 2G4TA 3UFAA 1HLTH 1KLTA 2Z9LA 9ESTA 4X1PU 3SNEA 1HAOH 1ZMJA 1CA0C 5BPEA 1QR3E 2TIOA 3Q76A 2PSXA 4OS2A 4ABBA 1GDQA 1AFQB 1OP0A 2F9UA 2VVCA 2PGBB 4BOHA 3A81A 1O2KA 4BTUB 2A4RA 2ZF0H 3BEUA 4O97A 2ZHFH 3SU6A 2H9TH 1ZMLA 2CHAC 2Y80A 5A8YA 3TGKE 1PPEE 3SNDA 1HIAB 2J92A 2HRVA 2ZU2A 1C9TA 4CHAB 4A1XA 1AD8H 2GCTB 1SC8U 2XYAA 3T25A 7ESTE 1CBWB 1F5LA 3NKKA 1Q2WA 2HOBA 5GCHG 4WXVA 2WUCA 5ESTE 4WVPE 2ZGHA 3T28A 5C5OA 3UR9A 4AYVB 3RXOA 3ZYEA 3UNSA 1C1NA 1EZXC 1WTHD 1BMLA 5L6NH 1S6FA 2R2WU 4XBBA 4DGJA 1LO6A 4XOJA 1OYTH 1GHYH 2TGTA 4KTSA 4MVNA 3NWUA 3MNCA 1TQ0B 3LGIA 1XXFA 1GI2A 1O31A 4A1VA 3A87A 1HXEH 1OWDA 1ANDA 2PSYA 1Q31A 1SQAA 2BB4A 2ZFQH 3QGJA 2AMDA 2BLOA 1DT2A 3SJKA 1ZHMA 2V3OH 3PTBA 3PMHB 2G5VA 3B9FH 4I31A 4BAHB 1NTPA 1O2GH 1VITG 4UEHH 3A86A 2ZC9H 2G4UA 4Y7BA 3KGPA 4FUIA 3LOXA 1W11U 4CR5A 4NA7A 1MCVA 2ZU5A 1XUHA 1GBAA 4IN2A 4OS6A 2W7UA 4JZFH 1Y3XA 1ELBA 3L33A 2HVXA 3UOPA 2XBWA 4X6MA 3TU7H 4DG4A 3KQDA 1UVPA 4CBNA 2ZFTA 3SV6A 1E38B 2EEKA 2BXTH 1AE8H 2CHAB 4YESB 1TQ7B 2CV3A 4BXSA 2VIPA 1KY9A 1V2MT 2ALPA 2VH6A 4J2YB 1FUJA 1NFWA 3GCTG 4MLFB 1GMHF 1C5UA 1KSNA 3KHVA 3SORA 1FPHH 4AFZA 2FI3E 3I78A 1BOQA 1DLEA 5EPNA 3N7OA 2FIRH 1QB9A 5E2PA 3CP7A 5HXFA 3LC3A 5FHTA 4MTBA 3S9AA 4WJG2 5HYOA 1CT2E 1RIWB 1WAYB 1DSTA 3RXJA 1XVOA 3RXTA 1FV9A 3S0NA 2VWMA 2HNTF 3VXEH 5DP5A 1ZMNA 2J94A 2RG3A 3GCHC 3LPRA 2BDHA 1O5EH 1DXPA 3H7OA 3SQEE 5C1UA 1O2UA 1Z71A 4Z0KA 1O2WA 3ZVBA 2QAAA 1QY6A 2FLBH 3EE0B 4AYYB 1HAXB 4LZ1H 2ZGJA 2OC8A 1OKXA 2B0FA 1CGJE 1GI6A 1W2KH 5GIBA 3QN7A 4AORA 4IW4E 2ZFPH 1GHAF 1UVOA 2Y6TA 3Q77A 1EAXA 1GCTC 1LVMA 3RXCA 4X8SH 1GBKA 5F6MA 1SQOA 1GG6B 1LVBA 3PMAB 4Y8YA 4X2XA 2NU4E 4GAWA 1HAVB 4UD9H 3MH7A 4B75A 1RTKA 4JYTA 5FCKA 3GOVB 1ETTH 1WYKA 1A1RA 3A84A 2QXJA 3TIUA 4JZDH 2J4IA 3BTKE 1SOZA 2UWPA 1TRYA 3GISB 3M37A 1X7AC 4MQAA 2OC7A 3FZZA 1NRSH 1Q3XA 1B7XB 1PPFE 4MNXA 2EC9H 3H7TA 1CHOG 1HUTH 4J1YA 4FUDA 2GT8A 2ZDVH 4O3UA 3SHAH 2H1UA 4FU7A 3PTNA 1AKSA 1HAZB 4X1QU 1W0YH 4XFQA 3UNQA 3LGTA 1Y3YA 3QO6A 2C90B 2Q6FA 3A7TA 2ZU3A 3BIUH 2G52A 2QF0A 5DP6A 3EGKH 3PM3A 5IDKA 1K9OE 1PPGE 1HRTH 1MUEB 2ILNA 2AGEX 1SGFA 3RU4T 2FS8A 1O3HA 3MTYA 1T8MA 1SGIB 4UFFH 1Z8RA 2ZI2H 1EQ9A 2GX4A 3P70B 1UK3A 3HKIB 1YPHE 1DLKB 2VIOA 4CH8B 1KTSB 4YT7H 2J34A 3F9HA 4PROA 5A0CA 1DUAA 3ITIA 2VB0A 3Q3YA 4OS4A 3SV2H 2A7HA 4Y76A 3GDUA 4NG9H 3UR6A 1GBEA 1ESAA 1P01A 2F9BH 1XUKA 5ABWA 1AGJA 2BD3A 2GGVB 1DE7H 3RLWH 2D26C 1HIAA 1CSOE 5JBBS 2AERH 3MHWU 3ZZ4A 5C1XA 4MG3A 4IS5A 2ZWLH 1ZSJA 1MTNB 2HWLB 5E0GA 3HGPA 4X1SU 1P3EA 1AI8H 2F91A 3ATIA 3LKWA 3M5OA 1V2RT 5F8XA 3DA9B 1E35B 1O2PA 2W7SA 2AH4X 1EB1H 4R0IA 1L1GA 2B5TB 2ANMH 4Q80A 2PR3A 5PTPA 1TX6A 1UTJA 3FP6E 2HGTH 1C5QA 3URDA 1O3PB 2XBVA 4Y8ZA 3SU0A 2RA0A 2G00A 1B0FA 3E8LA 1F92A 5DO4H 1DWCH 3VXFH 2YNBA 5JBCS 2AEIH 1UTPA 1EZSC 5C20A 1ZRKA 3GY6A 3M7QA 4WMDA 3O8CA 3MO3A 3OSYA 5F03A 2B8OH 3BG8A 3QDZB 3ZZDA 2XTTB 1OXGA 3EA9A 3RXQA 2BZ6H 1FAXA 1AVXA 4UFEH 5JB9S 4ABDA 1TYNA 1DVAH 2HALA 1O30A 1NU9A 1MKWK 3QZRA 2GCTC 3SU3A 1TGNA 1HXFH 2ASUB 1O3IA 1CT4E 3DFLA 1EB2A 1AUTC 3NZIA 3B23B 2VWOA 3FP8E 1ZPCA 1MU6B 4UFDH 2OQ5A 1H8IH 1SGYE 1WCZA 3TH4H 1QB6A 2BOHB 2O8TA 3TNTA 3VB5A 1NY22 1A0HB 4MNWA 2VGCC 1NFXA 2FYQA 1NRNH 1C2HA 1TX7A 1EUFA 3RC5A 1LTOA 1VCQA 4WWYA 1P0SH 3CS0A 2YOLA 4O03A 1GHBF 9LPRA 4K5ZA 3LGVA 1PPCE 3LC5A 1C4U2 1QIXB 2XC4A 3ESTA 4U32A 1J9CH 3MU5A 5EG4A 1ESBA 1GJ8B 1UTNA 4XDEA 1ZYOA 4DIIH 2C3SA 4TWYA 5EQQA 2SGPE 5E2OA 1O5GH 1P9UA 3SJOA 1P09A 1BJUA 1P02A 2BVSH 1NROH 3E16B 5JPMH 1BDAA 4K1TA 2Z3CA 1F2SE 1VJAU 1SLVB 1NZQH 1A5IA 3E0PB 1WU1A 4OS5A 3TGJE 3GY5A 4XBCA 2J95A 2D8WA 5GJ4B 1O5DH 1FY4A 4K60A 1QJ1B 1SLXB 2A5IA 2BM2A 3ATWA 4X2VA 2BY8X 3A7XA 1BB0B 1TRMA 4X2WA 3IG6B 2SGQE 1Z7KA 3ZVAA 3MWIU 1AHTH 1O3EA 3BIVH 2FOBA 1QJ6B 3RMMH 2ZDKA 2FOCA 1W10U 4U01A 1P2OA 2ODYB 2ZGXH 4JK6A 3EA8A 3F9FA 4WMFA 2VJ1A 5AFZH 3U1IB 1HJAC 1PQAA 3QX5H 5JBTA 1V2OT 1IQKA 3TLOA 2VNTA 4MPWA 2LNCA 1WQSA 1SOTA 5HGGA 1LQDB 1DM4B 3TJOA 1ABIH 3T62A 1C5OH 1D6WA 5FBEA 1H4WA 1C5PA 1NFYA 1F0RA 2Y5FA 3MI4A 1K1LA 1W12U 3U8RH 4BXWA 2OCVB 1GI8B 2ZDNA 2STAE 4ISLA 3TITA 1BMNH 1O3GA 1J8AA 2BX3A 1EJMA 5DK1A 2ANYA 2BLWA 1WOFA 1O2MA 4YO9A 3U9AH 1C5VA 2BY6X 2D1JA 3W94A 3UY9A 3R0FA 3AAUA 1GHVH 4SGBE 3ZZAA 3SOSA 4ABIA 5C2ZA 1QJ7B 4JCNA 1UTKA 3GCNA 3KEEA 1ORFA 2OC1A 1O2JA 1G30B 1C5WB 1UTQA 1ELCA 1CVWH 1EP6A 2VGCB 1YPHC 2J38A 2QA9E 3RXLA 1SB1H 1SGDE 4MPVA 5AVDA 4NWLA 3MNBA 4ZHMU 1EAWA 1ZPBA 5C3NA 3FANA 1C4Y2 1E34B 1SL3A 1IQMA 3VGCB 1C1VH 1O3JA 3MNSA 2PW8H 3ZYDA 3NPSA 1TGSZ 1VITH 3RDZA 2NU2E 1IQIA 2A4QA 1AU8A 3UWJH 4O3TA 2BXUH 4ZKNU 1ZPZA 1DSUA 4HI3A 3P92A 1C2EA 2ZPQA 1C5SA 1T7CA 1EPTC 1KYNA 3MH5A 1TB6H 3HK3B 2TBSA 3DUXH 1L1NA 1G32B 4BAQB 6CHAC 3ZZ3A 1V2TT 4GHTA 4FVDA 2ZHQH 1V2NT 1C2GA 3NK8A 1QNJA 1MTWA 3LH3A 2WYGA 3SUGA 5ESBA 1NO9H 3E3TA 4INKA 1C2LA 3RXVA 3FP7E 4Y79A 4R8TB 1GMDF 7GCHF 1LVYA 2Y5GA 1TA6A 4AFQA 4X0WU 2VU8E 1WQVH 3RLYH 1AVWA 1K1IA 4ABAA 4X8TH 1XX9A 1SVPA 1TAWA 4K8BA 1CE5A 1C5XB 1JXPA 5FPTA 1GI4A 1FAKH 2Z9IA 1TOMH 1NPMA 1JWTA 2FS9A 3SUFA 1KXDA 1OWKA 1WTGH 1HB0B 2OC0A 4VGCB 3GICB 3T26A 1AQ7A 3VB4A 1O2XA 2W26A 4Q7YA 3EYDA 3VFEA 1C2FA 1ZGIA 3RXSA 2XW9A 3D62A 3M3SA 1QFKH 4RSPA 2G8TA 4TWWA 3SUDA 5A8XA 3U8TH 1ZTJA 3RXKA 4DT7B 1EJAA 1SGPE 1QHRB 2CMYA 2R9PA 1IOEA