5F8TA

The crystal structure of human plasma kallikrein in complex with its peptide inhibitor pkalin-2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasma kallikrein light chain
publication title The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor pkalin-2
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8tA01
1BRCE 2TRMA 4D9RA 2ZU2A 1W0ZU 2VB0A 5SGAE 1KIGH 1SLVB 1G2MA 1AVGH 1KXBA 1X7AC 1NFWA 3NCLA 3V13A 1HAPH 1UVPA 1FIWA 4XSKU 1RXPA 5JBCS 4MQAA 1ELAA 1BTZA 2BY5X 4ABAA 3Q3XA 1DLEA 1GVZA 1YLCA 4MPVA 1AE8H 1BTYA 2LNCA 1DOJA 5HMAA 2WPIS 4AOQA 3B23B 1ABJH 2P93A 3M7UA 4YOIA 1OXGA 1YPGH 1TQ7B 4NIWA 4FUIA 1CU1A 1K9OE 1J17T 2W5EA 5J4QA 5FPSA 4Y76A 2GCHF 1MTSA 2ZU3A 1YF4A 1QQUA 1G9IE 1H8IH 2PSXA 4TWYA 4Q7YA 4AGJA 2V0BA 1QGFA 4DT7B 1C2LA 1F7ZA 1BMMH 1GBLA 1GJAB 1T7CA 2QN5T 4NG9H 4ISNA 3DUXH 2SGQE 1ETSH 5JDUB 1Z8GA 3QUMP 1NU9A 1ACBE 3A85A 3QK1A 2OP9A 2FYQA 2BXUH 1C1TA 3DFJA 1NFUA 2ZQ1A 3A8CA 3LT3A 2GGVB 1ZGIA 1HB0B 4BTIB 1AB9C 3O8DA 1WTGH 2BX3A 3IWMA 2PTNA 1XVMA 4UFDH 1GBKA 4GUXA 3GY4A 4ZHMU 3MH6A 2PUXB 1ZGVA 2XC0A 1EXFA 4A5TS 5T6FA 1EPTA 1EB2A 2QXIA 4AGKA 1ETTH 2R3UA 1C5VA 3AAUA 5EPNA 1O2VA 1GI6A 2ZFTA 2PHBA 2SGFE 3HKJB 2EI6A 3PROA 5FX6A 2J34A 3A88A 1AGJA 1S83A 1B0EA 4ZKNU 3H7TA 1K22H 4I32A 3M61U 3E1XB 1SLUB 1UTKA 3E0PB 1GHZA 1ZTKA 1N6XA 1MTVA 3SNAA 1AKSA 1QJ7B 4OS5A 1DT2A 1TNHA 5C67A 2F3CE 5F8TA 5GCHF 4LZ1H 3TGJE 2EC9H 5AHGH 2WV4A 5AFYH 3LH1A 3TITA 1FQ3A 2BY9X 1FZZA 4OS4A 2ULLA 1GI5A 4FU8A 1ZSKA 4UD9H 3SUDA 2GTBA 2J94A 2ZTYA 2KAIB 3GYMA 1DS2E 1AFQB 2I6QA 1CT0E 2WV5A 1NT1A 3MO9A 9ESTA 1O32A 1YYY1 1LHDH 3EYDA 2P3FH 3MNCA 3NWUA 1O35A 3TVJB 4X8TH 4KKDA 3OY5U 4X8UH 3CS0A 1VCQA 3UREA 1ZMLA 3SU3A 2ZPSA 2ZG0H 4GCHF 1TYNA 4B75A 2Z6BD 1QR3E 3LC5A 1T8LA 2JH5D 4HGCA 2P59A 2GMTC 1YCPK 1BQYA 1GBTA 1GI0A 1DUEA 4U2WA 3A8BA 1UVUH 4Y8XA 1P05A 2HWLB 3BG4C 1C9PA 5HGGA 3F1SB 1C5PA 1D3TB 3ZVDA 1RGQA 2J38A 2XRCA 2RA3A 1O3KA 1XX9A 2P3TB 3BTDE 1INCA 2CJIA 1O5AB 4B2BA 1Y3YA 4INLA 1TIOA 3UNRA 1O38A 1TONA 1GBDA 1A5IA 1EP6A 2D26C 2Z94A 3PV4A 1ZSLA 3PWBA 3SU0A 1B0FA 2D1JA 2A7JA 5FCKA 1CA0B 2WUBA 1THPB 4YTAA 3VXEH 2AMPA 1VITF 3RXLA 3SJOA 3P92A 3ZV8A 3H5CB 4YOJA 1ANEA 2Z3DA 3UQOA 1MU6B 1GHBF 2XWAA 4CRBA 6GCHG 1TNIA 4KELA 4NIVA 1BDAA 3T62A 1ELGA 4CHAB 2NU2E 1O2RA 1HV7A 5EQQA 3T28A 1IAUA 1AY6H 2QF0A 1UVTH 3VB5A 1W0YH 4J2YB 2ZPRA 2PKSC 1V2TT 4FVDA 1YPMH 5A8XA 2BQ6B 4OS2A 1TQ0B 1LPKB 4Y0YE 2G5NA 2ZPQA 4A92A 1A0LA 1HBTH 5A8ZA 2I6SA 1ELBA 2F9NA 1CBWB 1O3EA 3MU8A 3PO1C 1FIZA 1C2GA 2QY0B 1MUEB 2M5TA 2BLOA 5B6OA 1A61H 4THNH 3U8TH 2FS8A 1YBWA 1G32B 1TALA 4VGCC 1PPEE 2ZU4A 1S0RA 3TGIE 3LJJA 3NXPA 4DG4A 2ZFPH 4X6OA 3BTWE 1QB6A 1VCPA 1SGFA 6CHAB 1C4U2 2V3OH 5ABWA 1TGSZ 2J92A 2UUJB 1HXEH 2ZHEH 2ZEBA 4ZH8A 1RS0A 2OTVA 2R2WU 1UHBA 4NSVA 3W94A 1C4Y2 1O5BB 2VH0A 2ZGJA 4NGAH 1G3BA 2H5DA 3SV8A 3A8DA 1GJ9B 1WSSH 1PQ8A 1H9LB 3GCHC 5EXLA 2ZA5A 1GPZA 4X1NU 2AEIH 2P8OC 2A32A 2CHAC 1TA6A 1QBOA 1XXFA 2G55A 4K1SA 4YT6H 1C1WH 3FP6E 2ZDKA 3A7TA 4PROA 2OBQA 3A89A 5HM9A 2TGDA 4WF8A 4AFZA 1FN6A 2XC4A 1QURH 3TJNA 3EAJA 1ZTJA 3RXQA 1T31A 1SQOA 3OX7U 3IITA 1QY6A 2Y5HA 1DY8A 1L0ZA 2Q6DA 1ESTA 3RLWH 4DW2U 3VGCB 2FTMA 1RJXB 4D7GA 2A2XH 1MBQA 4OS1A 1L4DA 1Z1IA 4ZXXH 2FZZA 3QZRA 3SJ9A 1D6RA 4Z6AH 4UFGH 3PM3A 2W7SA 1WV7H 1O3PB 3MNXA 3SNCA 4NIXA 2BY6X 3LC3A 1UTLM 4XFQA 1FLEE 4AG2A 5F6MA 3D65E 4I31A 2GZ7A 3ODDA 1T8MA 1YC0A 1O37A 1RD3B 1TBRH 1YPEH 3QTOH 4WJG2 3ZZAA 2XTTB 1C1QA 4JZIA 1EQ9A 2Y81A 1UTPA 5L6NH 1EJMA 3QGJA 2A4RA 4GPGA 1LO6A 1HAXB 1SBWA 2O8LA 4AB8A 4KGAA 1DLKB 2HNTE 4I8JA 4B2AA 4AB9A 2FODA 2SNWA 1HGTH 5A8YA 2ZZUH 1CA8B 8ESTE 3GY7A 3V3MA 1O3GA 1MCTA 3SV7A 2BLWA 1ZOMA 3URDA 1C5QA 2HVXA 4TPYA 1KDQB 1HXFH 4JYTA 1BUIA 1C5LH 3Q3YA 1TGBA 1QTFA 1RRKA 3VFEA 2A1DB 3RXEA 1BTPA 1NC6A 1O2XA 5JPMH 2ZC9H 2WPJS 1JXPA 3SU2A 2WYJA 2BD3A 5DP4A 1J9CH 1F5KU 2R3YA 1TX6A 3HGPA 2PTCE 1IQNA 1MQ5A 1TNJA 2GP9B 1GGDB 3B8JA 5EPYA 1QL7A 2WPMS 3I29A 4GAWA 1JMOH 3T29A 4NCYA 3M5NA 3BTGE 1AN1E 5F8ZA 4UFEH 1RTKA 3TK5A 2Z9IA 1GMHG 2TGPZ 1HJAC 1HYLA 1F0RA 1O33A 2Z7FE 1ELFA 3EA7A 2R2MB 4WXIA 2Y80A 2ZKSA 4UDWH 2BZAA 1Y3XA 3GCOA 1HAIH 1O3IA 1AU8A 1C5YB 2R0KA 3SI4H 5L2ZH 2V3HH 1HUTH 1GJCB 1O2GH 2Y7XA 1BBRE 3RXOA 3MU4A 3ATIA 4NWKA 1NTPA 1S0QA 1S85A 2XW9A 1C1PA 1GJ6A 2ZNKH 3BTME 3QZQA 2VIDA 1DITH 3ZZDA 1THRH 1FPHH 3QDZB 4WXVA 4YO9A 1V3XA 3ATKA 1PPZA 1O31A 2QXJA 1ANDA 4OS6A 5DP3A 1HAGE 2ZFQH 1HNEE 1O2ZA 1EAXA 1O3JA 2BY7X 3I78A 1BTXA 3ZV9A 1QCPA 1F0SA 5E8EH 3E16B 2BOHB 1A7SA 4U01A 3H7OA 5F03A 1WAYB 1TRNA 4MPUA 1IQIA 1GJ7B 2UUFB 3VB6A 4X2XA 1OP8A 1O2MA 6ESTA 2P3UB 3PTBA 4CRDA 3M5LA 2JH0D 3BG8A 1P0SH 2XBXA 1EATA 3UR9A 5EW1H 4TPIZ 2YNBA 3LDXH 4B73A 1P2IA 4I8LA 4A1TA 1Y5BT 2STBE 2XCNA 1A3EH 1SGQE 3EQ0H 2XNIA 1K1MA 2AIQA 1XKAC 2A31A 1O36A 4YT7H 2VGCB 2ODPA 1GJDB 1O2PA 2BZ6H 1Q2WA 2NWNA 1BBRK 3TK6A 4K3JA 4IMQA 2BVSH 4INKA 2ODYB 2HPPH 1UJ1A 3T25A 8GCHG 1GDUA 5LGOA 2OINA 2ZFSA 3T26A 3UY9A 1UCYE 3BTQE 1IQHA 1KXAA 5IYTA 3QLPH 1C2IA 2HRVA 1UTQA 3M5OA 3QO6A 2B7DH 2A7CA 2XWBI 4B1TA 1NPMA 3BSQA 4X1QU 2QAAA 5L2YH 1GCDA 1V2PT 3UR6A 3BTFE 1ARCA 1UK3A 2OD3B 4X0WU 3VB7A 1K2I1 1F92A 2WPHS 3HK6B 5J4SA 1AFQC 1O2TA 2BD4A 3SGBE 2FOHA 2BTCE 1W7XH 4NA9H 1Z6EA 1O3MA 1THSH 1WBGB 4E06H 2IOTA 4K8BA 1GBFA 3A7XA 2FESH 2FDAA 3FP7E 3AAVA 2Y5FA 3KNXA 1DFPA 2VU8E 2STAE 3QTVH 3SBKA 1GHVH 1P9UA 1SC8U 1GBHA 2BYAX 3E90B 3TU7H 7GCHG 1O2QA 3KQEA 2ZHFH 1W3CA 1A4WH 1ZMNA 1ZPZA 1TX7A 1IQJA 2ESTE 1Y5AT 4A6LA 1NESE 3BIUH 1AD8H 2J2UA 2NU1E 1QIXB 1Z1JA 1OYTH 1SQTA 1XUJA 3SJ8A 3SJKA 1BRAA 4J1YA 1V2VT 1JWTA 4MTBA 4NA8A 3ZVGA 3GYLB 3TH2H 4F4OC 5T6GA 2BLVA 4ZXYH 4ZHLU 2FI3E 1P09A 3UFAA 1JBUH 1TA2A 2ANMH 1OP2A 1GMHF 2PGQB 5JYIA 1EZUC 1O3LA 2FX6A 3PYHA 1DSUA 1QRXA 2QA9E 3RXDA 3C27B 2UWLA 1LQDB 4A1VA 2FI5E 3RDZA 1L1JA 3UTUH 1BRBE 2SGDE 3NZIA 1Z8RA 3RXGA 1CA0C 4FUCA 2BVRH 1GJ5H 1C5SA 4RN6A 1SPJA 3VB4A 1UCYK 1Y8TA 1EASA 2ZGXH 3SHAH 1MTNB 1O5GH 1DWDH 3LKWA 3FZZA 1MH0A 2RG3A 1GJ4H 2VINA 2EI7A 1QFKH 2HALA 1LVYA 2JKHA 1K28D 4CHAC 2VIVA 3DA9B 1EJAA 1P3CA 1F0UA 1OYQA 2YNAA 1T8OA 1WU1A 3LIWA 3JZ2B 1PPHE 1D3PB 1TBQH 2DE9A 2HOBA 2GDDA 5K7RA 1G2LA 3BV9B 4IBLH 1G3EA 3RMNH 3HK3B 2FO9A 3PLPA 3MOCA 1VGCB 2A4GA 1CBWC 1G3CA 1PQ7A 2SGAA 3VXFH 1VITH 7ESTE 4CRAA 1ZZZA 5EW2H 1DWCH 1AKSB 2ZTZA 4NA7A 2BHGA 2BDAA 5FXLA 1FI8A 1M9UA 2NU4E 1C1UH 3ZZ7A 5FPYA 1DXPA 2FOEA 2J4IA 1L2EA 1XKBC 1SQAA 3STJA 4BXSA 3UOUA 2ZQ2A 6CHAC 4HFPB 1XMNB 1NU7B 1O3AA 1MAXA 4TY6A 1CHGA 1C5NH 1C5MD 3TPIZ 1W10U 2AGEX 4FUHA 4WVPE 1C5TA 1P12E 1HCGA 1YPHE 2H1UA 2BD2A 2JETB 4KP0A 1AUTC 3GY6A 1GVKB 3GY5A 4BAMB 2PKAA 1DXWA 1GI1A 5GDSH 3SU4A 1TRMA 4MPWA 2PV9B 2Q1JA 2C93B 4YLUA 2AMDA 1OKXA 3LGYA 4BAHB 1HAYB 1P11E 4FVBA 4D76A 4DVAU 2EA3A 1BITA 1D9IA 1V2WT 1AQ7A 3KHVA 2ANKH 2FM2A 3PLKA 1N6YA 4OS7A 4U30A 2FWWA 1OWEA 1RTFB 2DE8A 2QYIA 1GJ8B 1J14A 3OY6U 8GCHF 1LHGH 1IQMA 1AWFH 4CRFA 1KLTA 2A5IA 4AFQA 1YCPH 5C5NA 1TGTA 1AZZA 5EGMA 1GMDG 2ZDVH 3A7YA 4UFFH 3VGCC 3BIVH 2ASUB 3TLOA 5CMXH 1GBJA 4MNYA 5DP6A 4I8GA 1FV9A 2Z9LA 4ASHA 5C20A 3BTHE 3RM2H 1LVBA 3RXCA 2VWLA 3RC4A 2AFQB 1J16A 1GHAF 1GMCG 1GI3A 3UIRA 1D6WA 1GL0E 1BCUH 1O3DA 2FS9A 1O2YA 1HFDA 1CHOF 3A80A 1G37A 4I8KA 1E37B 3SI3H 5JB8S 2QXHA 1BTHH 4ABDA 8KME2 1F0TA 4O3UA 1EUFA 2G00A 4YZUA 5GXPA 1E34B 1XM1A 4Y6DA 1H9HE 1SFIA 5TJXA 1Z6JH 7GCHF 3LU9B 5K0HA 2PR3A 1E36B 1XXDA 2ZGCA 1OS8A 2BVXH 3P8FA 1YCPM 1AMHA 3K6ZA 1TPSA 1C4V2 4DIHH 2A4QA 1JIMA 1NRQH 1TB6H 3GOVB 2K1QA 1BHXB 4UE7H 2YOLA 1AVXA 1O30A 2SFAA 3MTYA 1S6HA 4OGXA 3DFLA 1P9SA 2AIPA 3M7TA 4DGJA 1QHRB 1TPPA 3SV2H 3UWJH 4Y8YA 1EKBB 1TX8A 1O5FH 1AE5A 2C8ZB 2GT7A 2G81E 4ABGA 5BRRE 2PWXA 2RCEA 1Y5UT 1ZHRA 2CF9H 3ZYDA 1WCZA 4IN2A 7LPRA 1SB1H 1LPGB 1VR1H 4X6MA 5FX5A 1GGDC 2BD9A 1C1OA 3PMAB 3ZVBA 3MO3A 5A0BA 1XUFA 4ISIH 2ZGHA 1H1BA 3A84A 3RXSA 1BA8B 2Z9GA 4RKOB 3U1IB 4E05H 5C1UA 2PUQH 4FUBA 4XBCA 1S81A 3RM0H 1W7GH 2UUYA 1MD8A 3KQCA 5A2MH 3LGTA 4NFEA 1ESBA 4GHTA 2F9OA 1YLDA 1RIWB 4O03A 4BOHA 4ESTE 1ZLRA 3RXBA 4HI3A 4Y71A 4ABEA 2FOGA 2PSYA 2AGIX 1MQ6A 3K6YA 2BD8A 3MH5A 1BB0B 1T8NA 2ZDNA 1HDTH 3I77A 2ZIQH 1ZHMA 1H8DH 2A2QH 3SGAE 1GJBB 3T5FH 2W3KA 4NIYA 3M5MA 2H9EH 2FOBA 4Q2KA 1SR5C 4RKJB 4UONA 2TGTA 3PMJA 1DE7H 1EAUA 4XBBA 1MKXK 1MMJN 1OWJA 2NU0E 1TE0A 1BRUP 1V2NT 2FOMB 4B2CA 1HLTH 4Y0ZE 4YM9A 1FAXA 4D7FA 1BJVA 2FOCA 4Y11E 1S82A 5FBIA 3P6ZB 4A7IB 2F83A 4I33A 2D8WA 5GPIB 3TH4H 2HGTH 1GCTB 1WTHD 4BANB 1P2MA 4AYVB 1QA7A 2B5TB 4CR9A 3S0NA 1FY4A 4AORA 3ZZ4A 1C9TA 5HM2A 2XBWA 3Q76A 1LQEA 4MLFB 4D8NA 4E7NA 1SHYA 2NU3E 3SUEA 2CF8H 3PWCA 3L33A 1DY9A 3AW0A 4QT8C 1AZ8A 3MH7A 2RA0A 4DURA 5IDKA 3GDVA 3FAOA 1HAHH 3BF6H 1A0JA 3KIDU 2GT8A 1BZXE 3Q00A 1MAYA 1SGYE 1PYTD 3UPEA 1E38B 2ZCKP 4ZROA 1P04A 4B74A 1SMFE 2ODQA 2Y7ZA 1AFEH 1A0HB 1CVWH 4YOGA 1QB9A 4WWYA 5AFZH 3EA8A 3M3TA 4E7RG 1BIOA 1ETRH 3VB3A 1HJ8A 2PFEA 1ELTA 1FN8A 1C2HA 1GMDF 4GVUA 4X8VH 1BOQA 2H6MA 1NM6A 4K8YA 2IJOB 1PPBH 3M7QA 2VGCC 2ZDMA 3G01A 2GCTB 1V6DA 3ZZ6A 5C1XA 3RMMH 1K1OA 1UO6A 2BB4A 2G51A 1C1RA 1B7XB 1PFXC 3MFJA 3ZZBA 1GDNA 4K2YA 2PLXA 2SGPE 3LGUA 3F68H 3PLBA 5DGJA 4NWLA 1NFYA 1YPLH 1GHWH 3EE0B 2FLRH 2FPZA 3BTEE 2FOFA 3BTTE 4LK4A 2VWOA 1Q3XA 1EJNA 1P2NA 3JZ1B 6GCHF 3O8CA 2QF3A 3F9FA 3M3SA 2CV3A 3ESTA 4I7YH 4K1TA 3L3TA 1J8AA 3ZZ9A 1O2OA 1N8OB 5EXNA 2XCFA 3QWCH 2CXVA 1O3OA 1O2UA 3LGWA 2ZP0H 5AF9H 1S84A 5DPAA 3LONA 5EQSA 2G4UA 2G52A 1QA0A 3BEFB 2TIOA 1WQSA 2VIWA 1LDTT 2GCHG 3SU1A 1CGJE 4ZKOU 4R8TB 1OOKB 3PMHB 4JCNA 1YPJH 4AG1A 3TJUA 3LOXA 1CO7E 4DY7B 1Y3UA 5HXFA 2QCYA 2O9QA 1C2MA 1ID5H 2BDIA 2GDEH 2OLGA 3Q3KA 3TJVA 3DT0H 3P70B 1S5SA 1KLJH 2QC2A 2R0LA 1C1SA 1TRYA 3SNEA 4JYUH 1C2KA 3RU4T 1YP9A 2ANWA 1TABE 1ZR0A 3MO6A 4X2YA 1EOLA 2GX4A 4ABJA 3RU4E 4ZMAH 5FCRA 2G4TA 1LCYA 4K5ZA 1YPKH 1GL1A 3EDXB 3SQHE 1OX1A 1O2WA 1AVWA 1GI2A 1CT2E 1GI8B 1Z8IB 1MTNC 1TGNA 2ZWLH 4ZUHA 4CH8B 1FONA 5BPEA 1C5XB 1SFQB 1NROH 2HPQH 5PTPA 1O2LA 1FNIA 3AVZA 2H9HA 1ZSJA 4JZ1A 1ABIH 2WYGA 2THFB 4JZFH 4OGYA 1EPTC 3K65B 3LJOA 3GCNA 1UK4A 3GY8A 2PGBB 1FUJA 5E0JA 1GBCA 1XVOA 3STIA 3Q77A 1V2ST 5TCCA 3TNSA 4BTTB 1P03A 2XC5A 1VGCC 3M37A 4MNXA 1HAVA 3TIUA 1O5CB 2ZGBH 1N1LA 2OBOA 1A46H 1DVAH 3A86A 5EU8A 2BDBA 1HIAB 2P95A 1AO5A 1BBRH 3RC6A 1KXDA 2OC1A 2Y5GA 2JH6D 3ATMA 1RFNA 2FTLE 3ZVEA 3FP8E 1P8VC 1A5GH 1C5WB 1UVOA 2V6NA 1K1JA 4GCHG 4DOQA 1BMLA 3P95A 2W26A 1MZAA 1O34A 4Y10E 2C8WB 1GI7B 5CHAC 2W7UA 1J15A 3A7VA 2W3IA 1V2UT 3V12A 3OTJE 1T4VH 2JETC 2ZDAH 1P01A 1ELCA 1EB1H 1AHTH 1P02A 4LOYH 3RMLH 3RXTA 1E0FD 4DCDA 1W2KH 5E2OA 1ZJDA 1ZRBA 1MKWK 2FLBH 2CN0H 1SGCA 3HPTB 3ATWA 1SOTA 1FY1A 1P2QA 5FBEA 2GKVE 3RXFA 3MI4A 4FXGH 1O3BA 4O3TA 1EZSC 1VITG 2B8OH 1YM0A 2V35A 4HTCH 4JK5A 3RXVA 3S9CA 3S69A 1W12U 2AYWA 5FHTA 3A8AA 1HJ9A 4FUEA 2GZ9A 1FPCH 3SV6A 3DHKH 4Y7AA 1GHBG 5E2PA 1QBNA 2F9BH 4XE4A 3R3GB 2ALVA 5C2ZA 1TFXA 3KEEA 2ILNA 2OQ5A 1TMBH 2LPRA 5DKMA 4D9QA 1DWEH 1A1RA 3NUMA 3OU0A 2BMGB 1L1GA 1IOEA 2J95A 1G36A 2BDHA 1OWHA 4IC6A 1BMAA 1ZHPA 2QV1A 1IQEA 1V2RT 3F6UH 1P2KA 4H42U 1DPOA 4AFSA 1PPFE 3MWIU 2XXLA 1O2HA 3VEQB 1XUHA 3P8OA 5G4BA 3TH3H 4CH2B 3OYPA 4MPXA 2OC7A 1S6FA 2ZTXA 3RXKA 3V7TA 5DP7A 3GISB 1SGPE 4I8HA 1UCYH 1GBBA 3PMBB 1TLDA 1IHTH 3MHWU 3T2NA 1FXYA 1GHXH 4IGDA 3S7KB 1K1IA 3K9XB 1W8BH 2WUCA 1KSNA 3MU1A 5C1YA 1P57B 3UNQA 3UUZA 3NKKA 3SHCH 2Q6GA 1EPTB 2RDLA 3ODFA 6LPRA 3QGNB 1PPGE 1A2CH 1SGIB 1ZTLA 3D23A 3SOSA 2AERH 3NPSA 9LPRA 1CE5A 4Y8ZA 4IS5A 1ARBA 1SGTA 3TGKE 3A81A 3ZZCA 1C2JA 1V2MT 2ZI2H 3LGIA 4UEHH 3RMOH 1H9IE 1EP5A 1TWXB 1G3DA 1GI4A 2ZHWH 5I25A 1GI9B 5E0HA 3RP2A 1C2EA 5LPEA 3FFGA 5AVDA 4BAOB 1LVMA 2A5KA 1O3FA 4H6TA 3M35A 5T3HA 2EEKA 3U8RH 3UNSA 4NSYA 2QIQA 2AGGX 1GHYH 1WQVH 4MDSA 1O2KA 1DANH 5CHAB 5DK1A 2QGRA 3E0NB 5GIBA 1TMUH 1GBAA 1Y59T 2Q6FA 1RIWC 4ZKRU 3QX5H 3RXIA 2WINI 1GG6C 2ANYA 2PKAB 2GVFA 3RXRA 1IHSH 2OCVB 5EG4A 2D2DA 3MYWA 1GBMA 4YLQH 4GSOA 3SNDA 2UWOA 1DDJA 4JZEH 4IMZA 4MNWA 1PPCE 1GDQA 2A45B 4ABHA 2KAIA 1PJPA 1V2QT 5DP9A 2H9TH 4CBNA 3BEIB 1QNJA 4H4FA 3HATH 1CGIE 4Z0KA 1LTOA 3SUFA 1OSSA 3ITIA 4TWWA 4AFUA 2XBYA 4IN1A 3O8BA 5I46H 1T4UH 3EGKH 1GBEA 4K69A 1GCTC 4K1EA 3E91A 3U1JB 3GICB 4H6SB 1WOFA 3SORA 1AUJA 4FUDA 1XUGA 4CRCA 1SSXA 3HKIB 3NK8A 4Q7ZA 4O97A 1ZPBA 4JK6A 3VPKA 3GDUA 4X1PU 3QN7A 1QRWA 5LPRA 1SLXB 4GHQA 1B5GH 4INHA 3CP7A 4FUFA 5LPFA 2FEQH 2P94A 2ZFFH 2VIPA 4X8SH 1IQFA 4IW4E 4LXBH 3A7WA 4ZAEA 2H2ZA 4CRGA 1YKTA 3F9HA 1UVSH 1YGCH 3ATLA 1OWIA 1NZQH 1TOMH 1KXFA 2HNTC 3SU5A 1MTUA 2P16A 2TBSA 1NRSH 2FYRA 3KQDA 5DO4H 2GV7A 1FY8E 1P2OA 1HPGA 1SVPA 4JMYA 1Z8JB 2G8TA 5ESBA 3UWIA 2GZ8A 3ZVAA 1SLWB 3U8OH 2BY8X 4U32A 1AB9B 4KTUA 4ISLA 1LKBA 1LHCH 2GCTC 1FAKH 4HZHA 2BDCA 2ZU1A 2CMYA 5T6DA 1MCVA 2EI8A 2FMJA 2FOAA 2SNVA 1DUAA 2FIRH 1NN6A 2CGAA 4O9VA 4X1SU 1ELDE 5A0AE 2A5AA 1QJ1B 1C1MA 4CBOA 4NZQA 3W95A 1MD7A 1OWKA 3UQVA 1UK2A 3L6PA 3M36A 2C4FH 1C2FA 1UHBB 3MU5A 3F9EA 2UUKB 3MH4A 3UOPA 1SGEE 1PYTC 2BX4A 1GWAA 4F49A 2AMQA 1FMGA 4ABFA 1BMNH 3BN9A 2A7HA 3GDSA 1N8OC 1Z71A 1GG6B 2OQUA 1SGNE 2O8UA 4ABIA 3RXPA 1Y3VA 1K21H 1TPOA 4WMFA 1SGFG 5C3NA 2QXGA 1TMTH 2ZHDA 3RXHA 1EAIA 5A09A 1C5OH 4FU9A 1O0DH 1UTOA 5JBTA 1HAOH 1C5ZB 4TYDA 4WH6A 2Y82A 2A4OA 3E8LA 1MU8B 2BDYA 2PW8H 2J9NA 1CSOE 3P8GA 1XUIA 1MTWA 2VVCA 2VJ1A 3B9FH 4BAQB 1EX3A 4YESB 1TBZH 1KY9A 4RSPA 1ELEE 4B71A 1FJSA 5EQRA 2ZU5A 1PQ5A 1EZQA 1MKXH 2SGEE 3SO3A 1AIXH 1QRZA 2GMTB 1NRRH 1EOJA 4BTUB 4XDEA 3GCTG 1D3QB 3SGQE 2BD5A 3OSYA 2OXSA 5F8XA 1F2SE 3BG4B 3FANA 4ZKSU 3A7ZA 1QQ4A 3C1KA 1U6QA 1VCWA 1QBVH 2VVUA 1TOCB 1BTUA 2C8XB 5TCAA 3RXAA 1TNGA 5EXMA 3E6PH 2G5VA 3RXJA 4ISHH 1LVOA 4WH8A 1T32A 1WYKA 1QJ6B 2BD7A 5DP5A 3MU0A 1TNKA 4X6PA 4MVNA 5H4IB 4AX9H 1K1NA 3U98H 1P10A 1SOZA 2Z9JA 3SZNA 1A3BH 2VVVA 4TY7A 3ELAH 2DUCA 5EOKA 2F9VA 2GV6A 2O8TA 5E0GA 1KTSB 1DICA 1KXEA 4FU7A 3A83A 1SGDE 1C1VH 3S9AA 2FI4E 5JBBS 2C90B 3ZVCA 1BT7A 3MNBA 2IPHA 3TJOA 4NFFA 1ZJKA 1AWHB 1ZMJA 1ZYOA 4FUGA 3KF2A 1JOUB 3LPRA 1P06A 3GY3A 1OP0A 5GJ4B 1TPAE 5EODA 2H5CA 1LPZB 3SUGA 5DP8A 1IQLA 2ZCLP 2F91A 2PKSB 3M3VA 2TPIZ 2IN2A 1GMCF 1UTNA 1RTLA 1L4ZA 1V2LT 2C3SA 1XUKA 1IQGA 4X2VA 4AN7A 5DG6A 4BXWA 2HLCA 2VWNA 1K1LA 1KDQA 4X2WA 1CGHA 2WPLS 3PO1B 3SJIA 1O2JA 1OPHB 3S9BA 1DSTA 1O5EH 4ABBA 1AI8H 1C5RA 2F9UA 3MNSA 4R0IA 3SV9A 4LZ4B 2O8WA 3RU4D 2VWMA 3D62A 4Y79A 1SI5H 4VGCB 2Y6TA 1SHHB 3FVFB 4K60A 5DJ7A 3GY2A 1MBMA 4WMEA 4Q80A 3SNBA 8LPRA 3O8RA 3BEUA 3IG6B 3HGNA 5FAHA 2Z3CA 1ZRKA 1GVLA 2OUAA 1VZQH 1UMAH 5GWZA 1TAWA 2XBVA 2ZECA 1Q31A 1DWBH 4ZHAA 2GD4B 1L1NA 1W14U 3URCA 4MG3A 1HAZB 4AYYB 1BJUA 4ISOA 2O8MA 1SG8B 3WY8A 3K2UA 3N7OA 3GCHB 4M7GA 4Y7BA 4B76A 3MMGA 1W11U 4FUJA 1K1PA 2BQ7B 5LH8A 1P2JA 1C1NA 2P8OB 1UTMA 1C2DA 4CR5A 1NRNH 2ZF0H 3RLYH 3RXUA 1BHXF 3KQBA 2CHAB 1VJAU 3ZZ3A 3SW2B 3R0FA 3RUOA 1O3CA 3A87A 3SU6A 4GLYA 3TNTA 2BM2A 5FPTA 3U69H 1V2JT 5JBAS 3KGPA 4IC5A 1SL3A 4SGBE 1NY22 1V2OT 1FDPA 4KTCA 1ANBA 1F5LA 1QB1A 3KL6A 1MZDA 1DX5M 3E3TA 5C5OA 1JIRA 2BDGA 1WUNH 2FXRA 4JZDH 2Z9KA 1JRTA 2AS9A 1UTJA 5A0CA 1O2SA 1O2NA 4BNRA 2Z3EA 1KLIH 3EA9A 1CQQA 1FY3A 2VIOA 3D49H 3CENA 1KTTB 1P3EA 3V0XA 4Q7XA 5ETXA 3DD2H 5HYOA 5GCHG 3PTNA 1DM4B 1JRSA 7KMEH 5JB9S 1E35B 3AASA 3SN8A 4JYVH 1LKAA 2VNTA 2XYAA 4XOJA 1QL9A 3ZYEA 1G30B 1LHEH 1W13U 1O5DH 2VH6A 1BTWA 3KN2A 3BTKE 1D4PB 2B9LA 2ZHQH 4DIIH 2BXTH 4DJZB 1NS3A 1HAVB 5L30H 1O3NA 3ZZ8A 1LHFH 1KXCA 2FP7B 3S7HB 1LMWB 1QL8A 3GCTF 3TK9A 3LGVA 1H4WA 4BAKB 4A1XA 1HRTH 3RXMA 1NO9H 4CREA 3FZDA 3T27A 2BOKA 1Z7KA 3SQEE 3ENSB 1ESAA 1GBIA 1NRPH 2B0FA 2BQWB 5ESTE 1SGRE 1OWDA 1CT4E 4WY3A 1VJ9U 1KYNA 3F9GA 1F5RA 2A0QB 3P17H 3PB1E 2WPKS 3CS7A 1O2IA 2ALPA 1HIAA 1ELVA 1TGCA 1YPHC 1O3HA 1TNLA 1ORFA 4KTSA 2BLQA 3RC5A 2UWPA 1NFXA 2F9PA 3ZZ5A 1O39A 1EZXC 2ZCHP 3A82A 4XBDA 4AZ2B 2OC0A 5CE1A 2OC8A 4MNVA 4WMDA 2ZFRH 1HJAB 2AH4X 4X6NA 1EAWA 1ZPCA 1D3DB 1GHAG 3U9AH 1V2KT 2HNTF 4NZLA 1MKWH 1IQKA 1FY5A 1PQAA 2C8YB 3LH3A 2FX4A 1CHOG 4X1RU 1ANCA 1Y3WA 2TGAA 3AW1A 1A5HA 3KCGH 2R9PA 4SGAE 2VIQA 1C5UA 2ZDLA 2ZO3H 3ZVFA 3P8NA
chains in the Genus database with same CATH superfamily
1BRCE 2TRMA 4D9RA 2ZU2A 1W0ZU 2VB0A 5SGAE 1KIGH 1SLVB 1G2MA 1AVGH 1KXBA 1X7AC 1NFWA 3NCLA 3V13A 1HAPH 1UVPA 1FIWA 4XSKU 1RXPA 2M2AA 5JBCS 3WWBA 4MQAA 1ELAA 1BTZA 2BY5X 4ABAA 3Q3XA 1DLEA 1GVZA 1YLCA 4MPVA 1AE8H 1BTYA 2LNCA 1DOJA 5HMAA 2WPIS 4AOQA 3B23B 1ABJH 2P93A 3M7UA 4YOIA 1OXGA 1YPGH 1TQ7B 4NIWA 4FUIA 1CU1A 1K9OE 1J17T 2W5EA 1H8ED 5J4QA 5FPSA 4Y76A 2GCHF 1MTSA 2ZU3A 1YF4A 1QQUA 1G9IE 1H8IH 2PSXA 4TWYA 4Q7YA 4AGJA 2V0BA 3DSOA 1QGFA 4DT7B 1C2LA 1F7ZA 1BMMH 1GBLA 1GJAB 1T7CA 2V7QD 2QN5T 4NG9H 4ISNA 3DUXH 2SGQE 1ETSH 5JDUB 1Z8GA 3QUMP 1NU9A 1ACBE 3A85A 3QK1A 2OP9A 5C0TA 2FYQA 2BXUH 1C1TA 3DFJA 1NFUA 2ZQ1A 3A8CA 3LT3A 2GGVB 1ZGIA 1HB0B 4BTIB 1AB9C 2HLDD 3O8DA 1WTGH 2BX3A 3IWMA 2PTNA 1XVMA 4UFDH 1GBKA 4GUXA 3GY4A 4ZHMU 3MH6A 1MABB 2PUXB 1ZGVA 2XC0A 1EXFA 4A5TS 5T6FA 3FN8A 1EPTA 1EB2A 2QXIA 4AGKA 1OHHD 2WSSD 1ETTH 2R3UA 1C5VA 3AAUA 5EPNA 1O2VA 1GI6A 2ZFTA 2PHBA 2SGFE 3HKJB 2EI6A 2KZ4A 3PROA 5FX6A 2J34A 2WZQA 3A88A 1AGJA 1S83A 1B0EA 4ZKNU 3H7TA 1K22H 4I32A 3M61U 3E1XB 1SLUB 1UTKA 3E0PB 1GHZA 1ZTKA 1N6XA 1MTVA 3SNAA 1AKSA 1QJ7B 4OS5A 1DT2A 1TNHA 5C67A 2F3CE 5F8TA 5GCHF 4LZ1H 3TGJE 1BMFD 2EC9H 5CHBA 5AHGH 2WV4A 5AFYH 3LH1A 3TITA 1FQ3A 2BY9X 1FZZA 4OS4A 2ULLA 1GI5A 4FU8A 1ZSKA 5EIYA 4UD9H 3SUDA 2GTBA 2J94A 2ZTYA 2KAIB 3GYMA 1DS2E 1AFQB 2I6QA 2IJD1 1CT0E 2WV5A 2EY4C 1NT1A 3MO9A 3SZEA 9ESTA 1O32A 1YYY1 1LHDH 3EYDA 2P3FH 3MNCA 3NWUA 1O35A 3TVJB 4X8TH 4KKDA 3OY5U 4X8UH 3CS0A 1VCQA 3UREA 1ZMLA 3SU3A 3FKSD 2ZPSA 2ZG0H 4GCHF 1TYNA 3UAIC 2Z6BD 4B75A 1QR3E 3LC5A 1T8LA 2JH5D 4HGCA 2P59A 2GMTC 3FO8D 1YCPK 1BQYA 1GBTA 1GI0A 1DUEA 2CK3D 4U2WA 3A8BA 1UVUH 4Y8XA 1P05A 2HWLB 3BG4C 1C9PA 5HGGA 3F1SB 1C5PA 1D3TB 3ZVDA 1RGQA 2J38A 2XRCA 2RA3A 1O3KA 1XX9A 2P3TB 3BTDE 1INCA 2CJIA 1O5AB 4B2BA 1Y3YA 4INLA 1TIOA 3UNRA 1O38A 1TONA 1GBDA 1A5IA 1EP6A 2D26C 2Z94A 3PV4A 1ZSLA 3PWBA 3SU0A 1B0FA 2D1JA 2A7JA 5FCKA 1CA0B 2WUBA 1THPB 4YTAA 3VXEH 2AMPA 1VITF 3RXLA 3SJOA 3P92A 3ZV8A 3H5CB 4YOJA 1ANEA 2Z3DA 3UQOA 1MU6B 1GHBF 2XWAA 4CRBA 6GCHG 1TNIA 4KELA 4NIVA 1BDAA 3T62A 1ELGA 4CHAB 2NU2E 1O2RA 1HV7A 1VKYA 5EQQA 3T28A 1IAUA 1AY6H 2QF0A 1UVTH 3VB5A 1W0YH 4J2YB 2ZPRA 2PKSC 1V2TT 4FVDA 1YPMH 3ZIAD 2LP6A 5A8XA 2BQ6B 4OS2A 1TQ0B 1LPKB 3DCLA 2G5NA 2ZPQA 4Y0YE 4A92A 1A0LA 1HBTH 5A8ZA 3EE7A 2I6SA 1ELBA 2F9NA 2KFWA 1CBWB 1O3EA 3MU8A 3PO1C 1FIZA 1C2GA 2QY0B 3WWFA 1MUEB 2M5TA 4FOUC 2BLOA 5B6OA 1A61H 4THNH 3U8TH 2FS8A 4F55A 1YBWA 1G32B 1TALA 4VGCC 1PPEE 2ZU4A 1S0RA 3TGIE 3LJJA 3NXPA 4DG4A 2ZFPH 4X6OA 3BTWE 1QB6A 1VCPA 3KYGA 1SGFA 6CHAB 1C4U2 2V3OH 5ABWA 1TGSZ 2J92A 2UUJB 1HXEH 2ZHEH 3F2HA 3KQ5A 2ZEBA 4ZH8A 1RS0A 2OTVA 2R2WU 1UHBA 4NSVA 3W94A 2J98A 1C4Y2 1O5BB 2VH0A 2ZGJA 4NGAH 1G3BA 2H5DA 3SV8A 5HKKD 3A8DA 1GJ9B 3NRLA 1WSSH 1PQ8A 1H9LB 3GCHC 5EXLA 2ZA5A 1GPZA 4X1NU 2AEIH 3UB0A 2P8OC 2A32A 2RDEA 2CHAC 1TA6A 1QBOA 1XXFA 2G55A 4K1SA 4YT6H 1C1WH 3FP6E 2ZDKA 3A7TA 4PROA 2OBQA 3A89A 5HM9A 2TGDA 4WF8A 4AFZA 1FN6A 2XC4A 1QURH 3TJNA 3EAJA 1ZTJA 3RXQA 1T31A 1SQOA 3OX7U 3IITA 1QY6A 2Y5HA 1DY8A 2JJ2D 1L0ZA 2Q6DA 1ESTA 3RLWH 4DW2U 3VGCB 2FTMA 1RJXB 4D7GA 2A2XH 1MBQA 4OS1A 1L4DA 1Z1IA 4ZXXH 2FZZA 3QZRA 3SJ9A 1D6RA 4Z6AH 4UFGH 3PM3A 2W7SA 1WV7H 5C0UA 1O3PB 3MNXA 3SNCA 4NIXA 2BY6X 3LC3A 1UTLM 4XFQA 1FLEE 4AG2A 5F6MA 3D65E 4I31A 2GZ7A 3ODDA 1T8MA 1YC0A 1O37A 1RD3B 1TBRH 1YPEH 3QTOH 4WJG2 3ZZAA 1UW7A 2XTTB 2J5UA 1C1QA 4JZIA 1EQ9A 2Y81A 1UTPA 5L6NH 1EJMA 3QGJA 2KCPA 2A4RA 4GPGA 1LO6A 1HAXB 1SBWA 2O8LA 4AB8A 4KGAA 1DLKB 2HNTE 4I8JA 4B2AA 4AB9A 2JIZD 2FODA 2SNWA 1E1QD 1HGTH 5A8YA 2ZZUH 1CA8B 8ESTE 3GY7A 3V3MA 1O3GA 1MCTA 3SV7A 2BLWA 1ZOMA 3URDA 1C5QA 2HVXA 4TPYA 1S6LA 1KDQB 1HXFH 4JYTA 1BUIA 1C5LH 3Q3YA 1TGBA 1QTFA 1RRKA 4RI0A 3VFEA 2A1DB 3RXEA 1BTPA 1NC6A 1O2XA 5JPMH 3N7DA 2ZC9H 2WPJS 1JXPA 3SU2A 1W0KD 2WYJA 2BD3A 5DP4A 1J9CH 1F5KU 2R3YA 1TX6A 3F0OA 2PTCE 3HGPA 1IQNA 1MQ5A 1TNJA 2GP9B 1GGDB 3B8JA 5EPYA 1QL7A 2WPMS 3I29A 4GAWA 1JMOH 3T29A 4NCYA 3M5NA 3BTGE 1AN1E 5F8ZA 4UFEH 1RTKA 3TK5A 2Z9IA 1GMHG 2TGPZ 1HJAC 1HYLA 1F0RA 1O33A 2Z7FE 1ELFA 3EA7A 2R2MB 4WXIA 2Y80A 2ZKSA 4UDWH 2BZAA 1Y3XA 3GCOA 1HAIH 5HIYA 1O3IA 1AU8A 1C5YB 2R0KA 3SI4H 5L2ZH 2V3HH 1HUTH 3H09A 1GJCB 1O2GH 2Y7XA 4HG6A 1BBRE 3RXOA 3MU4A 3ATIA 4NWKA 1NTPA 1S0QA 1S85A 2XW9A 1C1PA 1GJ6A 2ZNKH 3BTME 3QZQA 2VIDA 1DITH 3ZZDA 1THRH 1FPHH 3QDZB 4WXVA 4YO9A 1V3XA 3ATKA 1PPZA 1O31A 2QXJA 1ANDA 4OS6A 5DP3A 1HAGE 2ZFQH 1HNEE 1O2ZA 4ASUD 1EAXA 1O3JA 2BY7X 3I78A 2KCOA 1BTXA 3ZV9A 1QCPA 1F0SA 5E8EH 3E16B 2BOHB 1A7SA 4ACAA 4U01A 3H7OA 5F03A 1WAYB 1TRNA 2F4LA 4MPUA 1IQIA 1GJ7B 2UUFB 3VB6A 4X2XA 1OP8A 1O2MA 6ESTA 2P3UB 3PTBA 4XRNA 4CRDA 3M5LA 2JH0D 3BG8A 5KECA 1P0SH 2XBXA 3OEHD 1EATA 3UR9A 5EW1H 4TPIZ 2YNBA 3LDXH 3MQKC 4B73A 1P2IA 4I8LA 4A1TA 1Y5BT 2STBE 2XCNA 1A3EH 1SGQE 3EQ0H 2XNIA 2W6JD 1K1MA 3F3BA 2AIQA 1XKAC 2A31A 1O36A 4YT7H 2VGCB 2AHME 2ODPA 1GJDB 1O2PA 2BZ6H 1Q2WA 2NWNA 1BBRK 3TK6A 4K3JA 4IMQA 2BVSH 4INKA 2ODYB 2HPPH 1UJ1A 3T25A 8GCHG 1GDUA 5LGOA 2OINA 2ZFSA 3T26A 3UY9A 1UCYE 3BTQE 1IQHA 1KXAA 5IYTA 3QLPH 1C2IA 2HRVA 1UTQA 3M5OA 3W1EA 3QO6A 2B7DH 2A7CA 2XWBI 4B1TA 1NPMA 3BSQA 4X1QU 2QAAA 5L2YH 1GCDA 1V2PT 3UR6A 3BTFE 1ARCA 1UK3A 2OD3B 4X0WU 3VB7A 1K2I1 1F92A 4Q4LA 2WPHS 3HK6B 5J4SA 4RT1A 1AFQC 1O2TA 2BD4A 3SGBE 2FOHA 2BTCE 1W7XH 4NA9H 1Z6EA 1O3MA 1THSH 1WBGB 4E06H 2IOTA 4K8BA 1GBFA 3A7XA 2FESH 3F2FA 2FDAA 3FP7E 3AAVA 2Y5FA 3KNXA 1DFPA 2VU8E 2STAE 3QTVH 3SBKA 1GHVH 5EJZA 1P9UA 1SC8U 1GBHA 2BYAX 3E90B 3TU7H 1NBME 7GCHG 1O2QA 3KQEA 2ZHFH 1W3CA 1A4WH 1ZMNA 1ZPZA 1TX7A 1IQJA 2ESTE 1Y5AT 4A6LA 1NESE 3BIUH 1AD8H 2J2UA 2NU1E 1QIXB 1Z1JA 1OYTH 1SQTA 1XUJA 3SJ8A 3SJKA 1BRAA 4J1YA 1V2VT 1JWTA 4MTBA 4NA8A 3OAAD 3ZVGA 3GYLB 3TH2H 4F4OC 5T6GA 2BLVA 4ZXYH 4ZHLU 2FI3E 1P09A 3UFAA 1JBUH 1TA2A 2ANMH 1OP2A 1GMHF 2PGQB 5JYIA 1EZUC 1O3LA 2FX6A 3PYHA 1DSUA 1QRXA 2QA9E 3RXDA 3C27B 2UWLA 1LQDB 4A1VA 2FI5E 3RDZA 1L1JA 3UTUH 1BRBE 2SGDE 3NZIA 1Z8RA 3RXGA 3N7EA 1CA0C 4FUCA 2BVRH 1GJ5H 1C5SA 4RN6A 1SPJA 3VB4A 1UCYK 1Y8TA 1EASA 2ZGXH 3SHAH 1MTNB 1O5GH 1DWDH 2KCAA 3LKWA 3FZZA 1MH0A 2RG3A 1GJ4H 2VINA 2EI7A 1QFKH 2HALA 1LVYA 2JKHA 1K28D 4CHAC 2VIVA 3DA9B 1EJAA 1P3CA 1F0UA 1OYQA 4P00A 2YNAA 1T8OA 1WU1A 3LIWA 1E79D 3JZ2B 1PPHE 1D3PB 1TBQH 2DE9A 2HOBA 2GDDA 5K7RA 1G2LA 3BV9B 4IBLH 1G3EA 3RMNH 3HK3B 2FO9A 3PLPA 3MOCA 2RFKC 1VGCB 2HVYB 2A4GA 1CBWC 1G3CA 1PQ7A 2SGAA 3VXFH 1VITH 7ESTE 4CRAA 1ZZZA 5EW2H 1DWCH 1AKSB 2ZTZA 4NA7A 2BHGA 2BDAA 5FXLA 1FI8A 1M9UA 2NU4E 1C1UH 3ZZ7A 5FPYA 1DXPA 2FOEA 2J4IA 1L2EA 1XKBC 1SQAA 3STJA 4BXSA 3UOUA 2ZQ2A 6CHAC 4HFPB 1XMNB 1NU7B 1O3AA 1MAXA 4TY6A 1CHGA 4AC9A 1C5NH 1C5MD 3TPIZ 2LELA 1W10U 2AGEX 4FUHA 4WVPE 1C5TA 1P12E 1HCGA 1YPHE 2H1UA 2BD2A 2JETB 2OK5A 4KP0A 1AUTC 3GY6A 1GVKB 3GY5A 4BAMB 2PKAA 1DXWA 1GI1A 5GDSH 3SU4A 1TRMA 4MPWA 2PV9B 2Q1JA 2C93B 4YLUA 2AMDA 1OKXA 3LGYA 4BAHB 1HAYB 1P11E 4FVBA 4D76A 4DVAU 2EA3A 1BITA 1D9IA 1V2WT 1AQ7A 3KHVA 2ANKH 2FM2A 3PLKA 4FETA 2GJGA 1N6YA 4OS7A 4U30A 2FWWA 1OWEA 1RTFB 2DE8A 2QYIA 1GJ8B 1J14A 3OY6U 8GCHF 5HIZA 1LHGH 1IQMA 1AWFH 4CRFA 1KLTA 2A5IA 4AFQA 1YCPH 5C5NA 1TGTA 1AZZA 5EGMA 1GMDG 2ZDVH 3A7YA 4UFFH 3VGCC 3BIVH 2ASUB 3TLOA 5CMXH 1GBJA 4MNYA 5DP6A 4I8GA 1FV9A 2Z9LA 4ASHA 5C20A 3BTHE 3RM2H 1LVBA 3RXCA 2VWLA 3RC4A 2AFQB 1J16A 2VBCA 1GHAF 1GMCG 1GI3A 3UIRA 1D6WA 1GL0E 1BCUH 1O3DA 2FS9A 2WPDD 1W0JD 1O2YA 1HFDA 1CHOF 3A80A 1G37A 4I8KA 1E37B 3SI3H 5JB8S 2QXHA 1BTHH 4ABDA 8KME2 1F0TA 4O3UA 1EUFA 2G00A 4YZUA 5GXPA 1E34B 1XM1A 4Y6DA 1H9HE 1SFIA 5TJXA 1Z6JH 7GCHF 3LU9B 5K0HA 2PR3A 1E36B 1XXDA 2ZGCA 1OS8A 2BVXH 3P8FA 1YCPM 1AMHA 3K6ZA 1TPSA 1C4V2 4DIHH 2A4QA 1JIMA 4RT0A 1NRQH 1TB6H 3GOVB 1YLNA 3WW7A 2K1QA 1BHXB 4UE7H 2YOLA 1AVXA 1O30A 2SFAA 3MTYA 1S6HA 4OGXA 3DFLA 1P9SA 2AIPA 3M7TA 4DGJA 1QHRB 1TPPA 3SV2H 3UWJH 4Y8YA 1EKBB 1TX8A 1O5FH 2QE7D 1AE5A 2C8ZB 2GT7A 2G81E 4ABGA 5BRRE 2PWXA 2RCEA 1Y5UT 1ZHRA 2CF9H 3ZYDA 1WCZA 4IN2A 7LPRA 1SB1H 1LPGB 1VR1H 4X6MA 5FX5A 1GGDC 2BD9A 1C1OA 3PMAB 3ZVBA 3MO3A 5A0BA 1XUFA 4ISIH 2ZGHA 1H1BA 3A84A 3RXSA 1BA8B 2Z9GA 4RKOB 3U1IB 4E05H 5C1UA 2PUQH 4FUBA 3PV5A 4XBCA 1S81A 3RM0H 1W7GH 2UUYA 1MD8A 3KQCA 5A2MH 3LGTA 4NFEA 2J98B 1ESBA 4GHTA 2F9OA 1YLDA 1RIWB 4O03A 3GS9A 4BOHA 4ESTE 1ZLRA 3RXBA 4HI3A 4Y71A 4ABEA 2FOGA 2PSYA 2AGIX 1MQ6A 3K6YA 2BD8A 3MH5A 1BB0B 1T8NA 2ZDNA 1HDTH 3I77A 2ZIQH 3PRDA 1ZHMA 1H8DH 2A2QH 3SGAE 1GJBB 2YMSD 3T5FH 5F53A 2W3KA 4NIYA 3M5MA 2H9EH 2FOBA 4Q2KA 1SR5C 4RKJB 4UONA 2TGTA 3PMJA 4XD7D 1DE7H 1EAUA 4XBBA 1MKXK 1MMJN 1OWJA 2NU0E 1TE0A 1BRUP 1V2NT 2FOMB 4B2CA 1HLTH 4Y0ZE 4YM9A 1FAXA 4D7FA 1BJVA 2FOCA 4Y11E 1S82A 5FBIA 3P6ZB 2KX4A 4A7IB 2F83A 4I33A 2D8WA 5GPIB 3TH4H 2HGTH 1GCTB 1WTHD 4BANB 1P2MA 4AYVB 1QA7A 2B5TB 4CR9A 3S0NA 1FY4A 4AORA 3ZZ4A 1C9TA 5HM2A 2XBWA 3Q76A 1LQEA 4MLFB 4D8NA 4E7NA 1SHYA 5IK2D 2NU3E 3SUEA 2CF8H 3PWCA 3L33A 1DY9A 3AW0A 4QT8C 1AZ8A 3MH7A 2RA0A 4DURA 5IDKA 3GDVA 3FAOA 1HAHH 3BF6H 1A0JA 3KIDU 2GT8A 1BZXE 3Q00A 4P02A 1MAYA 1SGYE 1PYTD 3UPEA 2L6OA 1E38B 2ZCKP 4ZROA 1P04A 2YMSB 4B74A 1SMFE 2ODQA 2Y7ZA 1AFEH 1A0HB 1CVWH 2V3MA 4YOGA 1QB9A 4WWYA 5AFZH 3EA8A 3M3TA 4E7RG 1BIOA 1ETRH 3VB3A 1HJ8A 2PFEA 1ELTA 1FN8A 1C2HA 1GMDF 4GVUA 4X8VH 1BOQA 2H6MA 4F48B 1NM6A 4K8YA 2IJOB 1PPBH 3M7QA 2VGCC 2ZDMA 3G01A 3CNRA 2GCTB 1V6DA 3ZZ6A 5C1XA 3RMMH 1K1OA 1UO6A 2BB4A 2G51A 1C1RA 1B7XB 1PFXC 3MFJA 3ZZBA 3PRBA 1GDNA 4K2YA 2PLXA 2SGPE 3LGUA 3F68H 3PLBA 5DGJA 4NWLA 1NFYA 1YPLH 1GHWH 3EE0B 3SYJA 2FLRH 2FPZA 2KR7A 3BTEE 2FOFA 3BTTE 4LK4A 2VWOA 3PV2A 1Q3XA 1EJNA 1P2NA 3JZ1B 6GCHF 3O8CA 2QF3A 3F9FA 3M3SA 2CV3A 3ESTA 4I7YH 4K1TA 3L3TA 1J8AA 3ZZ9A 1O2OA 1N8OB 5EXNA 2XCFA 3QWCH 2CXVA 1O3OA 1O2UA 3LGWA 2ZP0H 5AF9H 1S84A 5DPAA 3LONA 5EQSA 2G4UA 3VG8A 2G52A 1QA0A 3BEFB 2TIOA 1WQSA 2VIWA 1LDTT 5GNDA 2GCHG 3SU1A 1COWD 2QF4A 1CGJE 4ZKOU 4R8TB 1OOKB 3PMHB 4JCNA 1YPJH 4AG1A 3TJUA 3LOXA 1CO7E 4DY7B 1Y3UA 5HXFA 2QCYA 2O9QA 1C2MA 1ID5H 2BDIA 2GDEH 4M9FA 2OLGA 3Q3KA 3TJVA 3DT0H 3P70B 1S5SA 1KLJH 2QC2A 2R0LA 1C1SA 1TRYA 1EFRD 3SNEA 4JYUH 1C2KA 3RU4T 1YP9A 2ANWA 1TABE 1ZR0A 3MO6A 4X2YA 1EOLA 2GX4A 4ABJA 3OE7D 3RU4E 4ZMAH 5FCRA 2G4TA 1LCYA 4K5ZA 1FX0B 1YPKH 1GL1A 3EDXB 3SQHE 1OX1A 1O2WA 1AVWA 1GI2A 1CT2E 1GI8B 1Z8IB 1MTNC 1TGNA 2ZWLH 4ZUHA 4CH8B 1FONA 5BPEA 1C5XB 1SFQB 1NROH 2HPQH 5PTPA 1O2LA 1FNIA 3AVZA 2H9HA 1ZSJA 4JZ1A 1ABIH 2WYGA 2THFB 4JZFH 4OGYA 1EPTC 3K65B 3LJOA 3GCNA 1UK4A 3GY8A 2PGBB 1FUJA 5E0JA 1NBMD 1GBCA 1XVOA 3STIA 3Q77A 1V2ST 5TCCA 3TNSA 4BTTB 1P03A 2XC5A 1VGCC 3M37A 4MNXA 1HAVA 4DT4A 3TIUA 1O5CB 2ZGBH 1N1LA 2OBOA 2K0QA 1A46H 1DVAH 3A86A 5EU8A 2BDBA 5EJ1A 1HIAB 2P95A 1AO5A 1BBRH 5B6LA 3RC6A 1KXDA 2OC1A 2Y5GA 2JH6D 3ATMA 1RFNA 2FTLE 3ZVEA 3FP8E 5KEDA 1P8VC 1A5GH 1C5WB 1UVOA 2V6NA 1K1JA 4GCHG 4DOQA 1BMLA 3P95A 2W26A 1MZAA 1O34A 4Y10E 2C8WB 1GI7B 5CHAC 1WXRA 2W7UA 1J15A 3A7VA 2W3IA 1V2UT 3V12A 3OTJE 1T4VH 2JETC 2ZDAH 1P01A 1ELCA 1EB1H 1AHTH 1P02A 4LOYH 3RMLH 3RXTA 1E0FD 4DCDA 1W2KH 5E2OA 1ZJDA 1ZRBA 1MKWK 2FLBH 2CN0H 1SGCA 3HPTB 3ATWA 1SOTA 1FY1A 1P2QA 5FBEA 3DSGA 3N99A 2GKVE 3RXFA 3MI4A 4FXGH 1O3BA 4O3TA 1EZSC 1VITG 2B8OH 1YM0A 2V35A 4HTCH 4JK5A 3RXVA 3S9CA 3S69A 1W12U 2AYWA 5FHTA 3A8AA 1HJ9A 4FUEA 2GZ9A 1FPCH 3SV6A 3DHKH 4Y7AA 1GHBG 5E2PA 1QBNA 2F9BH 4XE4A 3R3GB 2ALVA 5C2ZA 1TFXA 3KEEA 2ILNA 2OQ5A 1TMBH 2LPRA 5DKMA 4D9QA 1DWEH 1A1RA 3NUMA 3OU0A 2BMGB 1L1GA 1IOEA 2KCYA 2J95A 1G36A 2BDHA 1OWHA 4IC6A 1BMAA 1ZHPA 2QV1A 1IQEA 1V2RT 3F6UH 1P2KA 4H42U 1DPOA 4AFSA 1PPFE 2WHXA 3MWIU 2XXLA 1YY3A 1O2HA 3VEQB 1XUHA 3P8OA 5G4BA 3TH3H 4CH2B 3OYPA 4MPXA 2OC7A 1S6FA 2ZTXA 3RXKA 3V7TA 5DP7A 3GISB 1SGPE 4I8HA 1UCYH 1GBBA 3PMBB 1TLDA 1IHTH 3MHWU 3T2NA 1FXYA 1GHXH 4IGDA 3S7KB 1K1IA 2F43B 3K9XB 1W8BH 2WUCA 1KSNA 3DSPA 3MU1A 5C1YA 1P57B 3UNQA 3UUZA 3NKKA 3SHCH 2Q6GA 1EPTB 2RDLA 3ODFA 6LPRA 3QGNB 1PPGE 1A2CH 1SGIB 1ZTLA 3D23A 3SOSA 2AERH 3NPSA 9LPRA 1CE5A 4Y8ZA 4IS5A 1ARBA 1SGTA 3TGKE 3A81A 3ZZCA 1C2JA 1V2MT 2ZI2H 3LGIA 4UEHH 3RMOH 1H9IE 1EP5A 1TWXB 1G3DA 1GI4A 2ZHWH 5I25A 1GI9B 5E0HA 3RP2A 1C2EA 5LPEA 3FFGA 5AVDA 4BAOB 1WDIA 1LVMA 1SQRA 2A5KA 1O3FA 4H6TA 3M35A 5T3HA 2EEKA 3U8RH 3UNSA 4NSYA 2QIQA 2AGGX 1GHYH 1WQVH 4MDSA 1O2KA 1DANH 3OFND 5CHAB 5DK1A 2QGRA 3E0NB 5GIBA 1TMUH 1GBAA 1Y59T 2Q6FA 2XOKD 5DN6D 1RIWC 4ZKRU 3QX5H 3RXIA 2WINI 1GG6C 2ANYA 2PKAB 2GVFA 3RXRA 1IHSH 2OCVB 5EG4A 2D2DA 3MYWA 1GBMA 4YLQH 2WV9A 4GSOA 3SNDA 2UWOA 1DDJA 4JZEH 4IMZA 4MNWA 3FOAA 1PPCE 1GDQA 2A45B 4ABHA 1KMHB 2KAIA 1PJPA 1V2QT 5DP9A 2H9TH 4TT3D 2JDID 4CBNA 3BEIB 1QNJA 4H4FA 3HATH 1CGIE 4Z0KA 1LTOA 3SUFA 1OSSA 3ITIA 4TWWA 4AFUA 2XBYA 4IN1A 3O8BA 5I46H 1T4UH 3EGKH 1GBEA 4K69A 1GCTC 4K1EA 3E91A 3U1JB 3GICB 4H6SB 1WOFA 3SORA 1AUJA 4FUDA 1XUGA 4CRCA 1SSXA 3HKIB 3NK8A 4Q7ZA 4O97A 1ZPBA 4JK6A 3VPKA 3GDUA 4X1PU 3QN7A 1QRWA 5LPRA 1SLXB 4GHQA 1B5GH 4INHA 3CP7A 4FUFA 5LPFA 2FEQH 2P94A 2ZFFH 2VIPA 4X8SH 4Z1MD 1IQFA 4IW4E 4LXBH 3A7WA 4ZAEA 2H2ZA 4CRGA 1YKTA 3F0PA 3F9HA 1UVSH 1YGCH 3ATLA 1OWIA 1NZQH 1TOMH 1KXFA 2HNTC 3SU5A 2YMSC 1MTUA 5C94A 2P16A 2TBSA 1NRSH 2FYRA 3KQDA 5DO4H 2GV7A 1FY8E 1P2OA 1HPGA 1SVPA 4JMYA 1Z8JB 2G8TA 5ESBA 3KYFA 3UWIA 2GZ8A 3ZVAA 1SLWB 3U8OH 2BY8X 4U32A 1AB9B 4KTUA 4ISLA 1LKBA 1LHCH 2GCTC 1FAKH 4HZHA 2BDCA 2ZU1A 2CMYA 5T6DA 1MCVA 2EI8A 2FMJA 2FOAA 2SNVA 1DUAA 4YXWD 2FIRH 1NN6A 2CGAA 4O9VA 4X1SU 1ELDE 5A0AE 2A5AA 1QJ1B 1C1MA 4B6EA 4NZQA 4CBOA 3W95A 1MD7A 1OWKA 3UQVA 1UK2A 3L6PA 3M36A 2C4FH 1C2FA 1UHBB 3MU5A 3F9EA 2UUKB 3MH4A 3UOPA 1SGEE 1PYTC 2BX4A 1GWAA 4F49A 2AMQA 1FMGA 4ABFA 1BMNH 3BN9A 4OM9A 2A7HA 3GDSA 1N8OC 1Z71A 1GG6B 2OQUA 1SGNE 2O8UA 4ABIA 1YWUA 3RXPA 1Y3VA 1K21H 1TPOA 4WMFA 1SGFG 5C3NA 2QXGA 1TMTH 2ZHDA 3RXHA 1EAIA 5A09A 1C5OH 4FU9A 1O0DH 1UTOA 5JBTA 1HAOH 1C5ZB 4TYDA 4WH6A 2Y82A 2A4OA 3E8LA 1MU8B 2BDYA 2PW8H 2J9NA 1CSOE 3P8GA 1XUIA 1MTWA 2VVCA 2VJ1A 3B9FH 4BAQB 1EX3A 4YESB 1TBZH 1KY9A 4RSPA 1ELEE 4B71A 1FJSA 4TSFD 5EQRA 2ZU5A 1PQ5A 4B6FA 1EZQA 1MKXH 2SGEE 5EJLA 3SO3A 1AIXH 1QRZA 2GMTB 1NRRH 1EOJA 4BTUB 4XDEA 3GCTG 1D3QB 3SGQE 2BD5A 3OSYA 2OXSA 5F8XA 1F2SE 3BG4B 3FANA 4ZKSU 3A7ZA 1QQ4A 3C1KA 1U6QA 1VCWA 1QBVH 2VVUA 1TOCB 1QZ8A 2XNDD 1BTUA 2C8XB 5TCAA 3RXAA 1TNGA 5EXMA 3E6PH 2G5VA 3RXJA 4ISHH 1LVOA 5FL7D 4WH8A 1T32A 1WYKA 1QJ6B 2BD7A 5DP5A 3MU0A 1TNKA 4X6PA 4MVNA 5H4IB 4AX9H 1K1NA 3U98H 1P10A 1SOZA 2Z9JA 3SZNA 2J97A 2L74A 1A3BH 2VVVA 2EQNA 4TY7A 3ELAH 2DUCA 5EOKA 2F9VA 2GV6A 2O8TA 5E0GA 1KTSB 1DICA 1KXEA 4FU7A 3A83A 3AK5A 1SGDE 1C1VH 3S9AA 2FI4E 5JBBS 2C90B 3ZVCA 1BT7A 3MNBA 2IPHA 3TJOA 4NFFA 1ZJKA 1AWHB 1ZMJA 5T1VA 1ZYOA 4FUGA 3KF2A 1JOUB 3LPRA 1P06A 3GY3A 1OP0A 5GJ4B 1TPAE 5EODA 2H5CA 1LPZB 3SUGA 3OTPA 5DP8A 1IQLA 2ZCLP 2F91A 2PKSB 3M3VA 2TPIZ 2IN2A 1GMCF 1UTNA 1RTLA 1L4ZA 1V2LT 2C3SA 1XUKA 1IQGA 4X2VA 4AN7A 5DG6A 4BXWA 2HLCA 2VWNA 1K1LA 1KDQA 4ZCNA 4X2WA 1CGHA 2WPLS 3PO1B 3SJIA 1O2JA 1OPHB 3S9BA 1DSTA 1O5EH 4ABBA 1AI8H 1C5RA 2F9UA 3MNSA 4R0IA 3SV9A 4LZ4B 2O8WA 3RU4D 2VWMA 3D62A 4Y79A 1SI5H 4VGCB 4Q63A 2Y6TA 1SHHB 3FVFB 4K60A 5DJ7A 3GY2A 1MBMA 4WMEA 4Q80A 3SNBA 8LPRA 3O8RA 3BEUA 3IG6B 3HGNA 5FAHA 2Z3CA 1ZRKA 1GVLA 2OUAA 1VZQH 1UMAH 5GWZA 1TAWA 2XBVA 2ZECA 1Q31A 1H8HD 1DWBH 4ZHAA 2GD4B 1L1NA 1W14U 3URCA 4MG3A 1HAZB 4AYYB 1BJUA 4ISOA 2O8MA 1SG8B 3WY8A 3K2UA 3N7OA 3GCHB 4M7GA 4Y7BA 4I86A 4B76A 3MMGA 1W11U 4FUJA 1K1PA 2BQ7B 5LH8A 1P2JA 1C1NA 2P8OB 1UTMA 1C2DA 3U28C 4CR5A 1NRNH 2ZF0H 3RLYH 3RXUA 1BHXF 3KQBA 2CHAB 1VJAU 3ZZ3A 3SW2B 3R0FA 3RUOA 1O3CA 3A87A 3SU6A 4GLYA 3TNTA 2BM2A 5FPTA 3U69H 1V2JT 5JBAS 3KGPA 4IC5A 1SL3A 4SGBE 5KGOA 1NY22 1V2OT 1FDPA 4KTCA 1ANBA 1F5LA 1QB1A 3KL6A 1MZDA 3F2GA 1DX5M 3E3TA 5C5OA 1JIRA 2BDGA 1WUNH 2FXRA 4JZDH 5CDFE 2Z9KA 1JRTA 2AS9A 1UTJA 5A0CA 1O2SA 1O2NA 4BNRA 2K8IA 2Z3EA 1KLIH 3EA9A 1CQQA 1FY3A 2VIOA 3D49H 3CENA 1KTTB 1P3EA 3V0XA 4Q7XA 5ETXA 4ACBA 3DD2H 5HYOA 5GCHG 3PTNA 1DM4B 1JRSA 7KMEH 5JB9S 1E35B 3AASA 3SN8A 4JYVH 1LKAA 2VNTA 2XYAA 4XOJA 1QL9A 3ZYEA 1G30B 1LHEH 1W13U 1O5DH 2VH6A 1BTWA 3KN2A 3BTKE 1D4PB 2B9LA 2PP6A 2ZHQH 4DIIH 2BXTH 4DJZB 1NS3A 1HAVB 5L30H 1O3NA 3ZZ8A 1LHFH 1KXCA 1SKYE 2FP7B 3S7HB 1LMWB 1QL8A 3GCTF 3TK9A 3LGVA 1H4WA 4BAKB 4A1XA 2IPQX 1HRTH 3RXMA 1NO9H 4CREA 5C17A 3FZDA 3T27A 2BOKA 3OEED 1Z7KA 3SQEE 3ENSB 1ESAA 1GBIA 1NRPH 1E1RD 2B0FA 2BQWB 5ESTE 1K0HA 1SGRE 1OWDA 1CT4E 4WY3A 1VJ9U 1KYNA 3F9GA 1F5RA 2A0QB 3P17H 3PB1E 2JJ1D 2WPKS 3CS7A 1O2IA 2ALPA 1HIAA 1ELVA 1TGCA 1YPHC 1O3HA 1TNLA 1ORFA 4KTSA 2BLQA 3RC5A 2UWPA 1NFXA 2F9PA 3ZZ5A 1O39A 5DSFA 1EZXC 2ZCHP 3A82A 4XBDA 4AZ2B 2KM0A 2OC0A 5CE1A 2OC8A 4MNVA 4WMDA 2ZFRH 1HJAB 2AH4X 4X6NA 1EAWA 1ZPCA 1D3DB 1GHAG 3U9AH 1V2KT 2HNTF 4NZLA 1MKWH 1IQKA 1FY5A 2C8YB 1PQAA 3LH3A 2FX4A 1CHOG 2W6ID 4X1RU 1ANCA 1Y3WA 2TGAA 3AW1A 2QF5A 1A5HA 3KCGH 2R9PA 4SGAE 2VIQA 1C5UA 2ZDLA 2ZO3H 3ZVFA 3P8NA
chains in the Genus database with same CATH topology
1BRCE 2TRMA 4D9RA 2ZU2A 1W0ZU 2VB0A 5SGAE 1KIGH 1SLVB 1G2MA 1AVGH 1KXBA 1X7AC 1NFWA 3NCLA 3V13A 1HAPH 1UVPA 1FIWA 4XSKU 1RXPA 5JBCS 4MQAA 1ELAA 1BTZA 2BY5X 4ABAA 3Q3XA 1DLEA 1GVZA 1YLCA 4MPVA 1AE8H 1BTYA 2LNCA 1DOJA 5HMAA 2WPIS 4AOQA 3B23B 1ABJH 2P93A 3M7UA 4YOIA 1OXGA 1YPGH 1TQ7B 4NIWA 4FUIA 1CU1A 1K9OE 1J17T 2W5EA 5J4QA 5FPSA 4Y76A 2GCHF 1MTSA 2ZU3A 1YF4A 1QQUA 1G9IE 1H8IH 2PSXA 4TWYA 4Q7YA 4AGJA 2V0BA 1QGFA 4DT7B 1C2LA 1F7ZA 1BMMH 1GBLA 1GJAB 1T7CA 2QN5T 4NG9H 4ISNA 3DUXH 2SGQE 1ETSH 5JDUB 1Z8GA 3QUMP 1NU9A 1ACBE 3A85A 3QK1A 2OP9A 2FYQA 2BXUH 1C1TA 3DFJA 1NFUA 2ZQ1A 3A8CA 3LT3A 2GGVB 1ZGIA 1HB0B 4BTIB 1AB9C 3O8DA 1WTGH 2BX3A 3IWMA 2PTNA 1XVMA 4UFDH 1GBKA 4GUXA 3GY4A 4ZHMU 3MH6A 2PUXB 1ZGVA 2XC0A 1EXFA 4A5TS 5T6FA 1EPTA 1EB2A 2QXIA 4AGKA 1ETTH 2R3UA 1C5VA 3AAUA 5EPNA 1O2VA 1GI6A 2ZFTA 2PHBA 2SGFE 3HKJB 2EI6A 3PROA 5FX6A 2J34A 3A88A 1AGJA 1S83A 1B0EA 4ZKNU 3H7TA 1K22H 4I32A 3M61U 3E1XB 1SLUB 1UTKA 3E0PB 1GHZA 1ZTKA 1N6XA 1MTVA 3SNAA 1AKSA 1QJ7B 4OS5A 1DT2A 1TNHA 5C67A 2F3CE 5F8TA 5GCHF 4LZ1H 3TGJE 2EC9H 5AHGH 2WV4A 5AFYH 3LH1A 3TITA 1FQ3A 2BY9X 1FZZA 4OS4A 2ULLA 1GI5A 4FU8A 1ZSKA 4UD9H 3SUDA 2GTBA 2J94A 2ZTYA 2KAIB 3GYMA 1DS2E 1AFQB 2I6QA 1CT0E 2WV5A 1NT1A 3MO9A 9ESTA 1O32A 1YYY1 1LHDH 3EYDA 2P3FH 3MNCA 3NWUA 1O35A 3TVJB 4X8TH 4KKDA 3OY5U 4X8UH 3CS0A 1VCQA 3UREA 1ZMLA 3SU3A 2ZPSA 2ZG0H 4GCHF 1TYNA 4B75A 2Z6BD 1QR3E 3LC5A 1T8LA 2JH5D 4HGCA 2P59A 2GMTC 1YCPK 1BQYA 1GBTA 1GI0A 1DUEA 4U2WA 3A8BA 1UVUH 4Y8XA 1P05A 2HWLB 3BG4C 1C9PA 5HGGA 3F1SB 1C5PA 1D3TB 3ZVDA 1RGQA 2J38A 2XRCA 2RA3A 1O3KA 1XX9A 2P3TB 3BTDE 1INCA 2CJIA 1O5AB 4B2BA 1Y3YA 4INLA 1TIOA 3UNRA 1O38A 1TONA 1GBDA 1A5IA 1EP6A 2D26C 2Z94A 3PV4A 1ZSLA 3PWBA 3SU0A 1B0FA 2D1JA 2A7JA 5FCKA 1CA0B 2WUBA 1THPB 4YTAA 3VXEH 2AMPA 1VITF 3RXLA 3SJOA 3P92A 3ZV8A 3H5CB 4YOJA 1ANEA 2Z3DA 3UQOA 1MU6B 1GHBF 2XWAA 4CRBA 6GCHG 1TNIA 4KELA 4NIVA 1BDAA 3T62A 1ELGA 4CHAB 2NU2E 1O2RA 1HV7A 5EQQA 3T28A 1IAUA 1AY6H 2QF0A 1UVTH 3VB5A 1W0YH 4J2YB 2ZPRA 2PKSC 1V2TT 4FVDA 1YPMH 5A8XA 2BQ6B 4OS2A 1TQ0B 1LPKB 4Y0YE 2G5NA 2ZPQA 4A92A 1A0LA 1HBTH 5A8ZA 2I6SA 1ELBA 2F9NA 1CBWB 1O3EA 3MU8A 3PO1C 1FIZA 1C2GA 2QY0B 1MUEB 2M5TA 2BLOA 5B6OA 1A61H 4THNH 3U8TH 2FS8A 1YBWA 1G32B 1TALA 4VGCC 1PPEE 2ZU4A 1S0RA 3TGIE 3LJJA 3NXPA 4DG4A 2ZFPH 4X6OA 3BTWE 1QB6A 1VCPA 1SGFA 6CHAB 1C4U2 2V3OH 5ABWA 1TGSZ 2J92A 2UUJB 1HXEH 2ZHEH 2ZEBA 4ZH8A 1RS0A 2OTVA 2R2WU 1UHBA 4NSVA 3W94A 1C4Y2 1O5BB 2VH0A 2ZGJA 4NGAH 1G3BA 2H5DA 3SV8A 3A8DA 1GJ9B 1WSSH 1PQ8A 1H9LB 3GCHC 5EXLA 2ZA5A 1GPZA 4X1NU 2AEIH 2P8OC 2A32A 2CHAC 1TA6A 1QBOA 1XXFA 2G55A 4K1SA 4YT6H 1C1WH 3FP6E 2ZDKA 3A7TA 4PROA 2OBQA 3A89A 5HM9A 2TGDA 4WF8A 4AFZA 1FN6A 2XC4A 1QURH 3TJNA 3EAJA 1ZTJA 3RXQA 1T31A 1SQOA 3OX7U 3IITA 1QY6A 2Y5HA 1DY8A 1L0ZA 2Q6DA 1ESTA 3RLWH 4DW2U 3VGCB 2FTMA 1RJXB 4D7GA 2A2XH 1MBQA 4OS1A 1L4DA 1Z1IA 4ZXXH 2FZZA 3QZRA 3SJ9A 1D6RA 4Z6AH 4UFGH 3PM3A 2W7SA 1WV7H 1O3PB 3MNXA 3SNCA 4NIXA 2BY6X 3LC3A 1UTLM 4XFQA 1FLEE 4AG2A 5F6MA 3D65E 4I31A 2GZ7A 3ODDA 1T8MA 1YC0A 1O37A 1RD3B 1TBRH 1YPEH 3QTOH 4WJG2 3ZZAA 2XTTB 1C1QA 4JZIA 1EQ9A 2Y81A 1UTPA 5L6NH 1EJMA 3QGJA 2A4RA 4GPGA 1LO6A 1HAXB 1SBWA 2O8LA 4AB8A 4KGAA 1DLKB 2HNTE 4I8JA 4B2AA 4AB9A 2FODA 2SNWA 1HGTH 5A8YA 2ZZUH 1CA8B 8ESTE 3GY7A 3V3MA 1O3GA 1MCTA 3SV7A 2BLWA 1ZOMA 3URDA 1C5QA 2HVXA 4TPYA 1KDQB 1HXFH 4JYTA 1BUIA 1C5LH 3Q3YA 1TGBA 1QTFA 1RRKA 3VFEA 2A1DB 3RXEA 1BTPA 1NC6A 1O2XA 5JPMH 2ZC9H 2WPJS 1JXPA 3SU2A 2WYJA 2BD3A 5DP4A 1J9CH 1F5KU 2R3YA 1TX6A 3HGPA 2PTCE 1IQNA 1MQ5A 1TNJA 2GP9B 1GGDB 3B8JA 5EPYA 1QL7A 2WPMS 3I29A 4GAWA 1JMOH 3T29A 4NCYA 3M5NA 3BTGE 1AN1E 5F8ZA 4UFEH 1RTKA 3TK5A 2Z9IA 1GMHG 2TGPZ 1HJAC 1HYLA 1F0RA 1O33A 2Z7FE 1ELFA 3EA7A 2R2MB 4WXIA 2Y80A 2ZKSA 4UDWH 2BZAA 1Y3XA 3GCOA 1HAIH 1O3IA 1AU8A 1C5YB 2R0KA 3SI4H 5L2ZH 2V3HH 1HUTH 1GJCB 1O2GH 2Y7XA 1BBRE 3RXOA 3MU4A 3ATIA 4NWKA 1NTPA 1S0QA 1S85A 2XW9A 1C1PA 1GJ6A 2ZNKH 3BTME 3QZQA 2VIDA 1DITH 3ZZDA 1THRH 1FPHH 3QDZB 4WXVA 4YO9A 1V3XA 3ATKA 1PPZA 1O31A 2QXJA 1ANDA 4OS6A 5DP3A 1HAGE 2ZFQH 1HNEE 1O2ZA 1EAXA 1O3JA 2BY7X 3I78A 1BTXA 3ZV9A 1QCPA 1F0SA 5E8EH 3E16B 2BOHB 1A7SA 4U01A 3H7OA 5F03A 1WAYB 1TRNA 4MPUA 1IQIA 1GJ7B 2UUFB 3VB6A 4X2XA 1OP8A 1O2MA 6ESTA 2P3UB 3PTBA 4CRDA 3M5LA 2JH0D 3BG8A 1P0SH 2XBXA 1EATA 3UR9A 5EW1H 4TPIZ 2YNBA 3LDXH 4B73A 1P2IA 4I8LA 4A1TA 1Y5BT 2STBE 2XCNA 1A3EH 1SGQE 3EQ0H 2XNIA 1K1MA 2AIQA 1XKAC 2A31A 1O36A 4YT7H 2VGCB 2ODPA 1GJDB 1O2PA 2BZ6H 1Q2WA 2NWNA 1BBRK 3TK6A 4K3JA 4IMQA 2BVSH 4INKA 2ODYB 2HPPH 1UJ1A 3T25A 8GCHG 1GDUA 5LGOA 2OINA 2ZFSA 3T26A 3UY9A 1UCYE 3BTQE 1IQHA 1KXAA 5IYTA 3QLPH 1C2IA 2HRVA 1UTQA 3M5OA 3QO6A 2B7DH 2A7CA 2XWBI 4B1TA 1NPMA 3BSQA 4X1QU 2QAAA 5L2YH 1GCDA 1V2PT 3UR6A 3BTFE 1ARCA 1UK3A 2OD3B 4X0WU 3VB7A 1K2I1 1F92A 2WPHS 3HK6B 5J4SA 1AFQC 1O2TA 2BD4A 3SGBE 2FOHA 2BTCE 1W7XH 4NA9H 1Z6EA 1O3MA 1THSH 1WBGB 4E06H 2IOTA 4K8BA 1GBFA 3A7XA 2FESH 2FDAA 3FP7E 3AAVA 2Y5FA 3KNXA 1DFPA 2VU8E 2STAE 3QTVH 3SBKA 1GHVH 1P9UA 1SC8U 1GBHA 2BYAX 3E90B 3TU7H 7GCHG 1O2QA 3KQEA 2ZHFH 1W3CA 1A4WH 1ZMNA 1ZPZA 1TX7A 1IQJA 2ESTE 1Y5AT 4A6LA 1NESE 3BIUH 1AD8H 2J2UA 2NU1E 1QIXB 1Z1JA 1OYTH 1SQTA 1XUJA 3SJ8A 3SJKA 1BRAA 4J1YA 1V2VT 1JWTA 4MTBA 4NA8A 3ZVGA 3GYLB 3TH2H 4F4OC 5T6GA 2BLVA 4ZXYH 4ZHLU 2FI3E 1P09A 3UFAA 1JBUH 1TA2A 2ANMH 1OP2A 1GMHF 2PGQB 5JYIA 1EZUC 1O3LA 2FX6A 3PYHA 1DSUA 1QRXA 2QA9E 3RXDA 3C27B 2UWLA 1LQDB 4A1VA 2FI5E 3RDZA 1L1JA 3UTUH 1BRBE 2SGDE 3NZIA 1Z8RA 3RXGA 1CA0C 4FUCA 2BVRH 1GJ5H 1C5SA 4RN6A 1SPJA 3VB4A 1UCYK 1Y8TA 1EASA 2ZGXH 3SHAH 1MTNB 1O5GH 1DWDH 3LKWA 3FZZA 1MH0A 2RG3A 1GJ4H 2VINA 2EI7A 1QFKH 2HALA 1LVYA 2JKHA 1K28D 4CHAC 2VIVA 3DA9B 1EJAA 1P3CA 1F0UA 1OYQA 2YNAA 1T8OA 1WU1A 3LIWA 3JZ2B 1PPHE 1D3PB 1TBQH 2DE9A 2HOBA 2GDDA 5K7RA 1G2LA 3BV9B 4IBLH 1G3EA 3RMNH 3HK3B 2FO9A 3PLPA 3MOCA 1VGCB 2A4GA 1CBWC 1G3CA 1PQ7A 2SGAA 3VXFH 1VITH 7ESTE 4CRAA 1ZZZA 5EW2H 1DWCH 1AKSB 2ZTZA 4NA7A 2BHGA 2BDAA 5FXLA 1FI8A 1M9UA 2NU4E 1C1UH 3ZZ7A 5FPYA 1DXPA 2FOEA 2J4IA 1L2EA 1XKBC 1SQAA 3STJA 4BXSA 3UOUA 2ZQ2A 6CHAC 4HFPB 1XMNB 1NU7B 1O3AA 1MAXA 4TY6A 1CHGA 1C5NH 1C5MD 3TPIZ 1W10U 2AGEX 4FUHA 4WVPE 1C5TA 1P12E 1HCGA 1YPHE 2H1UA 2BD2A 2JETB 4KP0A 1AUTC 3GY6A 1GVKB 3GY5A 4BAMB 2PKAA 1DXWA 1GI1A 5GDSH 3SU4A 1TRMA 4MPWA 2PV9B 2Q1JA 2C93B 4YLUA 2AMDA 1OKXA 3LGYA 4BAHB 1HAYB 1P11E 4FVBA 4D76A 4DVAU 2EA3A 1BITA 1D9IA 1V2WT 1AQ7A 3KHVA 2ANKH 2FM2A 3PLKA 1N6YA 4OS7A 4U30A 2FWWA 1OWEA 1RTFB 2DE8A 2QYIA 1GJ8B 1J14A 3OY6U 8GCHF 1LHGH 1IQMA 1AWFH 4CRFA 1KLTA 2A5IA 4AFQA 1YCPH 5C5NA 1TGTA 1AZZA 5EGMA 1GMDG 2ZDVH 3A7YA 4UFFH 3VGCC 3BIVH 2ASUB 3TLOA 5CMXH 1GBJA 4MNYA 5DP6A 4I8GA 1FV9A 2Z9LA 4ASHA 5C20A 3BTHE 3RM2H 1LVBA 3RXCA 2VWLA 3RC4A 2AFQB 1J16A 1GHAF 1GMCG 1GI3A 3UIRA 1D6WA 1GL0E 1BCUH 1O3DA 2FS9A 1O2YA 1HFDA 1CHOF 3A80A 1G37A 4I8KA 1E37B 3SI3H 5JB8S 2QXHA 1BTHH 4ABDA 8KME2 1F0TA 4O3UA 1EUFA 2G00A 4YZUA 5GXPA 1E34B 1XM1A 4Y6DA 1H9HE 1SFIA 5TJXA 1Z6JH 7GCHF 3LU9B 5K0HA 2PR3A 1E36B 1XXDA 2ZGCA 1OS8A 2BVXH 3P8FA 1YCPM 1AMHA 3K6ZA 1TPSA 1C4V2 4DIHH 2A4QA 1JIMA 1NRQH 1TB6H 3GOVB 2K1QA 1BHXB 4UE7H 2YOLA 1AVXA 1O30A 2SFAA 3MTYA 1S6HA 4OGXA 3DFLA 1P9SA 2AIPA 3M7TA 4DGJA 1QHRB 1TPPA 3SV2H 3UWJH 4Y8YA 1EKBB 1TX8A 1O5FH 1AE5A 2C8ZB 2GT7A 2G81E 4ABGA 5BRRE 2PWXA 2RCEA 1Y5UT 1ZHRA 2CF9H 3ZYDA 1WCZA 4IN2A 7LPRA 1SB1H 1LPGB 1VR1H 4X6MA 5FX5A 1GGDC 2BD9A 1C1OA 3PMAB 3ZVBA 3MO3A 5A0BA 1XUFA 4ISIH 2ZGHA 1H1BA 3A84A 3RXSA 1BA8B 2Z9GA 4RKOB 3U1IB 4E05H 5C1UA 2PUQH 4FUBA 4XBCA 1S81A 3RM0H 1W7GH 2UUYA 1MD8A 3KQCA 5A2MH 3LGTA 4NFEA 1ESBA 4GHTA 2F9OA 1YLDA 1RIWB 4O03A 4BOHA 4ESTE 1ZLRA 3RXBA 4HI3A 4Y71A 4ABEA 2FOGA 2PSYA 2AGIX 1MQ6A 3K6YA 2BD8A 3MH5A 1BB0B 1T8NA 2ZDNA 1HDTH 3I77A 2ZIQH 1ZHMA 1H8DH 2A2QH 3SGAE 1GJBB 3T5FH 2W3KA 4NIYA 3M5MA 2H9EH 2FOBA 4Q2KA 1SR5C 4RKJB 4UONA 2TGTA 3PMJA 1DE7H 1EAUA 4XBBA 1MKXK 1MMJN 1OWJA 2NU0E 1TE0A 1BRUP 1V2NT 2FOMB 4B2CA 1HLTH 4Y0ZE 4YM9A 1FAXA 4D7FA 1BJVA 2FOCA