5F8XA

The crystal structure of human plasma kallikrein in complex with its peptide inhibitor pkalin-3
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
b'IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasma kallikrein
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title The Crystal Structure Of Human Plasma Kallikrein In Complex With Its Peptide Inhibitor Pkalin-3
rcsb
total genus 55
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8xA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8xA01
1YPHE 1GJ5H 1MZAA 2ZGHA 1QB1A 2AIPA 4O3TA 1O3AA 1J8AA 2HNTC 1W0YH 4O3UA 2ALPA 1ELCA 2XXLA 4CREA 1GHBF 3P8OA 1Z1JA 1BJVA 1BTHH 1P09A 3GISB 3P92A 1O3CA 3E8LA 2VINA 3LJOA 1SG8B 2HGTH 3GY5A 3SUEA 1GI5A 3NZIA 2R0LA 1Y59T 5C5OA 1GMDG 2BX3A 2BZAA 4O97A 4A5TS 1TPPA 1DLKB 3LIWA 1QJ7B 3M5OA 1TBQH 2THFB 4OGYA 5FHTA 1AFEH 2JH6D 4MTBA 1GJ9B 1O3JA 1TFXA 1NY22 4O9VA 4NFEA 2P3FH 4HFPB 1KTTB 1EAIA 2PKAB 2A45B 3U8OH 1P06A 5ESBA 2ZTYA 1YP9A 1GI4A 4SGAE 2Y81A 2A0QB 3LGIA 3PLPA 1IQEA 2SGQE 2GP9B 2XNIA 3A82A 1GCTB 3L3TA 2FPZA 1C2KA 1OWHA 1LPGB 3ZYDA 3V12A 4DIIH 2J2UA 1ACBE 2FMJA 4GUXA 2BDCA 4ZKNU 1PYTC 3UTUH 2GGVB 4YT7H 1L4ZA 1WSSH 4AB8A 1F2SE 1T4UH 1FONA 3FP7E 1BTYA 4X8SH 1XUGA 4MLFB 5BRRE 3UY9A 4DGJA 1TRNA 5E0GA 2Y5HA 2ZDNA 3KHVA 1C9TA 1ELGA 1QNJA 2AYWA 4ZROA 1TRMA 2CHAC 1LHGH 1BRAA 1H4WA 3U69H 1AZ8A 1GBTA 3BF6H 1GI0A 4BXSA 2A2QH 4IS5A 2QF0A 3SHCH 4IMZA 4HTCH 5C2ZA 1EUFA 1VCQA 5E2OA 5FPYA 3F9FA 3GCTG 3A8CA 1MTUA 1VJAU 3K6YA 3MU8A 5EPNA 3H7TA 2IPHA 1MU6B 3RXGA 1GHVH 1B7XB 3PTNA 4CR9A 2EEKA 4WXIA 1KLIH 8LPRA 2SGEE 1E34B 3LONA 2H2ZA 1UVTH 1ZTJA 2OINA 1Z7KA 1OX1A 2HWLB 4JZEH 2BD4A 1UVPA 1ZSLA 3E0NB 3VB4A 1KDQB 3BEUA 1YYY1 2XBYA 1C5LH 1NFYA 1IQLA 3AW1A 2R9PA 2FOBA 1DS2E 1HAGE 3LGYA 1G30B 3TJUA 2VU8E 3V13A 1IOEA 1KTSB 2VWOA 2ANMH 1HAYB 3SUGA 4K3JA 3GDSA 1O5EH 1SPJA 3EAJA 3LGUA 2QCYA 3ATWA 2VIPA 2BDHA 2QIQA 2FP7B 1O3MA 4AYVB 1PPGE 3O8DA 1SVPA 1NFUA 2JETC 3N7OA 2Q6FA 1SLVB 4FUEA 4GHTA 3U1JB 5CHAC 1C9PA 2BVRH 2ZHEH 1SGEE 4IW4E 1Z8GA 3VB6A 4GPGA 1DFPA 3PYHA 3VGCC 2PV9B 4NWKA 2QXGA 4Y71A 1FY4A 2V35A 1O5FH 1BT7A 2Y7XA 1A5IA 4KGAA 1C4Y2 3F9GA 4BOHA 3SV2H 1P12E 1UVUH 1UTLM 1PYTD 1EJNA 2FOHA 2BOHB 4ISNA 3UWJH 3S0NA 2TIOA 2GZ8A 4Q2KA 4GCHG 3V3MA 1YKTA 3RP2A 2TGAA 3A83A 4Y6DA 1O3NA 3B8JA 4UFFH 2BB4A 2ODYB 2STAE 1M9UA 1AKSB 1O3GA 1LPKB 3HGNA 1LO6A 2JKHA 4DW2U 4ZHAA 2UUYA 1XXDA 2ZGJA 3AAVA 4K60A 4A92A 2BXTH 1GL1A 2FM2A 1JBUH 5ESTE 3STIA 3VXFH 2AMPA 3FZZA 1NESE 3LJJA 2ZGXH 1P2NA 3OYPA 4K8BA 3TPIZ 4FXGH 4B73A 1QL8A 1GMCF 1XUIA 3ZVAA 4X2VA 2W5EA 1XVMA 4X6PA 3RMNH 2JH0D 3RXKA 2H5DA 1K1OA 1TNLA 1DY8A 3R3GB 2A7CA 3MH7A 3NK8A 1A61H 2ZEBA 1F5LA 3A89A 1U6QA 5AHGH 5JB9S 3SNDA 1T4VH 2ODPA 4Y79A 1PPHE 3A7TA 1Y5BT 1C1SA 3A85A 1CA8B 3HKJB 3ZVBA 4ZKSU 1JOUB 1ORFA 1CA0C 1O30A 3TIUA 2VGCB 1RJXB 1C2HA 2Z6BD 4K5ZA 1ESTA 4MPUA 2FEQH 1S85A 1GJ4H 1BMMH 1SLXB 3PLBA 2OP9A 2WPMS 3SQHE 4NIWA 1VITG 2IJOB 3SGQE 1PPFE 2D8WA 4OS5A 1PPBH 3PV4A 5A09A 1C5YB 3TLOA 3T26A 3F9HA 1A5GH 3TGJE 1ZTLA 2J34A 4LZ1H 1HPGA 1V2LT 1YBWA 1DPOA 1HGTH 1K22H 1AHTH 2BDIA 3LPRA 1UTQA 4A1VA 4CHAB 4INLA 2C8ZB 1P2MA 4KTSA 5EOKA 1QRXA 2AFQB 1SI5H 1TGTA 4X1NU 2G8TA 3KIDU 4NIYA 4B1TA 1O3FA 2ZTXA 1P02A 4K69A 2QAAA 2FOAA 3S69A 3SU2A 1UK4A 3GCTF 4K1TA 5EODA 1O5AB 1CBWB 3PLKA 1B0EA 2BDBA 3RXAA 3QN7A 4NIXA 3TH2H 2G4UA 4QT8C 1Q31A 1OWKA 4DIHH 2WV4A 1UO6A 2IOTA 2F9OA 4KP0A 1D3PB 1WOFA 5F8TA 3SW2B 2QXIA 5JBCS 1QJ1B 1GHWH 1P2IA 1N6YA 3E90B 1QURH 1BRUP 1WQSA 2GCTC 5BPEA 1OSSA 1NT1A 2V6NA 1V2QT 1BQYA 5JBAS 4Y10E 2XBVA 4AFUA 2ZFQH 5AFZH 3QUMP 1GDNA 1IQKA 1O3EA 3M35A 4WH6A 2OUAA 3RLWH 4AORA 1FQ3A 3P70B 2Y6TA 1C2GA 1YCPM 1LVOA 5C1YA 1AY6H 1NRRH 5HXFA 2NU0E 2ANYA 1TGNA 2KAIA 5ABWA 2M5TA 4AN7A 4NA7A 1H9LB 2VVVA 1FIWA 2EA3A 1W12U 1TX8A 1KXFA 3QGNB 2PHBA 1O2KA 3BTKE 3KF2A 3RM0H 3RLYH 1FLEE 3U8RH 1TGCA 3FVFB 1MBMA 3D49H 3B23B 1DWEH 2C90B 1SOTA 1BTXA 2OD3B 1YCPH 5LH8A 1DANH 2ZECA 5LGOA 1ZGIA 1SOZA 1ZPZA 1P9SA 3SNBA 1Y5UT 2ZFSA 2WV5A 3ESTA 2ZP0H 1ZRKA 1V2NT 2BMGB 2BY5X 1W14U 3H7OA 2ZU2A 1P01A 1EZUC 4JCNA 1C5WB 3D62A 1NS3A 3OY5U 5B6OA 1FJSA 3KL6A 3NXPA 4MPWA 4XSKU 4Y7AA 1S82A 1O5DH 1Y3YA 2BDGA 2FESH 5EQRA 1HFDA 2VIDA 1O2JA 3ZZ4A 1SC8U 4UEHH 1MH0A 4AFQA 5HYOA 2QF3A 1ARBA 4ZMAH 5GXPA 3HPTB 4IN1A 1UTNA 3RXFA 4ISHH 3T28A 2OC7A 1MCVA 1DXPA 2A4GA 1TLDA 1SBWA 3RC5A 1MTNB 4JMYA 1EPTA 3RXJA 1EKBB 1XX9A 1ZGVA 5CMXH 3ZZ5A 2SGPE 1K1MA 1O33A 3E6PH 3Q76A 3RXMA 4CBNA 4GAWA 2OC8A 1L1GA 3A7YA 1GHYH 1UTJA 1T7CA 3V7TA 1QRZA 1GHXH 4NG9H 1GI3A 2PLXA 1DDJA 3RC4A 2GMTB 3MYWA 2C4FH 2SGDE 3DA9B 3ZVGA 1HB0B 5F6MA 1P8VC 1W11U 1O2PA 2AGIX 3GCHC 1OS8A 4GHQA 1C5ZB 1O3PB 2AGEX 1KXCA 2GTBA 2ZFFH 2A7HA 3SN8A 3MH5A 3ZZ7A 4JK6A 3ZZ8A 5J4SA 8ESTE 3CS7A 3URDA 4HGCA 4WMEA 3QWCH 3QZQA 2C3SA 1THRH 3BSQA 3UNRA 6ESTA 3PM3A 1ZHMA 2CF8H 4MPVA 1AN1E 1ETRH 1HCGA 1O34A 1YLDA 2C8YB 1SR5C 2NU2E 4K2YA 1MKWH 1RD3B 2GCHF 5SGAE 1FDPA 1LHEH 2UUJB 2OLGA 1ARCA 1MD7A 1O3IA 3TH3H 2FOFA 2BLWA 5GJ4B 4FVBA 5A8ZA 3IITA 5GCHG 4AX9H 5FPSA 3S9BA 3ODFA 1C5TA 5EW2H 1TNHA 4IMQA 1CSOE 3L6PA 3VB3A 4ABEA 1DT2A 1CQQA 1JXPA 5E0HA 2ZA5A 3QO6A 4BTUB 1C1PA 3BG4B 3M5MA 4I7YH 1W2KH 1EB2A 1EAXA 1EOJA 4BAMB 2PSYA 1GJ6A 3SV8A 1ESAA 1SGYE 2GVFA 2ZKSA 2P8OC 3ZZCA 1DWBH 1C1TA 1QQ4A 1K1IA 4FUDA 2QN5T 1F0TA 2JH5D 2D2DA 1CE5A 2O8UA 2ZU1A 4NWLA 3QX5H 1H9HE 2XYAA 3P17H 1HAIH 3U8TH 4FUCA 5FBEA 3ELAH 2VB0A 2ZFRH 2DUCA 1BUIA 1RGQA 1EXFA 4FUIA 5GDSH 2Y7ZA 1L2EA 3BEFB 4O03A 2ZIQH 4I32A 1BDAA 2LNCA 1UK2A 2BYAX 3KN2A 3ODDA 3M5NA 3SV6A 1EATA 3QGJA 1XUKA 1OXGA 1IQJA 1DX5M 1WTGH 4E06H 2P3TB 5L2ZH 3EGKH 1O32A 3RXIA 5I25A 7GCHF 3ATLA 1C5RA 1CHGA 1H8IH 5TCCA 4HZHA 3ZZ6A 3QLPH 4Y8YA 1Z71A 1AKSA 1GMHF 1ZJDA 1BBRE 2GCHG 4Q7XA 4BAHB 3DD2H 1E0FD 1IHTH 4X0WU 2WINI 3F68H 2YOLA 5DO4H 3MO9A 3NPSA 1RTKA 1K21H 5DP4A 4DOQA 1Y5AT 4K1EA 2A7JA 1QHRB 2ZHFH 2XC0A 1P03A 5HMAA 1K28D 1FV9A 1PQ8A 3A86A 3D65E 1P2OA 3SU1A 1QTFA 3T2NA 2TGTA 3TK9A 1YPMH 3S7HB 4X6NA 4B2AA 3LGTA 3M37A 2PW8H 1O2QA 4NGAH 3RXLA 2BD5A 4NFFA 5A0BA 3ATKA 2OCVB 5DG6A 4XFQA 3RU4T 4YLUA 1WU1A 1CA0B 4UFDH 4WF8A 1P2QA 4RSPA 3TU7H 2ZHWH 1A46H 1J14A 4KELA 4X2WA 4KTUA 2WPIS 2FO9A 2G52A 4IGDA 2QC2A 1O39A 3O8CA 1SQOA 1GL0E 3DFJA 1UTOA 5DP6A 1GBLA 2C8XB 2XCNA 5ETXA 1AO5A 1GGDB 1YF4A 1MAXA 5FBIA 3MNCA 1O2HA 2OTVA 4YESB 1AFQC 1NRSH 2QY0B 1ETTH 3E91A 2P95A 2ZFPH 3EA8A 1GDQA 2ZQ2A 3GYLB 4JYUH 4Y0ZE 2NU1E 1W7XH 1ANBA 2BLVA 2TGDA 1LDTT 3MNSA 4CHAC 3LH1A 1V2TT 2YNAA 2B8OH 4JZFH 3MOCA 3SZNA 4NCYA 2LPRA 2PKAA 2GDDA 3E3TA 1V2OT 4WVPE 3A7WA 1OYTH 1N8OC 3KNXA 2F9UA 1SFQB 1CT2E 1UVOA 2VVUA 1GHAG 1GVLA 5T6DA 1TPSA 2A1DB 2XBXA 4WWYA 3Q3KA 5FXLA 3ENSB 1W3CA 2FTLE 1JIMA 2XRCA 1SGCA 1LHCH 3W95A 1UMAH 1TPOA 4UE7H 3UPEA 4ZXXH 5I46H 2BY7X 2VIOA 3SHAH 5C3NA 2FI3E 1T8LA 1OWIA 1Y8TA 1WQVH 2A32A 2BZ6H 2VIQA 2Y82A 1YPLH 4E7RG 3GY7A 2Y5FA 4DG4A 1QB6A 1S6FA 2BVXH 1K2I1 4JZ1A 1O2SA 2I6QA 1AVXA 1IQNA 2WPHS 1H8DH 3S9AA 1C2IA 1BB0B 1OOKB 2A4QA 3Q00A 2ZO3H 4UDWH 3BTEE 2CN0H 2ILNA 4ASHA 1KLTA 2FOGA 3DFLA 1UCYH 4UFEH 1GG6B 1YPHC 4GVUA 4AOQA 5AFYH 2PGBB 1TNIA 1BRBE 4X2YA 3EQ0H 4DCDA 4JYTA 4KKDA 1D9IA 5C1XA 5EXMA 3U9AH 3PWBA 1CGJE 2ZQ1A 1MTVA 1QBNA 2VH6A 1GCTC 3E16B 4SGBE 5JYIA 1L0ZA 2SGFE 1K1JA 4X2XA 2G5NA 2BDAA 2AIQA 1K1NA 3LDXH 3B9FH 1TOMH 3UR6A 1ELEE 4DY7B 1GBMA 1O2TA 3GDUA 1A3EH 1LHFH 4RKJB 7GCHG 2SGAA 1WYKA 3CENA 3RM2H 1JRSA 3BTDE 1B5GH 2BM2A 1BMNH 1GJ8B 1TB6H 1MBQA 2DE9A 1SQAA 3KGPA 1G36A 1SGTA 1JMOH 4X1SU 1W13U 1VR1H 1BA8B 1AUJA 1UHBB 1HAZB 3DHKH 2WPKS 2CGAA 2VWNA 2AH4X 3BV9B 3SU6A 1HRTH 4ZH8A 3TK5A 1C5XB 6GCHG 5LPFA 2HRVA 3RXVA 1C4U2 2H6MA 1IQGA 1TBRH 1HUTH 1CVWH 1W10U 3RXTA 4JZDH 3C1KA 1VZQH 3I29A 1E38B 2ZG0H 2ODQA 1V2ST 7ESTE 2BDYA 1YPGH 3OTJE 1FY5A 2VWLA 1EB1H 1MMJN 2BXUH 4AG2A 1DXWA 1GBKA 5EQQA 1C5UA 1LQDB 1C1OA 1E35B 4GLYA 1CT0E 5JDUB 1UTMA 3TJVA 3MNBA 2GZ9A 1AE5A 3SI4H 2FODA 1CGHA 2PUXB 1BHXB 3Q77A 2BD8A 1EP5A 1YCPK 3P8NA 3LC5A 1QFKH 2V3OH 1EPTC 3PMAB 1EP6A 1C2FA 3FP8E 2PGQB 1BJUA 3IWMA 5DP5A 2QGRA 1MQ6A 2H9EH 3AASA 1TA2A 1WTHD 2AMDA 1SGFG 2VGCC 1IAUA 2FTMA 3S9CA 1LQEA 1VGCC 2CMYA 5FX6A 1LCYA 3O8BA 5LPRA 2B5TB 3EDXB 4X1PU 1C1WH 3GOVB 1T32A 1C1VH 2P3UB 2A31A 4Y8XA 3RMOH 1C2LA 1GBHA 2P8OB 2F3CE 3SU4A 3HATH 1HIAB 1GBJA 1O2OA 1TIOA 2W7UA 1KDQA 1HBTH 3UWIA 2VJ1A 1BTPA 3ZVCA 5EU8A 2P16A 1KIGH 1F92A 2Z9JA 5A0AE 1K1PA 2J95A 4FVDA 1ZHPA 3PMHB 1ZSKA 3OX7U 1DY9A 1WCZA 3MU0A 2ZGBH 3GY8A 2GX4A 1O36A 1MTSA 3AW0A 2HOBA 4FU9A 3SU0A 3LGWA 5JBTA 1QA7A 1PQ5A 5EPYA 1GBIA 4UD9H 3JZ1B 3SV9A 1P11E 2ZCKP 1BBRK 4E05H 2CF9H 3NUMA 5A2MH 5T6FA 1RRKA 1AB9B 4FUBA 5C67A 2BD3A 4TYDA 3QDZB 1AE8H 1GBEA 3CP7A 3SQEE 2QA9E 4DJZB 3SUDA 3OU0A 1KLJH 3RXPA 1A3BH 1GHAF 1TNKA 2O8MA 5DP7A 4I31A 1XKAC 1AMHA 3MWIU 2B0FA 4J1YA 4VGCC 4JYVH 1XVOA 4MNXA 3UIRA 4AGJA 2BQWB 3K6ZA 1TQ0B 3TITA 1O37A 4YT6H 3GY2A 1IHSH 4X6MA 4FUHA 1NU9A 2OBQA 4U32A 1QBVH 4AZ2B 3SJIA 1BTUA 1D3DB 5EXLA 3URCA 1TBZH 4Y11E 3UOPA 1L1NA 4D76A 2EI7A 2BTCE 1HAPH 1PJPA 1TE0A 1ELTA 1AU8A 2A5KA 2H5CA 3SNCA 3ZZBA 5F8XA 3A84A 6CHAB 1A0HB 2HPQH 1DUAA 1LVBA 1V6DA 3FP6E 1F5KU 3RDZA 1OKXA 4B2BA 1HAOH 1WBGB 1TMUH 4BAQB 1TABE 3ZZ3A 1S6HA 1JIRA 1GI9B 1ZJKA 4YLQH 3ZV8A 1Q3XA 2GKVE 4CRCA 3E1XB 3QTVH 1FAKH 3TGIE 3A88A 3SOSA 4ISLA 3LKWA 2ESTE 5TCAA 1DOJA 2AS9A 2GV7A 1ZYOA 1SGFA 4D7GA 1PPZA 4A7IB 1GVZA 1AGJA 1Z8RA 5AF9H 1W7GH 3SV7A 1J17T 5L6NH 2ZHQH 1QJ6B 1V3XA 3P95A 1SHYA 2KAIB 2ANKH 3RXCA 5C1UA 3FAOA 1V2MT 2G4TA 4CRBA 1C5OH 1HIAA 1CHOG 1QA0A 2R2WU 5EGMA 1GBAA 3NKKA 1ABIH 4RKOB 1EX3A 1SQTA 3BTHE 1GMHG 1G37A 1W0ZU 1MU8B 3BTQE 3VB5A 2H9TH 1TNJA 1EAUA 2P59A 2P94A 3PO1B 1VGCB 3PB1E 4CRFA 4UFGH 4NIVA 1S0RA 1P2JA 1HJAB 1HJ8A 3KQCA 1CU1A 3BTWE 4U01A 4Z6AH 1XM1A 2PR3A 1S81A 1OP2A 2PTNA 3ZYEA 3TJNA 5GPIB 1VCPA 3LOXA 3EA9A 3ZZAA 9LPRA 1QB9A 1TALA 2FXRA 1O3OA 5EG4A 2VH0A 1N1LA 2PSXA 3TH4H 1QIXB 3A81A 5FPTA 5F8ZA 1HV7A 4OS2A 2FLBH 1LTOA 2FS8A 2XW9A 4IN2A 6LPRA 2XC5A 2ZU5A 4MG3A 3MNXA 5EXNA 3R0FA 1O5GH 4D9RA 1A1RA 2FI4E 3FZDA 4XBDA 3GCOA 1CO7E 1YLCA 2BD7A 5T3HA 5LPEA 4DURA 3G01A 1O5BB 3T27A 2QXJA 1HAHH 3TJOA 3FANA 4CR5A 1FPCH 4YOGA 2W7SA 3W94A 1V2RT 2GZ7A 1YGCH 1ELDE 2Z3CA 8GCHF 2DE8A 2ASUB 3ZVEA 1F0UA 3L33A 2IN2A 4XDEA 4ABBA 1QR3E 1O2IA 4CRAA 3DT0H 4NSVA 1GI8B 1RIWC 5G4BA 1P3EA 3KQBA 1Z8JB 1UCYE 5L2YH 1XUJA 5CE1A 1NC6A 2G55A 1GI1A 3AAUA 8GCHG 3ITIA 2UWOA 3M3SA 1S5SA 1JWTA 4GCHF 4B2CA 3RMLH 2ZFTA 1AD8H 1IQHA 2VIWA 1O5CB 1HXFH 1QL7A 5IDKA 3SJOA 2CHAB 5IYTA 1CT4E 1GBBA 1OWDA 2O8TA 2ZZUH 1AUTC 1AVGH 4NZLA 1YM0A 1ZHRA 3HKIB 2TGPZ 1DVAH 2BVSH 1P2KA 1F5RA 1HAVA 2C8WB 2FZZA 3WY8A 2GD4B 1RFNA 2BY9X 1C1QA 3ATIA 2OQUA 1MTWA 3M36A 4NA8A 3T5FH 1GHZA 2OQ5A 3A87A 1TX7A 3KCGH 2A4OA 2OC0A 4HI3A 3PMBB 4LXBH 1Y3UA 2P93A 4TPIZ 2GDEH 1FPHH 1OPHB 4I8KA 2ZDAH 3PTBA 2HPPH 3UNSA 4WMFA 4ABDA 4Y7BA 5H4IB 3ZZ9A 3K2UA 1GHBG 2OXSA 4KTCA 1BMLA 4I33A 2WYJA 5T6GA 1SHHB 1DE7H 1FUJA 2HNTF 1ZPBA 1QL9A 1S83A 1O2RA 2FYQA 1TA6A 2Z3DA 2HALA 1VCWA 5GCHF 2PKSB 4B71A 1L1JA 1OYQA 2CV3A 1XKBC 2O8WA 1D3TB 2ZDLA 2F9PA 3U1IB 1TRYA 1IQIA 1C5PA 5K0HA 2V3HH 1CHOF 1C4V2 3ZZDA 2FS9A 1H1BA 3PWCA 4MVNA 1HAVB 1MQ5A 4BXWA 3EYDA 1B0FA 5E2PA 3TGKE 2UWLA 2G81E 2PUQH 1GBDA 1P57B 2ZU4A 3TNSA 1OP8A 2ZDMA 1D6WA 1HJ9A 1KXDA 2J4IA 1V2WT 5L30H 2XWAA 1P10A 4ZUHA 1FIZA 1LKAA 2VNTA 3M61U 3NWUA 1GJBB 2AMQA 1OWEA 2J38A 1C5VA 2SFAA 1D4PB 1NU7B 3A8BA 2RG3A 3A7VA 3F1SB 4H6SB 3BTME 1IQMA 4X8VH 4JZIA 2ALVA 1C1RA 2BQ6B 2VVCA 1O35A 1LKBA 4OS1A 4X8UH 1KXBA 5JPMH 4LK4A 1HYLA 4MQAA 5PTPA 3D23A 5DKMA 1G2MA 2W3IA 1UTKA 4MNYA 4AB9A 4ZAEA 1F0SA 1ESBA 3LT3A 5F03A 4WH8A 4D8NA 2NU3E 1Z8IB 4ABHA 1J15A 1O2YA 3EA7A 4DVAU 4ABAA 1SL3A 1GI7B 2ZPRA 2GCTB 3MMGA 1LMWB 1Z6JH 3MH6A 5CHAB 2SNVA 3UOUA 4CBOA 1BOQA 1YPEH 3BG4C 1C5NH 4B74A 3M5LA 2PWXA 1PQAA 4WY3A 3SGBE 1SGNE 1GJCB 4OS7A 3HK6B 3KEEA 3VFEA 4YOJA 1C5QA 1PPCE 1GBFA 1D6RA 5EQSA 1QBOA 1GJ7B 1NRQH 2FOMB 3H5CB 4INHA 3VGCB 3GDVA 1EQ9A 3K65B 1BRCE 4ESTE 2F83A 1RTFB 2J94A 4FUGA 2GT8A 1GMDF 1G32B 1A0JA 1O2GH 5A8XA 4Q7YA 1EAWA 1RS0A 2EC9H 4K1SA 4R0IA 2BOKA 1TQ7B 2BD2A 3ZVFA 1D3QB 2H9HA 1G9IE 1UTPA 2G51A 2RDLA 3RXBA 1Y3XA 3BTFE 1C5SA 3GYMA 2ZTZA 4F49A 7LPRA 6CHAC 4WXVA 3MU5A 4YM9A 4Q7ZA 1VJ9U 5E0JA 5DJ7A 2FX4A 1VITF 2WPJS 2FI5E 3SJ9A 4ZXYH 5JBBS 3U98H 1H9IE 4XOJA 4F4OC 2ZWLH 1XMNB 4J2YB 1MZDA 1DWDH 1EJAA 3BIVH 1GGDC 1ZPCA 4IC6A 1ELFA 2BD9A 3AVZA 4BAKB 4ZKOU 5HM2A 1ZZZA 3P6ZB 4B76A 1LVMA 2Y5GA 1AI8H 4CH8B 1QY6A 5EW1H 3QTOH 1C2DA 1KY9A 1EZQA 4TWWA 1TYNA 1S0QA 4A1XA 1XUFA 3RXEA 1TPAE 1QQUA 1C2EA 4INKA 1MKXH 2FDAA 1GWAA 5FX5A 3V0XA 2R3YA 2RCEA 4NSYA 2OBOA 3RXHA 1GJAB 1BTZA 2PKSC 4FUJA 1O3LA 1UK3A 1T8MA 2I6SA 1LPZB 2JETB 1A0LA 2H1UA 1O2LA 2R2MB 4X1QU 3SU5A 3VEQB 4CH2B 4MNVA 2Y80A 2ZI2H 3A7XA 4IBLH 1ABJH 3RUOA 2ZC9H 1GJDB 1P0SH 3EE0B 2GMTC 4CRGA 3TNTA 1T8OA 3RMMH 3F6UH 1O2WA 3SJ8A 2Z3EA 2D1JA 1SFIA 1E37B 2OC1A 2UUFB 1O2NA 2ZDKA 1SGPE 1ZR0A 3A80A 1HJAC 2J9NA 2XBWA 4OS6A 2FLRH 2Z94A 3STJA 5JB8S 2ULLA 2Z9GA 1O3BA 3LH3A 3SJKA 5DP3A 1KYNA 2FIRH 1ID5H 2BLOA 1TMBH 4ISIH 1YPKH 2A4RA 1J9CH 1MAYA 3UREA 3NCLA 4E7NA 2VIVA 5HGGA 2WYGA 3E0PB 3SBKA 1E36B 3M3VA 3OY6U 3GICB 4YOIA 1FMGA 4AFZA 1P04A 2WPLS 1Z6EA 1AWHB 1AWFH 4TY7A 1TAWA 1Q2WA 1VITH 4WJG2 2J92A 1ELVA 1EJMA 4LZ4B 2AGGX 3BTTE 1FY3A 1K9OE 2EI8A 4H42U 1Y3VA 1OP0A 3UQVA 1UCYK 2FYRA 1YC0A 2BX4A 5HM9A 3RC6A 4A1TA 1O2ZA 2R0KA 3BN9A 3MU4A 2HLCA 1RTLA 1OWJA 1THSH 1SGIB 3SNEA 4JK5A 4LOYH 1SB1H 4FU7A 4THNH 1KXAA 2UWPA 4ABJA 1FY1A 2Q6GA 1NRPH 3C27B 1ELBA 1A4WH 4X8TH 1AVWA 1GDUA 3PROA 3BEIB 2AEIH 1XUHA 3VXEH 1P9UA 4U30A 1DICA 3DUXH 3GCNA 1FZZA 3RXQA 1IQFA 1A2CH 3RXUA 1P3CA 3MFJA 1TGSZ 5A8YA 2FOEA 3HGPA 1SGRE 1ZMJA 3UFAA 1LVYA 1V2JT 1NN6A 3M7QA 4TPYA 3I78A 1FY8E 1Y3WA 1HXEH 1GG6C 1O3KA 1GPZA 1UHBA 2W3KA 4FU8A 3VPKA 1ZTKA 3FFGA 2AERH 1QGFA 4ZHLU 1DM4B 1C5MD 3F9EA 2GV6A 1FN6A 1O2MA 5K7RA 1A7SA 5A0CA 1ZLRA 1C2MA 1XXFA 4NZQA 2A2XH 3LU9B 2CJIA 1QRWA 3MU1A 2ZDVH 3KQDA 2PTCE 1G3BA 1SGDE 1O3DA 3QK1A 4VGCB 1HLTH 1AZZA 1TGBA 1V2PT 4Y76A 2A5AA 4X1RU 3BTGE 2EI6A 1GCDA 1O2XA 4D9QA 3ATMA 5GIBA 3RXRA 2NU4E 1FNIA 4PROA 5AVDA 1G3CA 2XC4A 1HNEE 1SLUB 4BNRA 1EPTB 1TNGA 3Q3YA 1SMFE 4A6LA 3JZ2B 2A5IA 1O31A 1V2KT 4MPXA 4BAOB 4R8TB 1DSUA 2ZGCA 2Z9IA 1NFXA 4H6TA 1FI8A 3IG6B 1YPJH 4RN6A 1C2JA 1ANDA 1T31A 2ZCHP 4BTIB 5DK1A 4B75A 1NPMA 4XE4A 1MKWK 1WV7H 4ISOA 3P8FA 4M7GA 3RXOA 4TWYA 3ZV9A 1TOCB 4MNWA 2HNTE 3GCHB 1ELAA 3HK3B 4OGXA 2SNWA 4YZUA 5TJXA 9ESTA 3MI4A 2WUCA 3M7UA 2ZF0H 1PQ7A 3MH4A 3SGAE 1O2UA 2G00A 2QV1A 1ZSJA 1KSNA 4YTAA 1GMCG 3TK6A 2BY8X 2XWBI 4BTTB 1ANCA 4ABFA 2WUBA 2ZNKH 5FCRA 1TWXB 1PPEE 1ZOMA 1BCUH 2VWMA 4IC5A 2F9NA 1WAYB 2R3UA 1DITH 2RA0A 3M3TA 1BMAA 1NO9H 1MD8A 2BLQA 2STBE 1DLEA 1FN8A 1AB9C 3VB7A 1Z1IA 2HVXA 1FAXA 1O2VA 1T8NA 1MKXK 3SU3A 2O8LA 1LHDH 5DP8A 4U2WA 3SNAA 2XCFA 1NROH 3ZVDA 4Y0YE 2G5VA 3TVJB 3SO3A 1G2LA 2D26C 2Z9LA 3BIUH 1HAXB 2ZHDA 1SGQE 1EZSC 4Y8ZA 3PO1C 1F0RA 1RIWB 2NWNA 4BANB 1S84A 3UR9A 1FXYA 1BHXF 1INCA 4DT7B 4FUFA 3RXSA 4X6OA 1MTNC 1BIOA 4AGKA 2V0BA 4I8JA 2F9VA 3S7KB 1O3HA 1TONA 1C1MA 3Q3XA 5FCKA 3LC3A 5FAHA 2BHGA 4I8LA 3K9XB 8KME2 4ZHMU 1NRNH 3GY6A 3PMJA 4NA9H 1UVSH 1JRTA 2Q6DA 2TPIZ 4OS4A 3BG8A 1DSTA 1P05A 1HDTH 4XBCA 4Z0KA 3LGVA 2C93B 1EZXC 1W8BH 1AFQB 2UUKB 1BTWA 2ZPQA 4D7FA 5C20A 1AQ7A 1ANEA 2BQ7B 7KMEH 1RXPA 1N6XA 3A8DA 2QXHA 2FWWA 1NM6A 3T29A 2F9BH 3QZRA 3MTYA 3SORA 3P8GA 4I8HA 1ETSH 1V2VT 4AG1A 1MUEB 2Z9KA 2QYIA 4TY6A 2Q1JA 6GCHF 3A8AA 1N8OB 2K1QA 4UONA 5DP9A 2TBSA 2RA3A 3O8RA 3OSYA 1J16A 3RXDA 2ANWA 3GY3A 2TRMA 3T25A 1G3EA 5DPAA 3T62A 1C1UH 4YO9A 2XTTB 3CS0A 2FOCA 2YNBA 1MCTA 4XBBA 4Q80A 1GBCA 4I8GA 2B9LA 1CGIE 1TMTH 4WMDA 1NTPA 2GT7A 4CRDA 3SUFA 1ZMLA 4GSOA 2BY6X 2ZPSA 2F91A 1BITA 1ZMNA 1DWCH 4MDSA 1ZRBA 5GWZA 1BZXE 1PFXC 1O38A 1X7AC 2B7DH 1A5HA 3RU4D 1EOLA 3I77A 3UNQA 1SSXA 3GY4A 3MO6A 3UQOA 3A7ZA 1BBRH 1CBWC 1F7ZA 2O9QA 1NZQH 4K8YA 5C5NA 5E8EH 3MO3A 1SLWB 1GI2A 4AFSA 2ZU3A 1TX6A 1O0DH 2ZCLP 4AYYB 1KXEA 1L4DA 1QCPA 3SI3H 2FX6A 1K1LA 1GVKB 2PFEA 4ABIA 4ABGA 1EASA 5DGJA 1DUEA 2Z7FE 3MHWU 1THPB 2CXVA 3M7TA 1WUNH 1C1NA 3RU4E 4ZKRU 1UJ1A 1NFWA 4H4FA 1V2UT 3UUZA 1G3DA 1AIXH 3KQEA 5J4QA 2W26A 1GI6A
chains in the Genus database with same CATH superfamily
1YPHE 1GJ5H 1MZAA 2ZGHA 1QB1A 2AIPA 4O3TA 1O3AA 1J8AA 2HNTC 1W0YH 4O3UA 2ALPA 1ELCA 2XXLA 4CREA 1FX0B 1GHBF 3P8OA 5HKKD 1Z1JA 4B6EA 1BJVA 1BTHH 1P09A 3GISB 3P92A 1O3CA 3E8LA 2VINA 3LJOA 1SG8B 2HGTH 3GY5A 3SUEA 1GI5A 3NZIA 2R0LA 1Y59T 4RI0A 5C5OA 1GMDG 2BX3A 2BZAA 4O97A 3ZIAD 4A5TS 1TPPA 1DLKB 3LIWA 1QJ7B 3M5OA 1TBQH 2THFB 4OGYA 5FHTA 1AFEH 2JH6D 4MTBA 1GJ9B 1O3JA 1TFXA 1NY22 4O9VA 4NFEA 2P3FH 4HFPB 1KMHB 1KTTB 1EAIA 2PKAB 2A45B 3U8OH 1P06A 5ESBA 3UB0A 2ZTYA 1YP9A 1GI4A 4SGAE 2Y81A 2A0QB 3LGIA 3PLPA 1IQEA 2SGQE 2GP9B 2XNIA 3A82A 1GCTB 3L3TA 2FPZA 1C2KA 1OWHA 1LPGB 3ZYDA 1EFRD 3V12A 2WHXA 4DIIH 2J2UA 1ACBE 2FMJA 4GUXA 2BDCA 4ZKNU 1PYTC 3UTUH 2GGVB 4YT7H 1L4ZA 1WSSH 4AB8A 1F2SE 1T4UH 1FONA 3FP7E 1BTYA 4X8SH 1XUGA 4ASUD 4MLFB 5BRRE 3UY9A 4DGJA 1TRNA 3KYFA 5E0GA 2Y5HA 2ZDNA 3KHVA 1C9TA 1ELGA 1QNJA 2AYWA 4ZROA 1TRMA 2CHAC 2OK5A 1LHGH 1BRAA 1H4WA 3U69H 1AZ8A 1GBTA 3BF6H 1GI0A 4BXSA 1WXRA 2A2QH 4IS5A 2QF0A 3SHCH 4IMZA 4HTCH 5C2ZA 1EUFA 1VCQA 5E2OA 5FPYA 3F9FA 3GCTG 3A8CA 1MTUA 1VJAU 3K6YA 3MU8A 5EPNA 3H7TA 2IPHA 1MU6B 3RXGA 1GHVH 1B7XB 3PTNA 3PRBA 4CR9A 2EEKA 4WXIA 1KLIH 8LPRA 2SGEE 1E34B 3LONA 2H2ZA 1UVTH 1ZTJA 2KZ4A 2OINA 1Z7KA 1OX1A 2HWLB 4JZEH 2BD4A 3FOAA 1UVPA 1ZSLA 3E0NB 3VB4A 1KDQB 2LELA 3BEUA 1YYY1 2XBYA 1C5LH 1NFYA 1IQLA 3AW1A 2R9PA 2FOBA 1DS2E 1HAGE 3LGYA 1G30B 3TJUA 2VU8E 3V13A 1IOEA 1KTSB 2VWOA 2ANMH 1HAYB 3SUGA 4K3JA 3GDSA 1E79D 1O5EH 1SPJA 3EAJA 3LGUA 2QCYA 3ATWA 2V3MA 2VIPA 2BDHA 2QIQA 2FP7B 1O3MA 4AYVB 1PPGE 2F4LA 3O8DA 1SVPA 1NFUA 3N7DA 2JETC 3N7OA 2Q6FA 1SLVB 4FUEA 4GHTA 3SZEA 3U1JB 5CHAC 1C9PA 2BVRH 2ZHEH 1SGEE 4IW4E 1Z8GA 3VB6A 4GPGA 4ACBA 1DFPA 3PYHA 3VGCC 2PV9B 4NWKA 2QXGA 4Y71A 1FY4A 2V35A 1O5FH 1BT7A 2Y7XA 1A5IA 4KGAA 1C4Y2 3F9GA 4BOHA 5F53A 3SV2H 1P12E 2KCYA 1UVUH 1UTLM 1PYTD 1EJNA 2FOHA 2BOHB 4ISNA 3UWJH 3S0NA 2TIOA 2GZ8A 4Q2KA 4GCHG 3V3MA 1YKTA 3RP2A 2TGAA 3A83A 4Y6DA 1O3NA 3B8JA 4UFFH 2BB4A 2ODYB 2STAE 1M9UA 1AKSB 1O3GA 1LPKB 3HGNA 1LO6A 2JKHA 4DW2U 4ZHAA 2UUYA 1XXDA 2ZGJA 3AAVA 4K60A 2AHME 4A92A 2BXTH 1GL1A 2FM2A 1JBUH 5ESTE 3STIA 3VXFH 2AMPA 3FZZA 1NESE 3LJJA 2ZGXH 1P2NA 3OYPA 4K8BA 3TPIZ 4FXGH 4B73A 1QL8A 1GMCF 1XUIA 3ZVAA 4X2VA 2W5EA 3F3BA 1XVMA 4X6PA 3RMNH 2JH0D 3RXKA 2H5DA 1K1OA 1TNLA 1DY8A 3R3GB 2A7CA 3MH7A 3NK8A 1A61H 2ZEBA 1F5LA 3A89A 1U6QA 5AHGH 5JB9S 3SNDA 1T4VH 2ODPA 4Y79A 1PPHE 3A7TA 1Y5BT 1C1SA 3A85A 1CA8B 3HKJB 3ZVBA 4ZKSU 1JOUB 1ORFA 1CA0C 1O30A 3TIUA 2VGCB 1YLNA 1RJXB 1C2HA 2Z6BD 4K5ZA 1ESTA 4MPUA 2FEQH 1S85A 1GJ4H 1BMMH 2JDID 1SLXB 3PLBA 2OP9A 2WPMS 3SQHE 4NIWA 1VITG 2IJOB 3SGQE 1PPFE 2D8WA 4OS5A 1PPBH 3PV4A 5A09A 1C5YB 3TLOA 3T26A 3F9HA 1A5GH 3TGJE 1ZTLA 2J34A 4LZ1H 1HPGA 1V2LT 1YBWA 1DPOA 1HGTH 1K22H 1AHTH 2BDIA 3LPRA 1UTQA 4A1VA 4CHAB 4INLA 2C8ZB 1P2MA 4KTSA 5EOKA 1QRXA 2AFQB 1SI5H 1TGTA 4X1NU 2G8TA 3KIDU 4NIYA 4B1TA 1O3FA 2ZTXA 1P02A 4K69A 2QAAA 2FOAA 3S69A 3SU2A 1UK4A 3GCTF 4K1TA 5EODA 1O5AB 1CBWB 3PLKA 1B0EA 2BDBA 3RXAA 3QN7A 4NIXA 3TH2H 3F2GA 2G4UA 4QT8C 1Q31A 1OWKA 4DIHH 2WV4A 1UO6A 2IOTA 2F9OA 4KP0A 1D3PB 1WOFA 5F8TA 3SW2B 2QXIA 5JBCS 1QJ1B 1GHWH 1P2IA 1N6YA 3E90B 1QURH 1BRUP 1WQSA 4XD7D 2GCTC 5BPEA 1OSSA 1NT1A 5KEDA 2V6NA 1V2QT 1BQYA 5JBAS 4Y10E 2XBVA 4AFUA 2ZFQH 5AFZH 3QUMP 1GDNA 1IQKA 1O3EA 3M35A 4WH6A 2OUAA 3RLWH 4AORA 1FQ3A 3P70B 2Y6TA 1C2GA 1YCPM 1LVOA 5C1YA 1AY6H 1NRRH 5HXFA 2NU0E 2ANYA 1TGNA 2KAIA 5ABWA 2M5TA 4AN7A 4NA7A 1H9LB 1E1RD 2VVVA 1FIWA 2EA3A 1W12U 1TX8A 1KXFA 3QGNB 2PHBA 1O2KA 3BTKE 3KF2A 3RM0H 3RLYH 1FLEE 3U8RH 1TGCA 3FVFB 1MBMA 3D49H 3B23B 1DWEH 2C90B 1SOTA 1BTXA 2OD3B 1YCPH 5LH8A 1DANH 2ZECA 5LGOA 1ZGIA 5HIYA 1SOZA 1ZPZA 1P9SA 3SNBA 1Y5UT 2ZFSA 2WV5A 3ESTA 3F2HA 2ZP0H 1ZRKA 1V2NT 2BMGB 2BY5X 1W14U 3H7OA 2ZU2A 1P01A 1EZUC 4JCNA 1C5WB 3D62A 1NS3A 3OY5U 4F48B 1OHHD 1FJSA 3KL6A 3NXPA 4MPWA 4XSKU 4Y7AA 5B6OA 1S82A 2VBCA 1O5DH 1Y3YA 2BDGA 2FESH 5EQRA 1HFDA 2VIDA 1O2JA 3ZZ4A 1SC8U 4UEHH 1MH0A 4AFQA 5HYOA 2QF3A 1ARBA 4OM9A 4ZMAH 3HPTB 5GXPA 4IN1A 1UTNA 3PV5A 3RXFA 4ISHH 3T28A 2OC7A 1MCVA 1DXPA 2A4GA 1TLDA 1SBWA 3RC5A 1MTNB 4JMYA 1EPTA 3RXJA 1EKBB 1XX9A 4I86A 2RFKC 1ZGVA 5CMXH 3ZZ5A 2SGPE 1K1MA 1O33A 3E6PH 3Q76A 3RXMA 4CBNA 4GAWA 2OC8A 1L1GA 3A7YA 1GHYH 1UTJA 1T7CA 3V7TA 1QRZA 1GHXH 4NG9H 1GI3A 2PLXA 1DDJA 3RC4A 2GMTB 3MYWA 2C4FH 2SGDE 3DA9B 3ZVGA 1HB0B 5F6MA 1P8VC 1W11U 1O2PA 2AGIX 3GCHC 1OS8A 4FOUC 1C5ZB 4GHQA 5C0UA 1O3PB 2AGEX 1KXCA 2GTBA 2ZFFH 2A7HA 3SN8A 3MH5A 3ZZ7A 4JK6A 3ZZ8A 5J4SA 8ESTE 3CS7A 3URDA 4HGCA 4WMEA 3QWCH 3QZQA 2C3SA 5C0TA 1THRH 3BSQA 3UNRA 6ESTA 3PM3A 1ZHMA 2CF8H 4MPVA 1AN1E 1ETRH 1HCGA 1O34A 1YLDA 2C8YB 1SR5C 2NU2E 4K2YA 1MKWH 1RD3B 2GCHF 5SGAE 1FDPA 1LHEH 2UUJB 2OLGA 1ARCA 1MD7A 1O3IA 3TH3H 2FOFA 2BLWA 5GJ4B 4FVBA 5A8ZA 3IITA 5GCHG 4AX9H 5FPSA 3S9BA 3ODFA 1C5TA 5EW2H 1TNHA 4IMQA 1CSOE 3L6PA 3VB3A 4ABEA 1DT2A 1CQQA 1JXPA 5E0HA 2ZA5A 3QO6A 4BTUB 1C1PA 3BG4B 3M5MA 4I7YH 1W2KH 1EB2A 1EAXA 1EOJA 4BAMB 2PSYA 1GJ6A 3SV8A 1ESAA 1SGYE 2GVFA 2ZKSA 2P8OC 3ZZCA 1DWBH 1C1TA 1QQ4A 1K1IA 4FUDA 2QN5T 1F0TA 2JH5D 2D2DA 3H09A 1CE5A 2O8UA 2ZU1A 4NWLA 1K0HA 3QX5H 1H9HE 2XYAA 3P17H 1HAIH 3U8TH 4FUCA 5FBEA 3ELAH 2VB0A 2ZFRH 2DUCA 1BUIA 1RGQA 1EXFA 4FUIA 5GDSH 2Y7ZA 1L2EA 3BEFB 5C94A 2EY4C 4O03A 2ZIQH 4I32A 1BDAA 2LNCA 1UK2A 2BYAX 3KN2A 3ODDA 3M5NA 3SV6A 1EATA 3QGJA 1XUKA 1OXGA 1IQJA 1DX5M 1WTGH 4E06H 2P3TB 5L2ZH 3EGKH 1O32A 2JJ1D 3RXIA 5I25A 7GCHF 3ATLA 1C5RA 1CHGA 1H8IH 5TCCA 4HZHA 3ZZ6A 3QLPH 4Y8YA 1Z71A 1AKSA 1W0JD 1GMHF 1ZJDA 3PRDA 1BBRE 2GCHG 4Q7XA 4BAHB 3DD2H 1E0FD 1IHTH 4X0WU 2WINI 3F68H 2YOLA 5DO4H 3MO9A 3NPSA 1RTKA 1K21H 5DP4A 4DOQA 1Y5AT 4K1EA 2A7JA 1QHRB 2ZHFH 1P03A 2XC0A 5HMAA 2KX4A 1K28D 1FV9A 1PQ8A 3A86A 3D65E 1P2OA 3SU1A 1QTFA 3T2NA 2TGTA 3TK9A 1YPMH 3S7HB 4X6NA 4B2AA 3LGTA 3M37A 2PW8H 1O2QA 4NGAH 3RXLA 2BD5A 4NFFA 5A0BA 3ATKA 2OCVB 5DG6A 4XFQA 3RU4T 4YLUA 1WU1A 1CA0B 4UFDH 4WF8A 1P2QA 4RSPA 2K8IA 3TU7H 2ZHWH 1A46H 1J14A 4KELA 4X2WA 4KTUA 2WPIS 2FO9A 2M2AA 2G52A 4IGDA 2QC2A 1O39A 3O8CA 1SQOA 1GL0E 3DFJA 1UTOA 5DP6A 1GBLA 2C8XB 2XCNA 5ETXA 1AO5A 1GGDB 1YF4A 1MAXA 5FBIA 3MNCA 1O2HA 2OTVA 4YESB 1AFQC 1NRSH 2QY0B 1ETTH 3E91A 2P95A 2ZFPH 3EA8A 1GDQA 2ZQ2A 3GYLB 4JYUH 4Y0ZE 2NU1E 1W7XH 1ANBA 2BLVA 2TGDA 1LDTT 3MNSA 4CHAC 3LH1A 1V2TT 2YNAA 2B8OH 4JZFH 3MOCA 4P02A 1YY3A 3SZNA 2KCAA 2L6OA 4NCYA 2LPRA 2PKAA 2CK3D 2GDDA 3E3TA 1COWD 1V2OT 4WVPE 3A7WA 1OYTH 1N8OC 3KNXA 2F9UA 1SFQB 3KQ5A 1CT2E 1UVOA 2VVUA 2GJGA 1GHAG 1GVLA 5T6DA 1TPSA 2A1DB 2XBXA 4WWYA 3Q3KA 5FXLA 3ENSB 1W3CA 2FTLE 1JIMA 2XRCA 1SGCA 1LHCH 3W95A 1UMAH 1TPOA 4UE7H 3UPEA 4ZXXH 5I46H 2BY7X 2VIOA 3SHAH 2YMSD 5C3NA 2FI3E 1T8LA 4B6FA 1OWIA 1Y8TA 1WQVH 2A32A 2BZ6H 2VIQA 2Y82A 1YPLH 4E7RG 3GY7A 2Y5FA 4DG4A 1QB6A 4P00A 1S6FA 2BVXH 1K2I1 4JZ1A 1O2SA 2I6QA 1AVXA 1IQNA 2WPHS 1H8DH 3S9AA 1C2IA 1BB0B 1OOKB 2A4QA 3Q00A 2ZO3H 4UDWH 3BTEE 2CN0H 2ILNA 4ASHA 1KLTA 2FOGA 3DFLA 1UCYH 4UFEH 1GG6B 1YPHC 4GVUA 4AOQA 5AFYH 2PGBB 1TNIA 1BRBE 4X2YA 3DSGA 3EQ0H 4DCDA 3N99A 4JYTA 4KKDA 1D9IA 5C1XA 5EXMA 3U9AH 3PWBA 1CGJE 2ZQ1A 1MTVA 1QBNA 2VH6A 1GCTC 3E16B 4SGBE 5JYIA 1L0ZA 2SGFE 1K1JA 4X2XA 2G5NA 2BDAA 3EE7A 2AIQA 1K1NA 3LDXH 3B9FH 1TOMH 3UR6A 1ELEE 4DY7B 1GBMA 1O2TA 3F0OA 3GDUA 1A3EH 1LHFH 4RKJB 7GCHG 2SGAA 1WYKA 3CENA 3RM2H 1JRSA 3BTDE 1B5GH 2BM2A 1BMNH 1GJ8B 1TB6H 1MBQA 2DE9A 1SQAA 3KGPA 1G36A 1SGTA 1JMOH 4X1SU 1W13U 2J97A 1VR1H 1BA8B 3F2FA 1AUJA 1UHBB 1HAZB 3DHKH 2WPKS 2CGAA 2VWNA 1SKYE 2AH4X 3BV9B 3KYGA 3SU6A 1HRTH 4ZH8A 3TK5A 4ZCNA 1C5XB 6GCHG 5LPFA 2HRVA 3RXVA 1C4U2 2H6MA 1IQGA 1TBRH 1HUTH 1CVWH 1W10U 3RXTA 4JZDH 3C1KA 1VZQH 3I29A 1E38B 2ZG0H 2ODQA 1V2ST 7ESTE 2BDYA 1YPGH 3OTJE 1FY5A 2VWLA 1EB1H 1MMJN 2BXUH 4AG2A 1DXWA 1GBKA 5EQQA 5KECA 1C5UA 1LQDB 1C1OA 1E35B 4GLYA 5EIYA 1CT0E 5JDUB 1UTMA 3TJVA 3MNBA 2GZ9A 1AE5A 3SI4H 2FODA 1CGHA 2PUXB 1BHXB 3Q77A 2BD8A 1EP5A 1YCPK 3P8NA 3LC5A 1QFKH 2V3OH 1EPTC 3PMAB 4RT0A 1EP6A 1C2FA 2YMSB 2PGQB 3FP8E 1BJUA 3IWMA 5DP5A 2QGRA 1MQ6A 2H9EH 3AASA 1TA2A 1WTHD 2AMDA 2JIZD 1SGFG 2VGCC 1IAUA 2FTMA 3S9CA 1LQEA 1VGCC 2CMYA 5FX6A 1LCYA 3O8BA 5LPRA 2B5TB 3EDXB 4X1PU 1C1WH 3GOVB 1T32A 1C1VH 2P3UB 2A31A 4Y8XA 3RMOH 1C2LA 1NBME 1GBHA 2P8OB 2F3CE 3SU4A 3HATH 1HIAB 1GBJA 1O2OA 1TIOA 2W7UA 1KDQA 1HBTH 3UWIA 2VJ1A 5CDFE 1BTPA 3ZVCA 5EU8A 2P16A 1KIGH 1F92A 2Z9JA 5A0AE 1K1PA 2J95A 4FVDA 1ZHPA 3PMHB 1ZSKA 3OX7U 1DY9A 1WCZA 3MU0A 2ZGBH 3GY8A 2GX4A 1O36A 1MTSA 3AW0A 2HOBA 4FU9A 3SU0A 3LGWA 5JBTA 1QA7A 1PQ5A 5EPYA 1GBIA 4UD9H 3JZ1B 3SV9A 1P11E 2ZCKP 1BBRK 4E05H 2CF9H 3NUMA 2KCPA 5A2MH 5T6FA 1RRKA 1AB9B 4FUBA 5C67A 2BD3A 5DSFA 4TYDA 3QDZB 1AE8H 1GBEA 3CP7A 2PP6A 3SQEE 2QA9E 4DJZB 3SUDA 3OU0A 1KLJH 2KFWA 3RXPA 1A3BH 1GHAF 1TNKA 2O8MA 5DP7A 4I31A 1XKAC 2W6ID 1AMHA 3MWIU 2B0FA 4J1YA 4VGCC 4JYVH 1XVOA 4MNXA 3UIRA 4AGJA 2BQWB 1QZ8A 3K6ZA 1TQ0B 3TITA 1O37A 4YT6H 3FKSD 3GY2A 1IHSH 4X6MA 4FUHA 4AC9A 1NU9A 2OBQA 4U32A 1QBVH 4AZ2B 3SJIA 1BTUA 1D3DB 5EXLA 3URCA 1TBZH 4Y11E 3UOPA 1L1NA 4D76A 2EI7A 2BTCE 1HAPH 1PJPA 1TE0A 1ELTA 1AU8A 2A5KA 2H5CA 3SNCA 3ZZBA 5F8XA 3A84A 6CHAB 1A0HB 3AK5A 2HPQH 1DUAA 4TT3D 1LVBA 1V6DA 3FP6E 1F5KU 3RDZA 1OKXA 4B2BA 1HAOH 1WBGB 1TMUH 4BAQB 1TABE 3ZZ3A 1S6HA 1JIRA 1GI9B 5GNDA 1ZJKA 4YLQH 3ZV8A 1Q3XA 2HLDD 2GKVE 4CRCA 3E1XB 3QTVH 1FAKH 3TGIE 3A88A 3SOSA 4DT4A 4ISLA 3LKWA 2ESTE 5TCAA 1DOJA 2AS9A 2GV7A 1ZYOA 1SGFA 4D7GA 1PPZA 4A7IB 1GVZA 2KR7A 2QF4A 1AGJA 1Z8RA 5AF9H 1W7GH 3SV7A 1J17T 5L6NH 2ZHQH 1QJ6B 1V3XA 3P95A 1SHYA 2KAIB 2ANKH 3RXCA 5C1UA 3FAOA 1V2MT 2G4TA 3CNRA 4CRBA 1C5OH 1HIAA 1CHOG 1QA0A 2R2WU 5EGMA 1GBAA 3NKKA 1ABIH 4RKOB 1EX3A 1SQTA 3BTHE 1GMHG 1G37A 1W0ZU 1MU8B 3BTQE 3VB5A 3VG8A 2H9TH 1TNJA 1EAUA 2P59A 2P94A 3PO1B 1VGCB 3PB1E 4CRFA 4UFGH 4NIVA 1S0RA 1P2JA 1HJAB 1HJ8A 3KQCA 1CU1A 3BTWE 4U01A 4Z6AH 1XM1A 5KGOA 2PR3A 1S81A 2XOKD 1OP2A 2PTNA 3ZYEA 3TJNA 5GPIB 1VCPA 3LOXA 3EA9A 3ZZAA 9LPRA 1QB9A 1TALA 2FXRA 1O3OA 5EG4A 2VH0A 1N1LA 2PSXA 3TH4H 1QIXB 3A81A 5FPTA 5F8ZA 1HV7A 4OS2A 2FLBH 1LTOA 2FS8A 2XW9A 4IN2A 6LPRA 2XC5A 2ZU5A 4MG3A 3MNXA 5EXNA 3DSPA 3R0FA 1O5GH 4D9RA 1A1RA 2FI4E 3FZDA 4XBDA 3GCOA 5FL7D 1CO7E 1YLCA 2BD7A 5T3HA 5LPEA 4DURA 3G01A 1O5BB 3T27A 3OFND 2QXJA 1HAHH 3TJOA 3FANA 4CR5A 1FPCH 4YOGA 2W7SA 3W94A 1V2RT 2GZ7A 1YGCH 1ELDE 2Z3CA 8GCHF 2DE8A 2ASUB 3ZVEA 1F0UA 3L33A 2IN2A 4XDEA 4ABBA 1QR3E 1O2IA 4CRAA 3DT0H 4NSVA 1GI8B 1RIWC 5G4BA 1P3EA 3KQBA 1Z8JB 1UCYE 5L2YH 1XUJA 5CE1A 1NC6A 2G55A 1GI1A 3AAUA 8GCHG 3ITIA 2UWOA 3M3SA 1BMFD 1S5SA 1JWTA 4GCHF 4B2CA 1S6LA 3RMLH 2ZFTA 1AD8H 1IQHA 2VIWA 1O5CB 1HXFH 1QL7A 2WZQA 5IDKA 3SJOA 2CHAB 2V7QD 1CT4E 1GBBA 5IYTA 1OWDA 2O8TA 2ZZUH 1AUTC 1AVGH 4NZLA 1YM0A 1ZHRA 3HKIB 4Q4LA 2TGPZ 1DVAH 2BVSH 2L74A 1P2KA 1F5RA 1HAVA 2C8WB 2FZZA 3WY8A 2GD4B 1RFNA 2BY9X 1C1QA 3ATIA 2OQUA 1MTWA 3M36A 4NA8A 3T5FH 3OAAD 1GHZA 2OQ5A 3A87A 4ACAA 1TX7A 3KCGH 2A4OA 2OC0A 4HI3A 3PMBB 4LXBH 1Y3UA 2P93A 4TPIZ 2GDEH 1FPHH 1OPHB 4I8KA 2ZDAH 3PTBA 2HPPH 3UNSA 4WMFA 4ABDA 4Y7BA 5H4IB 3ZZ9A 3K2UA 1GHBG 2OXSA 4KTCA 1BMLA 4I33A 2WYJA 5T6GA 1SHHB 1DE7H 1FUJA 2HNTF 1ZPBA 1QL9A 1S83A 1O2RA 2FYQA 2EQNA 1TA6A 2IJD1 2W6JD 2Z3DA 2HALA 1VCWA 5GCHF 2PKSB 3NRLA 4B71A 1L1JA 1OYQA 2CV3A 1XKBC 2O8WA 1D3TB 2ZDLA 2F9PA 3U1IB 1TRYA 1IQIA 3OEED 1C5PA 5K0HA 2YMSC 2V3HH 1CHOF 1C4V2 3ZZDA 2FS9A 1H1BA 3PWCA 4MVNA 1HAVB 1MQ5A 4BXWA 3EYDA 1B0FA 5E2PA 3TGKE 2UWLA 2G81E 2PUQH 1GBDA 1P57B 2ZU4A 3TNSA 1OP8A 2XNDD 2ZDMA 1D6WA 1HJ9A 1KXDA 2J4IA 1V2WT 3FO8D 5L30H 2XWAA 1P10A 4ZUHA 1FIZA 1LKAA 2VNTA 2WSSD 3M61U 3NWUA 1GJBB 2AMQA 1OWEA 2J38A 1C5VA 2SFAA 1D4PB 1NU7B 3A8BA 2RG3A 3A7VA 3F1SB 4H6SB 3BTME 1IQMA 4X8VH 4JZIA 2ALVA 1C1RA 2BQ6B 2VVCA 1H8HD 1O35A 1LKBA 4OS1A 4X8UH 2K0QA 1KXBA 5JPMH 4LK4A 1HYLA 4MQAA 5PTPA 3D23A 5DKMA 1G2MA 2W3IA 1UTKA 4MNYA 4AB9A 4ZAEA 1F0SA 1ESBA 3LT3A 5F03A 4WH8A 4D8NA 2NU3E 1Z8IB 4ABHA 4TSFD 1J15A 1O2YA 3EA7A 4DVAU 4ABAA 1SL3A 1GI7B 2ZPRA 3UAIC 2GCTB 3MMGA 1LMWB 1Z6JH 3MH6A 5CHAB 2SNVA 3UOUA 4CBOA 1BOQA 1YPEH 3BG4C 1C5NH 4B74A 3M5LA 2PWXA 1PQAA 4WY3A 3SGBE 1SGNE 1GJCB 4OS7A 3OEHD 3HK6B 3KEEA 3VFEA 4YOJA 1C5QA 1PPCE 1E1QD 1GBFA 1D6RA 5EQSA 1QBOA 1GJ7B 1NRQH 2FOMB 3H5CB 4INHA 3VGCB 3GDVA 1EQ9A 3K65B 1BRCE 4ESTE 2F83A 5T1VA 1RTFB 2J94A 4FUGA 2GT8A 1GMDF 1G32B 1A0JA 1O2GH 5A8XA 4Q7YA 1EAWA 1RS0A 2EC9H 4K1SA 4R0IA 2BOKA 1TQ7B 2BD2A 3ZVFA 1D3QB 2H9HA 1G9IE 1UTPA 2G51A 2RDLA 3RXBA 1Y3XA 3BTFE 1C5SA 3GYMA 2ZTZA 5EJ1A 4F49A 7LPRA 6CHAC 1MABB 4WXVA 4F55A 3MU5A 4YM9A 4Q7ZA 1VJ9U 5E0JA 2QE7D 5DJ7A 2FX4A 1VITF 2WPJS 1UW7A 2FI5E 3SJ9A 4ZXYH 5JBBS 3U98H 1H9IE 4XOJA 4F4OC 2ZWLH 1XMNB 4J2YB 1MZDA 1DWDH 1EJAA 3BIVH 3MQKC 1GGDC 1ZPCA 4IC6A 1ELFA 2BD9A 3AVZA 4BAKB 4ZKOU 5HM2A 1ZZZA 3P6ZB 4B76A 1LVMA 2Y5GA 1AI8H 4CH8B 1QY6A 5EW1H 3QTOH 3WWBA 1C2DA 1KY9A 1EZQA 4TWWA 1TYNA 1S0QA 4A1XA 1XUFA 3RXEA 1TPAE 5HIZA 1QQUA 1C2EA 4INKA 1MKXH 2FDAA 1GWAA 4XRNA 5FX5A 3V0XA 2R3YA 2RCEA 4NSYA 2KM0A 2OBOA 3RXHA 1GJAB 1BTZA 2PKSC 4FUJA 1O3LA 1UK3A 1T8MA 2I6SA 1LPZB 2JETB 1A0LA 2H1UA 1O2LA 2R2MB 4X1QU 3SU5A 3VEQB 4CH2B 4MNVA 2Y80A 2ZI2H 3A7XA 4IBLH 1ABJH 2IPQX 3RUOA 2ZC9H 1GJDB 1P0SH 5CHBA 3EE0B 2GMTC 4CRGA 3TNTA 1T8OA 3RMMH 3F6UH 1O2WA 3SJ8A 2Z3EA 2D1JA 1SFIA 1E37B 2OC1A 2UUFB 1O2NA 2ZDKA 1SGPE 1ZR0A 3A80A 1HJAC 2J9NA 2XBWA 4OS6A 2FLRH 2Z94A 3STJA 5JB8S 2ULLA 2Z9GA 1O3BA 3LH3A 3SJKA 5DP3A 1KYNA 2FIRH 1ID5H 2BLOA 1TMBH 1YWUA 4ISIH 1YPKH 2A4RA 1J9CH 1MAYA 3UREA 3NCLA 4E7NA 2VIVA 5HGGA 2WYGA 3E0PB 3SBKA 1E36B 3M3VA 3OY6U 3GICB 4YOIA 1FMGA 4AFZA 1P04A 2WPLS 1Z6EA 1AWHB 1AWFH 4TY7A 1TAWA 1Q2WA 1VITH 4WJG2 2J92A 1ELVA 1EJMA 4LZ4B 2AGGX 3BTTE 1FY3A 1K9OE 2EI8A 4H42U 1Y3VA 1OP0A 3UQVA 1UCYK 2FYRA 5EJLA 1YC0A 2BX4A 5HM9A 3RC6A 4A1TA 1O2ZA 2R0KA 3BN9A 3MU4A 3F0PA 2HLCA 1RTLA 1OWJA 1THSH 1SGIB 3SNEA 4JK5A 3GS9A 4LOYH 1SB1H 4FU7A 4THNH 5EJZA 1KXAA 2UWPA 1H8ED 4ABJA 1FY1A 2Q6GA 1NRPH 3C27B 1ELBA 1A4WH 4X8TH 1AVWA 1GDUA 3PROA 3BEIB 2AEIH 1XUHA 3VXEH 5DN6D 1P9UA 4U30A 1DICA 3DUXH 3GCNA 1FZZA 3RXQA 1IQFA 1A2CH 3RXUA 1P3CA 3MFJA 1TGSZ 5A8YA 2FOEA 3HGPA 1SGRE 1ZMJA 3UFAA 1LVYA 1V2JT 3WW7A 1NN6A 3M7QA 4TPYA 3I78A 1FY8E 1Y3WA 1HXEH 1GG6C 4Z1MD 1O3KA 1GPZA 1UHBA 2W3KA 4FU8A 3VPKA 1ZTKA 3FFGA 2AERH 1QGFA 4ZHLU 1DM4B 2F43B 1C5MD 3F9EA 2GV6A 1FN6A 1O2MA 2WV9A 5K7RA 1A7SA 5A0CA 1ZLRA 1C2MA 1XXFA 4NZQA 2A2XH 3LU9B 2CJIA 1QRWA 3MU1A 2ZDVH 3KQDA 2PTCE 1G3BA 1SGDE 1O3DA 3QK1A 4VGCB 1HLTH 1AZZA 1TGBA 1V2PT 4Y76A 2A5AA 4X1RU 3DSOA 3BTGE 2EI6A 4RT1A 1GCDA 1O2XA 4D9QA 3ATMA 5GIBA 3RXRA 2NU4E 1FNIA 4PROA 5AVDA 1G3CA 2XC4A 1HNEE 1SLUB 4BNRA 1EPTB 1TNGA 3Q3YA 1SMFE 4A6LA 3JZ2B 2A5IA 1O31A 1V2KT 4MPXA 4BAOB 4R8TB 2JJ2D 1DSUA 2ZGCA 3FN8A 2Z9IA 1NFXA 4H6TA 1FI8A 3IG6B 1YPJH 4RN6A 2J5UA 1C2JA 3U28C 1ANDA 1T31A 2ZCHP 4BTIB 2RDEA 5DK1A 4B75A 1NPMA 4XE4A 1MKWK 1WV7H 4ISOA 3P8FA 4M7GA 3RXOA 4TWYA 4M9FA 3ZV9A 1TOCB 4MNWA 2HNTE 3GCHB 1ELAA 3HK3B 4OGXA 2SNWA 4YZUA 5TJXA 9ESTA 3MI4A 3OE7D 3W1EA 2WUCA 3M7UA 2ZF0H 1PQ7A 3MH4A 3SGAE 1O2UA 2J98B 2G00A 2QV1A 1ZSJA 1KSNA 4YTAA 1GMCG 3TK6A 2BY8X 2XWBI 1W0KD 4BTTB 1ANCA 4ABFA 2WUBA 2ZNKH 5FCRA 1TWXB 1PPEE 1ZOMA 1BCUH 2VWMA 4IC5A 2F9NA 1VKYA 1WAYB 2R3UA 1DITH 2RA0A 3M3TA 1BMAA 1NO9H 1MD8A 2BLQA 2STBE 1DLEA 1FN8A 1AB9C 3OTPA 3VB7A 1Z1IA 2HVXA 1FAXA 1O2VA 2LP6A 1T8NA 1MKXK 3SU3A 2O8LA 1LHDH 5DP8A 4U2WA 3SNAA 2XCFA 1NROH 3ZVDA 4Y0YE 2G5VA 3TVJB 3SO3A 1G2LA 2D26C 2Z9LA 3BIUH 1HAXB 2ZHDA 1SGQE 1EZSC 4Y8ZA 3PO1C 5IK2D 1F0RA 1RIWB 2NWNA 4Q63A 4BANB 1S84A 3UR9A 1FXYA 1BHXF 1INCA 3N7EA 4DT7B 4FUFA 3RXSA 4X6OA 1MTNC 1BIOA 4AGKA 2V0BA 4I8JA 2F9VA 3S7KB 1O3HA 1TONA 3SYJA 2KCOA 1C1MA 3Q3XA 5FCKA 3LC3A 5FAHA 2BHGA 1NBMD 4I8LA 3K9XB 8KME2 4ZHMU 1NRNH 3GY6A 3PMJA 4NA9H 1UVSH 1JRTA 2Q6DA 2TPIZ 4OS4A 3BG8A 1DSTA 4YXWD 1P05A 1HDTH 4XBCA 4Z0KA 3LGVA 2C93B 1EZXC 1W8BH 1AFQB 2UUKB 1BTWA 2ZPQA 4D7FA 5C20A 4FETA 1AQ7A 1ANEA 2BQ7B 7KMEH 1RXPA 1N6XA 3A8DA 2QXHA 2FWWA 1NM6A 3T29A 2F9BH 3QZRA 3MTYA 3SORA 3P8GA 4I8HA 1ETSH 1V2VT 4AG1A 1MUEB 2Z9KA 2QYIA 4TY6A 2Q1JA 6GCHF 3A8AA 1N8OB 2K1QA 4UONA 5DP9A 2TBSA 2RA3A 3O8RA 1SQRA 3OSYA 1J16A 3RXDA 2ANWA 3GY3A 2TRMA 3T25A 1G3EA 5DPAA 3T62A 1C1UH 4YO9A 2XTTB 3CS0A 2FOCA 2YNBA 1MCTA 4XBBA 4Q80A 4HG6A 1GBCA 4I8GA 3WWFA 2B9LA 2J98A 3DCLA 1CGIE 1TMTH 4WMDA 1NTPA 2GT7A 3PV2A 4CRDA 3SUFA 1ZMLA 4GSOA 2BY6X 2ZPSA 2F91A 1BITA 1ZMNA 1DWCH 4MDSA 1ZRBA 5GWZA 1BZXE 1PFXC 5C17A 1O38A 1X7AC 2B7DH 2QF5A 1A5HA 3RU4D 1EOLA 3I77A 3UNQA 1SSXA 3GY4A 3MO6A 3UQOA 3A7ZA 1BBRH 1CBWC 1F7ZA 2O9QA 1NZQH 2WPDD 4K8YA 5C5NA 5E8EH 3MO3A 1SLWB 1GI2A 4AFSA 2ZU3A 1TX6A 1O0DH 2ZCLP 4AYYB 1KXEA 1L4DA 1QCPA 3SI3H 2FX6A 1K1LA 1GVKB 2PFEA 4ABIA 4ABGA 1EASA 5DGJA 1DUEA 2Z7FE 3MHWU 1THPB 5B6LA 2CXVA 3M7TA 1WUNH 1C1NA 3RU4E 4ZKRU 1UJ1A 1NFWA 4H4FA 1V2UT 3UUZA 1G3DA 1AIXH 3KQEA 1WDIA 5J4QA 2W26A 1GI6A 2HVYB
chains in the Genus database with same CATH topology
1YPHE 1GJ5H 1MZAA 2ZGHA 1QB1A 2AIPA 4O3TA 1O3AA 1J8AA 2HNTC 1W0YH 4O3UA 2ALPA 1ELCA 2XXLA 4CREA 1GHBF 3P8OA 1Z1JA 1BJVA 1BTHH 1P09A 3GISB 3P92A 1O3CA 3E8LA 2VINA 3LJOA 1SG8B 2HGTH 3GY5A 3SUEA 1GI5A 3NZIA 2R0LA 1Y59T 5C5OA 1GMDG 2BX3A 2BZAA 4O97A 4A5TS 1TPPA 1DLKB 3LIWA 1QJ7B 3M5OA 1TBQH 2THFB 4OGYA 5FHTA 1AFEH 2JH6D 4MTBA 1GJ9B 1O3JA 1TFXA 1NY22 4O9VA 4NFEA 2P3FH 4HFPB 1KTTB 1EAIA 2PKAB 2A45B 3U8OH 1P06A 5ESBA 2ZTYA 1YP9A 1GI4A 4SGAE 2Y81A 2A0QB 3LGIA 3PLPA 1IQEA 2SGQE 2GP9B 2XNIA 3A82A 1GCTB 3L3TA 2FPZA 1C2KA 1OWHA 1LPGB 3ZYDA 3V12A 4DIIH 2J2UA 1ACBE 2FMJA 4GUXA 2BDCA 4ZKNU 1PYTC 3UTUH 2GGVB 4YT7H 1L4ZA 1WSSH 4AB8A 1F2SE 1T4UH 1FONA 3FP7E 1BTYA 4X8SH 1XUGA 4MLFB 5BRRE 3UY9A 4DGJA 1TRNA 5E0GA 2Y5HA 2ZDNA 3KHVA 1C9TA 1ELGA 1QNJA 2AYWA 4ZROA 1TRMA 2CHAC 1LHGH 1BRAA 1H4WA 3U69H 1AZ8A 1GBTA 3BF6H 1GI0A 4BXSA 2A2QH 4IS5A 2QF0A 3SHCH 4IMZA 4HTCH 5C2ZA 1EUFA 1VCQA 5E2OA 5FPYA 3F9FA 3GCTG 3A8CA 1MTUA 1VJAU 3K6YA 3MU8A 5EPNA 3H7TA 2IPHA 1MU6B 3RXGA 1GHVH 1B7XB 3PTNA 4CR9A 2EEKA 4WXIA 1KLIH 8LPRA 2SGEE 1E34B 3LONA 2H2ZA 1UVTH 1ZTJA 2OINA 1Z7KA 1OX1A 2HWLB 4JZEH 2BD4A 1UVPA 1ZSLA 3E0NB 3VB4A 1KDQB 3BEUA 1YYY1 2XBYA 1C5LH 1NFYA 1IQLA 3AW1A 2R9PA 2FOBA 1DS2E 1HAGE 3LGYA 1G30B 3TJUA 2VU8E 3V13A 1IOEA 1KTSB 2VWOA 2ANMH 1HAYB 3SUGA 4K3JA 3GDSA 1O5EH 1SPJA 3EAJA 3LGUA 2QCYA 3ATWA 2VIPA 2BDHA 2QIQA 2FP7B 1O3MA 4AYVB 1PPGE 3O8DA 1SVPA 1NFUA 2JETC 3N7OA 2Q6FA 1SLVB 4FUEA 4GHTA 3U1JB 5CHAC 1C9PA 2BVRH 2ZHEH 1SGEE 4IW4E 1Z8GA 3VB6A 4GPGA 1DFPA 3PYHA 3VGCC 2PV9B 4NWKA 2QXGA 4Y71A 1FY4A 2V35A 1O5FH 1BT7A 2Y7XA 1A5IA 4KGAA 1C4Y2 3F9GA 4BOHA 3SV2H 1P12E 1UVUH 1UTLM 1PYTD 1EJNA 2FOHA 2BOHB 4ISNA 3UWJH 3S0NA 2TIOA 2GZ8A 4Q2KA 4GCHG 3V3MA 1YKTA 3RP2A 2TGAA 3A83A 4Y6DA 1O3NA 3B8JA 4UFFH 2BB4A 2ODYB 2STAE 1M9UA 1AKSB 1O3GA 1LPKB 3HGNA 1LO6A 2JKHA 4DW2U 4ZHAA 2UUYA 1XXDA 2ZGJA 3AAVA 4K60A 4A92A 2BXTH 1GL1A 2FM2A 1JBUH 5ESTE 3STIA 3VXFH 2AMPA 3FZZA 1NESE 3LJJA 2ZGXH 1P2NA 3OYPA 4K8BA 3TPIZ 4FXGH 4B73A 1QL8A 1GMCF 1XUIA 3ZVAA 4X2VA 2W5EA 1XVMA 4X6PA 3RMNH 2JH0D 3RXKA 2H5DA 1K1OA 1TNLA 1DY8A 3R3GB 2A7CA 3MH7A 3NK8A 1A61H 2ZEBA 1F5LA 3A89A 1U6QA 5AHGH 5JB9S 3SNDA 1T4VH 2ODPA 4Y79A 1PPHE 3A7TA 1Y5BT 1C1SA 3A85A 1CA8B 3HKJB 3ZVBA 4ZKSU 1JOUB 1ORFA 1CA0C 1O30A 3TIUA 2VGCB 1RJXB 1C2HA 2Z6BD 4K5ZA 1ESTA 4MPUA 2FEQH 1S85A 1GJ4H 1BMMH 1SLXB 3PLBA 2OP9A 2WPMS 3SQHE 4NIWA 1VITG 2IJOB 3SGQE 1PPFE 2D8WA 4OS5A 1PPBH 3PV4A 5A09A 1C5YB 3TLOA 3T26A 3F9HA 1A5GH 3TGJE 1ZTLA 2J34A 4LZ1H 1HPGA 1V2LT 1YBWA 1DPOA 1HGTH 1K22H 1AHTH 2BDIA 3LPRA 1UTQA 4A1VA 4CHAB 4INLA 2C8ZB 1P2MA 4KTSA 5EOKA 1QRXA 2AFQB 1SI5H 1TGTA 4X1NU 2G8TA 3KIDU 4NIYA 4B1TA 1O3FA 2ZTXA 1P02A 4K69A 2QAAA 2FOAA 3S69A 3SU2A 1UK4A 3GCTF 4K1TA 5EODA 1O5AB 1CBWB 3PLKA 1B0EA 2BDBA 3RXAA 3QN7A 4NIXA 3TH2H 2G4UA 4QT8C 1Q31A 1OWKA 4DIHH 2WV4A 1UO6A 2IOTA 2F9OA 4KP0A 1D3PB 1WOFA 5F8TA 3SW2B 2QXIA 5JBCS 1QJ1B 1GHWH 1P2IA 1N6YA 3E90B 1QURH 1BRUP 1WQSA 2GCTC 5BPEA 1OSSA 1NT1A 2V6NA 1V2QT 1BQYA 5JBAS 4Y10E 2XBVA 4AFUA 2ZFQH 5AFZH 3QUMP 1GDNA 1IQKA 1O3EA 3M35A 4WH6A 2OUAA 3RLWH 4AORA 1FQ3A 3P70B 2Y6TA 1C2GA 1YCPM 1LVOA 5C1YA 1AY6H 1NRRH 5HXFA 2NU0E 2ANYA 1TGNA 2KAIA 5ABWA 2M5TA 4AN7A 4NA7A 1H9LB 2VVVA 1FIWA 2EA3A 1W12U 1TX8A 1KXFA 3QGNB 2PHBA 1O2KA 3BTKE 3KF2A 3RM0H 3RLYH 1FLEE 3U8RH 1TGCA 3FVFB 1MBMA 3D49H 3B23B 1DWEH 2C90B 1SOTA 1BTXA 2OD3B 1YCPH 5LH8A 1DANH 2ZECA 5LGOA 1ZGIA 1SOZA 1ZPZA 1P9SA 3SNBA 1Y5UT 2ZFSA 2WV5A 3ESTA 2ZP0H 1ZRKA 1V2NT 2BMGB 2BY5X 1W14U 3H7OA 2ZU2A 1P01A 1EZUC 4JCNA 1C5WB 3D62A 1NS3A 3OY5U 5B6OA 1FJSA 3KL6A 3NXPA 4MPWA 4XSKU 4Y7AA 1S82A 1O5DH 1Y3YA 2BDGA 2FESH 5EQRA 1HFDA 2VIDA 1O2JA 3ZZ4A 1SC8U 4UEHH 1MH0A 4AFQA 5HYOA 2QF3A 1ARBA 4ZMAH 5GXPA 3HPTB 4IN1A 1UTNA 3RXFA 4ISHH 3T28A 2OC7A 1MCVA 1DXPA 2A4GA 1TLDA 1SBWA 3RC5A 1MTNB 4JMYA 1EPTA 3RXJA 1EKBB 1XX9A 1ZGVA 5CMXH 3ZZ5A 2SGPE 1K1MA 1O33A 3E6PH 3Q76A 3RXMA 4CBNA 4GAWA 2OC8A 1L1GA 3A7YA 1GHYH 1UTJA 1T7CA 3V7TA 1QRZA 1GHXH 4NG9H 1GI3A 2PLXA 1DDJA 3RC4A 2GMTB 3MYWA 2C4FH 2SGDE 3DA9B 3ZVGA 1HB0B 5F6MA 1P8VC 1W11U 1O2PA 2AGIX 3GCHC 1OS8A 4GHQA 1C5ZB 1O3PB 2AGEX 1KXCA 2GTBA 2ZFFH 2A7HA 3SN8A 3MH5A 3ZZ7A 4JK6A 3ZZ8A 5J4SA 8ESTE 3CS7A 3URDA 4HGCA 4WMEA 3QWCH 3QZQA 2C3SA 1THRH 3BSQA 3UNRA 6ESTA 3PM3A 1ZHMA 2CF8H 4MPVA 1AN1E 1ETRH 1HCGA 1O34A 1YLDA 2C8YB 1SR5C 2NU2E 4K2YA 1MKWH 1RD3B 2GCHF 5SGAE 1FDPA 1LHEH 2UUJB 2OLGA 1ARCA 1MD7A 1O3IA 3TH3H 2FOFA 2BLWA 5GJ4B 4FVBA 5A8ZA 3IITA 5GCHG 4AX9H 5FPSA 3S9BA 3ODFA 1C5TA 5EW2H 1TNHA 4IMQA 1CSOE 3L6PA 3VB3A 4ABEA 1DT2A 1CQQA 1JXPA 5E0HA 2ZA5A 3QO6A 4BTUB 1C1PA 3BG4B 3M5MA 4I7YH 1W2KH 1EB2A 1EAXA 1EOJA 4BAMB 2PSYA 1GJ6A 3SV8A 1ESAA 1SGYE 2GVFA 2ZKSA 2P8OC 3ZZCA 1DWBH 1C1TA 1QQ4A 1K1IA 4FUDA 2QN5T 1F0TA 2JH5D 2D2DA 1CE5A 2O8UA 2ZU1A 4NWLA 3QX5H 1H9HE 2XYAA 3P17H 1HAIH 3U8TH 4FUCA 5FBEA 3ELAH 2VB0A 2ZFRH 2DUCA 1BUIA 1RGQA 1EXFA 4FUIA 5GDSH 2Y7ZA 1L2EA 3BEFB 4O03A 2ZIQH 4I32A 1BDAA 2LNCA 1UK2A 2BYAX 3KN2A 3ODDA 3M5NA 3SV6A 1EATA 3QGJA 1XUKA 1OXGA 1IQJA 1DX5M 1WTGH 4E06H 2P3TB 5L2ZH 3EGKH 1O32A 3RXIA 5I25A 7GCHF 3ATLA 1C5RA 1CHGA 1H8IH 5TCCA 4HZHA 3ZZ6A 3QLPH 4Y8YA 1Z71A 1AKSA 1GMHF 1ZJDA 1BBRE 2GCHG 4Q7XA 4BAHB 3DD2H 1E0FD 1IHTH 4X0WU 2WINI 3F68H 2YOLA 5DO4H 3MO9A 3NPSA 1RTKA 1K21H 5DP4A 4DOQA 1Y5AT 4K1EA 2A7JA 1QHRB 2ZHFH 2XC0A 1P03A 5HMAA 1K28D 1FV9A 1PQ8A 3A86A 3D65E 1P2OA 3SU1A 1QTFA 3T2NA 2TGTA 3TK9A 1YPMH 3S7HB 4X6NA 4B2AA 3LGTA 3M37A 2PW8H 1O2QA 4NGAH 3RXLA 2BD5A 4NFFA 5A0BA 3ATKA 2OCVB 5DG6A 4XFQA 3RU4T 4YLUA 1WU1A 1CA0B 4UFDH 4WF8A 1P2QA 4RSPA 3TU7H 2ZHWH 1A46H 1J14A 4KELA 4X2WA 4KTUA 2WPIS 2FO9A 2G52A 4IGDA 2QC2A 1O39A 3O8CA 1SQOA 1GL0E 3DFJA 1UTOA 5DP6A 1GBLA 2C8XB 2XCNA 5ETXA 1AO5A 1GGDB 1YF4A 1MAXA 5FBIA 3MNCA 1O2HA 2OTVA 4YESB 1AFQC 1NRSH 2QY0B 1ETTH 3E91A 2P95A 2ZFPH 3EA8A 1GDQA 2ZQ2A 3GYLB 4JYUH 4Y0ZE 2NU1E 1W7XH 1ANBA 2BLVA 2TGDA 1LDTT 3MNSA 4CHAC 3LH1A 1V2TT 2YNAA 2B8OH 4JZFH 3MOCA 3SZNA 4NCYA 2LPRA 2PKAA 2GDDA 3E3TA 1V2OT 4WVPE 3A7WA 1OYTH 1N8OC 3KNXA 2F9UA 1SFQB 1CT2E 1UVOA 2VVUA 1GHAG 1GVLA 5T6DA 1TPSA 2A1DB 2XBXA 4WWYA 3Q3KA 5FXLA 3ENSB 1W3CA 2FTLE 1JIMA 2XRCA 1SGCA 1LHCH 3W95A 1UMAH 1TPOA 4UE7H 3UPEA 4ZXXH 5I46H 2BY7X 2VIOA 3SHAH 5C3NA 2FI3E 1T8LA 1OWIA 1Y8TA 1WQVH 2A32A 2BZ6H 2VIQA 2Y82A 1YPLH 4E7RG 3GY7A 2Y5FA 4DG4A 1QB6A 1S6FA 2BVXH 1K2I1 4JZ1A 1O2SA 2I6QA 1AVXA 1IQNA 2WPHS 1H8DH 3S9AA 1C2IA 1BB0B 1OOKB 2A4QA 3Q00A 2ZO3H 4UDWH 3BTEE 2CN0H 2ILNA 4ASHA 1KLTA 2FOGA 3DFLA 1UCYH 4UFEH 1GG6B 1YPHC 4GVUA 4AOQA 5AFYH 2PGBB 1TNIA 1BRBE 4X2YA 3EQ0H 4DCDA 4JYTA 4KKDA 1D9IA 5C1XA 5EXMA 3U9AH 3PWBA 1CGJE 2ZQ1A 1MTVA 1QBNA 2VH6A 1GCTC 3E16B 4SGBE 5JYIA 1L0ZA 2SGFE 1K1JA 4X2XA 2G5NA 2BDAA 2AIQA 1K1NA 3LDXH 3B9FH 1TOMH 3UR6A 1ELEE 4DY7B 1GBMA 1O2TA 3GDUA 1A3EH 1LHFH 4RKJB 7GCHG 2SGAA 1WYKA 3CENA 3RM2H 1JRSA 3BTDE 1B5GH 2BM2A 1BMNH 1GJ8B 1TB6H 1MBQA 2DE9A 1SQAA 3KGPA 1G36A 1SGTA 1JMOH 4X1SU 1W13U 1VR1H 1BA8B 1AUJA 1UHBB 1HAZB 3DHKH 2WPKS 2CGAA 2VWNA 2AH4X 3BV9B 3SU6A 1HRTH 4ZH8A 3TK5A 1C5XB 6GCHG 5LPFA 2HRVA 3RXVA 1C4U2 2H6MA 1IQGA 1TBRH 1HUTH 1CVWH 1W10U 3RXTA 4JZDH 3C1KA 1VZQH 3I29A 1E38B 2ZG0H 2ODQA 1V2ST 7ESTE 2BDYA 1YPGH 3OTJE 1FY5A 2VWLA 1EB1H 1MMJN 2BXUH 4AG2A 1DXWA 1GBKA 5EQQA 1C5UA 1LQDB 1C1OA 1E35B 4GLYA 1CT0E 5JDUB 1UTMA 3TJVA 3MNBA 2GZ9A 1AE5A 3SI4H 2FODA 1CGHA 2PUXB 1BHXB 3Q77A 2BD8A 1EP5A 1YCPK 3P8NA 3LC5A 1QFKH 2V3OH 1EPTC 3PMAB 1EP6A 1C2FA 3FP8E 2PGQB 1BJUA 3IWMA 5DP5A 2QGRA 1MQ6A 2H9EH 3AASA 1TA2A 1WTHD 2AMDA 1SGFG 2VGCC 1IAUA 2FTMA 3S9CA 1LQEA 1VGCC 2CMYA 5FX6A 1LCYA 3O8BA 5LPRA 2B5TB 3EDXB 4X1PU 1C1WH 3GOVB 1T32A 1C1VH 2P3UB 2A31A 4Y8XA 3RMOH 1C2LA 1GBHA 2P8OB 2F3CE 3SU4A 3HATH 1HIAB 1GBJA 1O2OA 1TIOA 2W7UA 1KDQA 1HBTH 3UWIA 2VJ1A 1BTPA 3ZVCA 5EU8A 2P16A 1KIGH 1F92A 2Z9JA 5A0AE 1K1PA 2J95A 4FVDA 1ZHPA 3PMHB 1ZSKA 3OX7U 1DY9A 1WCZA 3MU0A 2ZGBH 3GY8A 2GX4A 1O36A 1MTSA 3AW0A 2HOBA 4FU9A 3SU0A 3LGWA 5JBTA 1QA7A 1PQ5A 5EPYA 1GBIA 4UD9H 3JZ1B