5F8XA

The crystal structure of human plasma kallikrein in complex with its peptide inhibitor pkalin-3
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
239
structure length
239
Chain Sequence
IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasma kallikrein
publication title The Crystal Structure Of Human Plasma Kallikrein In Complex With Its Peptide Inhibitor Pkalin-3
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8xA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8xA01
1C1SA 4UEHH 4ABEA 1C2DA 1GHXH 1LQDB 1O3FA 2CJIA 3SJ9A 3SUDA 1CU1A 1BRAA 1ELFA 1GBTA 2BY8X 1ZMJA 4BTIB 3SU0A 3ODDA 2XC5A 1EAUA 2ANMH 2VVCA 4X1RU 5AF9H 1C2GA 2BDHA 1DLEA 3ESTA 1AY6H 1LVMA 1M9UA 1GVLA 3M35A 3BTEE 1P2MA 1QB6A 1QFKH 3KF2A 2HRVA 1MTNC 1LVOA 2Z7FE 4DGJA 2O8WA 3RXQA 4XFQA 2O8MA 1TGCA 3GCTG 3PB1E 3LC5A 4JZFH 4SGAE 1G2MA 2O8LA 4ZH8A 1SFIA 2FIRH 2D8WA 1AB9B 3TU7H 1O2NA 1TPAE 1ZTLA 5TCCA 8KME2 1GBEA 1SLWB 2P95A 1O37A 1AMHA 1TA6A 2EI6A 3EA8A 5FX5A 2ZGBH 2FEQH 2D2DA 1OXGA 1YPHE 1ZOMA 1YF4A 1FLEE 3MI4A 1HJAC 3P17H 2FOGA 2IN2A 2ILNA 3PMHB 1IQFA 1YPEH 5J4SA 2GTBA 1SI5H 3RXVA 3LU9B 1WUNH 2WPLS 4ZKSU 5LGOA 1TMUH 3SV6A 1ORFA 1QIXB 2ZDKA 5L2YH 1IQKA 3ZV8A 1AUJA 3BV9B 4DVAU 1LHFH 1QBVH 5LPEA 2OC1A 1NO9H 4TY7A 1IHSH 1S0QA 4INHA 5DGJA 4O9VA 3SUGA 2GMTB 2C93B 2ZFTA 3ZZ9A 1E34B 3ATKA 1BOQA 1UJ1A 1SGRE 2Z3EA 4JZEH 3RMLH 1S5SA 1DSUA 2QF0A 3FZDA 2NU3E 1IQLA 3M5NA 3KCGH 2C8YB 3RLWH 1SG8B 4RKJB 3R3GB 1GL0E 3LKWA 4B74A 3E0PB 4UFFH 1F0UA 3MOCA 1C2HA 5DO4H 3M5OA 4J1YA 4I8JA 2PUQH 3MHWU 2OQ5A 1GI5A 1ELTA 1AO5A 1XXFA 1RXPA 4YT7H 1Y3YA 5I25A 2FODA 1O3LA 2O8TA 4GAWA 2G52A 1CVWH 1OP0A 1SGNE 3BTTE 2BD8A 1O3AA 1G9IE 2ANWA 3U8TH 1HJ9A 1N1LA 2FOEA 1CQQA 1ZSKA 3PV4A 4ABIA 4NZQA 3QO6A 5HMAA 1UK4A 1AWFH 2BDYA 1WOFA 3MNXA 1GMCF 3GY3A 6LPRA 2BDCA 1BB0B 3RXUA 3SUEA 3EA9A 1T8MA 1NRRH 4AG1A 3DFLA 1EAWA 2VNTA 1TBQH 2XBVA 1GBHA 5LPFA 4NIVA 1Y3WA 4MNXA 1MKWH 1CGHA 1RTLA 1XX9A 1V2OT 3W94A 3VXEH 3QLPH 3LGUA 4JZIA 4ZHLU 1QRXA 3DHKH 4FUFA 1LQEA 3RXSA 5GXPA 1XVMA 1MKXK 6GCHF 1K1NA 3RU4T 4Y7BA 2QAAA 1SVPA 1NN6A 4YESB 3GY7A 2H5CA 1CT0E 2FOHA 1T4UH 4I33A 3F9EA 1LKAA 2PKSC 4WWYA 1L4DA 4UFDH 2CXVA 3PMJA 1ACBE 1V2LT 4B1TA 3D65E 1HV7A 3ATIA 1MBMA 2FESH 5HM9A 1FDPA 2ODPA 1N6YA 3A7YA 1TGBA 1F0TA 1QRWA 1ANBA 4BXSA 4OS4A 3GCTF 5E2PA 1TAWA 1VJAU 2ZZUH 2Q6FA 2ZG0H 1BDAA 5T6GA 1CSOE 1TBRH 4ABBA 1GHAG 1AIXH 3SQHE 3H7TA 1W0YH 3VXFH 2H9HA 2A7HA 4Y8XA 1TX7A 3D62A 2CF8H 2A32A 2ZDVH 3EE0B 4WH8A 1Y3VA 1V6DA 2V6NA 3KQBA 1GI8B 1V2UT 1KXCA 3E91A 4BAHB 2ZGJA 5L6NH 1E37B 1ESTA 3M7QA 1A7SA 4WMFA 4LXBH 1AN1E 1ZJDA 4U32A 1QR3E 1EUFA 2SFAA 1W14U 1QA7A 3GYLB 1KLJH 1C5NH 3PMBB 1A5HA 1FIZA 5E0HA 4ISIH 1GMHG 4AFQA 1S0RA 4H6TA 4F4OC 1LPGB 1VGCB 1LHCH 4Y11E 3UTUH 5E8EH 1NFUA 1DPOA 5C1UA 1GVZA 2BQ6B 3SU2A 1DT2A 2VIQA 5FHTA 1W10U 4K69A 1J14A 4JCNA 3TK9A 2Y7XA 1GMDG 1O2WA 1TX6A 4KGAA 3UIRA 2ZTXA 3PLKA 1T32A 3E0NB 4TY6A 2JKHA 4X6OA 4I8HA 2FWWA 3QX5H 4MNVA 1MZAA 5JB8S 2ZP0H 3GOVB 1SGYE 4WXIA 2OXSA 1HAXB 3SQEE 1O3OA 3LGYA 4MNWA 1GBKA 3SUFA 3RXPA 3LH1A 3S9CA 1P2KA 4RSPA 1NY22 4K60A 4BAMB 1TPSA 4MPUA 3OY5U 4ZXXH 5C67A 1TE0A 3GCNA 3RXBA 3LT3A 1QJ7B 3R0FA 1C5UA 4AORA 2PSXA 3SHAH 1FMGA 1HAPH 3PROA 1C2MA 1FJSA 1EPTA 2V0BA 1BA8B 4AG2A 1WQVH 1DANH 3TK6A 5L2ZH 1RFNA 2PTNA 2QXGA 1HAVA 1O2HA 3QGJA 1CBWC 2PWXA 3AVZA 1FNIA 5JYIA 2BLVA 1CHOG 2CHAC 1C5RA 1D3DB 3HGPA 3ZZCA 3LGVA 4NWLA 1NU9A 3SNDA 1UTQA 3BTFE 4SGBE 4ZMAH 3KGPA 4YM9A 1QURH 1ELEE 1C1TA 2FO9A 4A5TS 4B75A 3ZVBA 1A1RA 1KXDA 1LMWB 2AMQA 3LH3A 2QC2A 3OTJE 4OS5A 1LVYA 1P2IA 3AW1A 5C3NA 1H9IE 5DP7A 1AVGH 1AZ8A 1GI1A 2HVXA 1O32A 5GIBA 1HIAA 2BM2A 2P8OC 3SHCH 4LZ4B 4X8UH 1L4ZA 4NSYA 2C8XB 3MNCA 4Q7ZA 3SU6A 2R2WU 3MH6A 1O33A 1Y3XA 1SGIB 5IYTA 2P94A 1O5DH 1BBRH 3SU5A 3BIVH 1DWCH 2ZU4A 2ESTE 1Q31A 2ZGXH 1GGDC 1W13U 2GV7A 4O3UA 1AUTC 3ENSB 3ATLA 4CHAC 4HZHA 2BB4A 2PGBB 1S84A 3TGJE 2ZI2H 2GCHG 3T27A 3ATWA 3E8LA 2XWBI 2BDIA 4X1PU 2A7CA 1TABE 4CH8B 3QK1A 5LH8A 5EQQA 3MMGA 4MDSA 2QXHA 1GHBF 2VB0A 1Z8IB 4DIHH 1E36B 4JYVH 1GCDA 1J17T 4IC6A 1O3EA 1QJ1B 1XKAC 1WU1A 1YLCA 3MU8A 2ODYB 5EG4A 1EJAA 3SO3A 2A2XH 1AWHB 2A5IA 1NRQH 2OC8A 1Z8JB 1NFXA 2TRMA 5H4IB 3D49H 2ANYA 1UK3A 2AIPA 2BD9A 1TNGA 2BMGB 1C5TA 5EQSA 4AYVB 3A84A 1FY3A 2F9UA 2Y81A 1SBWA 2G4TA 1WV7H 3A8CA 3Q3KA 2FS9A 4NA8A 1GMHF 3PTBA 3A7WA 4FU7A 1MQ5A 1GJ7B 1BTHH 5JBCS 3TPIZ 4VGCC 3TH4H 1VCQA 4X8VH 1Q3XA 1ZPCA 4WH6A 5FAHA 3LGWA 1S6HA 3BG4B 1P10A 1UVOA 1MZDA 3MU1A 3RXKA 1FAKH 1YGCH 2VGCB 4NZLA 1S6FA 1YP9A 4CH2B 2HPQH 2F3CE 1PPCE 4Y8YA 2J38A 1QHRB 1C5YB 2BLQA 3HK6B 1ANEA 3SV8A 2OUAA 1W12U 3SORA 3UPEA 1RD3B 1UTKA 1O2UA 2Q6GA 3S69A 1ZTJA 1BHXF 2WPMS 2BXTH 3UOUA 4Y10E 1LVBA 1CA8B 2R3UA 3STJA 4FUBA 4UDWH 3A7XA 2IPHA 1OPHB 4Y0YE 3K6ZA 2HPPH 4KP0A 1S82A 1L1GA 1GVKB 2BZ6H 1HAVB 1SQOA 1UVUH 2FDAA 1DDJA 5JB9S 1C5XB 1HXFH 3TH3H 4D9RA 1TMBH 3IITA 2GT8A 5E0JA 5TCAA 1BJUA 1MCTA 1FONA 3P8OA 2OINA 4A1VA 1BTXA 1CHOF 1KY9A 4NSVA 1PPHE 2B5TB 2THFB 1GJ8B 5FXLA 2W3IA 3AW0A 2O9QA 1RTFB 4X1NU 2F9PA 1RTKA 2ZTYA 7GCHG 1C9TA 2XC0A 1ZSJA 3RXGA 1W7XH 1FY8E 5FPYA 1NFYA 2ZU1A 1SFQB 3MYWA 3O8CA 1KTSB 1QY6A 2GP9B 2QA9E 3M3SA 4D9QA 1Y5BT 4ZUHA 2ZDLA 4BTUB 1TWXB 1LHDH 2ZFSA 1G36A 1FQ3A 1THSH 2QXJA 3TGKE 1F92A 1P2QA 3UREA 1AZZA 1SGDE 1O3MA 1TA2A 1YPKH 2VIDA 1V2MT 1HRTH 5EXNA 4IMQA 3UWIA 1DWBH 1D6RA 6ESTA 4J2YB 2BY7X 2K1QA 2C8WB 2FMJA 2BX4A 5F8ZA 3UFAA 2OC0A 1Z1IA 1HGTH 4GPGA 4WJG2 4FUGA 1OWEA 1W0ZU 2TGTA 2XXLA 5HM2A 1J9CH 1HAOH 2ZQ2A 1TRMA 3LJJA 2ZNKH 1EAIA 1GJDB 2ANKH 1KXFA 3T5FH 1GWAA 1GBCA 2XWAA 4WF8A 3ZZBA 3U69H 2BZAA 3ZZ4A 1C2JA 4H6SB 3BTKE 1O3KA 2FPZA 3NXPA 1GJCB 1O2RA 5DP6A 2BY6X 1K28D 4Q7YA 2Z6BD 2AMPA 1OP2A 4X6PA 1BRCE 4A7IB 1H8IH 1QTFA 2H9TH 5EW2H 1GJ9B 3FP7E 3RXHA 1ZR0A 3EDXB 2RCEA 2ZGHA 1DS2E 1GJBB 3A83A 2CN0H 1Z6JH 1O5AB 5CE1A 2BQ7B 2A7JA 3U8OH 5ESBA 1NFWA 1SGQE 3LC3A 2J92A 1AB9C 2Z9IA 1SGPE 1ABIH 1BHXB 4A1TA 1K1MA 4IMZA 1GI0A 4KTCA 2C4FH 2J2UA 1P0SH 1IQEA 1N8OC 1KLTA 2QXIA 1NS3A 3RXJA 3DT0H 1DSTA 2Y5HA 2W3KA 3ZVEA 2BVXH 1MD7A 4I8KA 1AFQC 3CS0A 2W26A 1DUEA 2BOHB 1INCA 3TJNA 1KXBA 3U98H 4CRDA 2FYQA 1YCPM 4ZHAA 2BLOA 1SPJA 2J9NA 2XCNA 2WPHS 3RM0H 1P11E 1C1VH 1O3GA 1Z8RA 1K1JA 2FLRH 1TNIA 1YM0A 1AE8H 1GG6C 2ZTZA 1GBDA 2VWOA 2FYRA 5EPNA 3EAJA 2GCTC 2GVFA 2F9OA 2PFEA 5CHAC 1SR5C 1MTNB 3FP8E 1WTGH 2WINI 2AGIX 1DY8A 5EQRA 3A81A 1UVSH 4AFUA 1G3EA 2NU0E 5AHGH 2HALA 2HNTC 3NKKA 5JBTA 3UWJH 1BRUP 1Z71A 1MTWA 1GHYH 2FTLE 2IJOB 1GCTC 1VJ9U 5FBIA 2H6MA 2KAIA 1PPZA 2JH6D 1D3QB 2UUYA 1HJAB 2O8UA 2G51A 3V3MA 4FVDA 4WVPE 4ABDA 4INLA 4DT7B 1LPKB 2J34A 3S7HB 1FV9A 2ZPSA 4Y0ZE 4CBNA 2G55A 2A1DB 2J94A 1D4PB 1GJ5H 4B2AA 2ZHEH 1XUGA 4ISLA 3BEIB 5C1XA 2SGEE 1C5WB 4DCDA 5DP3A 2OBOA 4AB8A 1ZPBA 2OD3B 1DITH 1P8VC 5GCHG 5FPSA 4INKA 3EYDA 1MCVA 1XUIA 3GISB 2G8TA 1C5ZB 3GCHC 3ZZAA 1BMLA 7LPRA 1O30A 5FCRA 1RGQA 2VWMA 3BEUA 5GWZA 1O5BB 2Z9LA 1D3TB 1YYY1 3M5LA 4U2WA 2ZDAH 1LO6A 3DUXH 2BVSH 1WYKA 1BCUH 4I31A 1H1BA 1QL8A 2GZ8A 2ZPQA 6CHAC 1SSXA 4WY3A 4I8GA 2RG3A 1RIWC 3F6UH 4Y71A 3KL6A 1AU8A 2G5VA 2XYAA 5EXLA 3FVFB 4FVBA 2HLCA 1JIRA 1YPLH 1NU7B 1TLDA 4YZUA 3RU4D 4DJZB 3UQVA 1KTTB 2WPIS 1OOKB 3NZIA 1P01A 1GI9B 1HJ8A 3W95A 2VVVA 2F9VA 4MG3A 3SNEA 1E35B 4BXWA 5ABWA 5FCKA 4WXVA 3LONA 3E6PH 2UWLA 2V35A 4Q80A 2ULLA 3K65B 1PPFE 1PYTC 4F49A 2GZ9A 5JBAS 5F8XA 4MNYA 1JRSA 1XVOA 3QZQA 2ZFPH 1NRNH 1EZQA 1GBJA 3SJ8A 3MU4A 1TFXA 1PQ7A 2AH4X 3PWBA 1O5GH 2SGQE 2CF9H 2NU1E 4Y79A 1HAZB 1XUHA 2GD4B 2HWLB 4AFZA 1D6WA 3QTVH 3TLOA 2ZU3A 1L2EA 1ZRBA 1AVWA 1A5GH 4JZ1A 1BMMH 2TGDA 5AVDA 1OX1A 1YLDA 1VCWA 1V2KT 2TGAA 1T8LA 3F9FA 2NU2E 1TMTH 4ABJA 1O2KA 4ABGA 1ZMNA 3I29A 2PKSB 1UCYH 2BD2A 7ESTE 1AD8H 1P09A 1VGCC 1YCPH 2FP7B 3TJOA 4HTCH 2ZU2A 3SJOA 2STBE 1OWHA 2PV9B 3RDZA 3SU4A 1TGSZ 1BJVA 1ZSLA 2ZCHP 1X7AC 4K1EA 2ZWLH 2WYJA 3FAOA 2AERH 3RMNH 1GHZA 2KAIB 1F5RA 5JPMH 1O2MA 3A89A 1SGFA 3UUZA 3T29A 2GDEH 1MAXA 4XSKU 1JIMA 4FUIA 1YPGH 4YLQH 1ETSH 4UD9H 3ZZ5A 2BTCE 3SI4H 3PM3A 1C5LH 1PFXC 1O2QA 1THPB 2ZO3H 2OLGA 3NCLA 5DJ7A 1LHGH 2F91A 4U30A 1A2CH 1P2JA 3SGAE 3N7OA 1VITG 1FIWA 2SNWA 2QCYA 1SGEE 1XUKA 1BZXE 1HDTH 4Y8ZA 1TYNA 1ELCA 5A0BA 5T6FA 1ID5H 4OS7A 4BAQB 1F0RA 2R3YA 3MH5A 5T6DA 1MTVA 1K1OA 2VH6A 1QB9A 1ZTKA 1NRSH 4KTUA 2FTMA 1C9PA 3FANA 1W7GH 5PTPA 4AB9A 1Y5AT 3LOXA 2ZCKP 1O2LA 1HNEE 1J16A 1JRTA 1F5LA 1MU6B 1B5GH 1ZYOA 2OC7A 1O2OA 1RJXB 3TH2H 4ZXYH 5C20A 4NIXA 3OY6U 1C1OA 1J8AA 1AGJA 2PW8H 1ELGA 1OWIA 3O8RA 3AAVA 5AFZH 4I7YH 4CR5A 3V12A 1CGJE 4NIYA 2CMYA 4B71A 1ANDA 2ZQ1A 3PLPA 1C5MD 2ZGCA 1ESAA 1L0ZA 2Y6TA 3WY8A 1ARBA 3A86A 1BTUA 1XKBC 3DD2H 4NFFA 3MO6A 3L3TA 4PROA 3ELAH 1E0FD 1GI7B 2JETC 3GDSA 4Z0KA 4I32A 3RMMH 1GHVH 5ESTE 4OS6A 4CRGA 2PLXA 3A85A 3OX7U 4YLUA 4BAOB 1CBWB 2ZHDA 5GPIB 8LPRA 1UVTH 2XC4A 1QRZA 3URCA 2P3TB 3ZVCA 4E06H 4OGXA 3HGNA 1EB1H 4JYUH 3K9XB 4DURA 2LNCA 1UTLM 3LDXH 2BXUH 4NCYA 3JZ1B 5C5OA 3GY8A 1DXPA 1ETRH 1C1UH 1CA0C 3UNSA 4BAKB 3VB6A 4Z6AH 4X2XA 4NG9H 4E7NA 1OSSA 8GCHG 1Z8GA 2XBYA 5T3HA 2XRCA 3GICB 1SLXB 2BLWA 4AYYB 4CRBA 1EQ9A 3RXEA 1EOJA 2TIOA 1K1IA 2TBSA 4I8LA 5A8YA 1JOUB 1IQGA 1KIGH 3T26A 1GHAF 4Y7AA 2P8OB 3VB3A 3PLBA 3U9AH 4AN7A 2ZU5A 4R0IA 1MTUA 1T8OA 1LKBA 2PHBA 4XDEA 4AGJA 4A6LA 5A8ZA 2QN5T 1EKBB 3O8DA 2H5DA 3ZVDA 1TONA 3H5CB 5A0CA 1AHTH 2WV4A 1GGDB 4NA7A 4CHAB 1JMOH 1EASA 2JH5D 2R0LA 1W3CA 4KELA 1C1NA 1D3PB 1W11U 5IDKA 1P05A 4ABFA 3PTNA 4IGDA 4ISNA 2ZF0H 2QGRA 3RXOA 1DXWA 2IOTA 2UUJB 1O3CA 1IQIA 1W2KH 3Q77A 1P12E 1KXAA 1FAXA 1YPMH 1C2IA 5HYOA 1QL7A 2FX6A 3ODFA 3P8GA 4DOQA 5EXMA 1SHHB 4DG4A 3L6PA 1KSNA 4D7GA 1B0EA 8ESTE 1A0HB 1TALA 1GMDF 2C8ZB 2FI5E 1O2TA 2BQWB 2BX3A 3E16B 1RS0A 2FXRA 1GL1A 1LHEH 3SU3A 1BITA 4Q7XA 2OCVB 3MO9A 2G5NA 2BD7A 2W7SA 1GBBA 2OP9A 1SQTA 4ZHMU 4NFEA 1C1MA 4X1QU 3M7UA 5DP9A 1G37A 1MKXH 1EB2A 1AQ7A 3ATMA 3ZYEA 5K7RA 4OGYA 3E1XB 4XBBA 4FUHA 3VGCB 1TNJA 2FOMB 2VU8E 2ALPA 2Z9KA 1A0LA 1BMNH 1C4Y2 1EPTB 4VGCB 1UTJA 4CRAA 3NWUA 3KHVA 1TGTA 1THRH 1O3NA 1JBUH 2CV3A 1DX5M 3PO1C 4IN1A 2VJ1A 1O35A 2PSYA 4O97A 2VIVA 1SC8U 3A8BA 1MKWK 2NWNA 2Z3CA 1PJPA 1T31A 2D26C 3UNQA 1TOCB 2BD4A 4DY7B 1TNKA 2XCFA 1H9HE 2AMDA 5I46H 3FFGA 5L30H 1GI3A 3V0XA 4RN6A 5EPYA 2SGPE 3MFJA 4YOGA 3SBKA 1SHYA 1KDQA 1ZGVA 1XUFA 4CRCA 2SGDE 1TGNA 2EI8A 4X0WU 1OYTH 1T4VH 3C1KA 1QB1A 4YOIA 1O2XA 4AOQA 1O3IA 2VWNA 2VWLA 2FI4E 3CP7A 2BY5X 3KIDU 4FU9A 1GBLA 3DFJA 3HKIB 3Q00A 9LPRA 1HIAB 4LOYH 3VB5A 2V3HH 3P95A 3IG6B 2V3OH 3RXTA 2XBXA 1MBQA 4ISOA 1ZGIA 2UUKB 3TITA 1C5OH 1GI6A 3GDVA 3JZ2B 1V2WT 2A4RA 4GCHG 3TIUA 1SGTA 1ZMLA 1P9UA 2D1JA 4YTAA 1A3EH 2OBQA 2TPIZ 3KEEA 4ABAA 1NM6A 1S85A 1V3XA 5C1YA 4THNH 4A1XA 1QL9A 2BDAA 4CR9A 1JXPA 3AAUA 4KTSA 3M3VA 4XOJA 1GDUA 1O38A 1P3CA 1O0DH 3A88A 3K2UA 4UFEH 3PYHA 1BBRE 1ZPZA 1AFEH 1TB6H 4NGAH 4K3JA 1Y59T 1PPEE 1FUJA 1NPMA 2GCHF 1CO7E 4AFSA 1UTMA 2GZ7A 2P16A 2QV1A 3TVJB 1GBAA 1IQMA 1O31A 3BTWE 3GY4A 3EA7A 3RP2A 1PYTD 1DUAA 4K1SA 7KMEH 5C2ZA 2RA0A 4NA9H 3UY9A 2YNBA 1BRBE 5ETXA 1G3CA 3RM2H 4IN2A 4UONA 1C2KA 1O36A 1GMCG 3A82A 4X6NA 1P3EA 1YC0A 5K0HA 3P70B 3EGKH 2ODQA 1O3BA 2J95A 4TPYA 3P8NA 4HI3A 3RC4A 1IHTH 2FOAA 5C5NA 1BTPA 1DWEH 1ZHMA 1ZJKA 4MLFB 2Y7ZA 1G3BA 2F83A 2R9PA 4OS1A 1QBOA 1SB1H 1TX8A 2Y5GA 1UHBA 3D23A 1SGCA 1HPGA 2HNTE 1A0JA 3S0NA 6GCHG 1P06A 2M5TA 2GX4A 9ESTA 2QIQA 1Y8TA 3A80A 2UWOA 1ABJH 5A09A 2FOCA 1O2GH 3SNAA 1TRYA 1SLVB 3RXLA 2PTCE 1XM1A 3P8FA 1ARCA 1WQSA 2F9NA 2VIOA 1ANCA 1GBIA 3RMOH 2EA3A 2DE8A 3UQOA 3MH4A 3A7TA 5FX6A 3LGTA 3SZNA 2ZEBA 5G4BA 5DK1A 4LZ1H 4GVUA 1G32B 3BTHE 1YBWA 1O5CB 1ZHRA 1UVPA 1SMFE 1WSSH 3ZVGA 4ZKOU 1QBNA 2G4UA 1N8OB 1BTWA 1QGFA 2BDGA 3RXIA 1CT4E 1EZXC 2GMTC 1XUJA 2F9BH 3BG8A 3F9GA 3S9BA 3NK8A 1FY5A 4K8YA 2AGEX 1AFQB 3AASA 3L33A 1O5FH 2ZA5A 4JZDH 3LIWA 1K2I1 3TNSA 2BHGA 3A7ZA 2YNAA 1C2EA 1GJAB 1P2NA 3GY6A 4MVNA 4JYTA 3CS7A 3SGBE 1KDQB 1GG6B 2Y80A 4IS5A 4JMYA 2FZZA 1UO6A 4K5ZA 1TPPA 4YOJA 1EP5A 2GCTB 3OSYA 3SN8A 1GI2A 5CHAB 1F0SA 3SW2B 1BBRK 3RLYH 4FUJA 3ZZ6A 2WYGA 3NUMA 1TNLA 4GHTA 1H8DH 1ESBA 3B9FH 1UTOA 7GCHF 3SJKA 5A8XA 1F2SE 1GDNA 1A4WH 5EGMA 1UMAH 1NZQH 2Z9JA 3Q76A 2WUBA 1HAYB 2ASUB 1GJ4H 2WV5A 3QZRA 1SGFG 1P9SA 4MPXA 1XXDA 1P57B 1EZSC 1WAYB 1SOZA 1GCTB 1EAXA 1P02A 4GCHF 3SNBA 4MPWA 1YPHC 4ZROA 1IQHA 4CRFA 1ELDE 1MU8B 4TPIZ 3PWCA 2ZFQH 4ZAEA 4FXGH 3VEQB 1FZZA 2AYWA 2PGQB 2AEIH 2PKAA 3M7TA 3U8RH 1HUTH 3QDZB 5E2OA 3PMAB 5AFYH 1L1JA 3MTYA 1KLIH 1PQAA 3BN9A 1JWTA 4OS2A 3ZZDA 1TIOA 4WMDA 1FN8A 2FM2A 1YKTA 5GJ4B 3Q3XA 5BPEA 1NESE 3RC5A 3V13A 1DY9A 1SOTA 1QA0A 4CREA 3EQ0H 3M3TA 2AIQA 3MU0A 2PUXB 1V2ST 3OYPA 4HGCA 3MNBA 1F5KU 1O3PB 3GCHB 3KN2A 3GYMA 3CENA 1MQ6A 5HXFA 3UOPA 2EI7A 4AZ2B 4Q2KA 4H42U 1BQYA 1OYQA 2Z9GA 4X2VA 3ZV9A 4FUDA 4MTBA 2FOBA 2W5EA 2FOFA 5JBBS 1FI8A 2XW9A 4TYDA 1QQ4A 3QN7A 1QCPA 2XBWA 4B73A 1UHBB 2FX4A 6CHAB 5B6OA 2ZKSA 3M37A 3S9AA 2WUCA 5DP4A 1O2YA 2BOKA 1RIWB 4X1SU 3RUOA 2VIWA 1UTPA 3RXRA 2DE9A 1RRKA 1SLUB 3SU1A 4DW2U 3VB4A 2A5KA 1IOEA 4JK6A 1TPOA 2G81E 3SJIA 1V2TT 1DOJA 1C1PA 1K1LA 1B0FA 2Y5FA 3TGIE 4D8NA 3RXFA 2A45B 3STIA 5TJXA 3MH7A 1ETTH 1O2VA 1CHGA 5DKMA 1PQ8A 1MD8A 1MAYA 1P2OA 4BNRA 4BOHA 1EP6A 4RKOB 4B76A 1DM4B 3M5MA 1FPHH 1XMNB 3T28A 2Y82A 2HGTH 2ZC9H 4ASHA 4DIIH 2BDBA 3NPSA 1GHBG 2LPRA 1N6XA 1UK2A 1PPGE 1OWDA 1ZZZA 4B2BA 2WPJS 4UFGH 2BY9X 1GI4A 3LGIA 2R0KA 4IW4E 5E0GA 1EOLA 4H4FA 1C2FA 1CT2E 4XE4A 1GJ6A 2P93A 3M36A 2VH0A 1Z6EA 3BF6H 2A2QH 3GY2A 2CGAA 1FY4A 1A3BH 1TNHA 5FBEA 4ZKRU 4K1TA 1BIOA 3F68H 4K8BA 1A61H 1O34A 1P04A 2ZFFH 3BTQE 2A4OA 2SNVA 1C4V2 5F03A 5FPTA 1V2PT 1C5QA 3A8DA 4X8SH 1EZUC 1ELBA 1OS8A 3BEFB 3SV9A 1QNJA 1BTZA 4MQAA 4E05H 1EJMA 4D7FA 1V2RT 1C2LA 4XBDA 2PR3A 2ZIQH 1ZLRA 1DLKB 4YO9A 1MMJN 3H7OA 1IQJA 3FZZA 4R8TB 1MTSA 3A8AA 4UE7H 1AI8H 3P92A 3ZVAA 2SGFE 2Z3DA 3SV7A 1EXFA 1F7ZA 1P03A 1C1RA 1H4WA 3TJUA 1Y3UA 1T8NA 1K1PA 3TJVA 1AVXA 4ESTE 1HYLA 3RXDA 2H2ZA 5GCHF 2WPKS 3MNSA 1OWJA 4IBLH 2YOLA 2PKAB 2XTTB 1DE7H 1VR1H 2RDLA 3RXCA 4GUXA 2DUCA 5EOKA 5J4QA 3SNCA 2GV6A 2ZECA 1HBTH 1CGIE 3G01A 1EJNA 1FPCH 4FU8A 1PQ5A 1B7XB 4X8TH 4KKDA 1TRNA 2B0FA 3ZYDA 1QJ6B 1TQ7B 3UR9A 1FY1A 1ZRKA 1O2IA 3UR6A 1BTYA 1VITH 3TK5A 3BTDE 3SI3H 1FN6A 1Z1JA 1WTHD 3RU4E 1TOMH 1HAIH 1S83A 4TWYA 4BTTB 2B9LA 3DA9B 1BMAA 3F1SB 2ZCLP 3ZZ3A 3B23B 3URDA 2R2MB 5SGAE 5DPAA 1EX3A 1K9OE 1TBZH 1AKSA 3VPKA 2VINA 2CHAB 2BD5A 3GY5A 4WMEA 3M61U 3BTGE 4B2CA 2P3UB 1J15A 1GBMA 4ISHH 1ELAA 1U6QA 1Y5UT 2UUFB 4AX9H 4NIWA 1S81A 3U1JB 2EC9H 5LPRA 2G00A 5CMXH 1O3DA 3IWMA 1C4U2 2JETB 3ZZ8A 1E38B 2QY0B 2ZPRA 1NRPH 4E7RG 1CE5A 4U01A 1DVAH 3GCOA 1V2VT 5F6MA 4BANB 3V7TA 4MPVA 1MUEB 3BSQA 1GBFA 1O3JA 1LTOA 2FI3E 2JH0D 2ZFRH 5EODA 1NTPA 3HKJB 1CA0B 1V2NT 1G30B 1UCYE 3P6ZB 4HFPB 1OKXA 1O5EH 4X6MA 3BG4C 3C27B 1NROH 3I78A 3SGQE 1DICA 2A4GA 1ZHPA 1L1NA 2VGCC 1O2SA 2H1UA 4X2WA 5A0AE 3O8BA 3T25A 2Q6DA 4A92A 4JK5A 4CBOA 2SGAA 1G3DA 3ITIA 3K6YA 1GHWH 5HGGA 1HAGE 3QWCH 1HCGA 4D76A 2BD3A 3BTME 2STAE 4FUCA 1HAHH 3RXMA 3RXAA 2BVRH 1IAUA 2GKVE 3B8JA 1D9IA 2Q1JA 4ZKNU 3VGCC 2FLBH 1T7CA 2GGVB 3VFEA 1PPBH 3I77A 3SV2H 4IC5A 1EPTC 3UNRA 3QTOH 1NT1A 1BUIA 1KYNA 2ZHWH 2VIPA 1VITF 1MH0A 1WBGB 3VB7A 3HPTB 3KQDA 1C1QA 1HFDA 1LDTT 1SL3A 4K2YA 2VVUA 2AS9A 2ZDMA 1C5PA 1A46H 1C5SA 5DG6A 1WCZA 2EEKA 1Z7KA 1O39A 4LK4A 1V2JT 1HB0B 3E90B 1FXYA 3BIUH 4GLYA 5A2MH 2ALVA 3HK3B 1W8BH 2UWPA 4YT6H 2AGGX 2P59A 1C1WH 3QUMP 4GSOA 1HLTH 2B8OH 3KQCA 2C3SA 1A5IA 2FS8A 1VCPA 2J4IA 2H9EH 2XNIA 1AE5A 2P3FH 4M7GA 3KQEA 1C5VA 1O2ZA 3A7VA 5DP8A 1Q2WA 2C90B 4Y6DA 3GDUA 2BYAX 2GDDA 1UTNA 4AGKA 1HXEH 1H9LB 2RA3A 3FP6E 1OP8A 4Y76A 1BT7A 2NU4E 1K21H 1V2QT 2A4QA 1ELVA 2QF3A 3PO1B 4O3TA 3T62A 5EW1H 2AFQB 2I6QA 5JDUB 1AKSB 1LPZB 1DFPA 3T2NA 1K22H 3LPRA 2OTVA 3E3TA 3Q3YA 2B7DH 1G2LA 1O2JA 2I6SA 4X2YA 1EATA 2OQUA 2ZHQH 4GHQA 2TGPZ 4TWWA 2A31A 3S7KB 1IQNA 1QQUA 3KNXA 1GDQA 2ZHFH 3ZVFA 1DWDH 1UCYK 3LJOA 3ZZ7A 1YCPK 5EU8A 3MWIU 2QYIA 2HOBA 2GT7A 1O3HA 8GCHF 1VZQH 1NC6A 1LCYA 2A0QB 1TQ0B 2HNTF 1OWKA 3U1IB 2A5AA 2W7UA 2Z94A 4FUEA 5F8TA 3OU0A 4ABHA 3F9HA 1O2PA 1GPZA 3TNTA 1KXEA 3HATH 5BRRE 3MU5A 1YPJH 3QGNB 4O03A 2ZDNA 3A87A 5GDSH 4XBCA 1SQAA 4NWKA 5DP5A 3SOSA 3MO3A 4QT8C 3RC6A
chains in the Genus database with same CATH superfamily
1C1SA 4UEHH 4ABEA 1C2DA 1GHXH 1W0JD 1LQDB 1O3FA 2CJIA 3SJ9A 3SUDA 1CU1A 1BRAA 1ELFA 1GBTA 2BY8X 1ZMJA 4BTIB 3SU0A 3ODDA 2XC5A 1EAUA 2ANMH 2VVCA 4X1RU 5AF9H 4ZCNA 1C2GA 2BDHA 1DLEA 3ESTA 1AY6H 1LVMA 1M9UA 1GVLA 3M35A 3BTEE 1P2MA 1QB6A 1QFKH 3KF2A 2HRVA 1MTNC 1LVOA 2Z7FE 3OTPA 4DGJA 2O8WA 3RXQA 1OHHD 4XFQA 2O8MA 1TGCA 3GCTG 3PB1E 3LC5A 4JZFH 4SGAE 1G2MA 1SQRA 2O8LA 4ZH8A 1SFIA 2FIRH 2D8WA 1AB9B 3TU7H 1O2NA 1TPAE 1ZTLA 5TCCA 8KME2 1GBEA 1SLWB 2P95A 1O37A 1AMHA 1TA6A 2EI6A 3EA8A 5FX5A 2ZGBH 2FEQH 2D2DA 1OXGA 1YPHE 1ZOMA 2V7QD 1YF4A 1FLEE 3MI4A 4DT4A 1HJAC 3P17H 2FOGA 2IN2A 2ILNA 3PMHB 2RFKC 1IQFA 1YPEH 5J4SA 2GTBA 1SI5H 3RXVA 3LU9B 1WUNH 2WPLS 4ZKSU 5LGOA 1TMUH 3SV6A 1ORFA 1QIXB 2ZDKA 5L2YH 1IQKA 3ZV8A 1AUJA 3BV9B 4DVAU 1LHFH 1QBVH 5LPEA 2OC1A 1NO9H 4TY7A 1IHSH 4I86A 1S0QA 4INHA 5DGJA 4O9VA 3SUGA 2GMTB 2C93B 2ZFTA 3ZZ9A 1E34B 3ATKA 1BOQA 1UJ1A 1SGRE 2Z3EA 4JZEH 3RMLH 1S5SA 1DSUA 2QF0A 3FZDA 2NU3E 2HLDD 1IQLA 1H8ED 3M5NA 3KCGH 2C8YB 3RLWH 1SG8B 4RKJB 3R3GB 1GL0E 3LKWA 4B74A 3E0PB 4UFFH 1F0UA 3MOCA 1C2HA 5DO4H 3M5OA 4J1YA 4I8JA 3GS9A 2PUQH 3MHWU 2OQ5A 2HVYB 1GI5A 1ELTA 1AO5A 1XXFA 1RXPA 4YT7H 1Y3YA 5I25A 2FODA 1O3LA 2O8TA 4GAWA 2G52A 1CVWH 1OP0A 1SGNE 3BTTE 2BD8A 1O3AA 1G9IE 2ANWA 3U8TH 3F2HA 1HJ9A 1N1LA 2FOEA 1CQQA 1ZSKA 3PV4A 4ABIA 2KCPA 4NZQA 3QO6A 5HMAA 1UK4A 1AWFH 2BDYA 4Q4LA 1WOFA 3MNXA 1GMCF 3GY3A 6LPRA 2BDCA 1BB0B 3RXUA 3SUEA 3EA9A 1T8MA 3H09A 1NRRH 4AG1A 3DFLA 5C17A 1EAWA 2VNTA 1TBQH 2XBVA 1GBHA 5LPFA 4NIVA 1Y3WA 4MNXA 1MKWH 1CGHA 1RTLA 1XX9A 1V2OT 3W94A 3VXEH 3QLPH 3N7EA 3LGUA 4JZIA 4ZHLU 1QRXA 3DHKH 4FUFA 1LQEA 3RXSA 5GXPA 1XVMA 1MKXK 6GCHF 1K1NA 3RU4T 4Y7BA 2QAAA 1SVPA 1NN6A 4YESB 3GY7A 2H5CA 1EFRD 1CT0E 2FOHA 1T4UH 4I33A 3F9EA 1LKAA 2PKSC 4WWYA 1L4DA 4UFDH 2CXVA 3PMJA 1ACBE 1V2LT 4B1TA 3D65E 1HV7A 3ATIA 1MBMA 2FESH 5HM9A 1FDPA 2ODPA 1N6YA 3A7YA 1TGBA 1F0TA 1QRWA 1ANBA 4BXSA 4OS4A 3GCTF 5E2PA 1TAWA 1VJAU 2ZZUH 2Q6FA 2ZG0H 1BDAA 5T6GA 5FL7D 1CSOE 1MABB 1TBRH 1GHAG 4ABBA 1AIXH 3F2GA 3SQHE 3H7TA 1W0YH 3VXFH 2H9HA 2A7HA 4Y8XA 1TX7A 3D62A 2KX4A 3F0OA 2CF8H 2A32A 2ZDVH 3EE0B 4WH8A 1Y3VA 1V6DA 2V6NA 3KQBA 1GI8B 1V2UT 1KXCA 3E91A 4BAHB 2ZGJA 5L6NH 1NBMD 1E37B 1ESTA 3M7QA 1A7SA 4WMFA 4LXBH 1AN1E 1ZJDA 4U32A 1QR3E 1EUFA 2SFAA 1W14U 1QA7A 3GYLB 1KLJH 1C5NH 3PMBB 1A5HA 1FIZA 5E0HA 4ISIH 1GMHG 2F43B 4AFQA 1S0RA 4H6TA 4F4OC 1LPGB 1VGCB 1LHCH 4Y11E 3UTUH 5E8EH 1NFUA 1DPOA 5C1UA 1GVZA 2BQ6B 3SU2A 1DT2A 2VIQA 5FHTA 1W10U 4K69A 1J14A 4JCNA 3TK9A 2Y7XA 1GMDG 1O2WA 1TX6A 4KGAA 3UIRA 2ZTXA 3PLKA 1T32A 3E0NB 4TY6A 2JKHA 4ACBA 4X6OA 4I8HA 4B6FA 2FWWA 3QX5H 4MNVA 1MZAA 5JB8S 2ZP0H 3GOVB 1SGYE 4WXIA 2OXSA 1HAXB 3SQEE 1O3OA 3LGYA 4MNWA 1GBKA 3SUFA 3RXPA 3LH1A 3S9CA 1P2KA 4RSPA 1NY22 4K60A 4BAMB 1YLNA 1TPSA 4MPUA 3OY5U 4ZXXH 5C67A 1W0KD 1TE0A 3GCNA 3RXBA 3LT3A 1QJ7B 3R0FA 1C5UA 4AORA 2PSXA 3SHAH 1FMGA 1HAPH 3PROA 3PV5A 1C2MA 1FJSA 1EPTA 2V0BA 1BA8B 4AG2A 1WQVH 1DANH 5EJZA 3TK6A 5L2ZH 1RFNA 2PTNA 2QXGA 1HAVA 1O2HA 3QGJA 1CBWC 2PWXA 3AVZA 1FNIA 5JYIA 2BLVA 1CHOG 2CHAC 1C5RA 1D3DB 3HGPA 3ZZCA 3LGVA 5DN6D 4NWLA 1NU9A 5CDFE 3SNDA 2WV9A 1UTQA 3BTFE 4SGBE 4ZMAH 3KGPA 4YM9A 1QURH 1ELEE 1C1TA 2FO9A 4A5TS 4B75A 3ZVBA 1A1RA 1KXDA 1LMWB 2AMQA 3LH3A 2QC2A 3OTJE 4OS5A 1LVYA 1P2IA 3AW1A 5C3NA 1YWUA 1H9IE 5DP7A 1AVGH 1AZ8A 1GI1A 2HVXA 1O32A 5GIBA 1HIAA 2BM2A 2P8OC 3SHCH 4LZ4B 4X8UH 1L4ZA 4NSYA 2C8XB 3MNCA 4Q7ZA 3SU6A 2R2WU 3MH6A 3PV2A 1O33A 1Y3XA 5F53A 1SGIB 5IYTA 2P94A 1O5DH 1BBRH 3SU5A 3BIVH 1DWCH 2ZU4A 2ESTE 1Q31A 2ZGXH 1GGDC 1W13U 2GV7A 4O3UA 1AUTC 3ENSB 3ATLA 4CHAC 4HZHA 2BB4A 2PGBB 1S84A 3TGJE 2ZI2H 2GCHG 3T27A 3ATWA 3E8LA 2K0QA 2XWBI 2BDIA 4X1PU 2A7CA 1TABE 4CH8B 3QK1A 5LH8A 5EQQA 3MMGA 4MDSA 2QXHA 1GHBF 2VB0A 1Z8IB 4DIHH 1E36B 4JYVH 1GCDA 1J17T 4IC6A 5EIYA 1O3EA 1QJ1B 1XKAC 1WU1A 1YLCA 3MU8A 2ODYB 5EG4A 1EJAA 3SO3A 2A2XH 1AWHB 2A5IA 1NRQH 2OC8A 1Z8JB 1NFXA 2TRMA 5H4IB 3D49H 2ANYA 1UK3A 2AIPA 2BD9A 1TNGA 2BMGB 1C5TA 5EQSA 4AYVB 3A84A 1FY3A 3WWFA 2F9UA 2Y81A 1SBWA 2G4TA 1WV7H 3A8CA 3Q3KA 2FS9A 4NA8A 1GMHF 3PTBA 3A7WA 4FU7A 1MQ5A 1GJ7B 1BTHH 5JBCS 3TPIZ 4VGCC 3TH4H 1VCQA 4X8VH 1Q3XA 1ZPCA 4WH6A 5FAHA 3LGWA 1S6HA 3BG4B 5CHBA 1P10A 1UVOA 1MZDA 3MU1A 3RXKA 1FAKH 1YGCH 2VGCB 4NZLA 1S6FA 1YP9A 4CH2B 2HPQH 2F3CE 3U28C 1PPCE 4Y8YA 2J38A 1QHRB 1C5YB 2BLQA 3HK6B 1ANEA 3SV8A 2OUAA 5GNDA 1W12U 3SORA 3UPEA 1RD3B 1UTKA 1O2UA 2Q6GA 3S69A 1ZTJA 1BMFD 1BHXF 2WPMS 2BXTH 3UOUA 4F55A 4Y10E 1LVBA 1CA8B 2R3UA 3STJA 4FUBA 4UDWH 3A7XA 2IPHA 1OPHB 2YMSB 4Y0YE 3K6ZA 2HPPH 4KP0A 1S82A 1L1GA 1GVKB 2BZ6H 1HAVB 1SQOA 1UVUH 2FDAA 1DDJA 5JB9S 1C5XB 1HXFH 3TH3H 4D9RA 1TMBH 3IITA 2GT8A 5E0JA 5TCAA 1BJUA 1MCTA 1FONA 3P8OA 2OINA 4A1VA 1BTXA 1CHOF 1KY9A 4NSVA 1PPHE 2B5TB 2THFB 1GJ8B 5FXLA 2W3IA 3AW0A 2O9QA 1RTFB 4X1NU 2F9PA 1RTKA 2ZTYA 7GCHG 1C9TA 2XC0A 1ZSJA 3RXGA 1W7XH 1FY8E 5FPYA 1NFYA 2ZU1A 1SFQB 3MYWA 3O8CA 1KTSB 1QY6A 2GP9B 2QA9E 3M3SA 4D9QA 1Y5BT 4ZUHA 2ZDLA 4BTUB 3DSPA 1TWXB 1LHDH 2ZFSA 2J5UA 1G36A 1FQ3A 1THSH 2QXJA 3TGKE 1F92A 1P2QA 3UREA 1AZZA 1SGDE 1O3MA 1TA2A 1YPKH 2VIDA 1V2MT 1HRTH 5EXNA 4IMQA 4P02A 3UWIA 1DWBH 1D6RA 6ESTA 4J2YB 2BY7X 2K1QA 2C8WB 2FMJA 2BX4A 5F8ZA 3UFAA 2OC0A 1Z1IA 1HGTH 4GPGA 4WJG2 4FUGA 1OWEA 3SZEA 1COWD 1W0ZU 2TGTA 2XXLA 5HM2A 1J9CH 1HAOH 2ZQ2A 1TRMA 3LJJA 2ZNKH 1EAIA 1GJDB 2ANKH 1KXFA 3T5FH 1GWAA 1GBCA 2XWAA 4WF8A 3ZZBA 3U69H 2BZAA 3ZZ4A 1C2JA 4H6SB 3BTKE 1O3KA 2FPZA 3NXPA 1GJCB 1O2RA 5DP6A 2BY6X 1K28D 4Q7YA 2Z6BD 2AMPA 1OP2A 4X6PA 1BRCE 4A7IB 1H8IH 1QTFA 2H9TH 5EW2H 1GJ9B 3FP7E 3RXHA 1ZR0A 3EDXB 2RCEA 2ZGHA 1DS2E 1GJBB 3A83A 2CN0H 4ASUD 1Z6JH 1O5AB 5CE1A 2BQ7B 2A7JA 3U8OH 5ESBA 1NFWA 1SGQE 3LC3A 2J92A 1AB9C 2Z9IA 1SGPE 1ABIH 1BHXB 4A1TA 1K1MA 4IMZA 1GI0A 4RT0A 4KTCA 2C4FH 2J2UA 1P0SH 1IQEA 1N8OC 1KLTA 2QXIA 1NS3A 3RXJA 3DT0H 2JIZD 5T1VA 1DSTA 2Y5HA 2W3KA 3ZVEA 2BVXH 4P00A 1MD7A 4I8KA 1AFQC 3CS0A 2W26A 1DUEA 2BOHB 1INCA 3TJNA 1KXBA 3U98H 4CRDA 2FYQA 1YCPM 4ZHAA 2BLOA 1SPJA 2J9NA 2XCNA 2JJ1D 2WPHS 3RM0H 1P11E 1C1VH 1O3GA 1Z8RA 1K1JA 2FLRH 1TNIA 1YM0A 1AE8H 5KEDA 1GG6C 2ZTZA 1GBDA 2VWOA 4B6EA 2FYRA 5EPNA 3EAJA 2GCTC 2GVFA 2F9OA 2PFEA 5CHAC 3SYJA 1SR5C 1MTNB 3FP8E 1WTGH 2WINI 4RI0A 5IK2D 2AGIX 1DY8A 5EQRA 3A81A 1UVSH 4AFUA 1G3EA 1SKYE 2NU0E 5AHGH 2HALA 2HNTC 3NKKA 5JBTA 3UWJH 1BRUP 1Z71A 1MTWA 1GHYH 2FTLE 2IJOB 1GCTC 1VJ9U 5FBIA 2H6MA 2KAIA 2KCAA 1PPZA 2JH6D 3ZIAD 1D3QB 2UUYA 2F4LA 2KCYA 1HJAB 2O8UA 2G51A 3V3MA 4FVDA 4WVPE 4ABDA 4INLA 4DT7B 1LPKB 2J34A 3S7HB 1FV9A 2ZPSA 4Y0ZE 4CBNA 2G55A 2A1DB 2J94A 1D4PB 1GJ5H 5C94A 4B2AA 2ZHEH 1XUGA 2JDID 4ISLA 3BEIB 5C1XA 2SGEE 1C5WB 4DCDA 2PP6A 5DP3A 2OBOA 4AB8A 1ZPBA 2OD3B 1DITH 1P8VC 5GCHG 5FPSA 4INKA 3EYDA 1MCVA 1XUIA 3GISB 2G8TA 1C5ZB 3GCHC 3ZZAA 1BMLA 7LPRA 1O30A 5FCRA 1RGQA 2VWMA 3BEUA 5GWZA 1O5BB 2Z9LA 1D3TB 1YYY1 3M5LA 4U2WA 2WPDD 1LO6A 2ZDAH 3DUXH 2BVSH 1WYKA 1BCUH 4I31A 1H1BA 1QL8A 2GZ8A 2ZPQA 2W6ID 6CHAC 1SSXA 4WY3A 4I8GA 2RG3A 1RIWC 3F6UH 4Y71A 1QZ8A 3KL6A 1E79D 1AU8A 2G5VA 2XYAA 5EXLA 3FVFB 4FVBA 5EJ1A 2HLCA 1JIRA 1YPLH 1NU7B 1TLDA 2QF5A 4YZUA 5EJLA 3RU4D 4DJZB 3UQVA 1KTTB 2WPIS 1OOKB 3NZIA 1P01A 1GI9B 1HJ8A 3W95A 2VVVA 2F9VA 4MG3A 3SNEA 1E35B 4BXWA 3WWBA 5ABWA 5FCKA 4WXVA 3LONA 3E6PH 2UWLA 2V35A 4Q80A 2ULLA 3K65B 1PPFE 1PYTC 4F49A 2GZ9A 5JBAS 5F8XA 4MNYA 1JRSA 1XVOA 3QZQA 2ZFPH 5KECA 1NRNH 1EZQA 1GBJA 3SJ8A 3MU4A 1TFXA 1PQ7A 2AH4X 3PWBA 1O5GH 2SGQE 2CF9H 2NU1E 1KMHB 4Y79A 1HAZB 1XUHA 2GD4B 2HWLB 4AFZA 1D6WA 3QTVH 3TLOA 2KZ4A 2ZU3A 1L2EA 2J98A 1ZRBA 1AVWA 1A5GH 4JZ1A 1BMMH 3VG8A 2TGDA 5AVDA 1OX1A 1YLDA 2YMSD 1VCWA 1V2KT 2TGAA 3DSOA 1T8LA 3F9FA 2NU2E 1TMTH 4ABJA 1O2KA 4ABGA 1ZMNA 3I29A 2PKSB 1UCYH 2BD2A 4RT1A 7ESTE 1AD8H 1P09A 1VGCC 1YCPH 2FP7B 3KYFA 3TJOA 4HTCH 2ZU2A 3SJOA 2KR7A 1OWHA 2STBE 2PV9B 3RDZA 3SU4A 1TGSZ 1BJVA 1ZSLA 2ZCHP 1X7AC 4K1EA 2ZWLH 2WYJA 3FAOA 2AERH 3RMNH 1GHZA 2KAIB 1F5RA 5JPMH 1O2MA 3A89A 1SGFA 3UUZA 3T29A 2GDEH 1MAXA 4XSKU 1JIMA 4FUIA 1YPGH 4YLQH 1ETSH 4UD9H 3ZZ5A 2BTCE 3SI4H 3PM3A 1C5LH 1PFXC 1O2QA 1THPB 2ZO3H 2OLGA 3NCLA 5DJ7A 1LHGH 2F91A 4U30A 1A2CH 1P2JA 3SGAE 3N7OA 1VITG 1FIWA 2SNWA 2QCYA 1SGEE 1XUKA 1BZXE 5B6LA 1HDTH 4Y8ZA 1TYNA 1ELCA 5A0BA 5T6FA 3FOAA 2IPQX 1ID5H 4OS7A 4BAQB 1F0RA 2R3YA 3MH5A 5T6DA 1MTVA 1K1OA 2VH6A 1QB9A 1ZTKA 1NRSH 4KTUA 2FTMA 1C9PA 3FANA 1W7GH 5PTPA 4AB9A 1Y5AT 3LOXA 2ZCKP 1O2LA 1HNEE 1J16A 1JRTA 1F5LA 1MU6B 1B5GH 1ZYOA 2OC7A 1O2OA 1RJXB 3TH2H 4ZXYH 5C20A 4NIXA 3OY6U 1C1OA 1J8AA 4F48B 1AGJA 2PW8H 1ELGA 1OWIA 3EE7A 3O8RA 3AAVA 5AFZH 4I7YH 4CR5A 3V12A 1CGJE 4NIYA 2CMYA 4B71A 1ANDA 2ZQ1A 3PLPA 1C5MD 2ZGCA 1ESAA 1L0ZA 2Y6TA 3WY8A 1ARBA 3A86A 1BTUA 1XKBC 3DD2H 4NFFA 3MO6A 3L3TA 4PROA 3ELAH 1E0FD 1GI7B 2JETC 3GDSA 4Z0KA 4I32A 3RMMH 1GHVH 5ESTE 4OS6A 4CRGA 2PLXA 3A85A 3OX7U 4YLUA 2EQNA 3F0PA 1CBWB 2ZHDA 4BAOB 5GPIB 8LPRA 1UVTH 2XC4A 1QRZA 3URCA 2P3TB 3ZVCA 4E06H 4OGXA 3HGNA 1EB1H 4JYUH 3K9XB 4DURA 2KCOA 2LNCA 1UTLM 3LDXH 2BXUH 4NCYA 3JZ1B 5C5OA 3DSGA 3GY8A 1DXPA 1ETRH 1C1UH 1CA0C 3UNSA 4BAKB 3VB6A 4Z6AH 4X2XA 4NG9H 4E7NA 1OSSA 8GCHG 1Z8GA 2XBYA 5T3HA 2XRCA 3GICB 1SLXB 2BLWA 4AYYB 4CRBA 1EQ9A 3RXEA 1EOJA 2TIOA 1K1IA 2TBSA 4I8LA 5A8YA 1JOUB 1IQGA 1KIGH 3T26A 1GHAF 4Y7AA 2P8OB 3VB3A 1H8HD 3PLBA 3U9AH 4AN7A 2ZU5A 4R0IA 1MTUA 1T8OA 1LKBA 2PHBA 4XDEA 4AGJA 4A6LA 5A8ZA 2QN5T 1EKBB 3O8DA 2H5DA 3ZVDA 1TONA 3H5CB 5A0CA 1AHTH 2WV4A 1GGDB 4NA7A 4CHAB 1JMOH 1EASA 2RDEA 2JH5D 2R0LA 1W3CA 4KELA 1C1NA 1D3PB 1W11U 5IDKA 1P05A 4ABFA 3PTNA 4IGDA 4ISNA 2ZF0H 2QGRA 3RXOA 1DXWA 3OFND 2IOTA 2UUJB 1O3CA 1IQIA 1W2KH 3Q77A 1P12E 1KXAA 1FAXA 1YPMH 1C2IA 3OEED 5HYOA 1QL7A 2FX6A 3ODFA 3P8GA 4DOQA 5EXMA 1SHHB 4DG4A 5C0TA 3L6PA 1KSNA 4D7GA 1B0EA 8ESTE 1A0HB 1TALA 1GMDF 2C8ZB 2FI5E 1O2TA 2BQWB 2BX3A 3E16B 2W6JD 1RS0A 2FXRA 1GL1A 1LHEH 3SU3A 1BITA 4Q7XA 2OCVB 3MO9A 2G5NA 2BD7A 2W7SA 1GBBA 2OP9A 1SQTA 4ZHMU 4NFEA 1C1MA 4X1QU 3M7UA 5DP9A 1G37A 1MKXH 4Z1MD 1EB2A 1AQ7A 3ATMA 3ZYEA 5K7RA 4OGYA 3E1XB 3OEHD 4XBBA 4FUHA 3VGCB 1TNJA 2FOMB 2VU8E 2ALPA 2Z9KA 1A0LA 1BMNH 1C4Y2 1EPTB 4VGCB 1UTJA 4CRAA 3NWUA 3KHVA 1TGTA 1THRH 1O3NA 1JBUH 2CV3A 1DX5M 3PO1C 4IN1A 2VJ1A 2XOKD 1O35A 2PSYA 4O97A 2VIVA 1SC8U 3A8BA 1MKWK 2NWNA 5C0UA 4TSFD 2Z3CA 1PJPA 1T31A 2D26C 3UNQA 1TOCB 2BD4A 4DY7B 1TNKA 2XCFA 1H9HE 2AMDA 5I46H 3FFGA 5L30H 1GI3A 3V0XA 4RN6A 5EPYA 3N99A 2SGPE 3MFJA 4YOGA 3SBKA 1SHYA 1KDQA 1ZGVA 1XUFA 4CRCA 2SGDE 1TGNA 2EI8A 4X0WU 1OYTH 1T4VH 3C1KA 1QB1A 4YOIA 1O2XA 4AOQA 1O3IA 2VWNA 2VWLA 2FI4E 3CP7A 2BY5X 3KIDU 4FU9A 1GBLA 3NRLA 5HIYA 3DFJA 3HKIB 3Q00A 9LPRA 1HIAB 4LOYH 3VB5A 2V3HH 3P95A 3IG6B 2V3OH 3RXTA 2XBXA 1MBQA 4ISOA 1ZGIA 2UUKB 3TITA 1C5OH 1GI6A 3GDVA 3JZ2B 1V2WT 2A4RA 4GCHG 3TIUA 1SGTA 1ZMLA 1P9UA 2D1JA 4YTAA 1A3EH 2OBQA 2TPIZ 3KEEA 4ABAA 1NM6A 1S85A 1V3XA 5C1YA 4THNH 4A1XA 1QL9A 2BDAA 4CR9A 1JXPA 3AAUA 4KTSA 3M3VA 4XOJA 1GDUA 1O38A 1P3CA 1O0DH 3A88A 3K2UA 4UFEH 3PYHA 1BBRE 1ZPZA 1AFEH 1TB6H 4NGAH 4K3JA 1Y59T 1PPEE 1FUJA 1NPMA 2GCHF 1CO7E 4AFSA 1UTMA 2GZ7A 2P16A 2QV1A 3TVJB 1GBAA 1IQMA 1O31A 3BTWE 3GY4A 3EA7A 3RP2A 1PYTD 1DUAA 4K1SA 7KMEH 5C2ZA 2RA0A 4NA9H 1YY3A 3UY9A 4XRNA 2YNBA 1BRBE 5ETXA 1G3CA 3RM2H 4IN2A 4UONA 1C2KA 1O36A 1GMCG 3A82A 4X6NA 1P3EA 1YC0A 3FN8A 5K0HA 1S6LA 3P70B 3EGKH 2ODQA 1O3BA 2J95A 4TPYA 3P8NA 4HI3A 3RC4A 1IHTH 2FOAA 5C5NA 1BTPA 1DWEH 1ZHMA 3OE7D 1ZJKA 4MLFB 2Y7ZA 1G3BA 2F83A 2EY4C 2R9PA 4OS1A 1QBOA 1SB1H 1TX8A 2Y5GA 1UHBA 3D23A 1SGCA 1HPGA 2HNTE 1A0JA 3S0NA 6GCHG 1P06A 2M5TA 2GX4A 9ESTA 2QIQA 1Y8TA 3A80A 2UWOA 1ABJH 5A09A 2FOCA 1O2GH 4FOUC 1TRYA 1SLVB 3RXLA 2PTCE 1XM1A 3P8FA 3SNAA 1ARCA 1WQSA 2F9NA 2VIOA 1ANCA 1GBIA 3RMOH 3FO8D 2EA3A 2DE8A 3UQOA 3MH4A 3A7TA 5FX6A 3LGTA 3SZNA 2ZEBA 5G4BA 5DK1A 4LZ1H 4YXWD 4GVUA 1G32B 3CNRA 3BTHE 1YBWA 1O5CB 1ZHRA 1UVPA 1SMFE 1WSSH 3ZVGA 4ZKOU 1QBNA 2G4UA 1N8OB 1BTWA 1QGFA 2BDGA 3RXIA 1CT4E 1EZXC 2GMTC 2AHME 1XUJA 3KQ5A 2F9BH 5HIZA 3BG8A 3F9GA 3S9BA 3NK8A 1FY5A 4K8YA 2AGEX 1AFQB 3AASA 3L33A 1O5FH 2ZA5A 4JZDH 3LIWA 1K2I1 3TNSA 2BHGA 3A7ZA 2YNAA 1C2EA 1GJAB 1P2NA 3GY6A 4MVNA 4JYTA 3CS7A 3SGBE 1KDQB 1GG6B 2Y80A 4IS5A 4JMYA 2FZZA 1UO6A 4K5ZA 1TPPA 4YOJA 1EP5A 2GCTB 3OSYA 3SN8A 1GI2A 2VBCA 5CHAB 1F0SA 4XD7D 1BBRK 3RLYH 3SW2B 4FUJA 3ZZ6A 3MQKC 2WYGA 3NUMA 1TNLA 4GHTA 1H8DH 1ESBA 2WHXA 1E1QD 3B9FH 1UTOA 7GCHF 3SJKA 5A8XA 1F2SE 1GDNA 1A4WH 5EGMA 1UMAH 1NZQH 2Z9JA 3Q76A 2WUBA 1HAYB 2ASUB 1GJ4H 2WV5A 3QZRA 1SGFG 1P9SA 4MPXA 1XXDA 1P57B 3PRBA 1EZSC 1WAYB 1SOZA 1GCTB 1EAXA 1P02A 4GCHF 3SNBA 4MPWA 1YPHC 4ZROA 1IQHA 4CRFA 1ELDE 1MU8B 4TPIZ 3PWCA 2ZFQH 4ZAEA 4FXGH 3VEQB 1FZZA 2AYWA 2PGQB 2AEIH 2PKAA 3M7TA 3U8RH 1HUTH 3QDZB 5E2OA 3PMAB 5AFYH 1L1JA 3MTYA 3FKSD 1KLIH 1PQAA 2IJD1 3BN9A 1JWTA 4OS2A 3ZZDA 1TIOA 4WMDA 1FN8A 2FM2A 1YKTA 5GJ4B 3Q3XA 5BPEA 1NESE 3RC5A 3V13A 1DY9A 1SOTA 1QA0A 4CREA 3EQ0H 3M3TA 2AIQA 3MU0A 3PRDA 2PUXB 1V2ST 3OYPA 4HGCA 2WZQA 3MNBA 1F5KU 1O3PB 3GCHB 3KN2A 3GYMA 2QF4A 3CENA 1MQ6A 5HXFA 2WSSD 3UOPA 2EI7A 4AZ2B 4Q2KA 4H42U 1BQYA 1OYQA 2Z9GA 3AK5A 4X2VA 3ZV9A 4FUDA 4MTBA 2FOBA 2W5EA 2FOFA 5JBBS 1FI8A 2XW9A 4TYDA 2OK5A 1QQ4A 3QN7A 1QCPA 2XBWA 4B73A 1VKYA 1UHBB 2FX4A 6CHAB 5B6OA 2ZKSA 3M37A 3S9AA 2WUCA 5DP4A 1O2YA 2BOKA 1RIWB 4X1SU 3RUOA 2VIWA 1UTPA 3RXRA 2DE9A 1RRKA 1SLUB 3SU1A 4DW2U 3VB4A 2A5KA 1IOEA 4JK6A 1TPOA 2G81E 3SJIA 3UAIC 1V2TT 1DOJA 1C1PA 1K1LA 1B0FA 2Y5FA 3TGIE 4D8NA 3RXFA 2A45B 3STIA 5TJXA 3MH7A 1ETTH 1O2VA 1CHGA 5DKMA 1PQ8A 1MD8A 1MAYA 1P2OA 4BNRA 4BOHA 2JJ2D 1EP6A 4RKOB 4B76A 1DM4B 3M5MA 1FPHH 1XMNB 3T28A 2Y82A 2HGTH 2ZC9H 4ASHA 4DIIH 2BDBA 1WDIA 3NPSA 1GHBG 2LPRA 1N6XA 1UK2A 1PPGE 1OWDA 1ZZZA 4B2BA 2WPJS 4UFGH 2BY9X 1GI4A 3LGIA 2R0KA 4IW4E 5E0GA 1EOLA 4H4FA 1C2FA 1CT2E 2J97A 4XE4A 1GJ6A 2P93A 3M36A 2VH0A 1Z6EA 3BF6H 2A2QH 3GY2A 2CGAA 1FY4A 1A3BH 3F3BA 1TNHA 5FBEA 4ZKRU 4K1TA 1BIOA 3F68H 4K8BA 1A61H 1O34A 1P04A 2ZFFH 3BTQE 2A4OA 2SNVA 1C4V2 5F03A 5FPTA 1V2PT 1C5QA 3A8DA 3F2FA 4X8SH 1EZUC 1ELBA 1OS8A 1FX0B 3BEFB 3SV9A 1QNJA 1BTZA 4MQAA 4E05H 1EJMA 4D7FA 1V2RT 1C2LA 4XBDA 2PR3A 2ZIQH 1ZLRA 1DLKB 4YO9A 1MMJN 3H7OA 1IQJA 3FZZA 4R8TB 1MTSA 3A8AA 4UE7H 1AI8H 3P92A 3ZVAA 4OM9A 2SGFE 2Z3DA 3SV7A 1EXFA 1F7ZA 1P03A 1C1RA 1H4WA 3TJUA 4M9FA 1Y3UA 1T8NA 1K1PA 3TJVA 1AVXA 4ESTE 1HYLA 3RXDA 2H2ZA 5GCHF 2WPKS 3MNSA 1OWJA 4IBLH 2YOLA 3N7DA 2PKAB 2XTTB 1DE7H 1VR1H 2RDLA 3RXCA 4GUXA 2DUCA 5EOKA 5J4QA 3SNCA 2GV6A 2ZECA 1HBTH 1CGIE 3G01A 1EJNA 1FPCH 4FU8A 1PQ5A 1B7XB 4X8TH 4KKDA 1TRNA 2B0FA 4HG6A 3ZYDA 1QJ6B 1TQ7B 3UR9A 1FY1A 1ZRKA 1O2IA 2L6OA 3UR6A 1BTYA 1VITH 3TK5A 3BTDE 3SI3H 1FN6A 1Z1JA 1WTHD 3RU4E 1TOMH 2V3MA 1HAIH 1S83A 4TWYA 4BTTB 2B9LA 3DA9B 1BMAA 2LELA 3F1SB 2ZCLP 3ZZ3A 3B23B 3URDA 2R2MB 5SGAE 5DPAA 1EX3A 1K9OE 1TBZH 1AKSA 2KFWA 3VPKA 2VINA 2CHAB 2BD5A 3GY5A 4WMEA 3M61U 3BTGE 4B2CA 2P3UB 1J15A 1GBMA 4ISHH 1ELAA 1U6QA 1Y5UT 2UUFB 4AX9H 4FETA 4NIWA 1S81A 2KM0A 3U1JB 2EC9H 5LPRA 5DSFA 2G00A 5CMXH 2J98B 1O3DA 3IWMA 1C4U2 2JETB 2LP6A 3ZZ8A 5HKKD 1E38B 2QY0B 2ZPRA 1NRPH 4E7RG 4AC9A 1CE5A 4U01A 1DVAH 3GCOA 1V2VT 5F6MA 4BANB 3V7TA 4MPVA 1MUEB 3BSQA 1GBFA 1O3JA 1LTOA 2FI3E 2JH0D 2ZFRH 5EODA 1NTPA 1NBME 3HKJB 1CA0B 1V2NT 4ACAA 2QE7D 2XNDD 1G30B 1UCYE 3P6ZB 4HFPB 1OKXA 1O5EH 3W1EA 4X6MA 5KGOA 3BG4C 3C27B 1NROH 3I78A 3SGQE 1DICA 2A4GA 1ZHPA 1L1NA 2VGCC 1O2SA 2H1UA 4X2WA 5A0AE 3O8BA 3T25A 2Q6DA 4A92A 4JK5A 4CBOA 2SGAA 1G3DA 3ITIA 3K6YA 1GHWH 5HGGA 1HAGE 3QWCH 1HCGA 4D76A 2BD3A 4Q63A 3BTME 2STAE 4FUCA 1HAHH 3RXMA 3RXAA 2BVRH 1IAUA 2GKVE 1K0HA 3B8JA 1D9IA 2Q1JA 4ZKNU 3VGCC 2FLBH 1T7CA 2GGVB 3VFEA 1PPBH 3I77A 3SV2H 4IC5A 1EPTC 3UNRA 3QTOH 1NT1A 1BUIA 1KYNA 2YMSC 2ZHWH 2VIPA 1VITF 1MH0A 1WBGB 3VB7A 3HPTB 3KQDA 3UB0A 1C1QA 1HFDA 1LDTT 1SL3A 4K2YA 2K8IA 2VVUA 2AS9A 2ZDMA 1C5PA 1A46H 1C5SA 5DG6A 1WCZA 2EEKA 2L74A 1Z7KA 1O39A 4LK4A 1V2JT 1HB0B 3E90B 1FXYA 3BIUH 4GLYA 5A2MH 2ALVA 3HK3B 3KYGA 1W8BH 2UWPA 4YT6H 2AGGX 2P59A 1C1WH 3QUMP 4GSOA 1HLTH 2B8OH 3KQCA 2CK3D 2M2AA 2C3SA 1A5IA 2FS8A 1E1RD 1VCPA 2J4IA 2H9EH 1UW7A 1AE5A 2XNIA 2P3FH 4M7GA 3KQEA 1C5VA 1O2ZA 3A7VA 5DP8A 1Q2WA 2C90B 4Y6DA 3GDUA 2BYAX 2GDDA 1UTNA 4AGKA 1WXRA 1HXEH 1H9LB 2RA3A 3FP6E 1OP8A 4Y76A 1BT7A 2NU4E 1K21H 1V2QT 2A4QA 1ELVA 2QF3A 3PO1B 4O3TA 3T62A 5EW1H 2AFQB 3OAAD 3DCLA 2I6QA 5JDUB 1AKSB 1LPZB 1DFPA 3T2NA 1K22H 3LPRA 2OTVA 3E3TA 2GJGA 3Q3YA 2B7DH 1G2LA 1O2JA 2I6SA 4TT3D 4X2YA 1EATA 2OQUA 2ZHQH 4GHQA 2TGPZ 4TWWA 2A31A 3S7KB 1IQNA 1QQUA 3KNXA 1GDQA 2ZHFH 3ZVFA 1DWDH 1UCYK 3LJOA 3ZZ7A 1YCPK 5EU8A 3MWIU 2QYIA 2HOBA 2GT7A 1O3HA 8GCHF 1VZQH 1NC6A 3WW7A 1LCYA 2A0QB 1TQ0B 2HNTF 1OWKA 3U1IB 2A5AA 2W7UA 2Z94A 4FUEA 5F8TA 3OU0A 4ABHA 3F9HA 1O2PA 1GPZA 3TNTA 1KXEA 3HATH 5BRRE 3MU5A 1YPJH 3QGNB 4O03A 2ZDNA 3A87A 5GDSH 4XBCA 1SQAA 4NWKA 5DP5A 3SOSA 3MO3A 4QT8C 3RC6A
chains in the Genus database with same CATH topology
1C1SA 4UEHH 4ABEA 1C2DA 1GHXH 1LQDB 1O3FA 2CJIA 3SJ9A 3SUDA 1CU1A 1BRAA 1ELFA 1GBTA 2BY8X 1ZMJA 4BTIB 3SU0A 3ODDA 2XC5A 1EAUA 2ANMH 2VVCA 4X1RU 5AF9H 1C2GA 2BDHA 1DLEA 3ESTA 1AY6H 1LVMA 1M9UA 1GVLA 3M35A 3BTEE 1P2MA 1QB6A 1QFKH 3KF2A 2HRVA 1MTNC 1LVOA 2Z7FE 4DGJA 2O8WA 3RXQA 4XFQA 2O8MA 1TGCA 3GCTG 3PB1E 3LC5A 4JZFH 4SGAE 1G2MA 2O8LA 4ZH8A 1SFIA 2FIRH 2D8WA 1AB9B 3TU7H 1O2NA 1TPAE 1ZTLA 5TCCA 8KME2 1GBEA 1SLWB 2P95A 1O37A 1AMHA 1TA6A 2EI6A 3EA8A 5FX5A 2ZGBH 2FEQH 2D2DA 1OXGA 1YPHE 1ZOMA 1YF4A 1FLEE 3MI4A 1HJAC 3P17H 2FOGA 2IN2A 2ILNA 3PMHB 1IQFA 1YPEH 5J4SA 2GTBA 1SI5H 3RXVA 3LU9B 1WUNH 2WPLS 4ZKSU 5LGOA 1TMUH 3SV6A 1ORFA 1QIXB 2ZDKA 5L2YH 1IQKA 3ZV8A 1AUJA 3BV9B 4DVAU 1LHFH 1QBVH 5LPEA 2OC1A 1NO9H 4TY7A 1IHSH 1S0QA 4INHA 5DGJA 4O9VA 3SUGA 2GMTB 2C93B 2ZFTA 3ZZ9A 1E34B 3ATKA 1BOQA 1UJ1A 1SGRE 2Z3EA 4JZEH 3RMLH 1S5SA 1DSUA 2QF0A 3FZDA 2NU3E 1IQLA 3M5NA 3KCGH 2C8YB 3RLWH 1SG8B 4RKJB 3R3GB 1GL0E 3LKWA 4B74A 3E0PB 4UFFH 1F0UA 3MOCA 1C2HA 5DO4H 3M5OA 4J1YA 4I8JA 2PUQH 3MHWU 2OQ5A 1GI5A 1ELTA 1AO5A 1XXFA 1RXPA 4YT7H 1Y3YA 5I25A 2FODA 1O3LA 2O8TA 4GAWA 2G52A 1CVWH 1OP0A 1SGNE 3BTTE 2BD8A 1O3AA 1G9IE 2ANWA 3U8TH 1HJ9A 1N1LA 2FOEA 1CQQA 1ZSKA 3PV4A 4ABIA 4NZQA 3QO6A 5HMAA 1UK4A 1AWFH 2BDYA 1WOFA 3MNXA 1GMCF 3GY3A 6LPRA 2BDCA 1BB0B 3RXUA 3SUEA 3EA9A 1T8MA 1NRRH 4AG1A 3DFLA 1EAWA 2VNTA 1TBQH 2XBVA 1GBHA 5LPFA 4NIVA 1Y3WA 4MNXA 1MKWH 1CGHA 1RTLA 1XX9A 1V2OT 3W94A 3VXEH 3QLPH 3LGUA 4JZIA 4ZHLU 1QRXA 3DHKH 4FUFA 1LQEA 3RXSA 5GXPA 1XVMA 1MKXK 6GCHF 1K1NA 3RU4T 4Y7BA 2QAAA 1SVPA 1NN6A 4YESB 3GY7A 2H5CA 1CT0E 2FOHA 1T4UH 4I33A 3F9EA 1LKAA 2PKSC 4WWYA 1L4DA 4UFDH 2CXVA 3PMJA 1ACBE 1V2LT 4B1TA 3D65E 1HV7A 3ATIA 1MBMA 2FESH 5HM9A 1FDPA 2ODPA 1N6YA 3A7YA 1TGBA 1F0TA 1QRWA 1ANBA 4BXSA 4OS4A 3GCTF 5E2PA 1TAWA 1VJAU 2ZZUH 2Q6FA 2ZG0H 1BDAA 5T6GA 1CSOE 1TBRH 4ABBA 1GHAG 1AIXH 3SQHE 3H7TA 1W0YH 3VXFH 2H9HA 2A7HA 4Y8XA 1TX7A 3D62A 2CF8H 2A32A 2ZDVH 3EE0B 4WH8A 1Y3VA 1V6DA 2V6NA 3KQBA 1GI8B 1V2UT 1KXCA 3E91A 4BAHB 2ZGJA 5L6NH 1E37B 1ESTA 3M7QA 1A7SA 4WMFA 4LXBH 1AN1E 1ZJDA 4U32A 1QR3E 1EUFA 2SFAA 1W14U 1QA7A 3GYLB 1KLJH 1C5NH 3PMBB 1A5HA 1FIZA 5E0HA 4ISIH 1GMHG 4AFQA 1S0RA 4H6TA 4F4OC 1LPGB 1VGCB 1LHCH 4Y11E 3UTUH 5E8EH 1NFUA 1DPOA 5C1UA 1GVZA 2BQ6B 3SU2A 1DT2A 2VIQA 5FHTA 1W10U 4K69A 1J14A 4JCNA 3TK9A 2Y7XA 1GMDG 1O2WA 1TX6A 4KGAA 3UIRA 2ZTXA 3PLKA 1T32A 3E0NB 4TY6A 2JKHA 4X6OA 4I8HA 2FWWA 3QX5H 4MNVA 1MZAA 5JB8S 2ZP0H 3GOVB 1SGYE 4WXIA 2OXSA 1HAXB 3SQEE 1O3OA 3LGYA 4MNWA 1GBKA 3SUFA 3RXPA 3LH1A 3S9CA 1P2KA 4RSPA 1NY22 4K60A 4BAMB 1TPSA 4MPUA 3OY5U 4ZXXH 5C67A 1TE0A 3GCNA 3RXBA 3LT3A 1QJ7B 3R0FA 1C5UA 4AORA 2PSXA 3SHAH 1FMGA 1HAPH 3PROA 1C2MA 1FJSA 1EPTA 2V0BA 1BA8B 4AG2A 1WQVH 1DANH 3TK6A 5L2ZH 1RFNA 2PTNA 2QXGA 1HAVA 1O2HA 3QGJA 1CBWC 2PWXA 3AVZA 1FNIA 5JYIA 2BLVA 1CHOG 2CHAC 1C5RA 1D3DB 3HGPA 3ZZCA 3LGVA 4NWLA 1NU9A 3SNDA 1UTQA 3BTFE 4SGBE 4ZMAH 3KGPA 4YM9A 1QURH 1ELEE 1C1TA 2FO9A 4A5TS 4B75A 3ZVBA 1A1RA 1KXDA 1LMWB 2AMQA 3LH3A 2QC2A 3OTJE 4OS5A 1LVYA 1P2IA 3AW1A 5C3NA 1H9IE 5DP7A 1AVGH 1AZ8A 1GI1A 2HVXA 1O32A 5GIBA 1HIAA 2BM2A 2P8OC 3SHCH 4LZ4B 4X8UH 1L4ZA 4NSYA 2C8XB 3MNCA 4Q7ZA 3SU6A 2R2WU 3MH6A 1O33A 1Y3XA 1SGIB 5IYTA 2P94A 1O5DH 1BBRH 3SU5A 3BIVH 1DWCH 2ZU4A 2ESTE 1Q31A 2ZGXH 1GGDC 1W13U 2GV7A 4O3UA 1AUTC 3ENSB 3ATLA 4CHAC 4HZHA 2BB4A 2PGBB 1S84A 3TGJE 2ZI2H 2GCHG 3T27A 3ATWA 3E8LA 2XWBI 2BDIA 4X1PU 2A7CA 1TABE 4CH8B 3QK1A 5LH8A 5EQQA 3MMGA 4MDSA 2QXHA 1GHBF 2VB0A 1Z8IB 4DIHH 1E36B 4JYVH 1GCDA 1J17T 4IC6A 1O3EA 1QJ1B 1XKAC 1WU1A 1YLCA 3MU8A 2ODYB 5EG4A 1EJAA 3SO3A 2A2XH 1AWHB 2A5IA 1NRQH 2OC8A 1Z8JB 1NFXA 2TRMA 5H4IB 3D49H 2ANYA 1UK3A 2AIPA 2BD9A 1TNGA 2BMGB 1C5TA 5EQSA 4AYVB 3A84A 1FY3A 2F9UA 2Y81A 1SBWA 2G4TA 1WV7H 3A8CA 3Q3KA 2FS9A 4NA8A 1GMHF 3PTBA 3A7WA 4FU7A 1MQ5A 1GJ7B 1BTHH 5JBCS 3TPIZ 4VGCC 3TH4H 1VCQA 4X8VH 1Q3XA 1ZPCA 4WH6A 5FAHA 3LGWA 1S6HA 3BG4B 1P10A 1UVOA 1MZDA 3MU1A 3RXKA 1FAKH 1YGCH 2VGCB 4NZLA 1S6FA 1YP9A 4CH2B 2HPQH 2F3CE 1PPCE 4Y8YA 2J38A 1QHRB 1C5YB 2BLQA 3HK6B 1ANEA 3SV8A 2OUAA 1W12U 3SORA 3UPEA 1RD3B 1UTKA 1O2UA 2Q6GA 3S69A 1ZTJA 1BHXF 2WPMS 2BXTH 3UOUA 4Y10E 1LVBA 1CA8B 2R3UA 3STJA 4FUBA 4UDWH 3A7XA 2IPHA 1OPHB 4Y0YE 3K6ZA 2HPPH 4KP0A 1S82A 1L1GA 1GVKB 2BZ6H 1HAVB 1SQOA 1UVUH 2FDAA 1DDJA 5JB9S 1C5XB 1HXFH 3TH3H 4D9RA 1TMBH 3IITA 2GT8A 5E0JA 5TCAA 1BJUA 1MCTA 1FONA 3P8OA 2OINA 4A1VA 1BTXA 1CHOF 1KY9A 4NSVA 1PPHE 2B5TB 2THFB 1GJ8B 5FXLA 2W3IA 3AW0A 2O9QA 1RTFB 4X1NU 2F9PA 1RTKA 2ZTYA 7GCHG 1C9TA 2XC0A 1ZSJA 3RXGA 1W7XH 1FY8E 5FPYA 1NFYA 2ZU1A 1SFQB 3MYWA 3O8CA 1KTSB 1QY6A 2GP9B 2QA9E 3M3SA 4D9QA 1Y5BT 4ZUHA 2ZDLA 4BTUB 1TWXB 1LHDH 2ZFSA 1G36A 1FQ3A 1THSH 2QXJA 3TGKE 1F92A 1P2QA 3UREA 1AZZA 1SGDE 1O3MA 1TA2A 1YPKH 2VIDA 1V2MT 1HRTH 5EXNA 4IMQA 3UWIA 1DWBH 1D6RA 6ESTA 4J2YB 2BY7X 2K1QA 2C8WB 2FMJA 2BX4A 5F8ZA 3UFAA 2OC0A 1Z1IA 1HGTH 4GPGA 4WJG2 4FUGA 1OWEA 1W0ZU 2TGTA 2XXLA 5HM2A 1J9CH 1HAOH 2ZQ2A 1TRMA 3LJJA 2ZNKH 1EAIA 1GJDB 2ANKH 1KXFA 3T5FH 1GWAA 1GBCA 2XWAA 4WF8A 3ZZBA 3U69H 2BZAA 3ZZ4A 1C2JA 4H6SB 3BTKE 1O3KA 2FPZA 3NXPA 1GJCB 1O2RA 5DP6A 2BY6X 1K28D 4Q7YA 2Z6BD 2AMPA 1OP2A 4X6PA 1BRCE 4A7IB 1H8IH 1QTFA 2H9TH 5EW2H 1GJ9B 3FP7E 3RXHA 1ZR0A 3EDXB 2RCEA 2ZGHA 1DS2E 1GJBB 3A83A 2CN0H 1Z6JH 1O5AB 5CE1A 2BQ7B 2A7JA 3U8OH 5ESBA 1NFWA 1SGQE 3LC3A 2J92A 1AB9C 2Z9IA 1SGPE 1ABIH 1BHXB 4A1TA 1K1MA 4IMZA 1GI0A 4KTCA 2C4FH 2J2UA 1P0SH 1IQEA 1N8OC 1KLTA 2QXIA 1NS3A 3RXJA 3DT0H 1DSTA 2Y5HA 2W3KA 3ZVEA 2BVXH 1MD7A 4I8KA 1AFQC 3CS0A 2W26A 1DUEA 2BOHB 1INCA 3TJNA 1KXBA 3U98H 4CRDA 2FYQA 1YCPM 4ZHAA 2BLOA 1SPJA 2J9NA 2XCNA 2WPHS 3RM0H 1P11E 1C1VH 1O3GA 1Z8RA 1K1JA 2FLRH 1TNIA 1YM0A 1AE8H 1GG6C 2ZTZA 1GBDA 2VWOA 2FYRA 5EPNA 3EAJA 2GCTC 2GVFA 2F9OA 2PFEA 5CHAC 1SR5C 1MTNB 3FP8E 1WTGH 2WINI 2AGIX 1DY8A 5EQRA 3A81A 1UVSH 4AFUA 1G3EA 2NU0E 5AHGH 2HALA 2HNTC 3NKKA 5JBTA 3UWJH 1BRUP 1Z71A 1MTWA 1GHYH 2FTLE 2IJOB 1GCTC 1VJ9U 5FBIA 2H6MA 2KAIA 1PPZA 2JH6D 1D3QB 2UUYA 1HJAB 2O8UA 2G51A 3V3MA 4FVDA 4WVPE 4ABDA 4INLA 4DT7B 1LPKB 2J34A 3S7HB 1FV9A 2ZPSA 4Y0ZE 4CBNA 2G55A 2A1DB 2J94A 1D4PB 1GJ5H 4B2AA 2ZHEH 1XUGA 4ISLA 3BEIB 5C1XA 2SGEE 1C5WB 4DCDA 5DP3A 2OBOA 4AB8A 1ZPBA 2OD3B 1DITH 1P8VC 5GCHG 5FPSA 4INKA 3EYDA 1MCVA 1XUIA 3GISB 2G8TA 1C5ZB 3GCHC 3ZZAA 1BMLA 7LPRA 1O30A 5FCRA 1RGQA 2VWMA 3BEUA 5GWZA 1O5BB 2Z9LA 1D3TB 1YYY1 3M5LA 4U2WA 2ZDAH 1LO6A 3DUXH 2BVSH 1WYKA 1BCUH 4I31A 1H1BA 1QL8A 2GZ8A 2ZPQA 6CHAC 1SSXA 4WY3A 4I8GA 2RG3A 1RIWC 3F6UH 4Y71A 3KL6A 1AU8A 2G5VA 2XYAA 5EXLA 3FVFB 4FVBA 2HLCA 1JIRA 1YPLH 1NU7B 1TLDA 4YZUA 3RU4D 4DJZB 3UQVA 1KTTB 2WPIS 1OOKB 3NZIA 1P01A 1GI9B 1HJ8A 3W95A 2VVVA 2F9VA 4MG3A 3SNEA 1E35B 4BXWA 5ABWA 5FCKA 4WXVA 3LONA 3E6PH 2UWLA 2V35A 4Q80A 2ULLA 3K65B 1PPFE 1PYTC 4F49A 2GZ9A 5JBAS 5F8XA 4MNYA 1JRSA 1XVOA 3QZQA 2ZFPH 1NRNH 1EZQA 1GBJA 3SJ8A 3MU4A 1TFXA 1PQ7A 2AH4X 3PWBA 1O5GH 2SGQE 2CF9H 2NU1E 4Y79A 1HAZB 1XUHA 2GD4B 2HWLB 4AFZA 1D6WA 3QTVH 3TLOA 2ZU3A 1L2EA 1ZRBA 1AVWA 1A5GH 4JZ1A 1BMMH 2TGDA 5AVDA 1OX1A 1YLDA 1VCWA 1V2KT 2TGAA 1T8LA 3F9FA 2NU2E 1TMTH 4ABJA 1O2KA 4ABGA 1ZMNA 3I29A 2PKSB 1UCYH 2BD2A 7ESTE 1AD8H 1P09A 1VGCC 1YCPH 2FP7B 3TJOA 4HTCH 2ZU2A 3SJOA 2STBE 1OWHA 2PV9B 3RDZA 3SU4A 1TGSZ 1BJVA 1ZSLA 2ZCHP 1X7AC 4K1EA 2ZWLH 2WYJA 3FAOA 2AERH 3RMNH 1GHZA 2KAIB 1F5RA 5JPMH 1O2MA 3A89A 1SGFA 3UUZA 3T29A 2GDEH 1MAXA 4XSKU 1JIMA 4FUIA 1YPGH 4YLQH 1ETSH 4UD9H 3ZZ5A 2BTCE 3SI4H 3PM3A 1C5LH 1PFXC 1O2QA 1THPB 2ZO3H 2OLGA 3NCLA 5DJ7A 1LHGH 2F91A 4U30A 1A2CH 1P2JA 3SGAE 3N7OA 1VITG 1FIWA 2SNWA 2QCYA 1SGEE 1XUKA 1BZXE 1HDTH 4Y8ZA 1TYNA 1ELCA 5A0BA 5T6FA 1ID5H 4OS7A 4BAQB 1F0RA 2R3YA 3MH5A 5T6DA 1MTVA 1K1OA 2VH6A 1QB9A 1ZTKA 1NRSH 4KTUA 2FTMA 1C9PA 3FANA 1W7GH 5PTPA 4AB9A 1Y5AT 3LOXA 2ZCKP 1O2LA 1HNEE 1J16A 1JRTA 1F5LA 1MU6B 1B5GH 1ZYOA 2OC7A 1O2OA 1RJXB 3TH2H 4ZXYH 5C20A 4NIXA 3OY6U 1C1OA 1J8AA 1AGJA 2PW8H 1ELGA 1OWIA 3O8RA 3AAVA 5AFZH 4I7YH 4CR5A 3V12A 1CGJE 4NIYA