5F8YA

Crystal structure of a crenomytilus grayanus lectin in complex with galactosamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
TTFLIKHKASGKFLHPYGGSSNPANNTKLVLHSDIHERMYFQFDVVDERWGYIKHVASGKIVHPYGGQANPPNETNMVLHQDRHDRALFAMDFFNDNIMHKGGKYIHPKGGSPNPPNNTETVIHGDKHAAMEFIFVSPKNKDKRVLVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Multivalent Marine Lectin from Crenomytilus grayanus Possesses Anti-cancer Activity through Recognizing Globotriose Gb3
pubmed doi rcsb
molecule keywords GalNAc/Gal-specific lectin
molecule tags Sugar binding protein
source organism Crenomytilus grayanus
total genus 41
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5f8yA00
3I29B 1J0SA 3H6SE 3ZXDA 3BADA 4I96A 5DSSB 1XHBA 3BA7A 2D20A 2ERMA 2RQ9A 3AZVA 3VT1A 3A23A 3P6JA 1JT4A 5EG6C 2BEAA 4ZKTB 1Q1UA 1S0BA 1JT7A 3MPPG 1EV2A 1M2TB 1MC9A 4OWJA 3WINA 3IM5A 1DZCA 1IOBA 1HCDA 1JY0A 2VUAA 3O49A 4II0A 5FZZA 4QO3A 2FFVA 1JTCA 1ONKB 2BEBA 4HR6C 4F34A 4XKIA 4XFSA 1E0OA 4AN7B 1UPSA 1BFCA 3HBWA 4ZOTA 2MIBA 1G9AA 1EVTA 2QN4A 4I4SA 4P0KA 3CA4A 1GGPB 1YYNA 1NUNA 3IM7A 3VSFA 1EYLA 2IHOA 2D43A 4ZFUB 1DZDA 3E8LC 5FZUA 4KEIA 3CA3A 1DJSB 4L4HA 2HWMA 1T4QA 3ZC8A 1RZOB 1G82A 4LO1C 4IY9A 2NM1A 2HW9A 4I6IA 3CA1A 4F83A 4OEGA 4QBCA 2FO1A 3FGMA 9ILBA 3AJ6A 3FJ9A 1HCEA 2F2FA 2NTDA 3ZX7A 4I7IA 3FJJA 3CU1B 3UDAA 1OQLB 5BXTA 2KKIA 1Q03A 3JUTA 1V6WA 1KNMA 1XZZA 3P53A 2ZR1B 4OW4A 3BAGA 3RMYA 4IYBA 3FJ8A 5I1BA 1P63A 3V0BA 3Q7XA 1AFCA 2FDBM 3RSJA 1V6VA 4XFTA 3AKIA 3OBRA 4ZA3B 1PZZA 1ISXA 4QKRA 3V0AB 2Z49A 1RMLA 3A22A 3HMYA 3NBNA 1SZ6B 2J3PA 4I4QA 4G9MA 4J2KA 4I4YA 3ZXGA 1DQOA 3K1XA 2X2TA 3ILAA 2UUSA 4GAFA 1BASA 4EKXB 4ENDA 5BXPA 2WRYA 4I4VA 3NBEA 5JLVA 1SR4A 5BP5A 4CJMA 4GOVA 2RSTA 3HOMA 1IRPA 2XOAA 4JPZA 1G9BA 1DLLA 1WBCA 1RY7A 2DS0A 41BIA 3BX1C 3CRHA 1PUUB 3BTAA 1S0FA 2MLLB 2M49A 2I1BA 4DCKC 3FJAA 4IZXA 2DREA 1S0DA 3IIRA 1MD6A 4G1RA 2VU9A 3VWCA 5DVHA 1YBIA 1AF9A 2K43A 1I1EA 1JLXA 2D24A 5D63A 2Y9WC 4P6AA 3FJEA 1W3FA 2X2SA 4EFPA 3AH2A 3HN1A 5BXSA 1ISZA 3PHZA 3H6QA 3AJ5A 4LO7B 3O4BA 4I0YA 4EFQA 1PUMB 3FUOA 3AKGA 3BRFA 4OEFA 3AH1A 2ZQOA 3QR5A 5FNWA 5EC5A 3O4AA 4QALA 2RG9B 1Z4SA 3CRIA 4H9WA 3EF2A 1XYFA 3LLPA 2AQZA 3SNVA 3AKHA 5FNXA 4LO7C 1ISWA 1TIEA 4R6UB 1PC8B 3AZWA 1JLYA 3PMEA 1JT3A 4QD2C 1IHKA 4P0JA 3IAGC 1S0CA 4J2SA 4EFRA 3FJHA 3N7MA 4JKQA 4X38A 1TWEA 2VSEA 2R9KB 1ISVA 1BLDA 1FGAA 1HWNB 4GAIA 5F8WA 2D7IA 4LO0C 2NP0A 1R8OA 3POKA 3W9TA 3P6IA 2KI6B 4ZBVB 4ZFYB 4GP0A 5BQUA 4HA2A 5BQUC 3BAQA 4LO1A 3R4SA 1FQ9A 4FVVA 1QQLA 1FV2A 2Q3NB 2NVHA 4Q91A 1TFMB 3AKFA 4A7KA 4OEEA 2VLCA 3NBCA 4EEEB 1ABRB 3VUOA 4IZEA 1CE7B 4L4IA 3H6RB 1HWOB 2Y9XE 3RMXA 4I4UA 3OJMA 4D0TA 8I1BA 2GO2A 3Q7WA 3FUQA 5G00A 4I4OA 5JMCA 3KMVA 4OUJA 1ISYA 1HIBA 2YUGA 4TLPA 4I8MA 1L2HA 3O5WB 3S8KA 2E4MC 1RG8A 3BAUA 1K5VA 4I4PA 4ISQA 3BAOA 2KLLA 3B9UA 1VCLA 1FWUA 3AH4A 4LO3C 1A8DA 3CAHA 3OGFA 3LTQA 1YF8B 6I1BA 4ISRA 3F1RA 4JP0A 3CQAA 3RTJB 1S0GA 3RTIB 1W3AA 2DRYA 2L5XA 4IQPA 2IWTB 3V0AA 3FJCA 4USPA 2HWAA 3UD8A 7I1BA 2BFHA 3O4DA 5F90A 1YXWA 1AVAC 3FJFA 3QYDA 4J23B 4JKXB 3VEQA 3R4UA 4DEPA 2D23A 3FJBA 2GZBA 5BOWA 2K4AB 3JRRA 1XG6A 3T8SA 1TWMA 2D44A 1TP0A 2D1ZA 1TOOA 1WD4A 3OJVA 1BLAA 4QKSA 3ZC9A 4A7YA 1JT5A 1FN0A 1QXMA 4HJJA 4YOLA 4I4XA 2LIEA 1W3GA 4ZFWB 3CA5A 1TTUA 3Q7YA 2NZ9A 3BA5A 3BAHA 3NJ5A 3O44A 4KC3A 3D7WB 4GOYA 4LO2C 4G6MA 1DIWA 3WMVA 3NBDA 4J2YA 2WBCA 3F62B 1DFCA 1FMMS 5DZUA 2VXRA 4KBBA 4LO8B 4QD2B 4X37A 3UD7A 3VT2A 1PWAA 4ZGRB 3I2XA 1AVWB 3PUBA 5GAQA 4ZLBB 3O4OA 3BRGC 3BB2A 3WO4A 1AVUA 1G9DA 1BARA 4IONA 4PC4A 5F8YA 1NZKA 2P39A 2LIQA 1M16A 1T9FA 4OWKA 3UD9A 4JAWA 4IHZA 3O4CA 3BA4A 2KI4A 1G9CA 4J2XA 1BFBA 3WINC 4I2SA 3WMUA 4OWLA 4X3AA 1II4A 2F8XC 1Q04A 4P0LA 1EPWA 2FGFA 3FJIA 2P23A 2VSAA 4LO0A 3VSZA 1IRAX 5D61A 4X39A 5BVPI 1JQZA 5DUYA 1IILA 2HZ9A 2Y9FA 1N4KA 1ITBA 1BFFA 1HWPB 2FFUA 1D0HA 3V79C 3WA1A 3O3QA 3BRDA 1V6UA 3N7LA 1F31A 3A21A 2MC2A 4KEJA 1V6XA 5F8SA 5FZYA 2Z48A 31BIA 4KEKA 5EHAA 3UJ0A 3PG0A 2Q9XA 2K8RA 2ZQNA 2AXMA 1HWMB 1QQKA 1I1BA 3CA6A 4Q9PA 5E24E 2Y9GA 1R8NA 4DENA 1DFQA 4G9NA 4AN6A 1BA7A 3H6RA 3S8JA 4EB2B 2E4MA 2ET2A 4I3NA 5D62A 3CA0A 1AXMA 2F2FC 1HKNA 1IT0A 4LO3A 1IJTA 3V0BB 2ESUA 1DQGA 4I37A 1CVSA 21BIA 2AFGA 1Z0HA 4JQ0A 3CRGA 2DRZA 3UJ4A 1WBAA 3HALA 3FFZA 2VXTI 4QBVA 3FJKA 3OJ2A 3MALA 3N0KA 1K5UA 3IM6A 2NYYA 3WO3A 4FGFA 4G6JA 4XFUA 2QYIB 4Z8SB 3WO2A 4GP3A 3VT0A 4JRAA 4QC4A 1Z2VA 2D22A 4Q9GA 2AAIB 4I1BA 4I1EA 2KH2A 4Z9WB 3TC2A 1ILR1 4D8HA 3FJDA 4USOA 3N7JA 4D0ZA 1SR4C 5BP5C 4IY8A 1FV3A 3HSMA 2D7RA 4I4RA 1AVXB 5HPZA 4A7ZA 3OBTA 3C9ZA 3OGGA 4H04A 1FWVA 4LO2A 1YTOA 5BXRA 1BFGA 3BAVA 5B2HA 3N7KA 4WBCA 1FMZA 1WD3A 3I2AA 1S0EA 3A07A 1S0LA
chains in the Genus database with same CATH superfamily
3I29B 1J0SA 3H6SE 3ZXDA 3BADA 4I96A 5DSSB 1XHBA 3BA7A 2D20A 2ERMA 2RQ9A 3AZVA 3VT1A 3A23A 3P6JA 1JT4A 5EG6C 2BEAA 4ZKTB 1Q1UA 1S0BA 1JT7A 3MPPG 1EV2A 1M2TB 1MC9A 4OWJA 3WINA 3IM5A 1DZCA 1IOBA 1HCDA 1JY0A 2VUAA 3O49A 4II0A 4MZGB 4QO3A 5FZZA 2FFVA 1JTCA 1ONKB 2BEBA 4HR6C 4F34A 4XKIA 4XFSA 1E0OA 4AN7B 1UPSA 1BFCA 3HBWA 4ZOTA 2MIBA 1G9AA 1EVTA 2QN4A 4I4SA 4P0KA 3CA4A 1GGPB 1YYNA 1NUNA 3IM7A 3VSFA 1EYLA 2IHOA 2D43A 4ZFUB 1DZDA 3E8LC 5FZUA 4KEIA 3CA3A 1DJSB 4L4HA 2HWMA 1T4QA 3ZC8A 1RZOB 1G82A 4LO1C 2NS2A 4IY9A 2NM1A 2HW9A 4I6IA 3CA1A 4F83A 4OEGA 4QBCA 2FO1A 3FGMA 9ILBA 3AJ6A 3FJ9A 1HCEA 2F2FA 2NTDA 3ZX7A 4I7IA 3FJJA 3CU1B 3UDAA 1OQLB 5BXTA 2KKIA 4MZFB 1Q03A 3JUTA 1V6WA 1KNMA 1XZZA 3P53A 2ZR1B 4OW4A 3BAGA 3RMYA 4IYBA 3FJ8A 5I1BA 1P63A 3V0BA 3Q7XA 1AFCA 2FDBM 3RSJA 1V6VA 4XFTA 3AKIA 3OBRA 4ZA3B 1PZZA 1ISXA 4QKRA 3V0AB 2Z49A 1RMLA 3A22A 3HMYA 3NBNA 1SZ6B 2J3PA 4I4QA 4G9MA 4J2KA 4I4YA 3ZXGA 1DQOA 3K1XA 2X2TA 3ILAA 2UUSA 4GAFA 1BASA 4EKXB 4ENDA 5BXPA 2WRYA 4I4VA 3NBEA 5JLVA 1SR4A 5BP5A 4CJMA 4GOVA 4UY4A 2RSTA 3HOMA 1IRPA 2XOAA 4JPZA 1G9BA 1DLLA 1WBCA 1RY7A 2DS0A 41BIA 3BX1C 3CRHA 1PUUB 3BTAA 1S0FA 2MLLB 2M49A 2I1BA 4DCKC 3FJAA 4IZXA 2DREA 1S0DA 3IIRA 1MD6A 4G1RA 2VU9A 3VWCA 5DVHA 1YBIA 1AF9A 2K43A 1I1EA 1JLXA 2D24A 5D63A 2Y9WC 4P6AA 3FJEA 1W3FA 2X2SA 4EFPA 3AH2A 3HN1A 5BXSA 1ISZA 3PHZA 3H6QA 3AJ5A 4LO7B 3O4BA 4I0YA 4EFQA 1PUMB 3FUOA 3AKGA 3BRFA 4OEFA 3AH1A 2ZQOA 3QR5A 5FNWA 5EC5A 3O4AA 4QALA 2RG9B 1Z4SA 3CRIA 4H9WA 3EF2A 1XYFA 3LLPA 2AQZA 3SNVA 3AKHA 5FNXA 4LO7C 1ISWA 1TIEA 4R6UB 1PC8B 3AZWA 1JLYA 3PMEA 1JT3A 4QD2C 1IHKA 4P0JA 3IAGC 1S0CA 4J2SA 4EFRA 3FJHA 3N7MA 4JKQA 4X38A 1TWEA 2VSEA 2R9KB 1ISVA 1BLDA 1FGAA 1HWNB 4GAIA 5F8WA 2D7IA 4LO0C 2NP0A 1R8OA 3POKA 3W9TA 3P6IA 2KI6B 4ZBVB 4ZFYB 4GP0A 5BQUA 4HA2A 5BQUC 3BAQA 4LO1A 3R4SA 1FQ9A 4FVVA 1QQLA 1FV2A 2Q3NB 2NVHA 4Q91A 1TFMB 3AKFA 4A7KA 4OEEA 2VLCA 3NBCA 4EEEB 1ABRB 3VUOA 4IZEA 1CE7B 4L4IA 3H6RB 1HWOB 2Y9XE 3RMXA 4I4UA 3OJMA 4D0TA 8I1BA 2GO2A 3Q7WA 3FUQA 5G00A 4I4OA 5JMCA 3KMVA 4OUJA 1ISYA 1HIBA 2YUGA 4TLPA 4I8MA 1L2HA 3O5WB 3S8KA 2E4MC 1RG8A 3BAUA 1K5VA 4I4PA 4ISQA 3BAOA 2KLLA 3B9UA 1VCLA 1FWUA 3AH4A 4LO3C 1A8DA 3CAHA 3OGFA 3LTQA 1YF8B 6I1BA 4ISRA 3F1RA 4JP0A 3CQAA 3RTJB 1S0GA 3RTIB 1W3AA 2DRYA 2L5XA 4IQPA 2IWTB 3V0AA 3FJCA 4USPA 2HWAA 3UD8A 7I1BA 2BFHA 3O4DA 5F90A 1YXWA 1AVAC 3FJFA 3QYDA 4J23B 4JKXB 3VEQA 3R4UA 4MZHA 4DEPA 2D23A 3FJBA 2GZBA 5BOWA 2K4AB 3JRRA 1XG6A 3T8SA 1TWMA 2D44A 1TP0A 2D1ZA 1TOOA 1WD4A 3OJVA 1BLAA 4QKSA 3ZC9A 4A7YA 1JT5A 1FN0A 1QXMA 4HJJA 4YOLA 4I4XA 2LIEA 1W3GA 4ZFWB 3CA5A 1TTUA 3Q7YA 2NZ9A 3BA5A 3BAHA 3NJ5A 3O44A 4KC3A 3D7WB 4GOYA 4LO2C 4G6MA 1DIWA 3WMVA 3NBDA 4J2YA 2WBCA 3F62B 1DFCA 1FMMS 5DZUA 2VXRA 4KBBA 4LO8B 4QD2B 4X37A 3UD7A 3VT2A 1PWAA 4ZGRB 3I2XA 1AVWB 3PUBA 5GAQA 4ZLBB 3O4OA 3BRGC 3BB2A 3WO4A 1AVUA 1G9DA 1BARA 4IONA 4PC4A 5F8YA 1NZKA 2P39A 2LIQA 1M16A 1T9FA 4OWKA 3UD9A 4JAWA 4IHZA 3O4CA 3BA4A 2KI4A 1G9CA 4J2XA 1BFBA 3WINC 4I2SA 3WMUA 4OWLA 4X3AA 1II4A 2F8XC 1Q04A 4P0LA 1EPWA 2FGFA 3FJIA 2P23A 2VSAA 4LO0A 3VSZA 1IRAX 5D61A 4X39A 5BVPI 1JQZA 5DUYA 1IILA 2HZ9A 2Y9FA 1N4KA 1ITBA 1BFFA 1HWPB 2FFUA 1D0HA 3V79C 3WA1A 3O3QA 3BRDA 1V6UA 3N7LA 1F31A 3A21A 2MC2A 4KEJA 1V6XA 5F8SA 5FZYA 2Z48A 31BIA 4KEKA 5EHAA 3UJ0A 3PG0A 2Q9XA 2K8RA 2ZQNA 2AXMA 1HWMB 1QQKA 1I1BA 3CA6A 4Q9PA 5E24E 2Y9GA 1R8NA 4DENA 1DFQA 4G9NA 4AN6A 1BA7A 3H6RA 3S8JA 4EB2B 2E4MA 2ET2A 4I3NA 5D62A 3CA0A 1AXMA 2F2FC 1HKNA 1IT0A 4LO3A 1IJTA 3V0BB 2ESUA 1DQGA 4I37A 1CVSA 21BIA 2AFGA 1Z0HA 4JQ0A 3CRGA 2DRZA 3UJ4A 1WBAA 3HALA 3FFZA 2VXTI 4QBVA 3FJKA 3OJ2A 3MALA 3N0KA 1K5UA 3IM6A 2NYYA 3WO3A 4FGFA 4G6JA 4XFUA 2QYIB 4Z8SB 3WO2A 4GP3A 3VT0A 4JRAA 4QC4A 1Z2VA 2D22A 4Q9GA 2AAIB 4I1BA 4I1EA 2KH2A 4Z9WB 3TC2A 1ILR1 4D8HA 3FJDA 4USOA 3N7JA 4D0ZA 1SR4C 5BP5C 4IY8A 1FV3A 3HSMA 2D7RA 4I4RA 1AVXB 5HPZA 4A7ZA 3OBTA 3C9ZA 3OGGA 4H04A 1FWVA 4LO2A 1YTOA 5BXRA 4H75A 1BFGA 3BAVA 5B2HA 3N7KA 4WBCA 1FMZA 1WD3A 3I2AA 1S0EA 3A07A 1S0LA
chains in the Genus database with same CATH topology
3I29B 1J0SA 3H6SE 3ZXDA 3BADA 4I96A 5DSSB 1XHBA 3BA7A 2D20A 2ERMA 2RQ9A 3AZVA 3VT1A 3A23A 3P6JA 1JT4A 5EG6C 2BEAA 4ZKTB 1Q1UA 1S0BA 1JT7A 3MPPG 1EV2A 1M2TB 1MC9A 4OWJA 3WINA 3IM5A 1DZCA 1IOBA 1HCDA 1JY0A 2VUAA 3O49A 4II0A 4MZGB 4QO3A 5FZZA 2FFVA 1JTCA 1ONKB 2BEBA 4HR6C 4F34A 4XKIA 4XFSA 1E0OA 4AN7B 1UPSA 1BFCA 3HBWA 4ZOTA 2MIBA 1G9AA 1EVTA 2QN4A 4I4SA 4P0KA 3CA4A 1GGPB 1YYNA 1NUNA 3IM7A 3VSFA 1EYLA 2IHOA 2D43A 4ZFUB 1DZDA 3E8LC 5FZUA 4KEIA 3CA3A 1DJSB 4L4HA 2HWMA 1T4QA 3ZC8A 1RZOB 1G82A 4LO1C 2NS2A 4IY9A 2NM1A 2HW9A 4I6IA 3CA1A 4F83A 4OEGA 4QBCA 2FO1A 3FGMA 9ILBA 3AJ6A 3FJ9A 1HCEA 2F2FA 2NTDA 3ZX7A 4I7IA 3FJJA 3CU1B 3UDAA 1OQLB 5BXTA 2KKIA 4MZFB 1Q03A 3JUTA 1V6WA 1KNMA 1XZZA 3P53A 2ZR1B 4OW4A 3BAGA 3RMYA 4IYBA 3FJ8A 5I1BA 1P63A 3V0BA 3Q7XA 1AFCA 2FDBM 3RSJA 1V6VA 4XFTA 3AKIA 3OBRA 4ZA3B 1PZZA 1ISXA 4QKRA 3V0AB 2Z49A 1RMLA 3A22A 3HMYA 3NBNA 1SZ6B 2J3PA 4I4QA 4G9MA 4J2KA 4I4YA 3ZXGA 1DQOA 3K1XA 2X2TA 3ILAA 2UUSA 4GAFA 1BASA 4EKXB 4ENDA 5BXPA 2WRYA 4I4VA 3NBEA 5JLVA 1SR4A 5BP5A 4CJMA 4GOVA 4UY4A 2RSTA 3HOMA 1IRPA 2XOAA 4JPZA 1G9BA 1DLLA 1WBCA 1RY7A 2DS0A 41BIA 3BX1C 3CRHA 1PUUB 3BTAA 1S0FA 2MLLB 2M49A 2I1BA 4DCKC 3FJAA 4IZXA 2DREA 1S0DA 3IIRA 1MD6A 4G1RA 2VU9A 3VWCA 5DVHA 1YBIA 1AF9A 2K43A 1I1EA 1JLXA 2D24A 5D63A 2Y9WC 4P6AA 3FJEA 1W3FA 2X2SA 4EFPA 3AH2A 3HN1A 5BXSA 1ISZA 3PHZA 3H6QA 3AJ5A 4LO7B 3O4BA 4I0YA 4EFQA 1PUMB 3FUOA 3AKGA 3BRFA 4OEFA 3AH1A 2ZQOA 3QR5A 5FNWA 5EC5A 3O4AA 4QALA 2RG9B 1Z4SA 3CRIA 4H9WA 3EF2A 1XYFA 3LLPA 2AQZA 3SNVA 3AKHA 5FNXA 4LO7C 1ISWA 1TIEA 4R6UB 1PC8B 3AZWA 1JLYA 3PMEA 1JT3A 4QD2C 1IHKA 4P0JA 3IAGC 1S0CA 4J2SA 4EFRA 3FJHA 3N7MA 4JKQA 4X38A 1TWEA 2VSEA 2R9KB 1ISVA 1BLDA 1FGAA 1HWNB 4GAIA 5F8WA 2D7IA 4LO0C 2NP0A 1R8OA 3POKA 3W9TA 3P6IA 2KI6B 4ZBVB 4ZFYB 4GP0A 5BQUA 4HA2A 5BQUC 3BAQA 4LO1A 3R4SA 1FQ9A 4FVVA 1QQLA 1FV2A 2Q3NB 2NVHA 4Q91A 1TFMB 3AKFA 4A7KA 4OEEA 2VLCA 3NBCA 4EEEB 1ABRB 3VUOA 4IZEA 1CE7B 4L4IA 3H6RB 1HWOB 2Y9XE 3RMXA 4I4UA 3OJMA 4D0TA 8I1BA 2GO2A 3Q7WA 3FUQA 5G00A 4I4OA 5JMCA 3KMVA 4OUJA 1ISYA 1HIBA 2YUGA 4TLPA 4I8MA 1L2HA 3O5WB 3S8KA 2E4MC 1RG8A 3BAUA 1K5VA 4I4PA 4ISQA 3BAOA 2KLLA 3B9UA 1VCLA 1FWUA 3AH4A 4LO3C 1A8DA 3CAHA 3OGFA 3LTQA 1YF8B 6I1BA 4ISRA 3F1RA 4JP0A 3CQAA 3RTJB 1S0GA 3RTIB 1W3AA 2DRYA 2L5XA 4IQPA 2IWTB 3V0AA 3FJCA 4USPA 2HWAA 3UD8A 7I1BA 2BFHA 3O4DA 5F90A 1YXWA 1AVAC 3FJFA 3QYDA 4J23B 4JKXB 3VEQA 3R4UA 4MZHA 4DEPA 2D23A 3FJBA 2GZBA 5BOWA 2K4AB 3JRRA 1XG6A 3T8SA 1TWMA 2D44A 1TP0A 2D1ZA 1TOOA 1WD4A 3OJVA 1BLAA 4QKSA 3ZC9A 4A7YA 1JT5A 1FN0A 1QXMA 4HJJA 4YOLA 4I4XA 2LIEA 1W3GA 4ZFWB 3CA5A 1TTUA 3Q7YA 2NZ9A 3BA5A 3BAHA 3NJ5A 3O44A 4KC3A 3D7WB 4GOYA 4LO2C 4G6MA 1DIWA 3WMVA 3NBDA 4J2YA 2WBCA 3F62B 1DFCA 1FMMS 5DZUA 2VXRA 4KBBA 4LO8B 4QD2B 4X37A 3UD7A 3VT2A 1PWAA 4ZGRB 3I2XA 1AVWB 3PUBA 5GAQA 4ZLBB 3O4OA 3BRGC 3BB2A 3WO4A 1AVUA 1G9DA 1BARA 4IONA 4PC4A 5F8YA 1NZKA 2P39A 2LIQA 1M16A 1T9FA 4OWKA 3UD9A 4JAWA 4IHZA 3O4CA 3BA4A 2KI4A 1G9CA 4J2XA 1BFBA 3WINC 4I2SA 3WMUA 4OWLA 4X3AA 1II4A 2F8XC 1Q04A 4P0LA 1EPWA 2FGFA 3FJIA 2P23A 2VSAA 4LO0A 3VSZA 1IRAX 5D61A 4X39A 5BVPI 1JQZA 5DUYA 1IILA 2HZ9A 2Y9FA 1N4KA 1ITBA 1BFFA 1HWPB 2FFUA 1D0HA 3V79C 3WA1A 3O3QA 3BRDA 1V6UA 3N7LA 1F31A 3A21A 2MC2A 4KEJA 1V6XA 5F8SA 5FZYA 2Z48A 31BIA 4KEKA 5EHAA 3UJ0A 3PG0A 2Q9XA 2K8RA 2ZQNA 2AXMA 1HWMB 1QQKA 1I1BA 3CA6A 4Q9PA 5E24E 2Y9GA 1R8NA 4DENA 1DFQA 4G9NA 4AN6A 1BA7A 3H6RA 3S8JA 4EB2B 2E4MA 2ET2A 4I3NA 5D62A 3CA0A 1AXMA 2F2FC 1HKNA 1IT0A 4LO3A 1IJTA 3V0BB 2ESUA 1DQGA 4I37A 1CVSA 21BIA 2AFGA 1Z0HA 4JQ0A 3CRGA 2DRZA 3UJ4A 1WBAA 3HALA 3FFZA 2VXTI 4QBVA 3FJKA 3OJ2A 3MALA 3N0KA 1K5UA 3IM6A 2NYYA 3WO3A 4FGFA 4G6JA 4XFUA 2QYIB 4Z8SB 3WO2A 4GP3A 3VT0A 4JRAA 4QC4A 1Z2VA 2D22A 4Q9GA 2AAIB 4I1BA 4I1EA 2KH2A 4Z9WB 3TC2A 1ILR1 4D8HA 3FJDA 4USOA 3N7JA 4D0ZA 1SR4C 5BP5C 4IY8A 1FV3A 3HSMA 2D7RA 4I4RA 1AVXB 5HPZA 4A7ZA 3OBTA 3C9ZA 3OGGA 4H04A 1FWVA 4LO2A 1YTOA 5BXRA 4H75A 1BFGA 3BAVA 5B2HA 3N7KA 4WBCA 1FMZA 1WD3A 3I2AA 1S0EA 3A07A 1S0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I29 B;  1J0S A;  3H6S E;  3ZXD A;  3BAD A;  4I96 A;  5DSS B;  1XHB A;  3BA7 A;  2D20 A;  2ERM A;  2RQ9 A;  3AZV A;  3VT1 A;  3A23 A;  3P6J A;  1JT4 A;  5EG6 C;  2BEA A;  4ZKT B;  1Q1U A;  1S0B A;  1JT7 A;  3MPP G;  1EV2 A;  1M2T B;  1MC9 A;  4OWJ A;  3WIN A;  3IM5 A;  1DZC A;  1IOB A;  1HCD A;  1JY0 A;  2VUA A;  3O49 A;  4II0 A;  5FZZ A;  4QO3 A;  2FFV A;  1JTC A;  1ONK B;  2BEB A;  4HR6 C;  4F34 A;  4XKI A;  4XFS A;  1E0O A;  4AN7 B;  1UPS A;  1BFC A;  3HBW A;  4ZOT A;  2MIB A;  1G9A A;  1EVT A;  2QN4 A;  4I4S A;  4P0K A;  3CA4 A;  1GGP B;  1YYN A;  1NUN A;  3IM7 A;  3VSF A;  1EYL A;  2IHO A;  2D43 A;  4ZFU B;  1DZD A;  3E8L C;  5FZU A;  4KEI A;  3CA3 A;  1DJS B;  4L4H A;  2HWM A;  1T4Q A;  3ZC8 A;  1RZO B;  1G82 A;  4LO1 C;  4IY9 A;  2NM1 A;  2HW9 A;  4I6I A;  3CA1 A;  4F83 A;  4OEG A;  4QBC A;  2FO1 A;  3FGM A;  9ILB A;  3AJ6 A;  3FJ9 A;  1HCE A;  2F2F A;  2NTD A;  3ZX7 A;  4I7I A;  3FJJ A;  3CU1 B;  3UDA A;  1OQL B;  5BXT A;  2KKI A;  1Q03 A;  3JUT A;  1V6W A;  1KNM A;  1XZZ A;  3P53 A;  2ZR1 B;  4OW4 A;  3BAG A;  3RMY A;  4IYB A;  3FJ8 A;  5I1B A;  1P63 A;  3V0B A;  3Q7X A;  1AFC A;  2FDB M;  3RSJ A;  1V6V A;  4XFT A;  3AKI A;  3OBR A;  4ZA3 B;  1PZZ A;  1ISX A;  4QKR A;  3V0A B;  2Z49 A;  1RML A;  3A22 A;  3HMY A;  3NBN A;  1SZ6 B;  2J3P A;  4I4Q A;  4G9M A;  4J2K A;  4I4Y A;  3ZXG A;  1DQO A;  3K1X A;  2X2T A;  3ILA A;  2UUS A;  4GAF A;  1BAS A;  4EKX B;  4END A;  5BXP A;  2WRY A;  4I4V A;  3NBE A;  5JLV A;  1SR4 A;  5BP5 A;  4CJM A;  4GOV A;  2RST A;  3HOM A;  1IRP A;  2XOA A;  4JPZ A;  1G9B A;  1DLL A;  1WBC A;  1RY7 A;  2DS0 A;  41BI A;  3BX1 C;  3CRH A;  1PUU B;  3BTA A;  1S0F A;  2MLL B;  2M49 A;  2I1B A;  4DCK C;  3FJA A;  4IZX A;  2DRE A;  1S0D A;  3IIR A;  1MD6 A;  4G1R A;  2VU9 A;  3VWC A;  5DVH A;  1YBI A;  1AF9 A;  2K43 A;  1I1E A;  1JLX A;  2D24 A;  5D63 A;  2Y9W C;  4P6A A;  3FJE A;  1W3F A;  2X2S A;  4EFP A;  3AH2 A;  3HN1 A;  5BXS A;  1ISZ A;  3PHZ A;  3H6Q A;  3AJ5 A;  4LO7 B;  3O4B A;  4I0Y A;  4EFQ A;  1PUM B;  3FUO A;  3AKG A;  3BRF A;  4OEF A;  3AH1 A;  2ZQO A;  3QR5 A;  5FNW A;  5EC5 A;  3O4A A;  4QAL A;  2RG9 B;  1Z4S A;  3CRI A;  4H9W A;  3EF2 A;  1XYF A;  3LLP A;  2AQZ A;  3SNV A;  3AKH A;  5FNX A;  4LO7 C;  1ISW A;  1TIE A;  4R6U B;  1PC8 B;  3AZW A;  1JLY A;  3PME A;  1JT3 A;  4QD2 C;  1IHK A;  4P0J A;  3IAG C;  1S0C A;  4J2S A;  4EFR A;  3FJH A;  3N7M A;  4JKQ A;  4X38 A;  1TWE A;  2VSE A;  2R9K B;  1ISV A;  1BLD A;  1FGA A;  1HWN B;  4GAI A;  5F8W A;  2D7I A;  4LO0 C;  2NP0 A;  1R8O A;  3POK A;  3W9T A;  3P6I A;  2KI6 B;  4ZBV B;  4ZFY B;  4GP0 A;  5BQU A;  4HA2 A;  5BQU C;  3BAQ A;  4LO1 A;  3R4S A;  1FQ9 A;  4FVV A;  1QQL A;  1FV2 A;  2Q3N B;  2NVH A;  4Q91 A;  1TFM B;  3AKF A;  4A7K A;  4OEE A;  2VLC A;  3NBC A;  4EEE B;  1ABR B;  3VUO A;  4IZE A;  1CE7 B;  4L4I A;  3H6R B;  1HWO B;  2Y9X E;  3RMX A;  4I4U A;  3OJM A;  4D0T A;  8I1B A;  2GO2 A;  3Q7W A;  3FUQ A;  5G00 A;  4I4O A;  5JMC A;  3KMV A;  4OUJ A;  1ISY A;  1HIB A;  2YUG A;  4TLP A;  4I8M A;  1L2H A;  3O5W B;  3S8K A;  2E4M C;  1RG8 A;  3BAU A;  1K5V A;  4I4P A;  4ISQ A;  3BAO A;  2KLL A;  3B9U A;  1VCL A;  1FWU A;  3AH4 A;  4LO3 C;  1A8D A;  3CAH A;  3OGF A;  3LTQ A;  1YF8 B;  6I1B A;  4ISR A;  3F1R A;  4JP0 A;  3CQA A;  3RTJ B;  1S0G A;  3RTI B;  1W3A A;  2DRY A;  2L5X A;  4IQP A;  2IWT B;  3V0A A;  3FJC A;  4USP A;  2HWA A;  3UD8 A;  7I1B A;  2BFH A;  3O4D A;  5F90 A;  1YXW A;  1AVA C;  3FJF A;  3QYD A;  4J23 B;  4JKX B;  3VEQ A;  3R4U A;  4DEP A;  2D23 A;  3FJB A;  2GZB A;  5BOW A;  2K4A B;  3JRR A;  1XG6 A;  3T8S A;  1TWM A;  2D44 A;  1TP0 A;  2D1Z A;  1TOO A;  1WD4 A;  3OJV A;  1BLA A;  4QKS A;  3ZC9 A;  4A7Y A;  1JT5 A;  1FN0 A;  1QXM A;  4HJJ A;  4YOL A;  4I4X A;  2LIE A;  1W3G A;  4ZFW B;  3CA5 A;  1TTU A;  3Q7Y A;  2NZ9 A;  3BA5 A;  3BAH A;  3NJ5 A;  3O44 A;  4KC3 A;  3D7W B;  4GOY A;  4LO2 C;  4G6M A;  1DIW A;  3WMV A;  3NBD A;  4J2Y A;  2WBC A;  3F62 B;  1DFC A;  1FMM S;  5DZU A;  2VXR A;  4KBB A;  4LO8 B;  4QD2 B;  4X37 A;  3UD7 A;  3VT2 A;  1PWA A;  4ZGR B;  3I2X A;  1AVW B;  3PUB A;  5GAQ A;  4ZLB B;  3O4O A;  3BRG C;  3BB2 A;  3WO4 A;  1AVU A;  1G9D A;  1BAR A;  4ION A;  4PC4 A;  5F8Y A;  1NZK A;  2P39 A;  2LIQ A;  1M16 A;  1T9F A;  4OWK A;  3UD9 A;  4JAW A;  4IHZ A;  3O4C A;  3BA4 A;  2KI4 A;  1G9C A;  4J2X A;  1BFB A;  3WIN C;  4I2S A;  3WMU A;  4OWL A;  4X3A A;  1II4 A;  2F8X C;  1Q04 A;  4P0L A;  1EPW A;  2FGF A;  3FJI A;  2P23 A;  2VSA A;  4LO0 A;  3VSZ A;  1IRA X;  5D61 A;  4X39 A;  5BVP I;  1JQZ A;  5DUY A;  1IIL A;  2HZ9 A;  2Y9F A;  1N4K A;  1ITB A;  1BFF A;  1HWP B;  2FFU A;  1D0H A;  3V79 C;  3WA1 A;  3O3Q A;  3BRD A;  1V6U A;  3N7L A;  1F31 A;  3A21 A;  2MC2 A;  4KEJ A;  1V6X A;  5F8S A;  5FZY A;  2Z48 A;  31BI A;  4KEK A;  5EHA A;  3UJ0 A;  3PG0 A;  2Q9X A;  2K8R A;  2ZQN A;  2AXM A;  1HWM B;  1QQK A;  1I1B A;  3CA6 A;  4Q9P A;  5E24 E;  2Y9G A;  1R8N A;  4DEN A;  1DFQ A;  4G9N A;  4AN6 A;  1BA7 A;  3H6R A;  3S8J A;  4EB2 B;  2E4M A;  2ET2 A;  4I3N A;  5D62 A;  3CA0 A;  1AXM A;  2F2F C;  1HKN A;  1IT0 A;  4LO3 A;  1IJT A;  3V0B B;  2ESU A;  1DQG A;  4I37 A;  1CVS A;  21BI A;  2AFG A;  1Z0H A;  4JQ0 A;  3CRG A;  2DRZ A;  3UJ4 A;  1WBA A;  3HAL A;  3FFZ A;  2VXT I;  4QBV A;  3FJK A;  3OJ2 A;  3MAL A;  3N0K A;  1K5U A;  3IM6 A;  2NYY A;  3WO3 A;  4FGF A;  4G6J A;  4XFU A;  2QYI B;  4Z8S B;  3WO2 A;  4GP3 A;  3VT0 A;  4JRA A;  4QC4 A;  1Z2V A;  2D22 A;  4Q9G A;  2AAI B;  4I1B A;  4I1E A;  2KH2 A;  4Z9W B;  3TC2 A;  1ILR 1;  4D8H A;  3FJD A;  4USO A;  3N7J A;  4D0Z A;  1SR4 C;  5BP5 C;  4IY8 A;  1FV3 A;  3HSM A;  2D7R A;  4I4R A;  1AVX B;  5HPZ A;  4A7Z A;  3OBT A;  3C9Z A;  3OGG A;  4H04 A;  1FWV A;  4LO2 A;  1YTO A;  5BXR A;  1BFG A;  3BAV A;  5B2H A;  3N7K A;  4WBC A;  1FMZ A;  1WD3 A;  3I2A A;  1S0E A;  3A07 A;  1S0L A; 
#chains in the Genus database with same CATH topology
 3I29 B;  1J0S A;  3H6S E;  3ZXD A;  3BAD A;  4I96 A;  5DSS B;  1XHB A;  3BA7 A;  2D20 A;  2ERM A;  2RQ9 A;  3AZV A;  3VT1 A;  3A23 A;  3P6J A;  1JT4 A;  5EG6 C;  2BEA A;  4ZKT B;  1Q1U A;  1S0B A;  1JT7 A;  3MPP G;  1EV2 A;  1M2T B;  1MC9 A;  4OWJ A;  3WIN A;  3IM5 A;  1DZC A;  1IOB A;  1HCD A;  1JY0 A;  2VUA A;  3O49 A;  4II0 A;  4MZG B;  4QO3 A;  5FZZ A;  2FFV A;  1JTC A;  1ONK B;  2BEB A;  4HR6 C;  4F34 A;  4XKI A;  4XFS A;  1E0O A;  4AN7 B;  1UPS A;  1BFC A;  3HBW A;  4ZOT A;  2MIB A;  1G9A A;  1EVT A;  2QN4 A;  4I4S A;  4P0K A;  3CA4 A;  1GGP B;  1YYN A;  1NUN A;  3IM7 A;  3VSF A;  1EYL A;  2IHO A;  2D43 A;  4ZFU B;  1DZD A;  3E8L C;  5FZU A;  4KEI A;  3CA3 A;  1DJS B;  4L4H A;  2HWM A;  1T4Q A;  3ZC8 A;  1RZO B;  1G82 A;  4LO1 C;  2NS2 A;  4IY9 A;  2NM1 A;  2HW9 A;  4I6I A;  3CA1 A;  4F83 A;  4OEG A;  4QBC A;  2FO1 A;  3FGM A;  9ILB A;  3AJ6 A;  3FJ9 A;  1HCE A;  2F2F A;  2NTD A;  3ZX7 A;  4I7I A;  3FJJ A;  3CU1 B;  3UDA A;  1OQL B;  5BXT A;  2KKI A;  4MZF B;  1Q03 A;  3JUT A;  1V6W A;  1KNM A;  1XZZ A;  3P53 A;  2ZR1 B;  4OW4 A;  3BAG A;  3RMY A;  4IYB A;  3FJ8 A;  5I1B A;  1P63 A;  3V0B A;  3Q7X A;  1AFC A;  2FDB M;  3RSJ A;  1V6V A;  4XFT A;  3AKI A;  3OBR A;  4ZA3 B;  1PZZ A;  1ISX A;  4QKR A;  3V0A B;  2Z49 A;  1RML A;  3A22 A;  3HMY A;  3NBN A;  1SZ6 B;  2J3P A;  4I4Q A;  4G9M A;  4J2K A;  4I4Y A;  3ZXG A;  1DQO A;  3K1X A;  2X2T A;  3ILA A;  2UUS A;  4GAF A;  1BAS A;  4EKX B;  4END A;  5BXP A;  2WRY A;  4I4V A;  3NBE A;  5JLV A;  1SR4 A;  5BP5 A;  4CJM A;  4GOV A;  4UY4 A;  2RST A;  3HOM A;  1IRP A;  2XOA A;  4JPZ A;  1G9B A;  1DLL A;  1WBC A;  1RY7 A;  2DS0 A;  41BI A;  3BX1 C;  3CRH A;  1PUU B;  3BTA A;  1S0F A;  2MLL B;  2M49 A;  2I1B A;  4DCK C;  3FJA A;  4IZX A;  2DRE A;  1S0D A;  3IIR A;  1MD6 A;  4G1R A;  2VU9 A;  3VWC A;  5DVH A;  1YBI A;  1AF9 A;  2K43 A;  1I1E A;  1JLX A;  2D24 A;  5D63 A;  2Y9W C;  4P6A A;  3FJE A;  1W3F A;  2X2S A;  4EFP A;  3AH2 A;  3HN1 A;  5BXS A;  1ISZ A;  3PHZ A;  3H6Q A;  3AJ5 A;  4LO7 B;  3O4B A;  4I0Y A;  4EFQ A;  1PUM B;  3FUO A;  3AKG A;  3BRF A;  4OEF A;  3AH1 A;  2ZQO A;  3QR5 A;  5FNW A;  5EC5 A;  3O4A A;  4QAL A;  2RG9 B;  1Z4S A;  3CRI A;  4H9W A;  3EF2 A;  1XYF A;  3LLP A;  2AQZ A;  3SNV A;  3AKH A;  5FNX A;  4LO7 C;  1ISW A;  1TIE A;  4R6U B;  1PC8 B;  3AZW A;  1JLY A;  3PME A;  1JT3 A;  4QD2 C;  1IHK A;  4P0J A;  3IAG C;  1S0C A;  4J2S A;  4EFR A;  3FJH A;  3N7M A;  4JKQ A;  4X38 A;  1TWE A;  2VSE A;  2R9K B;  1ISV A;  1BLD A;  1FGA A;  1HWN B;  4GAI A;  5F8W A;  2D7I A;  4LO0 C;  2NP0 A;  1R8O A;  3POK A;  3W9T A;  3P6I A;  2KI6 B;  4ZBV B;  4ZFY B;  4GP0 A;  5BQU A;  4HA2 A;  5BQU C;  3BAQ A;  4LO1 A;  3R4S A;  1FQ9 A;  4FVV A;  1QQL A;  1FV2 A;  2Q3N B;  2NVH A;  4Q91 A;  1TFM B;  3AKF A;  4A7K A;  4OEE A;  2VLC A;  3NBC A;  4EEE B;  1ABR B;  3VUO A;  4IZE A;  1CE7 B;  4L4I A;  3H6R B;  1HWO B;  2Y9X E;  3RMX A;  4I4U A;  3OJM A;  4D0T A;  8I1B A;  2GO2 A;  3Q7W A;  3FUQ A;  5G00 A;  4I4O A;  5JMC A;  3KMV A;  4OUJ A;  1ISY A;  1HIB A;  2YUG A;  4TLP A;  4I8M A;  1L2H A;  3O5W B;  3S8K A;  2E4M C;  1RG8 A;  3BAU A;  1K5V A;  4I4P A;  4ISQ A;  3BAO A;  2KLL A;  3B9U A;  1VCL A;  1FWU A;  3AH4 A;  4LO3 C;  1A8D A;  3CAH A;  3OGF A;  3LTQ A;  1YF8 B;  6I1B A;  4ISR A;  3F1R A;  4JP0 A;  3CQA A;  3RTJ B;  1S0G A;  3RTI B;  1W3A A;  2DRY A;  2L5X A;  4IQP A;  2IWT B;  3V0A A;  3FJC A;  4USP A;  2HWA A;  3UD8 A;  7I1B A;  2BFH A;  3O4D A;  5F90 A;  1YXW A;  1AVA C;  3FJF A;  3QYD A;  4J23 B;  4JKX B;  3VEQ A;  3R4U A;  4MZH A;  4DEP A;  2D23 A;  3FJB A;  2GZB A;  5BOW A;  2K4A B;  3JRR A;  1XG6 A;  3T8S A;  1TWM A;  2D44 A;  1TP0 A;  2D1Z A;  1TOO A;  1WD4 A;  3OJV A;  1BLA A;  4QKS A;  3ZC9 A;  4A7Y A;  1JT5 A;  1FN0 A;  1QXM A;  4HJJ A;  4YOL A;  4I4X A;  2LIE A;  1W3G A;  4ZFW B;  3CA5 A;  1TTU A;  3Q7Y A;  2NZ9 A;  3BA5 A;  3BAH A;  3NJ5 A;  3O44 A;  4KC3 A;  3D7W B;  4GOY A;  4LO2 C;  4G6M A;  1DIW A;  3WMV A;  3NBD A;  4J2Y A;  2WBC A;  3F62 B;  1DFC A;  1FMM S;  5DZU A;  2VXR A;  4KBB A;  4LO8 B;  4QD2 B;  4X37 A;  3UD7 A;  3VT2 A;  1PWA A;  4ZGR B;  3I2X A;  1AVW B;  3PUB A;  5GAQ A;  4ZLB B;  3O4O A;  3BRG C;  3BB2 A;  3WO4 A;  1AVU A;  1G9D A;  1BAR A;  4ION A;  4PC4 A;  5F8Y A;  1NZK A;  2P39 A;  2LIQ A;  1M16 A;  1T9F A;  4OWK A;  3UD9 A;  4JAW A;  4IHZ A;  3O4C A;  3BA4 A;  2KI4 A;  1G9C A;  4J2X A;  1BFB A;  3WIN C;  4I2S A;  3WMU A;  4OWL A;  4X3A A;  1II4 A;  2F8X C;  1Q04 A;  4P0L A;  1EPW A;  2FGF A;  3FJI A;  2P23 A;  2VSA A;  4LO0 A;  3VSZ A;  1IRA X;  5D61 A;  4X39 A;  5BVP I;  1JQZ A;  5DUY A;  1IIL A;  2HZ9 A;  2Y9F A;  1N4K A;  1ITB A;  1BFF A;  1HWP B;  2FFU A;  1D0H A;  3V79 C;  3WA1 A;  3O3Q A;  3BRD A;  1V6U A;  3N7L A;  1F31 A;  3A21 A;  2MC2 A;  4KEJ A;  1V6X A;  5F8S A;  5FZY A;  2Z48 A;  31BI A;  4KEK A;  5EHA A;  3UJ0 A;  3PG0 A;  2Q9X A;  2K8R A;  2ZQN A;  2AXM A;  1HWM B;  1QQK A;  1I1B A;  3CA6 A;  4Q9P A;  5E24 E;  2Y9G A;  1R8N A;  4DEN A;  1DFQ A;  4G9N A;  4AN6 A;  1BA7 A;  3H6R A;  3S8J A;  4EB2 B;  2E4M A;  2ET2 A;  4I3N A;  5D62 A;  3CA0 A;  1AXM A;  2F2F C;  1HKN A;  1IT0 A;  4LO3 A;  1IJT A;  3V0B B;  2ESU A;  1DQG A;  4I37 A;  1CVS A;  21BI A;  2AFG A;  1Z0H A;  4JQ0 A;  3CRG A;  2DRZ A;  3UJ4 A;  1WBA A;  3HAL A;  3FFZ A;  2VXT I;  4QBV A;  3FJK A;  3OJ2 A;  3MAL A;  3N0K A;  1K5U A;  3IM6 A;  2NYY A;  3WO3 A;  4FGF A;  4G6J A;  4XFU A;  2QYI B;  4Z8S B;  3WO2 A;  4GP3 A;  3VT0 A;  4JRA A;  4QC4 A;  1Z2V A;  2D22 A;  4Q9G A;  2AAI B;  4I1B A;  4I1E A;  2KH2 A;  4Z9W B;  3TC2 A;  1ILR 1;  4D8H A;  3FJD A;  4USO A;  3N7J A;  4D0Z A;  1SR4 C;  5BP5 C;  4IY8 A;  1FV3 A;  3HSM A;  2D7R A;  4I4R A;  1AVX B;  5HPZ A;  4A7Z A;  3OBT A;  3C9Z A;  3OGG A;  4H04 A;  1FWV A;  4LO2 A;  1YTO A;  5BXR A;  4H75 A;  1BFG A;  3BAV A;  5B2H A;  3N7K A;  4WBC A;  1FMZ A;  1WD3 A;  3I2A A;  1S0E A;  3A07 A;  1S0L A; 
#chains in the Genus database with same CATH homology
 3I29 B;  1J0S A;  3H6S E;  3ZXD A;  3BAD A;  4I96 A;  5DSS B;  1XHB A;  3BA7 A;  2D20 A;  2ERM A;  2RQ9 A;  3AZV A;  3VT1 A;  3A23 A;  3P6J A;  1JT4 A;  5EG6 C;  2BEA A;  4ZKT B;  1Q1U A;  1S0B A;  1JT7 A;  3MPP G;  1EV2 A;  1M2T B;  1MC9 A;  4OWJ A;  3WIN A;  3IM5 A;  1DZC A;  1IOB A;  1HCD A;  1JY0 A;  2VUA A;  3O49 A;  4II0 A;  4MZG B;  4QO3 A;  5FZZ A;  2FFV A;  1JTC A;  1ONK B;  2BEB A;  4HR6 C;  4F34 A;  4XKI A;  4XFS A;  1E0O A;  4AN7 B;  1UPS A;  1BFC A;  3HBW A;  4ZOT A;  2MIB A;  1G9A A;  1EVT A;  2QN4 A;  4I4S A;  4P0K A;  3CA4 A;  1GGP B;  1YYN A;  1NUN A;  3IM7 A;  3VSF A;  1EYL A;  2IHO A;  2D43 A;  4ZFU B;  1DZD A;  3E8L C;  5FZU A;  4KEI A;  3CA3 A;  1DJS B;  4L4H A;  2HWM A;  1T4Q A;  3ZC8 A;  1RZO B;  1G82 A;  4LO1 C;  2NS2 A;  4IY9 A;  2NM1 A;  2HW9 A;  4I6I A;  3CA1 A;  4F83 A;  4OEG A;  4QBC A;  2FO1 A;  3FGM A;  9ILB A;  3AJ6 A;  3FJ9 A;  1HCE A;  2F2F A;  2NTD A;  3ZX7 A;  4I7I A;  3FJJ A;  3CU1 B;  3UDA A;  1OQL B;  5BXT A;  2KKI A;  4MZF B;  1Q03 A;  3JUT A;  1V6W A;  1KNM A;  1XZZ A;  3P53 A;  2ZR1 B;  4OW4 A;  3BAG A;  3RMY A;  4IYB A;  3FJ8 A;  5I1B A;  1P63 A;  3V0B A;  3Q7X A;  1AFC A;  2FDB M;  3RSJ A;  1V6V A;  4XFT A;  3AKI A;  3OBR A;  4ZA3 B;  1PZZ A;  1ISX A;  4QKR A;  3V0A B;  2Z49 A;  1RML A;  3A22 A;  3HMY A;  3NBN A;  1SZ6 B;  2J3P A;  4I4Q A;  4G9M A;  4J2K A;  4I4Y A;  3ZXG A;  1DQO A;  3K1X A;  2X2T A;  3ILA A;  2UUS A;  4GAF A;  1BAS A;  4EKX B;  4END A;  5BXP A;  2WRY A;  4I4V A;  3NBE A;  5JLV A;  1SR4 A;  5BP5 A;  4CJM A;  4GOV A;  4UY4 A;  2RST A;  3HOM A;  1IRP A;  2XOA A;  4JPZ A;  1G9B A;  1DLL A;  1WBC A;  1RY7 A;  2DS0 A;  41BI A;  3BX1 C;  3CRH A;  1PUU B;  3BTA A;  1S0F A;  2MLL B;  2M49 A;  2I1B A;  4DCK C;  3FJA A;  4IZX A;  2DRE A;  1S0D A;  3IIR A;  1MD6 A;  4G1R A;  2VU9 A;  3VWC A;  5DVH A;  1YBI A;  1AF9 A;  2K43 A;  1I1E A;  1JLX A;  2D24 A;  5D63 A;  2Y9W C;  4P6A A;  3FJE A;  1W3F A;  2X2S A;  4EFP A;  3AH2 A;  3HN1 A;  5BXS A;  1ISZ A;  3PHZ A;  3H6Q A;  3AJ5 A;  4LO7 B;  3O4B A;  4I0Y A;  4EFQ A;  1PUM B;  3FUO A;  3AKG A;  3BRF A;  4OEF A;  3AH1 A;  2ZQO A;  3QR5 A;  5FNW A;  5EC5 A;  3O4A A;  4QAL A;  2RG9 B;  1Z4S A;  3CRI A;  4H9W A;  3EF2 A;  1XYF A;  3LLP A;  2AQZ A;  3SNV A;  3AKH A;  5FNX A;  4LO7 C;  1ISW A;  1TIE A;  4R6U B;  1PC8 B;  3AZW A;  1JLY A;  3PME A;  1JT3 A;  4QD2 C;  1IHK A;  4P0J A;  3IAG C;  1S0C A;  4J2S A;  4EFR A;  3FJH A;  3N7M A;  4JKQ A;  4X38 A;  1TWE A;  2VSE A;  2R9K B;  1ISV A;  1BLD A;  1FGA A;  1HWN B;  4GAI A;  5F8W A;  2D7I A;  4LO0 C;  2NP0 A;  1R8O A;  3POK A;  3W9T A;  3P6I A;  2KI6 B;  4ZBV B;  4ZFY B;  4GP0 A;  5BQU A;  4HA2 A;  5BQU C;  3BAQ A;  4LO1 A;  3R4S A;  1FQ9 A;  4FVV A;  1QQL A;  1FV2 A;  2Q3N B;  2NVH A;  4Q91 A;  1TFM B;  3AKF A;  4A7K A;  4OEE A;  2VLC A;  3NBC A;  4EEE B;  1ABR B;  3VUO A;  4IZE A;  1CE7 B;  4L4I A;  3H6R B;  1HWO B;  2Y9X E;  3RMX A;  4I4U A;  3OJM A;  4D0T A;  8I1B A;  2GO2 A;  3Q7W A;  3FUQ A;  5G00 A;  4I4O A;  5JMC A;  3KMV A;  4OUJ A;  1ISY A;  1HIB A;  2YUG A;  4TLP A;  4I8M A;  1L2H A;  3O5W B;  3S8K A;  2E4M C;  1RG8 A;  3BAU A;  1K5V A;  4I4P A;  4ISQ A;  3BAO A;  2KLL A;  3B9U A;  1VCL A;  1FWU A;  3AH4 A;  4LO3 C;  1A8D A;  3CAH A;  3OGF A;  3LTQ A;  1YF8 B;  6I1B A;  4ISR A;  3F1R A;  4JP0 A;  3CQA A;  3RTJ B;  1S0G A;  3RTI B;  1W3A A;  2DRY A;  2L5X A;  4IQP A;  2IWT B;  3V0A A;  3FJC A;  4USP A;  2HWA A;  3UD8 A;  7I1B A;  2BFH A;  3O4D A;  5F90 A;  1YXW A;  1AVA C;  3FJF A;  3QYD A;  4J23 B;  4JKX B;  3VEQ A;  3R4U A;  4MZH A;  4DEP A;  2D23 A;  3FJB A;  2GZB A;  5BOW A;  2K4A B;  3JRR A;  1XG6 A;  3T8S A;  1TWM A;  2D44 A;  1TP0 A;  2D1Z A;  1TOO A;  1WD4 A;  3OJV A;  1BLA A;  4QKS A;  3ZC9 A;  4A7Y A;  1JT5 A;  1FN0 A;  1QXM A;  4HJJ A;  4YOL A;  4I4X A;  2LIE A;  1W3G A;  4ZFW B;  3CA5 A;  1TTU A;  3Q7Y A;  2NZ9 A;  3BA5 A;  3BAH A;  3NJ5 A;  3O44 A;  4KC3 A;  3D7W B;  4GOY A;  4LO2 C;  4G6M A;  1DIW A;  3WMV A;  3NBD A;  4J2Y A;  2WBC A;  3F62 B;  1DFC A;  1FMM S;  5DZU A;  2VXR A;  4KBB A;  4LO8 B;  4QD2 B;  4X37 A;  3UD7 A;  3VT2 A;  1PWA A;  4ZGR B;  3I2X A;  1AVW B;  3PUB A;  5GAQ A;  4ZLB B;  3O4O A;  3BRG C;  3BB2 A;  3WO4 A;  1AVU A;  1G9D A;  1BAR A;  4ION A;  4PC4 A;  5F8Y A;  1NZK A;  2P39 A;  2LIQ A;  1M16 A;  1T9F A;  4OWK A;  3UD9 A;  4JAW A;  4IHZ A;  3O4C A;  3BA4 A;  2KI4 A;  1G9C A;  4J2X A;  1BFB A;  3WIN C;  4I2S A;  3WMU A;  4OWL A;  4X3A A;  1II4 A;  2F8X C;  1Q04 A;  4P0L A;  1EPW A;  2FGF A;  3FJI A;  2P23 A;  2VSA A;  4LO0 A;  3VSZ A;  1IRA X;  5D61 A;  4X39 A;  5BVP I;  1JQZ A;  5DUY A;  1IIL A;  2HZ9 A;  2Y9F A;  1N4K A;  1ITB A;  1BFF A;  1HWP B;  2FFU A;  1D0H A;  3V79 C;  3WA1 A;  3O3Q A;  3BRD A;  1V6U A;  3N7L A;  1F31 A;  3A21 A;  2MC2 A;  4KEJ A;  1V6X A;  5F8S A;  5FZY A;  2Z48 A;  31BI A;  4KEK A;  5EHA A;  3UJ0 A;  3PG0 A;  2Q9X A;  2K8R A;  2ZQN A;  2AXM A;  1HWM B;  1QQK A;  1I1B A;  3CA6 A;  4Q9P A;  5E24 E;  2Y9G A;  1R8N A;  4DEN A;  1DFQ A;  4G9N A;  4AN6 A;  1BA7 A;  3H6R A;  3S8J A;  4EB2 B;  2E4M A;  2ET2 A;  4I3N A;  5D62 A;  3CA0 A;  1AXM A;  2F2F C;  1HKN A;  1IT0 A;  4LO3 A;  1IJT A;  3V0B B;  2ESU A;  1DQG A;  4I37 A;  1CVS A;  21BI A;  2AFG A;  1Z0H A;  4JQ0 A;  3CRG A;  2DRZ A;  3UJ4 A;  1WBA A;  3HAL A;  3FFZ A;  2VXT I;  4QBV A;  3FJK A;  3OJ2 A;  3MAL A;  3N0K A;  1K5U A;  3IM6 A;  2NYY A;  3WO3 A;  4FGF A;  4G6J A;  4XFU A;  2QYI B;  4Z8S B;  3WO2 A;  4GP3 A;  3VT0 A;  4JRA A;  4QC4 A;  1Z2V A;  2D22 A;  4Q9G A;  2AAI B;  4I1B A;  4I1E A;  2KH2 A;  4Z9W B;  3TC2 A;  1ILR 1;  4D8H A;  3FJD A;  4USO A;  3N7J A;  4D0Z A;  1SR4 C;  5BP5 C;  4IY8 A;  1FV3 A;  3HSM A;  2D7R A;  4I4R A;  1AVX B;  5HPZ A;  4A7Z A;  3OBT A;  3C9Z A;  3OGG A;  4H04 A;  1FWV A;  4LO2 A;  1YTO A;  5BXR A;  4H75 A;  1BFG A;  3BAV A;  5B2H A;  3N7K A;  4WBC A;  1FMZ A;  1WD3 A;  3I2A A;  1S0E A;  3A07 A;  1S0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...