5F96H

Crystal structure of broadly neutralizing vh1-46 germline-derived cd4-binding site-directed antibody ch235.12 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
225
structure length
220
Chain Sequence
QVRLAQYGGGVKRLGATMTLSCVASGYTFNDYYIHWVRQAPGQGFELLGYIDPANGRPDYAGALRERLSFYRDKSMETLYMDLRSLRYDDTAMYYCVRNVGTAGSLLHYDHWGSGSPVIVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
total genus 44
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H01
1Q94A 1NCTA 2GUOA 1QRKA 2AQ1A 1X5LA 2QR0A 5CCKH 2EH7H 1BX2B 5EO0B 3SDAA 1CN4A 4UMGA 1NUNB 3LEVH 5LBSH 2YMXL 3CFJA 3ZYJA 4FFVC 5L9DH 5DJ0B 5GJTL 1M7DB 3ESUF 2IMMA 5TDPA 1YEJL 4HJJL 4KFZC 5LGHH 4HS6A 3DVFA 4PRPD 2XKNA 5I1GL 4QOKB 2FJFB 3ARUA 5T5FL 2QADC 3THMH 2NY5H 4MA7L 2ENSA 3T2QA 5E1AB 1FAIH 2MPAH 5EBWA 4PV8A 1B0RB 5FM4A 4KHXH 1F58H 4PJ8C 4G8IA 4NUGH 4QOKD 3SDCD 1HHIA 2VMFA 5E6IB 4XP9L 2CUIA 5DK2B 4QHNB 3WUWG 5FKPA 3FB5A 2X4OA 2Z93A 5KW9L 4WNQA 4MA3A 4NQVB 4NHUA 4L4VD 5HYJB 1N7MH 2IALB 3V2AR 5E6ID 1ZVHA 3JTSB 4M6NL 5ETUA 1QSFD 3BQUD 2ZCLH 3WFBH 2DMBA 2AEPL 3L7FA 2VC2H 3HE6A 3GM0A 1NAMH 4R26L 5HHNB 4UT7L 3CVHB 3DX9B 1CF8L 4LSVH 2HMIC 4BZ2L 5EU6D 4GRMB 1RJYA 3MXVH 1HSAA 3G6DL 1DLHB 3LIZL 4G8EA 4KKLD 1CD1A 1YY9D 4XCCL 4S0SD 1JFQL 3B9DA 4Z5RA 3GBML 4H88L 5HHNA 1JNNH 3KLSA 4PJGB 3I9GL 2PETA 4W4OC 3VDAA 4O00A 3JTSA 1J1OL 5J6GA 4PJ5D 1PKQB 3UAJD 3FAXA 2EE6A 3RVUD 3B3IB 4Q7DA 3RBGA 2NR6D 4PRPE 3V95A 3DJ9A 4GT7A 2QKIB 4KMTH 5K9OA 4I5BB 5DO2D 1RURH 3ARGA 1SEBB 4YE4H 1RZKL 5GS0L 2BRQA 5I16B 1XF5B 4LLVA 3MA9H 3RY6A 4RMVA 3UO1H 2FR4B 3BJLA 4U33A 1NH6A 1OAXL 1TITA 1XCTA 3IF1A 2FHCA 4Z7UA 2A77L 2VZ1A 2G9HB 3IFOA 4KJYA 2XPGB 2VXTH 2IANB 4ZUTA 1L7TH 1JHKH 3L1OL 1FVCA 1KGCE 1SBBA 4PJBB 3S5LB 4C59B 4PB0H 4U2YA 2IPKA 2VDQH 2QQNH 4U6YA 4C56D 3GSNL 4NQDE 4OUUB 3UDWC 4ORZC 1WC7B 1U6AH 2ZUQC 3VE0A 1E4XL 1IBGH 1UC6A 3UYRH 2VXUH 1OD7A 1S78D 3NN8A 4P3DB 5DDHB 5F8QC 3U7WH 2OTUB 5F7EH 3MLVL 1NEZA 2F54A 3S3PA 5C0JB 1UCBH 4PRIE 5DJYA 5EU6E 1VFAB 2DWEA 4HKBA 3OJVC 2H2PC 3KPOA 3LPWA 4FS0A 3PHOB 4OLXL 4PJXE 1U3HA 5L2KB 1NGXA 4X5LA 3OR7A 4CW1A 5T3ZH 1H3GA 1BFSA 4QTIH 1J5OH 3PDDA 1QFWH 1M1SA 2CIKB 5FYJH 3BISA 4NBYB 4R4ND 3U30B 4ALAL 5E8EB 1T0MB 1FVEB 3P0VL 1T21A 2AJVH 2Q7YB 3UYOD 4QWWC 5D7JA 5K59F 1VGEH 2GTZA 5KANG 3QUZD 3EJZC 4FQQA 5H8DA 5H35A 4R4BA 2WINB 3OHXA 4FFWD 1W0YT 4JM2F 4NHCH 4CAGA 5KN5A 4PJCF 3QPXH 3DX8B 3VFWA 3QQ3A 1MFDH 3WEXA 1PLGL 4KDTA 4L29B 3U46A 1JWMB 3B8YA 5FA4A 1FIEA 2FNBA 4WI9A 2D3VA 3SN6N 4X8JA 1HXYB 3QFJD 4J3OC 2B1AH 1MCPL 5B3JE 2YA0A 5EZOH 1F3DH 1WGOA 4KROD 5EU5A 4BM7A 3LQAL 2A6IB 2D4FA 1JPSL 4R8WL 5AWNH 1ETZA 1Q9KB 2EXWD 1EGJH 4BSVB 3S4SA 5ANMB 1YC7A 2E8YA 4BA8A 5H94A 3MJ7A 4JANB 3BKJH 4ZUUA 1GAFL 1BQLH 4Y1AE 1DQLL 4HBCL 4DVRL 3MRFB 3I2CL 2HT4D 4OCXH 4N90D 5BQ7A 4WFGE 4ZFGL 2EEBA 4XPAL 5BS0D 3PWPE 2HJLB 5CMAB 1NKOA 2VZSA 5DJDB 3WJJC 3MV9D 3TN0A 1D9KC 2DLFL 4N0UA 3B6SA 4IBLT 1EDQA 2ZUUA 4P23A 4M61A 3QUYC 4NSKB 2CD0A 2R0KH 3C2AH 2V9QA 4QHMB 4XMLL 1CTOA 5I18H 1KG0A 1QYGL 3OAYK 2D0GA 3I3BA 3QH3A 2X4PB 3NFSL 5F9DC 3C60B 1R3LA 3E6HA 1SM3H 5IVXA 3ZE1F 3ZKXB 1CG9B 3UPRA 2FZ3B 4P46D 2B2XH 1MAJA 4GAJL 1GGYA 4G6KH 4MA3B 1J8HE 4QNPF 3MFGB 3PWLA 4MLSA 1MWAL 4X99B 1QLEL 2ZG1A 1IC5H 3KXFB 5T1LB 3MLXH 3WL9B 1BJ1J 5C9KA 3VRIB 4RFEA 3CPLA 2ARJB 1AR1C 2X4QB 4M5ZL 4YNYA 4XXDA 1NMBH 1KJMB 1YNTA 1OWWA 3HB3D 3QWOA 5GRUL 5A2FA 3ZT7A 1B0RA 3TH3T 1KIRB 5DYOA 4GXVH 5MHSE 2GHWB 1WIPA 4FG6C 1EX0A 2QHLA 1H8SA 3FRPA 4NT6A 5I1HH 4RAHA 2HTKD 5GGUB 1IMHC 2DTML 4JFQB 3C9NA 3QA3A 4Z0BH 1LO3L 3KPPB 3BPCB 3DV4B 1T4KB 4LMQE 2R1WA 1C16A 1CD8A 3LEXA 4ZNEA 4EZMA 4KKBC 4GG8B 5TDPB 4HZLA 2IH3B 2ERJB 5E5MB 4O9HH 3HMWH 3SDYH 4BJLA 3EGSB 4B50A 3L5XL 3QDMB 3ZTNL 4RFNC 1WBYB 2O5XH 4OCRH 4YK4C 4O4YH 3TLRA 1S5HA 1LE9A 1XZ0A 3NTCH 3EYFB 1Z5LA 2X4NA 1RZJC 2EIBA 4NKIL 2EEDA 2X4SA 3VFRB 4JZJC 1H3WM 2Z8VC 4LPUA 4Y2DA 4O2EA 2JJWA 3EHBC 5DA0B 1V05A 2EDLA 4GKZB 5L2JA 1ND0A 2O5YH 3OKKB 4X7SL 4GG6B 4JCMA 3BMVA 1EXUB 4YHLL 2P4AB 3OV6A 1WZLA 4K7PL 5SX5H 4U6HA 5BMFL 2OL3A 1T2XA 1CDBA 3O4OC 3EAKA 5E2TL 4DN4H 3TJHC 4DJMA 3GKZA 2I07A 4XRCB 1G9ML 3UBXA 1G9MC 2X4TB 3KPPA 4EQ2A 2ZCKH 4MQSB 3SJVE 2AK1H 2X4UA 3FRPG 4U05A 3E1F1 4Z6AT 1D5MA 4P2RE 4AM0B 3SKMA 5IBLD 4PRHD 5F9JA 3TJHD 4P2YA 3GSQB 2NYYD 1EAPB 4CMHB 1NBZA 4Z95L 3SKJH 3U83A 3F7YB 3IU4H 4JKKA 3ROLA 1NBZB 1U2CA 4M8VA 4LF3B 4XPFH 1YEKL 2H6PB 3BWUC 1IC5L 2YR3A 1BBDH 3P11L 4LCWA 3PXHA 4WFHE 2F8OA 3WXVH 3OKNB 4UI2A 1SVZA 1INDH 3O6FB 2OTWA 2AV7B 5F1NB 3CFIC 1T1XB 2JJSA 5T1LD 4E0RA 3MRQB 1OW0A 4WY7L 3PWPB 3A6OA 4Z0XA 1R3JB 3QWQB 3VU2A 4BFIA 5BOZG 1BBJB 5AUMA 1X5FA 3D85D 1JGUH 3M1BA 1H3PL 3DVGB 3T0ED 3ZKMD 5EWIL 1AGEA 5CZXD 4KK5D 5INCA 2XWJB 4MGXA 3VFPB 3MRIB 1OAXH 2UY7A 5E5UB 1UQSB 5HDBE 2PR4L 1U8PB 4APQC 4J6RL 4F15B 3GMQA 1Z5LB 1KBGH 1NCDH 4NO2B 1QLFB 3HE6D 3PWUB 3RY6C 2ZG3A 3DO3A 4YHKL 5BS0B 3IETA 2VDPH 5GSRA 3C6LA 1FO0A 4L3EB 3D2UB 3WDIA 3BX7C 4L3CB 4I3GA 1C5CL 4NCC2 3MLYL 3GIVB 3CH1A 3CK0L 5JDSB 3O9WD 4MCZA 4RWYH 4ZYKB 4OZIF 1S9VB 1UH2A 4Q2ZA 4L8SA 3CH1B 4UBDC 5I19H 5J7CC 4XCFL 3LRSB 4G9FE 3E8UL 3QO0B 1JHTB 4OIIH 1JHLL 2HWZL 5I17B 5GGRY 1AI1H 2YKLH 2QADB 4IIQC 4NQCD 2Z92B 2KKQA 4H0GA 1TZHA 3SE8L 4PD4J 5FHBL 1CVRA 1MCHA 2X1XR 4N8VA 5HTSA 2A83A 4NQED 4LOUD 2ADIA 4PR5B 3KLDA 5HDQL 2HA1A 1G0DA 4PS4H 4HDIB 5A3IC 3U0PA 2UYLB 4JGUA 5C07A 3P0YH 3QWOB 1H3XA 1U8KB 1HINL 2R1YB 3VXUD 1FZJA 3U4BL 2VLKD 4RFEB 3SCMC 2Q76A 2DBLL 3FT3B 2Y23A 2HP4A 4U1GC 5I8CB 4PP1C 3DO7B 5GS1A 2DLHA 1NFDF 1U3HB 5L2KA 4PRHB 5DI8A 5SWZA 2DYPB 3FQRB 5CSGA 1CXIA 2VXUL 2M2DA 2BVUA 4PJIE 1KB5H 5JUEH 4G42B 2PCPA 1XR9A 1CLZL 1KENL 3PNWB 3CLFH 2N56A 4AEIL 4M1GH 4MWFB 1BFVL 1YJDH 4JZNB 4FQJH 5JZ7C 3KJ4B 3ZDYF 1J8HB 3P4LA 3QDMD 4PJDF 3VXSA 2YSSB 1Z0NA 3GSWB 5CEZE 1DDHA 1BD2E 4JFHD 2LVEA 4JPVH 2AEQH 3FO2B 6FABH 1Y6KR 4ZXBC 1R0AH 3MLTB 1MNUL 3GK8L 4OJFH 5I76B 2RCSH 2VABA 3EKCA 4ZUUB 3WIHL 1DQJB 1S7TA 3NAAH 1QO3B 2IADB 1HYRC 1T1ZB 3C08H 3LAFA 3VXNB 3QUKA 2A6DB 2HH0L 3UC0L 5B22A 3UXFA 4YR6A 4PP1D 2K7QA 5JXAL 2F53E 3ILQD 3QIWD 4FHBD 4YHOH 1SEBA 3I50L 5ADOH 1MCKA 1CGTA 3TJEH 4BYHA 3BYTA 1QBLH 3U36A 1XZ0B 2J3SA 3Q6GL 5TE6H 1AO7E 4XCCH 3GSXB 3G5VB 4Y4KD 4OD1L 5HHPB 1FV1B 2BCKB 5IM7A 2IADA 1NBYA 4WUKH 3W9DB 3MBEC 1FJ1A 5E9DB 1XGYL 3MOAL 3OAUL 3RVUC 1CI5A 4G9FA 3IS0X 1OSZB 2YPVH 3X17A 4D9LH 4OTXH 2YD2A 3SKUD 5GGTH 2VWEE 1YQVL 3REVA 3SGDI 4G8GD 3TGXA 1L0XA 2NY3D 4UT9L 4M8QA 3DV4A 3S96B 3C6SA 4BSWB 3GSWA 5GS0H 3G5YA 4UT7H 2MWCA 5IHUL 2VXVL 1T5XA 4GW4A 1J0KA 1NC2B 1MRDH 4Y5XB 4LPVA 2ZOLA 3SQOH 4UILH 4L4TD 3AB0B 4NKMB 1CLCA 1NDMA 3QDME 4XNZB 3RWFA 3BH9B 3O8XA 4NN5B 1K5NB 1Q72L 3EYOA 3MV9A 3O2DA 2FB4H 3A6BH 4D8PA 3VE0B 1FYTD 1HE7A 1JNLL 3KXFA 4G9DA 1GSMA 4YGVB 4PJCE 3BQUC 5D6DA 1YN6A 4G5ZH 2X70B 2PYFA 1U95A 3RNQA 5F3HA 3MJ9L 1U93A 4U7KA 3RL2A 4ENED 4W4OA 4TSAH 4NUGL 5CINH 5H2BA 4U1IA 4XP1L 3MRPA 1W72L 2IFFL 3D48R 2RFXA 3LEYL 1EUUA 2WBJA 4GBXD 3QP3A 5EO9A 5M7QA 1WFOA 3ARWA 3KJ6H 4PV8B 5DD3H 5A2JH 2N1KA 3MJ8B 4MJ5A 4L8DB 4XC3L 4OI9A 1MPAH 4PJ5A 3RX5A 4LLAA 4N8VB 1KT2B 4JQXA 4D9RE 2ZKHL 4U1JB 4FQLH 4LLVB 1PAMA 1CE1L 3ZTJG 3QUYA 2P5WB 2ZUXA 1T20B 3PGFL 2Z92A 3TO4C 2MKWA 5K9OB 3MJ9A 3HMXH 4FZ8L 1MELA 3C60C 4KUZL 4KK8C 5FGCB 4Y4FB 1FBIL 5DRWA 5KJRL 4OF8A 5DMJB 4C55A 4LCCC 3SDYL 1JZ3A 3S4SB 4UQ3A 4HGWA 4L3EA 1OLZA 3QHTC 1JWSA 4HUWB 5KZCD 4JGMA 1RHFA 2BK8A 4OLYH 3EYUL 3T08A 4HIJA 2G5RA 2ZUWA 3R06B 4ONHA 1GIGH 2VUYA 2I26N 1FN4B 1Z9LA 1CU4L 3NIDE 2JJUA 1CD1B 4HEME 1TZGH 1VPOL 2AABL 1SJEB 3WHXA 1AGCA 1PG7W 3U46B 2XZQH 1CDCA 4QO1A 3W0WB 3PQYB 2F15A 5F93C 4KTYA 4Z7VB 4WEUD 5D93C 1FFOA 3HI1A 4R97B 3O11B 4M4RA 1KUMA 3VXUA 1A3RH 1LEGA 43C9B 5KANI 5HI4C 1YMME 4BH8B 5J12B 3MREA 1LK2A 3S98A 1JK8B 1P7KA 2PXYA 4X6DE 3DVIA 4F33B 1BFOA 2E6QA 3EDFA 3MLTA 3HUJA 2DN7A 1N2RB 1OB1A 1G6RB 4LEXH 3WNMA 2DTMH 3RHWF 1ZANH 1K6QH 5DK2A 2DM7A 5MEQB 2EDXA 2IFGA 1NCDL 1KBGL 4L4TB 3RPKA 3O4OB 3ROLB 2F19L 4FQ1L 3CFKB 1JN6A 4WCYH 1NLBH 3AVEA 3NCCB 4X6BA 5ID0A 2AV1A 3ARTA 3NGBB 4ZAKD 1DBKH 4XPFL 2P5WE 4K3EL 5BVPL 1SVCP 3WLWD 5E8NB 1KJ2H 4ZTPL 5D7JD 3P2TA 5FUZL 43CAB 2Y4SA 4RRPA 1U42A 1C1EL 4FG6D 1KACB 1NC4B 3LVEA 1I1CA 3PWNA 3QNXA 1V7MH 2PO6B 4KRPB 1VACB 1DVFA 2WQ8A 3QDHA 2ORBL 2XKNB 1XIWB 1CR9L 4U1SA 5D1XD 3P73A 2DJ4A 4GRLC 4OUUA 1EIBA 4U6HB 1VCAA 2FH8A 4LCWD 3LZFL 5C0FA 1INEH 2C4FT 4H1LB 3KPRE 1QBMH 1ND0B 4L9LC 5L2JB 4ZFZA 4GKZA 5HYEA 1U3ZA 2WAHA 1HH6A 3O3EB 4KRPD 3TN0D 3HAEG 5ELIA 2VB5A 4OCYL 2JJTC 3G5VA 3GSXA 4XI5D 1QR1A 3RI5K 1HCVA 1KJ2B 2XI9A 1U8QA 3A67L 1UXSB 4NZRL 3HI6L 3L5IA 4KKNA 4X4MA 1Q0XL 3G6JA 5EBMB 2CLZA 4CU6A 5BV7L 3CXDH 5DEZA 3MRHB 1YPZA 3ZYZA 3OAYH 1F5WA 3CK0H 3CX2A 1T1WA 3FQUB 4MVBC 1XEDA 2LU3A 4Q2ZB 3SDDC 2BC4B 3KXFE 1W0WA 2IH3A 3C8KA 2BNQE 3CLEL 3IJSA 2XKSA 1K3IA 3TIEB 3GBMH 4H88H 1M05A 2ED9A 4NUJA 4Y4HA 3ABZA 4M62L 5D7IB 1TJIL 4M7ZB 4LLUB 2V7HA 2R1WB 2WIMA 5ERWB 2FSEB 3FO9B 4GLRH 2BVEA 2IGFL 2X2YA 4E5XA 4OLZH 3VFNB 5F7WC 3RZCD 5GRUH 1JF1A 1KIPB 4TRPL 4ZS6C 4AZ8A 4PYHA 1TJGL 4M00A 5K9KB 4HWZA 1BQHB 2NW2B 4H0IA 1QNZH 2X1PA 3K3QA 4FMFA 4LK4A 3TZVD 1AGEB 4LQFL 2VDKL 4PRBB 3P4MB 4Z7NE 1FSKB 1IL1A 2AS5M 4L8BB 2X05A 1I8IA 3OJMB 4PGBA 1A1NA 2HFEA 4P2OB 3RY4A 2CKBH 3PWJA 1KXVC 1RUQH 4MD0A 3RTQB 1YDPB 5C3TA 1KCKA 1N6QH 1PG7X 5K9QG 2Z93B 4P49A 2X4OB 4P4RB 4JFEA 1S7VA 1CLZH 3AREC 4FZEH 4MZ2A 1IC1A 4JFZL 3UX9B 4IMKA 1B4JL 4HLZG 1QLRB 1UKTA 2OZ4L 4P59H 2ADGA 2EKSA 4LHQB 3TA3B 5I75B 4G43A 4WI4A 1VFMA 4HIXH 3MCG1 1WV7T 1RZKH 4AM0A 3EO0A 1T1YB 2DQUL 3BKJL 1SYSB 3T2NH 3ZYIA 3QJHB 1XAUA 5DQ9B 4TPRL 3IFLH 3SGJA 4DN4L 4KV5E 4AT6A 4PRPA 3CD4A 3JV0A 4EUPH 3GMRB 3PQYD 4L8CB 1RHHA 4YXKL 4YLQT 1IT9H 1S9VA 4MXWL 4DEPB 4HKJA 4JQVA 4QYOA 1EPFA 3UTQB 5TDOB 2DQCL 4HT1H 4CVZA 4MMXC 5DEFB 3U7YL 4LVOC 4NP4H 4UDTB 1TFHA 3VI4E 1A4KB 2CLZB 1LO2L 2FX9L 3FFCA 2AJSH 5BS0A 2WK2A 4XGZB 3NH7H 1OOAA 4PJ5E 3KWWA 3NH7L 5EB9A 2OK0H 2AXJA 4LRNH 4P23C 3AXLA 2DM4A 3GSRB 1CU4H 5F21B 5C0EB 1ZVSA 4AMKL 1L6ZA 2EC9U 2HRPL 3ZL4L 1E6OH 1TQBC 1I9IH 2GI7A 4XPBL 1BPVA 4L4VA 3U4EA 1KTLA 4PJ9D 4PRIA 2CDFA 3L3OA 5HJ3B 1Q1JH 2DDQL 3CX5J 1QSFA 2F54E 3BQUA 3FHAA 3RTQC 4LBEB 4MAYD 4Z7OE 4JDZB 1NAKH 1OW0C 1T22A 1R0AL 2EO9A 3ZKSD 2FL5B 1D6EA 3WN5B 4JPVL 3QA3B 2DRUA 3WV0A 3CSYA 3BHBB 1N0XL 1RZJL 3KPQB 3P4OB 4R90L 4X7TB 4XP4H 5C0AA 3PGFH 5F88A 5IJVB 2W0KA 3MLWL 4GQ9L 3BJ91 4OZGA 1G7MB 1KTDA 4XP6H 3D85A 4PJHF 1EFXA 4FABL 1F4YH 4LF3A 3SGEI 2CO7B 2V17L 3CCHA 3OAZH 3BD3A 3E6FA 5IG7B 4ZUWB 3WS3A 1FHGA 4HIHB 3H8NA 4V1DE 3T1FA 4CVXA 4K7FA 2M26A 4CBPA 4WVRA 4WCYL 3WJLC 3KHOA 3GGWB 2EXYC 2Q8AL 3MRCA 4YZFE 1RJLB 1A6VL 4JY4A 2Q8BL 4WTZA 3IU4L 4Z7VF 4G3YL 1UENA 3NFSH 2BMKA 3O2DL 3T0VA 4GAGH 5ESAA 5JW3H 2R2BA 2DQGH 2MSPA 3D9AL 4GSDL 3QDJA 1Z2KA 1I3VA 1T7ZA 3NPZB 3OKKA 5LQBL 4M3JA 3O3AB 5CBAB 2I9LA 4JKMA 4Z18A 4L3EE 2BVPA 1NL0L 2Z35B 1YA5A 3RIAK 3DMMB 2XQYK 3H7BB 3RI5F 5BO1H 1QBBA 2J4WH 5DJZA 3LN4B 5DC0A 1I3UA 4R7NA 1KLFA 4JJ5A 4JY6B 1ZVYA 4ZPTB 3PDGA 3TV3L 3I6GA 1HXMB 4D9RD 1GGCL 3CH8A 3HZMA 2D0HA 4KRLB 3MNWA 1BOGA 4HUWA 3C09B 3TWCL 4S1RH 1V7NL 3KYOA 3HC3H 4P5TA 1AFVL 4BSVA 5C8JB 3KPNA 4KQ3L 4MNHA 4YHPA 5ILTL 1J0IA 1P69B 3HNTL 2MCG1 1F6AA 1UG9A 1UH4A 3SGKC 3KPSA 2ITCB 1A4JA 4LCUA 5CBEA 1JGEB 4MDJA 4Z7VE 3VXOA 1IQWH 3WDHA 1GJIA 1KCUH 1CGXA 4DOHB 1RSFA 1TVHA 4JFFB 3ARFD 3QAZB 4JPIB 2KBGA 5DS8A 1KT2A 4HC1H 3ZE2F 4R3SA 4P0DA 4G6ML 2Z91A 4QTHB 5SWQB 3QUMA 3DGCR 4LLUA 4JRWA 1MPAL 1FRGL 1H3PH 4HS8L 5IB3B 3CFDB 1V5JA 3H7LA 3MV8E 1WZMA 2AJYL 5CUSH 3W5MA 1S7RB 3G04B 5D2NC 3I6LE 3WIHH 3W2DL 1E0OB 1YPZF 4UU9B 3DI3B 2GSIA 9CGTA 3GB7A 1TNNA 1WCBA 4GW5B 1M7IB 4APQA 1CG9A 3BZEB 3DIFA 1UZ6E 4ZD3L 1P6AB 3AS0A 3BKMH 5ISZB 1LWRA 1KG0B 3PHSA 4LVHC 4NFDA 1BGXL 2HVJA 3QG6A 2F54B 2C3VA 5CEXB 5HYJD 3THML 1RULL 4RAVB 4KKCC 4IOIA 1QPXA 5FYKD 4M48L 5TQ0H 3K46A 1RVFH 1UH3A 1U58B 1DANU 3S96A 4QGTA 4P2CG 4YO0A 2PTTA 2BXZA 4HS6B 5DMIL 5DK0B 1SY6L 1W0VB 1CFNA 1S8DA 2J8UB 2X7LA 3MUGB 5DD5H 5F44A 4PJEB 1VFUA 3MJ7B 1CE6A 1T0NB 3BGAA 1W8NA 3O41A 2BCKA 43CAA 4TRPH 5HGBB 2A74A 3H9YA 3KG5A 1I7RA 4HCRA 1X5XA 3EYVB 1FL3A 3ECBA 3E3QC 3IT8D 3PP3K 4NQCA 5JQ6H 3WDJA 4UAOC 1RZ7H 4I5BA 1S7UA 3WJJA 1T7XA 2L0DA 5J1TC 4DKFH 3QNZA 2H26B 2VN4A 3VD3A 5J3HD 1PEZA 3GSNA 1OP5K 1A9EB 5D2LA 2ICWI 5E94A 3MRLB 2EC8A 4KMQA 3HMWL 3RFZC 3DXAA 1JF5A 1S3KH 3VA2C 4GRLA 3CFDA 3Q5TA 3U79A 3L5JA 4I0CC 1UM5H 1T0MA 4DGVL 5T1KA 3DXAB 3QQ4A 2DKMA 4OM1L 5MEND 4LAQH 5D6DC 1S7SA 4WU5A 3REWA 2JB5L 3V6BR 5DS8B 4DWHA 4P2QB 4RZCA 1U3YA 2VR4A 1FSKC 4H20L 1I8KB 3VFMB 4YDLB 4F7PA 1W72H 2IFFH 4R4FL 1H3UA 4AEHH 2GW5A 5KVDH 15C8H 4I4WB 4XC3H 4KTEH 4CUCA 2YC1A 4TPRH 5CBEB 3QIUA 5DJ6B 4UDUB 4QT5B 5FA3A 3ALWA 1RZJH 4R90H 4N0FB 4XNUL 3L3JA 1BD2D 4PP2B 5IW3A 2NW3A 3OKEA 3VGBA 1XFPA 4OF3A 1UWEH 3MNWB 4FNLH 1NCUA 4WWKD 1AQKL 3QXAB 2B20A 2DYPA 2VDLL 4YIQA 1XR8A 5JTWA 1HHJA 3W11D 4LNRB 4R9HA 5D1QA 3FFDA 4LCCA 2N7BA 4QRUA 3RWCA 4Z76A 5CWSA 3EO1B 2NZ9C 4U1JA 1E4XH 1XCTB 2WUCL 3BEVB 3PJSB 4NOFA 1MY7A 2R0WH 3QG6B 5EZLB 1E4WL 3HCVA 3IDGA 3QEUA 2UZIL 2WBJB 2Q86A 4RMTA 2PYEA 1A7OL 3BZEA 2IBZY 3IDJA 4DZBB 1REIA 2XY1A 4HH9B 4Y1AD 3HA0A 1HHGA 4J8RB 1XF3B 5KAQF 3IB4A 4K23H 3FCTA 3JWDC 3ZHDA 2X70A 1XGQB 3I02B 4I0PB 5L9DL 1I7ZA 2FWOB 2XTJB 3MQIA 5BO1L 3VMNA 3D6GA 4LSTH 2MNUA 4GRWB 5JHDE 5GIRA 3MRBB 1ITCA 4N0YL 4CADA 3PDOA 1XF2B 1ZA3B 1G7MA 1KTDB 4MJ4A 3QR2A 4Y19D 3EOYG 4X5WA 4M7JL 4M7JH 3MLZL 4K3EH 2PXYD 4PJIA 1R3IL 1Q72H 3DVNB 3FB6B 3SE3A 4X83A 3BHBA 1LEKB 5ESQB 5EOCL 2X10A 4PRNA 4RDQG 1RJYB 1G7LB 5L2KE 3ALPA 1A6ZA 1BP3B 3FJTA 4DKDC 5JPNA 5LWYH 2W0FB 3DROA 3DGGA 1DL7L 2Q8BH 2Z0BA 5B39A 3S88L 4C56B 3TT1L 1T80A 1PQZB 3MTRA 1NSNL 3GSOB 4GAGL 3LY6A 3PABB 1I4FB 2FX7H 4K3JL 4C58B 4LHUG 2VZVA 4MCYB 5DJAA 2YPKB 5I1CH 4JREB 5J12C 5CHNB 4WHDA 2AAVA 3CFBA 3K2UH 3OBAA 2NY0B 1QBML 4XPGL 3D1MC 4EXKA 1FYHB 2C3XA 3SCMB 3AU1A 3MYJB 1NLDH 2ZCLL 4JKWA 1D5XA 3Q3GA 3RZWA 1EZVY 5C2UB 1CFSA 1AQDB 1CFVH 5HHME 4PUBH 3HZKA 1A1MA 4S1QL 4EOWL 4OQTL 1RQ5A 3EYVA 4CVZB 2B8OT 1RJCA 2EDOA 2NY6B 3L6FB 4L1DA 3LB6C 5C9JA 3QXDB 4M93B 1P84K 2VIRB 2D7NA 4Y8DC 1DEDA 3BDBA 3SDXB 1WCQA 5TH2A 3O41B 4NKOA 2VL5B 4FQHA 1HSBA 3DX6B 1LP9E 5I1LA 1OP9A 3DARA 3PIQA 1A6PA 4NDMA 5B8CB 4FQHB 4TUOB 3NIDF 5CEZD 3LQZA 4X7DC 5CZXC 1X5YA 4KKLC 1D5IL 4IRZH 3V5HA 1EHNA 4XB7A 3VGHA 5DJXB 2CLRA 2BERA 1HH9A 2I60L 4WGVB 4G43B 1GH7A 4OGAD 4X80H 2WLYA 1QSED 5EUOA 3ULUH 4M6MH 2WLZA 1G9NL 3ULVD 1BEYL 5IIEA 1RIUL 3QAZC 4Z77B 5EBLA 1ZSDB 3GHBH 1TTUA 5F9OL 2GUOB 3FQXA 3TO4B 3FTGA 1QSVA 8CGTA 3Q1SL 3Q1SH 1RURL 3R1GH 4PJHE 2ILLA 3CFBB 4HFUL 3RVWD 5A2KH 4JY5L 3CSYB 5C0RL 1ZKAA 3RTQA 3VFOA 4GW5A 4MA1B 5IB2A 1A02N 3F62A 3F5WA 3RVTD 2JCCF 4YWGH 4MSWA 1AD9B 5E8PA 3CU7A 4KC3B 4YXLL 5AAWA 4YXKH 4F7MB 1IARB 3ZKNC 4LDLB 4PJBE 5D7IE 1A6TA 2IAMB 5GRVL 5DMKB 2ZCHH 4LLMA 1JNNL 4J1UB 2LE9A 1SEQL 3SPVB 3IDYC 4D0CB 5C07B 2YD1A 1U8MA 1U41A 5EDXA 3M17A 5HVHB 3ZT6A 1J05B 1EO5A 2P5EA 5GJSL 4PJIB 3TP4A 3AB0C 1F2QA 1V7ML 4XGZA 4HPYL 2P5EB 4WRLA 2FSEA 3FO9A 1PZ5B 2A1WH 1LE5A 5BJTA 1IGTA 3PDOB 1XF2A 2XA3A 3B2VH 4PJCA 1CT8A 1JGEA 2VH5L 4PGDB 5GPRA 2GKIA 1HEZB 4OZFB 4PJEF 5TDOA 3O2VL 1EMTL 4WI6A 1T66C 3WL9A 4ZYKA 1DUZA 1NBVL 1NMBL 1NBVH 3I02A 1VFOA 4LOUC 4ZDHB 5T3XD 1MI5B 2FEEL 2BNQA 3QI9B 1JVKA 3SOBH 1YYML 4WY7H 4ZSOB 3AC0A 3LHPH 1IGML 3MLRL 1QNZL 2EXYD 3WE6B 3VWJA 1YPZE 4MJ2A 1INQA 1TETH 3BUYA 1RK0A 2MCPH 1F3JA 4ZPTA 1R3LB 3MGTB 1WAAE 3MRDA 4KQ4L 5C09A 2X44D 5GGSY 4DTGH 1QYGH 4N0UB 2ZPKH 2XWJA 3EOTL 5ITFB 5D7LE 1TZGL 4YUEL 5DRZB 4I9WE 1UZ8B 2V5SA 1TCMA 1OGAB 4RCAA 4ZO9A 1NAMB 3GI9H 4PJ9A 4L8SC 1HKLL 3N50A 2CIIB 2IBBA 4YIQB 4RFNB 2WWKT 2ATKB 5KSVA 3JBG7 2P8PA 4FFYH 5AWNL 4R8WH 2A9NL 1FLTX 8FABA 3SDXA 4N0UE 2DQGL 2DI9A 1YZZA 1BIIB 5FA3B 3OF6D 3VXQB 3GEWB 3F7YA 2FEDC 1Z6JT 2ZOKA 4HWZB 2BHYA 4L4TA 3QRFM 2J8HA 4F7EA 1NCBL 1Y6MR 4YDIL 3GMPB 3X3GH 1EJ6A 3GBNL 1OB1B 2AEPH 4QXGL 2FLBT 4X7TA 2VLRD 1OL0A 1Q0YH 1O5DT 3NA9H 3GSUA 1KPVB 4OFIA 2IAMD 4WTWA 4QF1A 2YK1H 3WNKA 5FUOL 2D7PA 4HF5H 1M4KA 2HKFH 3WLBB 1FNFA 4MX7A 1G7QB 3WJLA 5HBBA 1IGCL 2GK0A 4F9LA 4QRQA 3BW9A 3OR7B 4CW1B 3ZDXE 3W39B 4OFYD 3V52H 4HH8A 1AGCB 2OJZH 3LKOA 5KOVC 4YZFF 1BLNB 4UB0H 3WSQL 1ITBB 1DBMH 3SO3C 3UJTL 1DBML 4XB8A 4Q6YA 5DJYB 3EYFA 1ZHLB 1H8NA 5L0QC 5HDOA 3MCKA 1V3JA 2DLTA 4LARL 4PJFA 4QWWD 4OCWH 1OT1A 1WBYA 4GRWE 2CPCA 1F8TL 3B9AA 5IB5A 4B7LA 35C8L 2XYCA 35C8H 4JREC 1BZ7B 3CC5B 1WSST 2CLRB 5IHUH 1E6JH 1QHPA 2N4IA 1WC7A 3HMXA 4HK3N 5IMMA 2H2SC 3P73B 5DO2C 2Q6WA 4AT6B 4RWHA 1AFVH 1ZOXA 4EN3D 1LO5B 3QFDB 4N9GB 4OCSL 4PBXA 1HSBB 2AVGA 2NY5C 5GS3A 3QNXB 4Z7UF 2P5WA 4ETYA 3HNTH 3KYKL 4OGXH 5BZDB 3EFDL 3QCVH 1ZLWH 2N7AA 3HCVB 1I1FA 4G7YH 4DAGL 4LDEB 2X9XA 2Q7NA 2OJEA 2ED8A 4D0BA 1IAOB 5BZWA 5BW7C 5FO8B 3MO1B 1BQUA 3EO1A 2RGSA 2O93L 1QLRA 2X1QA 3I75A 5J56B 3LS5L 3HR6A 2HT3D 2R4RH 4MNQA 2KL6A 3TPKA 4OF7A 4FQIH 4NC2B 5C6TH 3W5NA 4KMTL 2IC2A 3VG9C 1MHEA 2AI0H 3INUL 3L7EA 4HG4K 2EYRA 3SDDB 3STBA 3PGDA 2LAAA 3ARRA 4LSTL 4P2OA 3OKDB 4P3CH 1LEGB 2R15A 1YMMB 4YXHL 4P5KB 4JHWL 5DGQA 3V7AG 3BDYH 1DBAL 4IMLA 4RGOH 3DYPA 2CJUH 3IU3A 3R8BB 4X6FA 3C5ZD 1LGVA 2PO6D 2P5ED 3EOAB 1F11A 5JNYB 2APFA 2W38A 3HG1A 3QEQB 5EUOF 3H9SB 3I85A 3GMNB 4EI5D 4XNMA 4HWNA 5MEOA 5C0BA 5ITBL 5HHXL 5F7HA 3REVB 4LKCA 5L8LB 5IF0B 2NLJA 3CVIH 2OL3L 4KVNH 1I8LC 3BGMA 1KB5A 3TN0C 5H94B 5ETUB 3GMMA 1CQKA 3SO5A 3ARBD 3DI2B 3CLFL 2NY2B 4WO4C 4AENB 2EZ0D 4NHUB 5I2IA 1IC7H 2Q1EA 5FYKE 3GSNB 1QRND 4G6MH 1MHHA 4MNQB 3DMMA 1XF3A 4Z7QF 5F97E 3IDIA 1CGYA 2XKUA 2AXGA 5D7JC 1BVLB 4D94A 4Z7WB 2X41A 2XZAL 3VFWB 5FO9A 3N85L 4BQCA 4O5LH 1R5WB 3FT2A 4EEEA 3Q6FA 2GTZB 4JFXB 1IJ9A 3KGRA 3DECA 5BRZB 2NY2C 3MRNA 5A2IH 3KAAA 5DUBB 3L1OH 3X11B 4XVSL 4DW2L 1CDUA 3C5SB 5ISZE 3BP5B 4DKEH 4POZD 5T5FH 1KNOA 4Y5YA 4LSUH 4OCRL 3K8LA 4I3RL 1C5CH 1V3MA 4KJPC 1DFBL 2ERJC 5ID1A 4G6AC 4WU7A 3OKEB 4PFEA 1WF5A 3WNLA 5IVNA 2I27N 3HB3C 5EU3B 3L3JB 5CEXA 4M7KH 3DSFL 4HIXL 5EU3A 1OAKL 3QPQD 3R4DA 4P57B 1SHMA 4PGEA 2ICWJ 2VLRB 1YEFL 2CGRH 1J1PH 5DFVC 4M8QB 5EG6C 1J0YA 4F7PB 1P4LB 3SDDD 2CK0H 1ZLWK 4M5YH 5C0ND 3W39A 2VZOA 1KNOB 4Y5YB 5F9AC 1RU9L 5F9WC 1WIOA 4NWUH 4EUPG 2MCPL 4MA1C 4E41B 5FDWA 5E2UL 4QY8A 4M7LL 2E7BA 2C5DC 3U0TA 3HI5H 4XBEL 3O3DB 4QF1B 5BRZA 1BD2A 4OQTH 5C08D 4DCQA 3BZFB 2BNUA 2QJDA 1BJ8A 1YEEH 3QPXL 4R2GB 3OGCB 4MD4A 3QNZB 4PJDB 5C07E 3WD5L 4NWTH 2XRAH 3IFPA 4ZAKC 4MAYB 5EOQL 1S7QA 1L9MA 4TNVF 4X80L 4A2LA 2X09A 4OZHE 3MRGB 4WFFD 4G7VH 3G6AB 1GOGA 5D2LE 4HWEL 3F58H 3VXQA 3DBXA 3PP3H 2DMKA 3QUKB 3V8OA 4PJ9C 4U1GB 4U1KB 1IGFL 1IGYA 3S5LG 2PYED 2RHEA 3P3YA 4DVBA 4GLRI 1MCOH 4LSQL 3I2CH 3IAPA 2FJGA 5CP7A 4Y19A 4ETQA 5J0BA 1I1YB 2YD6A 4NRYA 5FV2A 4LVHB 1NC4D 4G8EB 4HWBA 3S35L 5B38G 1SQ2N 4ACPA 2NX5A 2VXVH 3U2SA 4NRZA 1P4BH 2GFBB 4GRMA 5KS9F 1ORQA 5E4EC 5D7KD 3VWJD 5CBAA 1NFKA 3P77B 1MFDL 3LSOB 1R24B 4I9WD 3S3JA 2GJ6A 4IRJB 2J6EH 1ZGLB 3OKDA 1WZKA 4RWYL 1R3JA 3L3IB 2VKXA 3T4AA 1HCFX 3E8UH 4NJ9L 3KPSE 4XAWL 1YMHA 2BOCB 2G5BA 1WEJH 3BGFB 1HWHB 4MXVF 1NSNH 3R0NA 4NYLA 2QLVB 1YN6B 2YZ8A 2C1OB 4NPYA 1FIGL 1T6WA 2RJMA 3MRRA 2WV3A 3NIFF 1R5VB 4OZFA 1SJVA 2X40A 4J3UA 5FUCC 4P46B 5IG7A 4GAYA 3LZFH 4NKMA 1CBVL 1EFXD 4K8RL 2WIIA 2YA2A 3GJEA 5IESH 1ONQB 2W9DH 5C7XH 1NC2A 2R8SL 1IGIH 1OP3K 5DGRA 1RUAH 4JGJA 3UC0H 4ZUVB 1FL6B 3OKMA 4K3GA 3RBSA 4NQEB 1GHFH 4OI8A 1BIHA 2P7TB 4UILL 4N90E 2V7NA 1UEMA 3P9MB 5F3BA 4L8SB 4WWID 4X0KA 3V4VL 4PRIB 4XMKH 4G9FB 2WUBL 3D69B 4NNXA 5JMOC 2F19H 1JNJA 4U6TA 4TNWK 2HKHH 1T7VA 5E03A 5IM7B 4JO3H 3D5OF 3H0TB 2XG4A 5GSRB 5I8KH 1LQSR 3A0OA 4BH7A 1UXSA 4LPTA 3GSVA 4AEIH 4X9BA 5ALBH 4M6OL 2FBJL 4S1SL 1X5JA 3TO4A 4PTTA 3LEYH 4M6AA 1XT5A 3RTQD 4X6DF 1A4KA 1BZQK 3KPRA 5J6HB 3GKWH 4JPKH 4KAQL 2DQDL 5IHLB 2JJSC 1J86A 3RU8H 4OZHB 4JR9H 1FE8H 4WUUD 5DF0A 4DVRH 3M1BB 3Q5OA 4UINL 4Q9CA 3LKNA 1QO3A 4NQDD 1PYWA 1T04A 3PWPA 3CFEB 2GJZA 4PUBL 1DN0B 4NQEA 2XACC 2VL5A 5KJRH 2V6HA 2ICES 2HH0H 1EUTA 3SDXF 1T1YA 2QSTA 4YHZH 3LD8B 1M71B 5D7LB 3ZHLA 2WMPA 3DXAE 5D1ZB 4K7FB 4HIIB 1RZKC 5DEGA 1NDGB 3ARFA 4XBGA 5AG9A 1DDHB 1TMCB 3BN3B 3LH2L 5JW4N 3J8F7 4UTAH 2VOTA 4ZOBA 3CCHB 3FHQA 3HE7C 2OP4H 4MWFA 4YK4B 2CLVA 1CGSL 1IM9B 4X6DA 1MOEA 4I77L 5F89A 4G42A 3HR5A 3SGDH 1V3KA 4IOFC 5C6TL 2IH1A 3IJHA 2YWYA 2GJZB 4PJ7A 2FO4B 4MCYA 1PFCA 4KXZH 4YEEA 2X9YA 3V0WH 3D18B 4U3XA 3O11A 2B4CC 2H3NA 5IHZA 3LQAC 4QHMA 5AZEH 4HIEA 3DGGB 4PRDA 2VDOL 1HHKA 5CLTA 1FO0L 5DVNA 2L7JA 3O45B 1B9ZA 1N5YH 4LVOB 2NY3B 3IXAA 4WV1B 3U4AA 2X4SB 2DI7A 2W60A 5KSUA 1N8ZB 3SQOL 5ICZB 2VRAA 3I6KB 5D7SH 3NCMA 1KPRA 2A6JB 3MRFA 5ERWA 1XF4A 2DWDA 2F5BL 2XA8L 4JDTH 5D1QC 2VWEC 4YDVA 5E7BA 3CVHH 4JZOB 1TVDA 4UDTA 5TJWK 2HTLC 5F7LB 4IDJL 4U3CA 4JLRA 1X6NA 4PGZA 4U49A 3DUUA 4XPTL 3WO4C 3NIGF 4DZ8A 3QG7H 4F2MA 1UXWB 5BVJB 3SE4A 3DUUB 1KV3A 1HEZA 5DWUL 3V7MA 3TO2A 2V7NB 2HWZH 3VFVA 3OMZA 4POUB 3UJIH 1MI5E 2FX7L 5BCAA 1AKJA 1JWMA 1SJHA 2NX5D 4P9MH 1NUGA 3OAUH 3BAEH 1KJ2A 4RA3A 2VLME 3LEVL 5LBSL 1K4CA 3BEVA 2CK0L 1N0XH 1DEEA 2EKSB 3TVMB 2W9DL 1U8OB 5E95B 5INCB 4JHAH 5FOBA 2EDEA 5DMKA 1AGBA 3F8UB 4LHUD 2J4WL 4J3VA 2D03L 3DETD 3QULA 1RPQA 5FK9A 5FCUH 3QUZC 4LGSB 5D1QB 3ARDA 5EPMA 1QFPA 3GZKA 3IDXH 1BBJA 1KCSL 4R6UA 5AUMB 4BFIB 4I0KA 3U4BH 4OZHF 3OKLA 1AXSA 4LKXB 2FO4A 4RMWA 4ZPVA 5FUOH 5EFIA 5BS0E 1IGJA 1VACA 3SBWC 4WENB 3UTPD 5BV7H 4XZUA 5F1NA 2OI9B 3RWFB 1I8IB 4PGBB 1JFQH 2AW2A 2NZ9D 1CFQB 4CL7A 5FKAB 2R69H 3MMEA 3FQXB 4HWBH 5DFVD 1E4WH 2OTUA 3LN5B 1FYTA 1JZ5A 4P9HL 4GS7B 4EKXA 4OFYA 2EYTB 1YJDL 4M6ML 3RUGF 2JIXD 1XGUB 3QIUC 5CCKL 5DD3L 4HFWA 3TBVA 4RIRB 1IGMH 3RRQA 1S7SB 4WU5B 2GTWA 3TV3H 1OSZA 1P7KB 2PXYB 1IGYB 1LK2B 3ULVF 3RWGA 4ZS6D 1A7QL 3ROOB 5IFAH 3TESA 1XF1A 4NKOB 4Y4HB 4GRWF 1RZIA 43C9A 4JFXA 2ZUQB 2ZG2A 3BVNA 3CSBA 1T1WB 3GRWA 1K8DA 5JXAH 3VFTA 5EIIA 1YEIL 2GY7B 4X4XA 1B6DA 5DTFB 4YUEH 3TYGL 4DK3A 1BQSA 3TYGH 5JO5A 4I1NB 1OTTD 1N6QL 2XXMB 1NLBL 3D2UD 4HMDA 3EFDH 5TGBB 1D5XB 2H2SD 2LU4A 1HYSD 2XN9D 2MPAL 3GMOB 1MJ8H 1G9EA 3CZFA 3GSVB 2BX5A 1U6AL 3CX5K 3V6OC 5KN5B 1KN4H 3ULUE 3HE7A 4RISL 4HIJB 1A7PH 3V4PL 1Q9WA 3H0TA 3L3DB 1T21B 1RZIB 3KVQA 4OLEA 2LFGA 2XN9B 5C0FB 2XICA 4XWOC 1UADC 3MV01 4HZLB 1WBZA 1XGUA 4NN7C 3F6IA 1BOYA 1J0HA 1P4LA 1LO4L 1RU9H 4KVCH 3RAJL 3VCLA 5DURD 3HPJB 4MJ6A 1G7HA 2AJZB 1OTSD 4NOBA 2W0PA 1ADQL 2NYYC 4NQXA 3QUYB 1W72B 3MRKA 5GGUA 1F6LL 2NY6D 2ICWB 4AEEA 1FC2D 1XR9B 4LEOB 3VXTA 1H5BA 2DBLH 1P5UA 2IPTL 4HUXB 1WJ3A 4BQ6A 5MI0B 4AIOA 5EFIB 4JO2H 1IFHH 5DD0H 4U2ZA 1MHEB 4NJ9H 2WP3T 4NPYB 1GOFA 3QDJD 1OQXA 5DJ2B 1A3LL 1XGTA 3VWKC 2UUDH 3KYMB 4CU7A 3OJ2C 2EDRA 3VGEA 1I9IL 3ZO0A 4H8WC 2HFTA 1M6OB 4NGHL 4GO6B 2VXSL 2Y07H 5IVXB 3JZ7A 2PYEB 1JGVL 4YHML 3I6LD 1I8MA 1SMAA 3LKPA 4BFEA 1BWMA 3QCUL 1INEL 1TZHB 1ORQB 2VDNH 1TVHB 5LVEA 3RWCB 3ARGB 3PG2A 4PJXA 3IDIB 4MJ6B 3HPJA 2A73A 2NX5B 3T3PE 3WKNA 3L9RB 4GG6F 3BIKB 4YPGA 3MLSH 5KVGH 2YPLB 1XR8B 3G5ZA 2ZP0T 2WP3O 1TTFA 5IBLC 4X5XB 3TVMD 3G5XA 4P5TB 5E0QA 5EU7C 1GPOL 4KRNA 1GPOH 2Q20A 2DQIH 2X1WL 4IDJH 3FO0H 3L95B 1A5FL 1GGBL 3ARQA 4I4WA 4LCIL 3OQ3B 3C6LD 5TGBA 5A1AA 2BSRB 1NMAH 1EHXA 1PKQE 3GI8H 2EKJA 5CEZH 4GFTB 5I1CL 1MFCH 1X4ZA 3B9KA 4JVPA 1FNSL 1PX4A 3REWB 1UEYA 3HE6B 2CR6A 1I8MB 2A6DA 4P5KA 1ZS8B 4IRSC 2D4DA 2YD7A 4FOMA 3VW3H 3AY4A 3WO3B 1Z3GH 4YXHH 3ULVH 1JGLH 2JJVA 5GRYA 3TNNA 4YDKL 5GZOD 3MC0A 3ROOA 5JLZA 2FD6L 4M5YL 5CJQH 1E27A 1T7WA 3VGDA 2EDKA 5LGKA 3RZCA 4J4PC 5FM5O 4OFVA 1Q38A 2YD8A 3PV6B 4P2OD 1JZ4A 5F96H 2CMRH 2O61A 1Q0XH 1UWGH 5FKPB 3SGJC 2ZSVA 1OF2B 4R2GC 5J06A 5SWSE 3IXTB 3T1FB 3K0WA 5FYJU 1AE6L 1JRHH 5HPOA 4UUJB 1K3ZA 3MO1A 4HXBH 3LN5A 1FL3B 5EBWB 4HIIA 3U1SH 1A3LH 2EDHA 1CFQA 2X4RB 1BIIA 4NQTA 3V5KB 4TVSa 4AJ0A 1GGTA 1UB6B 4NQXB 4EI5A 3EYQC 1WWBX 2JIXA 4XZUB 1CE6B 4HV8B 5EZOL 3UTSA 5JW5A 1E6OL 5DJ8B 2DM3A 4D0DA 3C8HA 2BP3A 4XAWH 4IHOB 1RJZB 5DA4A 1ZT7A 4PJGF 2AEQL 1LVEA 1N4XL 3GO1L 4NZTH 1FJ1B 3N9GH 3IFOB 1GVIA 1C8PA 3RHWK 4GAFB 2OTPA 4HDIA 4BK4A 2E6JA 5D9SA 1K4CB 2V5YA 1EK3A 3MRDB 2YN5A 4HC1A 2X4NB 2KZWA 2M1KA 1ZLVK 3V5DB 5FO9B 3V79C 5T3XH 1GOHA 4UOW1 5FAAA 2GEEA 5D4QA 4Q9RH 1IAKA 4YHZL 3BKML 2A77H 2DQFB 2VDRH 5FB8B 2D0FA 4NKQB 5I18L 4XMLH 3LB6D 2B4CH 3OGOE 1L4IA 5IQ7H 2GK0B 2MJWA 5BVJA 3NFNB 1XIWC 4JDVA 4R96A 3WIHA 4XNQB 4N0CC 5I2IB 1KC5L 3GIVA 2COQA 4YHIB 2F8XC 2XQBL 4BZ1L 1TZIA 2F8VA 3IGAB 1FO0B 1RUKH 3C6LB 5HGDB 3UTTE 5MERA 1XF4B 1MHPH 1ERNA 5C70A 4HFWB 3GRWH 1AR2A 4M5ZH 4RRPG 5IESL 4W6XB 2LTQC 3MCLL 1T03L 2HN7A 1C12B 2BVQA 1FCGA 4QRPA 4KK9D 2X89A 1ONQA 1YQVH 4XVUC 3N1MC 5GGTL 1Q9OB 4D0CA 3VXOB 4XHJC 2R39A 3S6CA 5SX4H 3GHEH 3PL6D 1ZTXL 4C57C 2IPUK 4OIBA 3PNWA 4KJWD 1MCWW 3DVGA 5E8OA 1CGUA 1Y18B 1YDPA 2WUBH 3KYOB 2VDKH 4PJFF 3ZDZE 2GIYA 5J1AA 1OCWL 1HXMA 4HUUA 1R6VA 3S36H 3FN3A 2DKSA 4XHQA 3ARPA 4HAFA 4PD4K 5GS2H 3VMPA 1YYLL 4K2UH 3O3UN 5IMLB 3DUSA 5IQ9A 3LH2H 4NQSB 1U8KA 5CZKA 4EDXA 2BJML 1U8OA 3VFUA 1C1EH 4I3SL 5GRJH 4M03A 4ONGH 5D7IF 3LQMA 3GSQA 4HAGA 4S1DD 3V5HB 1HILA 3OXRA 5ESAB 5F7EL 2FJGB 5F7YC 4Q6IC 1AKJB 1FFRA 1TJHH 1X4YA 1YNKH 2EO1A 3PIQB 3W2DH 1G7IA 3BEWA 3BT2H 1Q8MA 4LPXA 3HRZB 5CGTA 2E6PA 1FE8L 3LKNB 2YD4A 3RU8L 3GGWA 3V0WL 3MOQA 4F2MB 1Z3GL 2NXYC 3SOBL 3X14B 1KLUB 3L6FA 3V0VA 5F1KC 5FDYA 3HPLA 2VO5A 3MRGA 1I7TA 4ONFL 3O2WL 4L9DA 1AQDA 2GITB 3LOWA 1P9MC 3VFSA 3KR3H 4OLUL 3OZ9H 5D2NA 5I1EL 4O58H 5GGVY 3SDCC 3P0VH 1OP5H 4B7IA 1UB5A 4UT6H 3QISA 3OGCA 4MD4B 4WFGD 5TF0A 5JHDB 5LXGL 4UTAL 4K7PX 1A14L 1O7SA 4NO3A 4O2FB 3WXWL 4U1NA 4KXZI 3FZUD 4JFOB 4OFPA 1QSFB 3BQUB 3CUPB 1JJUA 4PJ7F 4OLWL 1VA9A 3I3EA 4LCYB 2XZCL 5L0QB 5JORA 1T3FA 3F58L 4K8RD 1EFQA 2Z31A 1ORSA 3VFOB 3IJHB 1FORH 2XTJE 1JZ6A 4Y5XC 3CXHK 2QSCL 4NZUH 4U6XA 4OGZA 2VAAA 2HAZA 3OKNA 1NQBA 3PL6B 4NT6B 3RVVC 1HI6A 1PSKH 4TVPL 3FFCB 5C86A 5EUKA 2H2PD 4LLDA 1KN2L 2FX9H 5GIRB 5GJTH 2EDFA 3PQYE 5GGVH 3CFKA 5GQBA 2DIBA 4XBGB 1LNUB 4Y16A 2LTQB 4OGXL 1KPUB 1E4KC 2DICA 4PTUA 5I73C 3HN3A 2WUCH 1KB9J 4ZO8A 4PRPB 2P8PB 1A6VH 5I1JL 1DN0A 5I1LB 3ZE1E 5HYSA 5CINL 3ARSA 5IP4A 3QG7L 2F74B 1QA9A 5J11B 3BO8B 3MNZA 4HHAA 1P7QA 1EXUA 2ZZUT 4JM2A 5GGSB 2YBRB 3V6OA 5CEZL 2P1YA 5F1IA 3SKNA 1MHPL 1XF5A 3BUTA 4G6FD 4JPKL 4KAQH 4K71C 2GFBA 2VISB 1IC4L 1RV6X 3DV6B 5EO1A 4MVBD 1URLA 2RR3A 3QZWB 3L95A 1KFAH 4DGYH 2ZUVA 1CDJA 4LCWE 3QXAA 4O51A 4PG2C 3RIFK 1D6VL 3JVGC 4PJDE 3KS0J 4YEFA 4OUOA 2R0LL 1SM3L 5E5RB 3ULUF 2VR5A 3S37H 1ZK9A 5HHXH 4Z95H 4PJHA 4MXVE 5DJ6A 5KAQG 4EXPX 2F5BH 2CXKA 2FATH 5C0BB 4PB9L 1PEWA 1F4WL 4ENEC 3WMSA 4B41A 4U1MA 4XCFH 1JGDB 2BFVH 3C9NB 3RNKA 5L2KD 4L29A 3X3FL 4PJ8A 1A9BB 4M1GL 2V9RA 1BAFH 4PLJC 1X5HA 4E5XB 4GRLD 1LDPH 5C0IB 3M8OL 1KCUL 1G6RH 4KKAC 4OKDA 1BEYH 1ZA3A 2BNUB 2DB8A 5MENA 3IGAA 1ZMYA 2Z8SA 1MRCL 4OGAC 5F1OB 1UACL 3MXWH 5I8EA 3U0TB 3ZKXC 3VRLF 5E9DD 2EYRB 1NAKL 2ARJA 2X4QA 1I7ZB 2FWOA 4XX1E 4UOW0 4I0PA 4N68A 1BVKA 3G9VA 5HHQA 4LSQH 3D0LB 2PYFB 3MRHA 4ELMF 3RUGE 4KU1A 5AYUH 4LP5A 5F6IB 4HS3B 4UQ2B 4D8PB 3HZYB 1S7WB 3D25B 1VADA 5D1XC 5CGMA 4OB5L 2OR8A 1I1AC 3GBNH 3L3IA 3K1DA 3QFJB 4KV5F 2B0SH 1QOKA 1C08A 5ACZA 5JXED 3N1PC 4JQIL 3U0WL 3BH9A 2P47B 3O8XB 1H5BB 2X4PA 1FCCA 4LEOA 5I1GH 3TH4T 1S9WA 4JO4H 2GJ6B 1CXLA 2ZOLB 5IJKC 2FH6A 4YX2H 1VFBA 4ZFFA 1RK1A 1BJMA 2CO6B 3RGVA 4ZOAA 5E08H 3RPIB 1K4DA 4FZEL 2Y06H 3OAZK 3SDCB 1U8LB 4LCCB 1G9NH 4NC1E 2OSLB 1WT5C 2VNCA 3AAZA 4WJ5B 1RJZA 3T0AA 1QKZH 2XG5A 3QXVA 3SO3B 5CAYB 1MFAL 5DVOA 1CCZA 3RJDA 2XNAB 4H5SA 3BI9X 5DJ8A 3CC5A 4PJBA 4N8CH 3X11A 4JN2A 1JYWA 1NC4A 3W9DA 1CLOH 1NBYB 5CD5D 4WEBH 3IRZA 4FQPA 4LARH 4MNGB 5C92A 4RAVA 2Z31C 1NGQH 1X5IA 3VH8G 3MCKB 3T4YB 3IKCA 5CJXC 4EI6B 1O7VA 1MCEA 4OLXH 5CLWA 4G9FD 2PTVA 4X8JB 5E00B 4OGYL 2ATPB 3HZYA 1FPTL 2O61B 2RAMA 4LASH 1JUFB 2K7PA 1K6QL 1WVZA 2KQMA 3WUWB 3T8XB 4FQCL 3S36L 2DQJL 3T3ME 1E4KA 1ED3A 3C2SA 1DVFD 4GMTH 1MY5A 5F7NC 1DQQB 2RQ8A 3ARDD 2OMBA 2OL3H 2CXGA 2MQ3A 3LD8C 1Y0LA 5F6IC 3F6LA 1S3KL 3ZL4H 2VQUA 3FO1A 1EEUA 1I9JL 1ZHKA 5LAXB 4JN1L 4R2GD 1JIBA 2W0FA 3L3GA 1XGYH 3MOAH 1PY4A 4NO0D 3OX8B 5C09E 1MH5A 3VI4F 5MI0C 4TSBH 4F9PC 2ZOKB 2Y9RT 5L88H 4MDJB 1ZA6A 1V3LA 5T1MB 1FN4A 1ZTXH 1FO0H 4PRID 2EEAA 4FTVB 1FP5A 1T89A 1UVQB 1HHHB 5DRXA 3WFEH 2PCPB 3VXRE 4JRXA 4I13B 8FABB 3TYFB 4N0YH 4Z7QE 4ZPVB 3I6GB 1RZ8A 3VI3E 5GS1B 5I8CA 4JAMB 1J10A 5EPMB 3GDBA 2BSED 4WWKC 3JTTA 5CJBA 2B4CL 4Q9QH 3DV6A 1N6UA 2VDRL 3NCYS 4QXTA 5I1KL 5I71B 3RPIA 4KMLB 4GXUM 3RWJB 2Q86B 3M45A 5LXGH 4PPTA 3TVMA 5I0ZA 3MODL 1DEEB 5J13C 4KY1H 3MLUH 4IRJD 1K2DB 5HHOE 2A2QT 5J4MA 4KI5C 4RSVA 4U1HA 5DC4B 5HSFA 1MLCA 3RX8A 1XH3A 2AGJL 2BOBB 1RAMA 1LO5A 1X5KA 4N9GA 2NXZD 1CIUA 1XGTB 4X9GA 2BNQB 4JAMA 2WBWB 4P99A 2FDBP 5HHQB 5IVXF 3RUGB 4IRSA 5KSBB 2AK4E 4DZ8B 4KRPC 4KK5C 2IQAB 4Z7WE 1JRHI 1KEGH 4KI1A 2A6KA 5IB5B 4S2SB 4L3CA 2NXZC 5ESVB 4JRXB 4NM4H 3VXTB 1EFXB 1OM3L 1AXIB 1HNFA 3P4NA 4KI5D 4Y5XA 3D39B 5DT1L 2A6JA 5DT1H 3P9WB 3VGFA 1NPUA 1FQ9C 2NY1D 5C0AB 2KPNA 4Q9RL 1AC6A 1HSAB 4GOSA 2A0LC 3OR6A 1S7XA 2D2OA 1F11B 4GRWH 3EOAA 3ARBA 2GAZB 2Z31B 2XZZA 4G7YL 2E7MA 2W92A 3IU3B 5I1JH 3BW9B 3QCVL 3FRUB 5HHOD 4F58H 1UM5L 5E4IA 2DM2A 4M62H 3L7FB 3PL6C 4GKNA 1MREL 4PGCB 5E4EB 2VLLA 2ADJB 4CVWA 1AO7D 4AYFA 1FNEA 5DJCB 3SDAD 5I73B 3L3DA 5TPWH 3PGDB 3LQAH 3BOVA 2KQNA 4S11A 3GSUB 1R3HB 5C0EA 5I74C 3UP1A 4KKBD 4UV7H 1UYWH 1UYWL 1CFTB 4WI3A 2R2CA 4RX4A 1UB5B 4X7FC 1P9MA 3FB5B 4FQIL 3DPBA 3QXTA 4LPYA 4OM0H 5JOFB 4G8GE 3LMJH 1QR4A 5KSAC 2I25N 3QIBA 1WITA 1K85A 2NPLX 3HPLB 4YR6B 3IKCB 3VFGL 1HH9B 3Q2CA 5HYFA 4QRRB 5KTEH 3G6JE 3E2HC 2A74B 4JJHA 2BNRA 1I85C 4TYUA 2P49B 4APQD 2PN5A 1G7IB 3BEWB 2D9QB 2W9EL 3PWVA 4PG2A 4Y16D 5DK0A 4JRYE 4WO4A 1M7DA 2NZIA 3QIWC 1UM4H 5DMIH 4OF6A 4OZFG 1X5GA 3GHBL 4Y2DB 5IQ9B 4UBDD 4S1DC 4Y4HD 5ALBL 3ARGC 1GGIL 1JPTH 4OZGB 1HI6B 1S7VB 5ISZA 3BZ4A 4YFEA 3QQ9C 4JO1H 4N8PA 1CFTA 4LHUA 3KJ6L 5TE7L 1HDMB 4KZEL 4C4KO 2ESVD 3B9KD 4Y16C 3BT2L 1G9NC 1RIHL 4UU9A 3FMGH 1I4FA 3K4AA 1WTLA 3ARDB 1E28B 3CDFA 3V4VH 3DXAD 5HJ3A 3L3OB 2CDFB 4XVUD 1DUZB 1JTTA 2R0LH 4NQUA 1IL1B 4V2CB 3VG0L 3W81A 3GJFA 3MBED 3H6JA 5EC1A 5B39B 1U2HA 3TZVA 4W70A 4ODHL 3CVIL 3U9UA 4F57L 5JPMB 5F7UA 1JZ2A 4XMKL 2VUOA 4MA7H 4KJWC 1EHAA 5AZ2H 4YBLC 1LE5B 2LABA 4QRPB 1XGRB 4NBZB 5C0IA 3NACH 5M95B 4JFZH 1ODAA 4Y4KB 2NY7H 4HC1L 5HHOB 3VH8A 2WIIB 1QQDB 5BXFA 3DETC 3BP6B 1JHTA 3WNNA 2HG5A 3TO2B 5AAMA 1U92B 5D1ZC 1I75A 3ZYOA 1W0WB 2MTPA 3GJFB 5MHSD 3MROB 1B2WH 1RHHB 2JCCA 1AGDB 1OGTB 4BQ9A 4JFDA 5SWZE 2EICA 4HQQH 1KLGA 4DN3L 3PWLB 12E8L 2DTSA 3LHPL 5DUPL 1YMHB 2BOCA 3BMWA 2VJXA 5F7DB 3MA9L 1JPFB 2YOCA 3IDJB 2B0SL 4DZBA 2SEBA 3EO0B 4OZGE 1U8QB 4LLQB 3GMQB 4PG9A 4EN3B 4P2RA 1FFPB 1P1ZB 4F9LC 3TT3L 3VXME 1IM3A 5CJOH 1W2KT 3SJVA 1HHKB 3SQBA 3HE7D 4LRIC 1WUNT 3C6LC 4P4RA 5HYIA 4OCNC 5D1QD 1EA9C 5H37H 1DBKL 5BQ7B 4WHTA 3BUYB 3HC4L 1LDPL 5J1AB 4LU5L 5C1MB 4E0RB 3MV7E 4RMQA 3FONA 4F37F 1CICA 3BN9C 4U31A 1NC2D 3N1GC 3BH8A 2NY2D 4Y4KC 1YYMH 4PTUB 5GGTA 4DUVA 3MLPA 4OT1L 4ZMAT 2Y72A 4OT1H 5B4MD 1FC1A 5I66B 1S9KC 4X6CE 2YC1B 1VERA 1JPST 1HYSC 4MNQD 1JNHA 1Q9OA 4A6YA 5JIKA 1L7IL 2AJVL 2X89D 3OX8A 1CF8H 4LSVL 4C56E 2Z31D 5T3XE 1OPGL 2YRLA 4UV4H 4YFLI 5A2LH 2VAAB 1Q9LA 1J05A 4U7SA 1AH1A 2V5MA 2X4TA 2EDTA 3O2WH 4MMZC 1YEJH 4ODXA 1MQKH 4YX2L 4BK5A 3CSGA 1A6WH 3V4UH 5GS1C 4Q9QL 4JO4L 3NVQA 4RGNE 4WTXA 3AUVA 3K74B 2AQ2A 2BC4A 4LP4A 3T8XA 3PHQA 4AMKH 3NFNA 5LWYL 3GFUA 1TPXB 2CDGB 4OZIE 3CUPA 1AD9A 2W9EH 4CMMB 1AC0A 4DKAA 4KVNL 3MV7D 1P2CA 3EZ8A 1X44A 3NCJL 1ZVSB 1MCPH 1YEDA 3VMOA 4EI5C 2EYSA 3U7WL 1EZVX 4C83B 5CJXA 1F58L 1LEKA 3SY0B 2AEWA 15C8L 5IR1A 4IOSD 5BV7B 1AI1L 1U3HC 3TVMC 1QEWB 4JHZA 3T65B 2C3HA 4N8VG 4OLVL 1CLYL 3ZT5A 4DN3H 1CBVH 3QIBD 3C60D 3LKRB 3QCTH 4XAKE 5FHBH 4O2CA 4IJ3C 4XCNB 1JWSB 1H0DB 2YPVL 1NLDL 2M8XA 1NEUA 1TQBB 3NN8B 3EGSA 4OM0L 4P3DA 5DDHA 5GGQH 4AIZA 1JGLL 1YUHB 4XPHL 1EEYA 4HKJB 1IZKA 3DSNA 3QEGL 3S37L 3ILPA 3W9EB 4BKLB 4IHOA 1XGQA 2VDML 2P48B 3C5SA 5KSAB 4Q9BA 3S97C 1DVFB 2FATL 2DS4A 5IV2B 3DX6A 4KDTC 5CSZA 2JIXB 4HH9A 1MLCB 3AS3A 3QB7C 4ZUTB 1QSEB 1CTNA 4LFHG 4TQEH 4N5UA 4XXCA 5E8DL 2X4RA 4XBPB 4K3HA 3S35X 3MGOA 2HTLD 1S9WB 4ZTPH 4XNYH 2RFXB 3RWJA 1FG2A 1MRFH 2WWKO 1MF2L 1YNTB 2JE8A 3WKML 4NQSA 2DMCA 4WDIB 4QRUB 1QLEH 1T03H 1FLRL 5ADPH 1NCWL 4ODUB 3NCYP 2JLLA 2NTFA 3QIUD 5MP6H 3DRQB 5GZND 4OZ4A 5T3ZD 3JWOC 3VXSE 4BQBA 5HYQB 2MKLC 4X99A 3JV5A 4ZNCD 5DQJA 4WI7A 1JK8A 2QSQA 4MJIB 4PY8I 4OCLC 2O26U 2FLRT 5AZEL 1DJSA 1L7IH 5TQ2H 3G08A 2C7UB 4P2QE 3LPFA 2ZNWA 2O5YL 4X7SH 4HJJH 5DRXB 4ZODA 5HYJE 5IVOA 4YWGL 1OP3H 1FFOB 2DBJA 3RZCC 2V17H 4UDUA 2Z8WC 1OCWH 5IUSA 1IAIM 3X3GL 2D7TL 4XNMB 3GMNA 5MEOB 1JWUA 5B38A 3E0GA 4X4YA 5CMAA 2HKHL 2DQHH 3O6MH 4M1DH 4X4YB 2HVKA 4BQ8A 3NBNA 1F3RB 2VQ1A 3DX9A 3KPSB 2E7LA 1XCQA 2BVOA 5IK3A 1KEMH 3FQTB 1Y0LB 5F7MC 1A6AA 4WWKB 4YHNB 5C8JA 1KULA 3K81A 3VGGA 4IMKC 4S2SA 3HAEA 1Q9KA 3DRTA 5IFJB 2NY4D 3IDNA 3L7EB 3QUML 4MNGE 4JFHE 5E94B 1OAKH 5JOEA 5EU5B 2YPLE 1EO7A 3QZWA 1HIML 4PJFE 3K2MC 3ES6A 4Q6IA 3LV3A 5DHVB 3T3PF 3UPCA 1ADQH 3C5JA 2CRMA 2NCMA 3MGOB 3KPMA 4GMSH 4R4BB 1MCRA 3EHBD 1KJVA 4PJ7E 1QA9B 1T1ZA 4RMSA 1R3KA 4KQ4H 1FVEA 2DAVA 2XN9E 5E8EA 2I5YL 4U0RC 1MIMH 5FDWB 4E41A 5KSAD 5IV2A 3RL2B 4GMTL 4ERSL 1BWWA 1EAJA 4NNPL 4FQCH 1MCBA 4FQ2H 4LNRA 3ZE2E 3JV4A 3A6CL 5DR5L 3AAZB 4JCLA 4JHBA 5IB4B 3GI9L 3PV7A 1INDL 3NACL 1C5DB 3CVHL 1S9YA 5ADPL 1VEPA 1K4DB 1UB6A 1B0GA 1A47A 4BUHA 5DZNA 2YPLD 4PYGA 3MMEB 4L9LB 4JB9L 5JIIA 3T0EA 3UAJC 3QIUB 1TVBA 3PL6A 1JV5A 1U91A 1N59A 1OQOA 3ARVA 2ID5A 2ZSWA 5IGXH 2FJHB 4JFYB 1G7HB 2AJZA 5JQ6L 5ALCL 5HGHA 4C54A 1VGKB 3P0GB 4LBEA 1LEIB 4XNUH 4YGAB 2AJYH 1F3DJ 4HUKB 1AGFB 5E2WL 3FB8A 5KVGL 4X6CB 4E42A 3VRLE 1QTYT 4OFDA 5T3XL 4HKZB 5E9DA 5TFSH 2CSPA 4UV4L 2IQ9H 3DNKA 2BHUA 2IANA 5KTEL 1F4HA 4KUZH 4LPCA 3L3KA 4NQDB 1L7TL 2JF1A 2VDMH 1CL7L 1I9EA 3EW3B 1A22B 4FMKA 5LKNA 1QFUH 4PLNC 1MVFA 5EC2B 5JOPE 2XOTA 3VXRD 3CZFB 2MQCA 5EU4A 3MLUL 2OP4L 2VERN 3CAFA 5ACMA 5I16A 4XXCC 4HK0B 1KF9B 3CZJA 3LRGA 5EZJB 1FNAA 4Y1AA 1U0QA 2VITB 1S5IH 3TCLB 2R0WL 2VLKB 4M93C 5CJ5A 4QHLB 1D5IH 4LU5H 4ISVA 1AR1D 3TA3C 5EA0H 1GYAA 3G6JF 3GI8L 4MNHB 4YHPB 3M07A 5J6GB 3X12B 2DL2A 3HRZA 1QZ1A 4ORGA 3RWIB 3RVTC 1LILA 2CH8A 1CVSC 1HINH 1EGJL 1GC1L 2XNAA 2Q3ZA 1CICC 4YHYB 4U6VL 4PREA 1P4IL 1ZXQA 5C0RH 1UWGL 3WO4B 2UVFA 3ELAT 1JPGA 4XC1H 1C7TA 1GZQA 1NFIB 1ZLSH 1J8HA 5D1XB 3HG1E 4NHCL 4Y0GA 1LO2H 2ICEA 4EVNB 4PRDB 4ZAKB 2J8UE 2C3VB 5CFHA 2F58H 3KYKH 3OG4B 2E5EA 1ZLUH 2XRAL 4DKEL 1BGXH 1WZ1L 4LIQE 1RFDL 3P9LA 2IBZX 5F7DA 3TFKC 3QNYA 5DWUH 1X9QA 2GSIB 3F7PC 5FGCE 5HHVH 1RJLA 1XIWD 5F3HB 4XP9H 2VSCA 2A0LD 3DRQA 1AGDA 1OGTA 5E8OB 3FT3A 4RX4D 1KPUA 2LVCA 5KW9H 3O6FD 5HGAA 2VE6B 3B2VL 4OD1H 3BRGC 2R1YA 2VTFA 2XTLA 5I8EB 4CVUA 5ALCH 4LVEA 3VXUE 1NDMB 2UYLA 5SX5K 3D85B 1CLOL 3C87A 5D1ZA 3P40A 1FFNB 2XV6B 1MSPA 4OZIA 1JMZA 3U30C 4U0QB 5B3NA 3VFGH 4NCC1 5IVXE 5EOCJ 3QUZA 4U6XB 3HG1D 1F2XK 2AXFA 3QYCA 4Q58C 5HGDA 4NM4L 2VDOH 1D6EB 3ZDYE 4OFKA 3UBXB 4F80A 5KBNC 4LSPH 3TIEA 3SBWA 1PBYA 4RNRB 3B2UD 5FHAL 2Y06L 4X4ME 4F3FB 3ULSA 5IW1A 5GISH 3PGCB 1AE6H 5ITBH 1BF2A 5FYJD 5CILH 1YUHA 5DLMH 1B3JA 1I85A 4JFFE 3I9GH 4PJAB 4ZFOA 1BOGB 4TTGA 1YEKH 5I9QC 4HBQA 4K94C 4O51B 5IWLA 4KJQC 4QXUL 2DWDB 1WFTA 4GKSB 4HWUA 2P46B 4NO3B 4NKDB 3WIFB 3HE7B 1LO0L 4S0TD 1HDMA 3T65A 2VXSH 3PWUA 4H26B 4NGHH 3OF6A 4RAUB 1WT5A 4EN3C 3BP7A 5J11C 1MFCL 2BDNL 1NFDA 4IDLA 4N1EA 1RIUH 2BVPB 4K8RC 3IXAB 4WV1A 2IGFH 2DJSA 3WNPA 1MCDA 1MJJA 1XMWA 2VLJB 1HH6B 3O3EA 4CMMA 1HIMH 5F1IB 3SKNB 5DEFA 1HQ4A 3WFBL 4HKXA 4KROC 4H1LA 5DJXA 5C0CE 1TCRA 3FKUS 3MNZB 1B88A 2Z9TA 5FEBA 1MCOL 3VXNA 3VG0H 4U1SB 3RL1B 2BMKB 4QGYA 4XAKD 3O8XD 3LEXB 3S35H 3FMGL 1C16B 5T1DH 2P24B 1NMCC 1QSZA 4PLOB 2BNRB 4JG1L 1Q9LB 4DTGL 4JRYD 3KLAB 3OXRB 1UJ3B 3FO2A 1ACYH 4NBXB 3UTZB 1FDLH 3EDKA 4LSUL 2EIEA 5DRNA 1BBDL 3CIQA 3UTSD 4UUJA 5D70L 4HK3J 1KJMA 4YJZL 4L5FH 4L5FL 5DRNB 4HX1A 2HJKA 2ARWA 4X6EB 3DX7B 2YXMA 5DSCA 1AHWC 4FQJL 4KDVA 2RBLA 4K9EC 4OBSA 5KVDL 4AEHL 4TSAL 1A7PL 3L3HB 3HUJB 1EV2E 1LP9F 3FOMB 3UJIL 4MB3A 3V6ZB 2VH5H 1FNSH 4Z78B 3QSKB 2FX8H 3TNNB 3GO1H 4NZTL 2I9TA 1VKXA 1Y18A 1MJUL 5AG8A 3BKCL 4NC0B 3PABA 2OLDA 5JHDD 2F54D 5A3ID 4J7RA 1BECA 1K9TA 5DMGC 5JXEA 5E6IC 4Z7VA 3NPSB 1DQMH 4MS8D 2J88H 3OPZL 5HXMA 3P30H 2BNQD 3GSRA 1P4IH 1JF1B 1KIPA 3AMLA 5FCUL 4EDWL 2HN7B 2HMID 3DVNA 3LS4L 1MEXL 3TT3H 1CZ8H 3N0PB 3TIDB 2SEBB 2UY6A 1ZANL 3UTSE 1YN7A 5E8DH 4FXKA 3X13B 5TE4H 1J18A 2G75B 4HF5L 3TBSA 3RGVC 3VD5A 5FECA 4NNPH 2Y7QA 3UZVB 4RA0C 5C09D 3BSZH 3X12A 4V2BA 4JFDB 4FP8L 2X9WA 3E2HB 4CGTA 4F3FA 5FYJE 3BXNB 2GT9A 5AD0B 4YPGB 1U92A 2QEJA 4P48A 5DD1H 4Y89A 2X42A 5DD5L 5B8CC 1RZFH 4OD2A 4M1CC 5F9OH 4E41E 2VZ3A 3TCLA 1T4KA 1ZHNB 2VR9A 5EBMA 1FZKB 1L6XA 2V2XB 4K23L 1T7YA 2MHAA 4Y4KA 3KDMA 1IEBA 3DX8A 2AKRB 4URTB 2AI0L 4OLVH 2O5ZH 3Q0HA 5CD3B 3MJ8A 5CEYA 3T0EC 5L8JB 2QSCH 4NZUL 1AY1H 2GSGA 1PY9A 3MRIA 5L7XL 2PR4H 5CP3H 4MJID 1OT2A 3MLWH 4GQ9H 4PJGE 4ZFZB 1R5VA 3AS1A 5D7SL 4EJ1C 4G8GA 3V4UL 4V1DA 1E28A 2R2HA 5DHYB 1SY6A 1N6VA 1GC1C 3A6BL 1G84A 3O3BB 3MPCA 3UBXG 3PHOA 4YC2C 4KTDH 3MRQA 3C5ZB 4U1LA 3ARBC 4LHUB 4HUXA 2FO1A 5TDNB 4MAYC 4FTVD 1RVFL 1J87A 3V7AE 3P4MA 2HJFA 4ZOEA 1RD6A 3FB7B 4EVNA 4XNYL 5LCVH 4RGMB 1W72A 3MRKB 4HULB 4NRZB 4WU7B 3IXTA 3T04D 4O02L 1AP2A 4GXUN 4JRXD 3WIIL 5EORH 2YUZA 2H1PL 5FCSH 4QLRA 3FO1B 4DGYL 1BFOB 4DVBB 1P84J 5MERB 3RWIA 1E27B 1DBBH 5F9WB 5KVEH 3S8WA 3C09C 2OL3B 3MJ6A 5HHPA 1TCRB 4POZC 1KJ3H 2VL4A 3HI1B 1V7NH 4QRTB 3STZA 5CD5C 2I24N 4K71B 1JUFA 4BUGA 1OAUL 3QUXB 2UV3A 3GMLB 5FB8A 4RFOL 4O2EB 4Y1AB 3G6JB 5E00A 2KH2B 4DAGH 2P44B 3SJVD 2O5XL 2G2RB 3M8OH 5EIIB 3VFTB 4YAQB 5K33A 2J8UF 4FRWA 4QRTA 5IVZA 3STZB 4H1LG 3IDNB 1CQYA 3NABH 1AHWA 4WI2A 1MREH 5DJAB 5D7JB 5GRWA 4MJIE 3UPAA 2QADD 2WANA 1JZ8A 4KZDL 5TPWL 4AL8H 3QDJE 2CIKA 3N1QC 1EVUA 2KZ1B 3PE9A 5E5MA 5IF0A 1N3NB 3OJDA 2GK2A 4X0KB 3R1GL 5I1AB 4GG6E 4U3HA 3O2VH 4YC2B 1VGKA 5HGHB 2AXHA 3BIBX 3QEQA 4TULH 5TQ2L 3WLWC 4RDQF 4WI5A 5DXWA 2PO6A 3TBWB 4JQIH 4FABH 1CWVA 1KN2H 4TVPE 1KFAL 3SEPA 3V5KA 4MB5A 3O81A 4PJ5B 4CDHA 3D3VA 2OS7A 5J8OA 3GJEB 4MNQE 4ZD3H 5TF1L 1NGWB 4KTDL 4J3TA 5FO7A 3TZVC 3QFJA 2IQAA 5GRZA 1OD9A 4EQ3A 5JA9A 1GIGL 2ZPKL 5FUZH 1A5FH 1LD9A 3MGAA 3UYRL 1WQVT 4G3YH 2YS4A 1N2RA 5GRJL 4KI5F 2MMXA 3A6CH 2HYMA 4J8RA 2IG2L 5C0BD 5IBTH 4J3SA 4YBLB 1R3KB 2YWZA 3WXWH 1A6UH 2DLGA 2R29H 3MR9A 5HPMB 3NZHL 4U7MA 4DEPC 5JQHC 3Q6FB 3S37X 3JV6A 1DSFL 3MV7A 2Z91B 4QTHA 4UIKH 1G1YA 3B5HA 5E1AA 3B9KB 1EHLH 4P23B 2XY2A 3BDYL 4NFCA 4Z76B 2VC2L 1NCAL 5D1XA 4WHYG 4JY5H 4U6VH 3RDTC 2BSRA 4BSWA 3HZVA 3C6SB 3CGTA 2YUVA 5KSAA 1BM3L 4XC1L 1KELL 1AJ7H 1U8JB 5IMOA 4EBQH 1MLBA 5CP7B 4MA8H 2CRZA 3R06A 2IQ9L 3IJYA 5CILL 4U1KA 3NCFB 1YECL 4UQ3B 4M4PA 4PRAB 1YY8A 5K93A 5TE4L 5EN2B 1ETZB 4G5ZL 5GSVB 3LKRA 2QBWA 3U9PH 4X7EC 2DJUA 2J1KA 1HZHH 3D39D 2H32B 4WW1B 2CDEB 1KCVH 4JM4L 3I3DA 1RY7B 4LSDA 2W60B 2K1MA 2A73B 1BLNA 2OZ4H 4P59L 4MQTB 5ENWB 4WIQA 4JB9H 4R7DA 4NIKB 3O9WA 4C4KT 4ELMB 4QRSA 3VWKB 1IRAY 1FYTE 1IAII 1ZHKB 5LAXA 4MJ5B 3WFDH 3NCEB 3MUHL 3MV7B 5I0DA 3JV6B 2DQTL 3BVNB 4Y2OA 5H35B 4B53A 1N64L 4YDJB 1BD2B 2VAJA 2NY0C 3EZJB 2HLFC 1OWRM 3AROA 3ZMRA 4XPGH 4LDOB 4HKZA 4NQVA 4KUCF 1F8TH 1U8NA 1FZMA 5GGVL 3FOMA 5DQJB 4F7TA 2W07A 4HXAH 5TFSL 3MV8D 2H26A 4YGVA 5C3LD 3GJFH 4XVSH 2C9AA 4W81A 3HI5L 4ODUA 4M7ZC 4HLZH 1AP2B 2H6PA 1PGRB 4P2QD 4LMQI 1FPTH 3EYOB 2ATPA 1K5NA 3LS4H 3MV9B 4LL9A 3OB8A 1QG3A 4ODWA 3Q48A 5GRVK 1JV5B 3V52L 3UTZA 3D3VB 2YUXA 2NY3C 4WV1C 5MENE 4XBPA 4KHXL 5I1KH 1PDKA 3DOSA 4NM8L 5I1IL 2B7DT 3CU1A 2J5LC 2ICWA 3MRJA 5D96B 2LV4A 4XMPH 3WS6C 1N0LA 1KXTB 1SJXA 5CP3A 2VLJD 1I8LA 3UMTA 3VCLB 4I48A 4D3CH 1AXSB 4LKXA 4JDZA 5F6HJ 1W0VA 3GNMH 5DK3A 4Y4HC 2WWMD 2IPKB 5FK9B 3BP5A 5FYLD 5HYSG 3O6LL 1OAQH 1W8OA 5HDBF 5ITFA 4Y8AA 5F6HI 2R0ZL 4M3KB 1GRWA 3B5GA 4O2FA 1U8HB 4PV9B 2VDNL 4EBQL 2CUMA 4JRYB 1R5WA 5ECJE 5JHDA 2BY1A 4ZQKA 2NY1C 2QHRL 4TVPH 4OF5A 1DBAH 1A8JH 2EDBA 5FFLA 5L6YL 1T89C 2FIKB 4JG1H 2DIJA 3U9PL 4O9HL 5IKCB 1I7TB 1QP1A 2BRRH 4TNWF 1S78C 4XTRC 3WYRA 1ZT1A 2R9HC 5EOCH 3GBLA 2GT9B 5AD0A 3AMKA 3ZTNH 5FYKU 1J0ZA 2EH8L 1QBLL 3L5WB 3VRJA 4PY7B 3ETBF 1QACA 1CICD 1OARH 1QVOB 3IVKA 2ORBH 2DD8L 3I50H 5SWSB 1MFNA 3FT4B 4W4NA 1KPVA 1ZWIB 3RWGB 4JZOA 3AREA 5KS9E 3BGMB 1KC5H 5D71L 1I3GL 1F4XL 4ZUVA 4GUPB 1DR9A 5D1ZD 4R0LB 1NMAL 7FABL 1KPRB 2J5LB 2DQEL 1C5BH 1ZHBA 4FQLL 4F7EB 5HGGS 1IE5A 4M1CD 5EORL 5IBUB 2ADGB 5B38B 4GAYB 1JWUB 4OV5B 5I66A 3FB7A 1R5IB 4YNYB 4JO1L 1DBJL 2HLFD 3H3BC 4WUUB 4XHJD 3VGAB 3T0XA 4MD5A 2JKXA 1KTRL 4NYLB 4OKVA 3DHJA 2BVYA 1NJ9B 2HT3C 5KZCB 4U1LB 1D6VH 3SE3C 4MJIA 3BWAA 5DI8B 1SMOA 3TF7C 2DQJH 5FOJA 2BVTA 1TIUA 1CXKA 1DTUA 2B2XL 4R4NC 4IRJA 4L3AA 1UZ8A 1YJDC 4QHNA 3FTGB 1NUFA 4G8GB 3RWDA 4D2NA 5E1HB 4CKVX 1KJ2L 2VLKE 5CSBA 2AABH 4NZJA 3KPRD 3WFHA 1UM4L 1IAOA 5BZWB 5CGYD 1JTPA 2V2TA 5C09B 4P4KC 3WCYA 4LLQA 1M71A 1IM9D 2EECA 3VFNA 5HHMB 4JFFD 1I1YA 2XXCB 1VEMA 5EUOE 2F74A 4R0LA 1H9VA 1F3JB 4I3SH 5C07D 1WAAF 2E9BA 2V2XA 2VLJE 1B4RA 4HZAA 2NNAB