5F96H

Crystal structure of broadly neutralizing vh1-46 germline-derived cd4-binding site-directed antibody ch235.12 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
225
structure length
220
Chain Sequence
QVRLAQYGGGVKRLGATMTLSCVASGYTFNDYYIHWVRQAPGQGFELLGYIDPANGRPDYAGALRERLSFYRDKSMETLYMDLRSLRYDDTAMYYCVRNVGTAGSLLHYDHWGSGSPVIVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 44
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H01
2AGJL 3FOMA 1JVKA 5I8OL 4X6DB 2ZUQB 5B39A 1A6PA 1NC4B 4FQIL 5TH2A 3TEUA 1MCCA 2BVOB 3GJFA 2IGFL 5DI8B 1F90L 3C5JA 3CX5J 1P4BH 1FQ9C 4LPUA 1S9WA 4F7CA 4HAFA 2ARJB 2H1PH 4BSWA 3GGWB 2DKMA 3PL6C 3D87B 4FFWC 2ZNWA 5DHVH 4UIMB 3GMLB 3OKNA 5TQ2H 4OGXL 1D5MB 2VIRA 4PP1C 1LO3L 2R29L 5D1ZD 5I17B 5IMMB 1AXTH 3T0EA 5IVOA 4XTRD 1O7VA 3BZ4B 4X83A 5AG8A 5SWSD 5FECB 1LGVA 2LE9A 3K1KC 5FM5O 1UVQB 2VL5A 3QP3A 4XVTL 2O61A 1BHGA 1VPOL 3UTSB 4KK6C 5D96C 4NN6C 2F19L 2BSRA 4U2ZA 4HS6A 4Z7OF 5DJDA 3W5MA 1KEGL 4KI5C 4PJ7B 3FZUC 1FFOB 2WINA 3GHBH 1YNKH 3S35L 1YN7B 4WW1B 2FX9H 5KVFH 3HB3D 4FZ8H 5EC1B 4RQQB 4NCDA 2VR9A 1V7NL 2MCPH 3SE3A 5KSAB 5KVDH 1KSRA 5FM5M 3V0WH 4LVEA 1UEYA 4TRPH 3TBYB 4JY5H 3TNNB 1U41A 1SEQL 1MJ7H 3ULVE 5H94A 4DKFL 1WEJH 4O5LL 1FG2B 3EO0B 5EZIL 5C8JA 1PJ9A 1T21B 4MNQB 1I85C 2QR0A 3C60D 2GTWB 2X1OA 3ULVC 5JPMB 4QRSA 5IGXH 3D1MC 3O41A 2OI9B 2IBGA 5BOZG 2IH3B 5C1MB 1T3FA 1I3UA 4QRPD 1KIPA 5CILL 1KFAL 4NFDA 3SGJA 1NLDL 1F6FB 2XV6B 4E41A 1U6AH 2DTSA 1X5IA 4PJCA 5TF1H 2NY7L 1AGEB 3H9ZA 4BK4A 4F33A 5L6YL 4OCRH 4R7NB 5F1NA 3VE0A 5DSCB 1S7RB 3SO3B 1LO4L 2WBJB 1QZ1A 3ZE0E 5HGGS 5DZNA 2FEEL 5TDOB 2VLMD 3F65A 3FB8A 4IOIB 5T5NF 5EC2A 4IRJA 4ZSOA 3CFEA 4GXVL 4NPYA 3LN4B 4YIQB 1G7LB 4P2QD 2DDQL 1RUKH 1FVDA 4ZNEE 1I9RL 1M7IA 3QRGL 4G80B 3BPCA 3UPCA 1SVZA 1FZJB 1P69B 2HRLA 4QT5A 1W72H 1MJUH 4OKVB 1BFSA 2X70A 3CU1A 4V2CB 4NCC2 5AYUL 4OLEA 5TPWL 4NQVA 3QXDA 4PY8I 1B6UA 3AXLB 3TJHC 1K8IA 1RHHB 2D9QB 1XGTB 1IEBB 3QNZB 2IH1A 5C0GB 5IBTL 4YAQA 1J1OL 3PWJB 1JCKA 4JZOA 4KKNA 4OT1H 2DWEA 2A74A 1DLFL 3MJ9A 4AEHH 3ZT6A 2PXYC 1MLBA 2I27N 5HGDA 3L5XL 3L95A 4PRNA 1IQWH 4ELKB 2JB6B 4G6MH 3KR3H 3MV11 1NL0L 4XAKD 4F7MB 1NFDF 3DMMD 3RVTC 5EU3A 4EOWL 4S1RH 1GZPA 3UTTB 4P2OC 1ZHBA 4GMSH 1ZVSB 2ZOLA 2F5BH 1Q9OB 4K8RC 4M5YH 1I3RA 4HX1B 4F9LC 5SV4A 4XVJH 1W0WA 4APQA 3BH8B 5IOPA 1N5YH 3N9GL 2N56A 1QRNB 2HT4D 4H1LB 3DUUB 2PCPB 3PHSA 3W0WB 5JHDB 3BP4B 4R4BB 4Y8DC 3L3HA 3MQIA 4MJIE 4P9MH 5EZJB 4PJIB 5F1IB 2D0FA 2AJZB 5FK9B 3FQNB 2YS4A 3WN5A 1M4KA 4OAWB 5GZOD 5HVHB 4KWUA 1JPST 4HLJA 4CJ0A 3FB5B 3NGBC 1AGBA 4QHUB 3VXRE 1J0JA 1N26A 4KJPC 2B4CC 3MREA 4P2RB 4R0LA 2WV3A 5JQHC 1TJIH 4RRPG 1U9KA 4PGCA 5D1XA 3VMOA 5JA9A 5JPNB 4PJHF 3D48R 4I9WE 3GRWH 4GBXA 3MO1A 3KWWA 3TVMA 2HVKA 2VL4A 4N9OB 1HI6B 5CJOL 3VXUA 2V2TA 5D7LE 5I15H 2YD4A 1IQDB 1IAKA 3QPXH 1FBIH 4PLJD 3P9MB 4R4FH 2G9HA 4JFYA 4Y2DC 3LDBC 2Z91B 4MD4B 3VJ6B 4BFBD 4D9LH 4OV5B 1RZIB 2ZKHL 5D1QA 1I8LA 2BSSA 1E4XH 1BZ9B 3B9VA 4YDLB 4V2BA 4UQ2A 1KIRA 5GGTL 4TTDC 3LKPB 4NWUH 5KN5B 1Z9SA 3RL2A 4KJQD 3GSNA 1XIWC 1UA6L 1P4IH 2YK1L 4PRPA 1WIOA 3L3KB 3VFSB 3TPUA 1KXQE 4JM2B 3D3VE 4A6YB 4Y1AA 2I07A 2EIZA 2B20A 4TVSa 1FO0B 5LAXB 3WMSA 3GSUA 1IGYB 1F3JA 4ONFH 4F7TB 4DN3L 3RGVD 5KSBB 2Y07H 2ZG2A 5L7XL 4XC3H 4X80H 3IDMB 5T1KD 5J7CC 3JV0A 1TQCC 4L4JA 5E2UH 4M6NH 2F54E 5CJQH 4I0PC 5HDLA 1D5IH 1FIGL 1QSED 5D5ME 1JGUH 3CX2A 5EULV 3KPTA 4JKLA 4YHZL 3C6SA 1ACZA 3V0VA 1DQML 1UWGL 4LHUA 2XZAL 5J06A 1ZV5A 4TOYL 4QHNB 1D5XB 5EBLA 2BMKB 3FO0H 2LTQC 5E08H 4JZJB 2QKIA 4XRCB 4BH7A 1EX0A 3G5XA 1NUDA 5DF0A 2HJFA 3ES6A 1SJHB 1N3NA 4MB5A 2YRZA 4R3SB 1VESA 5AWNH 4PP1D 4YQXL 1MOEA 1S8DA 4MA7L 4LOUC 3I6LE 3OXRA 1S7XB 4XGZA 4WFED 4KQ4L 4WFHE 4X6CB 2CDFB 3VRLF 2DQFA 4XP1L 4WI5A 4PGEB 1NCNA 2F8VA 4KK6D 4ZPVB 1KGCE 5C07B 3LCYA 4AENB 1OTSC 2JJTA 4KI5D 4R2GC 2XKSA 4I13B 4NKDA 4LSDA 1JHLH 2CO7B 4HFUL 43C9A 4LCWA 4LP5A 2HA1A 2QQKH 2A6KA 4OQ1A 3P11L 1B9ZA 4KMTL 1RJLB 2AEIT 4PJFE 1H0DB 3EYFA 3LKSA 3QUXC 4DZBB 4U1LB 4YJZL 3E1F1 3V5HB 2IBBA 25C8H 3O2WL 5IESH 2BX5A 4PJAA 4YZFE 2VLLB 5E24E 4OLWL 2R1WB 3GBNH 4QNPE 1S7QA 4O2EA 4WW2A 4WO4A 5I30L 3ZYOA 4MCZA 2DLGA 2XI9A 1FL6B 2I9TB 1HEZB 1I9JL 3LRHA 1G9MH 3DV4B 5GGRA 1RJZB 2APFA 3CD4A 4K2UL 3VFMB 2Z4QB 3I6KA 4MXQC 3O6LL 4YHOH 3HG1D 4OLZH 2BFVL 2GYSA 3RDTB 4BUGA 1XGPB 4KRMB 3RWFA 4PJEA 4JCMA 4OI7A 3BIKB 4PRID 5IF0A 4HIIB 3WDJA 2XA8H 1HHIB 4GG8B 3MOBL 2GAZA 2HLFC 4CUCA 4X6EA 1UC6A 5ESVA 1HE7A 3WO4C 2LU7A 3H9SD 1XF3B 4Y4KC 3RU8H 3HZMB 3MLZL 3OR6B 3D2UA 5DRXB 3MC0A 1BREA 3O8XB 5HI4C 2H26A 4UT9H 4LGPB 3FQRA 5SV3A 3IDGA 4HIHA 1EA9C 3VD9A 2OS7A 1T1YA 2BVEA 5IVZB 4BQ9A 5DLML 3FOLA 1S7WB 1VGKA 4JFOA 1I1FA 4HSQA 1I9EA 3C6LC 2ZUWA 5SWZA 3SJVA 1YEFL 2G60H 1MHEB 2AXGB 3TJHD 4AMKH 4NQDD 2HTLC 3MGOA 4JHAL 3DVFA 4I3RH 1JFQL 3N85H 1NC2B 2Q7YB 3H7BA 1LWRA 3SE8H 5DUPH 4JFQB 1YJDC 5FYKE 1C08A 1DVFB 5IFAL 3PL6B 3PABA 3PDOB 5ILTH 4PJGF 1KLGB 2PXYD 3BDYH 2FX8L 4YHIA 2DM7A 4EJ1C 4M93B 2WM0A 4LCIH 2W9EL 5DUBB 4XVUD 4HWNA 4NO0A 4N8PA 4GW5A 4P3CL 1EFXD 1CDIA 1TLKA 3RVTD 4KMLB 1N0XH 1HSBA 5HHOA 3OKOA 3FQWA 4JO3H 4P2OD 1IC4H 4H0IA 2FEDC 3WIHL 4KY1L 5ISZE 2XACC 5IIEB 4PPTA 4K8RD 1W8NA 3T1FA 1U8IA 1Q94B 1YYLL 2X7LA 3O6FC 4JO2L 4BM7A 4D0BB 2OP4L 2HVJB 1NCTA 3QB7C 4MSWA 2FJHB 3HS0A 2NXYC 1MQ8A 3D25A 1KTRL 1U8LB 5GS3A 1AD9B 4XNXH 1SY6L 1OGAE 5FCUH 2UZIL 5E8OA 3V4UL 1FN4A 3L6FA 1CDJA 4JY6B 4KAQH 4DKEL 4J3VA 5IMOA 1X6NA 2BNRA 5TFSH 4RBPH 2ZCLL 4JJ5A 4KJPD 3DX7B 5FA3B 4GMTH 4JFED 1UKQA 1R0AH 4XXCC 3LB6C 2VLJE 1BFTA 2NYYC 3VXRD 2D4DA 3VWKA 4KTYA 1JTTA 1I4FB 5BS0A 1CG9B 5GJTL 2YOCA 3ARBA 4LLWA 2ESVE 4EVNA 1IGTA 3SN6N 4N0YH 1R3HA 1NCAH 3GSOA 2XQBL 1NBQA 4HWBL 5B38G 4Y2DD 1PFCA 3U83A 1AR1C 2Q87A 1KIQA 2G2RB 2X4UB 5CSZA 1CI5A 4ODTH 3AAZA 2XG5A 2Z92B 4JDVB 4U31A 5L2KA 4X5WA 1CS6A 1Z9LA 3U36B 4OCWL 1DL7L 3BHBA 3OTTA 1AQDA 1U91A 4ONHA 5BZDB 3TBWA 4TTDD 2AEWA 2VLKE 2VAAA 1KXTB 1JUFB 1XIWD 3L3OA 1LNUB 1D5BB 5BVPH 4LASH 4L29B 5E0QA 1KN4L 3I3BA 3NACH 4I5BB 4Z95L 4MXWH 1IT9H 4WDIB 2V9QA 5TDNB 3BVNB 4MQ7A 4JM4L 5EBWA 4Y5VC 3DURA 2ILLA 1A4JB 4L8DA 4GQPH 4PGJA 5F7NC 2DLFH 1WIUA 2JCCF 3CVIL 4TVPL 1QFUH 3OBAA 2EKJA 5IVXA 4I0PD 2OXHA 3LPFA 3X3GL 2EDFA 1F13A 5T1DL 1FNSL 3OQ3B 3JVGC 5F7DA 4ZO7A 4M4RA 3VXNB 2AJSH 4C55A 2EDEA 3W9EA 4TUOB 4P23C 4PGBA 4P5TA 4RFEA 3FRUB 3QEGL 5EUKA 3WD5H 2X6MA 4MXVE 3RY4A 4LVOC 1MQKL 3VG9B 2ED8A 4Z8FH 1CCZA 4XZUB 2Z35B 4A6YL 2DI9A 2J88L 3FAXA 2O5XH 2FBJL 3PP4H 5IK3B 3UZQA 3EJYC 1Q0YL 2ZOKA 4U7MA 2VSDA 5CHNB 5FDWA 4ZYKB 1P7HL 4KDVA 1C5DA 1ETZB 3LS4H 2FRGP 3LVEA 3MRMA 4TNVK 4YHPA 4OLXH 3B9AA 4LOUD 4E41E 1ZVYA 5HDBE 3UROR 1QTYT 2IWGA 1LK2A 3GSRB 1HH9A 1UWXH 5J1TC 4S1QL 4UV7H 3NFNB 4PV8B 4Z5RB 3MTRA 5CSGA 3RA7L 4QKXB 2D7NA 2HTKC 1FVCB 1OW0A 1U8PA 4QXGL 4LAQL 1T5XB 4X7CC 1OTSD 3MFFB 2HRPL 3O3AB 5C0BD 1H3WM 3P73B 5LQBH 3MRFB 4MJIB 4DGVL 3IJYB 1BZ7B 4Y4FB 3NGBB 5BJTA 3QG7L 2OXGA 3BP7B 4P57A 5LGKA 4NO5B 1B2WH 1PX4A 4YBLC 4PB9H 5FO8A 1R5VA 3Q5TA 2HYMA 2JF1A 3FCTB 3BT2L 4LSVH 3LKQA 3OKYA 5C0IA 3PWPD 4LEOA 5F88B 3JUZA 4UDUB 4W81A 5GRZA 1ES0A 1YEIH 2A6JB 4GRWH 4I77L 4Y5XC 1NGQH 3P40A 5HY9B 4JFZL 5MENE 3CDFA 3RUGF 2CLRB 4BFIB 1U8HB 3O2DH 3VFRB 4OF3A 1MCWW 1AGFB 2P47B 2BSTB 4MXQD 1T83C 4JFHE 4YBQC 2ATKA 4GQ9H 4JPIA 4OFKA 5DWUH 4QY8A 3SQOL 4W6WB 5HPOA 1U8MB 2YMXL 1G0DA 2P24A 4NO2B 5CBEB 4QYOB 4YEEA 3WL9A 3P77A 1B88A 2VDLL 4U1IA 3VXOA 3LV3B 4FQXC 4PYGA 5FAAA 4N8CL 1CK0L 5HI4D 3D3VB 1S7VA 5HHVL 1J0HA 4S2SA 1G6RH 3EO1B 4XP5H 2MTPA 4PJ5B 1FG9C 1N6VA 4WV1C 5DZOA 2Q3AA 3MRIA 1IBGL 4HLZG 5IFAH 3BQUD 1CQKA 4U1MB 1DFBH 2DQIH 5D5MB 1ADQL 1FGVH 2OL3A 3G04B 4I2XA 2HTLD 2VE6A 2PO6D 3WYRA 1U3YA 1SHMA 5JR1L 1EO7A 1FAIL 3L7FB 3MBEC 1RIUH 3VWJA 2R39A 1CLOH 5LG1A 4UINL 5HGHA 4GG6A 4PB0L 4Y4HA 4PLNC 5JW4N 4K3JL 5CEZE 5GJSH 2R4SH 3VXUE 1TZIB 4R26H 5FHAH 5K9QI 4Q2ZB 2I9LB 3PQYE 4XBGA 1X44A 4JGJA 3ARDA 3QYCA 4Z6AT 4YLQT 1NBVL 3V7MA 3TYGH 2P8MB 4ONGL 4QTIL 3KYMA 4LSRH 4XP4H 1N2RB 1ZHKB 5HJ3A 4MJ5A 4NCC1 1KCSH 2EDWA 2AW2A 2ZSWA 3O6FD 3PHQB 4H8WC 3U82B 1GJIA 2EE9A 5HYJE 2A0LC 3BGFB 1CE1L 1AHWB 5DK2B 1KYOJ 3G6JA 1UJ3C 1UKSA 1F3RB 2VXVH 2NXYD 3BO8A 3C9NA 2FHFA 1PW3A 4UILH 2CJUL 1A6VH 5DURB 4EDXA 4QF1B 5JXAL 2CGRL 4UZGA 4HLZH 4LLVB 5M95B 4G5ZH 4RSVA 4ACPA 4FP8L 5CJXC 2E27H 1G7HB 4PJFB 4OZ4A 5AG9A 3BE1H 1NJ9A 3E8UH 3JTTA 1CXEA 1ULVA 2DS4A 1A6UL 3LB6D 1FFRA 4J4PC 2Y06H 4YFLF 2NYYD 4OD2A 2EH7H 5MHSE 3CFBA 3P4MB 3V2AR 3QWRA 1LO5A 3FO1B 4NGHH 4POUB 4HJJL 3LH2H 5DK0B 1EGJH 5T1LB 5I1IL 1QFPA 5ERWB 1NFIB 3WFEL 4LF3B 4JREB 2R4RH 3VMPA 2Y4SA 1KJMA 2CK0H 3TIEB 1YA5A 4N8VG 2FL5B 5I16B 1AR1D 5E4EB 5DD3H 4NUJA 1L0YA 3WHXB 3VDBA 2X10A 3ALPA 3NBNA 1YDPA 2D7OA 3ZYJA 3L3JB 1UYWL 5ALCH 1MPAH 2X4NB 3BKJL 4M1CC 1XCQA 4DGYH 3O6MH 3CPLA 3MRNA 2ED7A 3NCJH 5EOQL 4WWKA 5DJ0B 3T3MF 4G42A 1OP3K 5SX4H 3RWCB 4M62L 4HWEL 2OR8A 3C6LB 2C1OA 2GFBB 4IS6B 5DGQA 3JWDC 5ITFA 3IFNL 3PP3K 3MUGA 3PHOA 3KNBB 1QYGH 3DX6B 1JWUB 3KLHD 3DX8A 4M48H 4LVNC 1CXKA 5F9JA 2VITA 5EWIH 4N1EA 2P5WE 2W92A 4ZFZA 5FO9B 4HC1L 3ZE2F 1CE6B 1LEKA 3WFCH 4OJFH 1EXUB 2HG5B 4QRQA 1CYGA 3GUTA 4P3WA 5DJCA 2V2WA 3BKMH 3ZHLA 4DZ8B 1OAYH 3ZTNL 1CLZH 5IT2H 1LILA 3S3SA 2HKHL 2R0KH 3GBMH 5DJ6A 5ALBH 4X7SH 3H0TA 1UGNA 4G8IA 4LIQL 3SDDB 2OYPA 3MLYL 1WZ1L 3U4EB 4GW1A 3DRQA 2F8XC 5ISZB 5C0JA 2XPGB 2NCMA 3X13B 1GGIL 1KB5H 1P7KB 2BNQD 5E70A 3QCVH 3EYSL 2HTKD 3A6CL 1GC1C 2WQ8A 4NQTA 2ICWA 4GRLD 3MA9H 3ESUF 1GGTA 4PJDE 4DFHA 3KPOA 4OZIE 3VG0L 1G7IB 3ARTA 1OGAB 1XF5A 3MLSH 1U92A 5CZVH 4L4TA 3QHFH 3QUMB 1NC4D 3EOYG 4FQPA 4WEBL 5GS1C 3HZKA 3L5IA 5SWZE 5IEKA 2IPUK 3FOMB 1UKTA 4M3JA 4LARL 1MJ8L 1A3LL 2VLJB 2J6EH 5B39B 1G1CA 3DLQR 1VCAA 3UYRL 4I18C 5TH2B 4GRMA 2GCYB 2B1AL 3GJFB 2OQJA 1JZ6A 3C5JB 2ESVB 4GRWF 2OJZL 5DRNB 4OQTL 5FM8A 5CUSH 4F7CB 5DFVD 5GGUA 4IHOA 3WNKA 4KTEH 5FGSA 2NNAB 3EDEA 4YBQD 2DB8A 1N7MH 3TH3T 1CBVH 3IFLL 2VIRB 3VH8A 2C3HA 3NPZB 5HHOE 1A3QA 4F9PC 5D8JH 5EOCJ 1VEPA 1WGOA 2APTA 4QHMA 2Z8SA 1HYSC 1M71A 3TBTB 1V8HA 1KCVL 2O61B 1UXWB 3P30L 5DJZA 2BSRB 3D0LA 4FQXD 2NPLX 3O45A 5CZKA 5DJDB 1A9EA 1H3PH 3OZ9L 3CMGA 3ULUE 2WINB 1HCFX 3LQAL 3BPLC 3S98A 4B7IA 5C7XH 4ZFOB 3JWOL 1IC5L 2Q8BH 1XZ0B 2VZSA 2VZ1A 3TN0A 2BNRE 1E6OL 4KC3B 2IFFL 2XA3A 5BW7C 4MNQD 2WP3T 3CVHL 3BZFA 3U7WL 3H9HA 5D2LE 3SDCB 3MBED 4EUPA 1RUPH 5H94B 1JHKL 2VDNL 4HKXA 3K4ZA 2QR0B 1JI1A 5IJVB 4QRSB 5F89A 4JHBA 5FKPA 3O41B 4J3SA 1AKJD 2OCFD 1F11A 1RUAH 4FZEH 4JLRA 1HK6A 2HT2C 5C08D 3VFUA 3Q6FA 1NANH 3PQYD 3RVUC 5DR5L 3D9AH 4E41B 4PJCB 3C8KA 4QWWD 4F33B 3VFPA 5F1NB 3VE0B 3PWVA 2C5DC 4RFNB 1CICC 2XZZA 2H32H 5DD1L 3K8KA 3BWUC 2A0LD 2OSLB 5EORH 4LQ1A 5DJXB 4IRJB 1CGSL 5EC2B 3SO5A 3P9WB 2H8PB 4ISVA 4KDTC 4J1UA 3ARFA 4JVWA 1F8TH 4NPYB 4UB0L 4WTXA 3QZWG 5GPRA 3SGKC 5IMKA 3VDCA 2APWA 4X99A 5AZ2L 5ANMA 4ZFFA 4K71C 1C16A 1M7IB 3BPCB 4NHCL 2VR4A 4JB9H 5IB5A 3D0VA 3WFZA 2CDGA 5JHLL 3UCRA 1QKZL 3GJEB 1G7QA 2X70B 4KKBC 2R0ZL 4NQVB 3QXDB 3BZDA 3MRDA 1ZLVK 4Y5XB 5KAQG 2PYED 4J4PD 4UT6L 4ZD3H 4YAQB 2NQCA 2NY0D 5C0CD 2NY5L 2XWTA 2NW2B 4KK9C 4JZOB 1NQBA 4PIRF 1G0YR 3ESVF 2IQ9H 2YBRB 4JR9L 5HGDB 4PG2A 3MV8A 3EOAA 1IKNC 4Q0XL 5GGQL 1BZQK 4RA3A 4CADB 4PJBF 3P0VL 4W4OA 5EU3B 1OB1B 3HPJA 5BXFA 1MCNA 5KJRL 1P5UA 1ZHBB 2ZOLB 3CMOH 4Z7WA 1OAUH 2H9GB 3NFSH 2RCSL 3QO0A 5E9DE 1W0WB 4APQB 2R0WL 3VGDA 5IOPB 4FS0A 2Y7QA 5ICXA 1A1NA 3L3HB 1S5IH 4R7DA 5E2TL 4MS8C 1MEXH 1P9MA 3F5WA 2YPKB 1ZVHA 5EO1B 3WN5B 1TNNA 3OV6A 4FFZL 3RWDB 5JTWA 3T0VA 1T2XA 2DIJA 4F2MB 1IGCL 3QXTA 2XQYK 1T2JA 3AREC 5E2WL 5AAWA 2O5YH 1M7DB 2PN5A 1I8MA 2ZPKL 4LRIC 4ZUVA 3BN3B 3VXQB 5IB4A 1A9BA 3MLVH 4NNXB 1NGXA 4JO1H 1EBPA 5DS8A 4GBXB 3MO1B 1T0MA 4HGWA 3KWWB 1UQSA 5IQ9A 5DQ9A 2DQEL 3VXUB 3MLXL 1AQKH 1OARL 2DMKA 2V2TB 1SQ2N 1IAKB 4U1GB 2ENSA 5GRJL 1N8ZA 1MJJA 1HZHH 3E6FA 4TVPD 1BFVL 5DQJA 2G9HB 4JFYB 1AO7A 2PKDA 3MBXH 2ADJA 3MCLL 3OX8A 2AVGA 5D1QB 4DN4L 4QRRE 3R1GL 2BSSB 4TSCL 1H5BA 4XBEL 2J5LC 3FFDA 2P5EA 2VO5A 4UQ2B 4NZRL 1D5ZA 3VXSE 4UBDC 2V17L 1IAIH 4JFDA 4OIIL 5FYKL 1OQOA 1EO8H 3RL2B 3V4VH 5HYJB 2YPLD 5C92A 1W72A 2MHAA 3BKYL 4G6JL 2EXWC 4Y16C 1U3HC 1VGEL 4Y1AB 5FB8B 4W6YB 5J3HC 4HS8L 5FYJD 5KS9F 2Z31A 1AI1H 2HJKB 4NOFA 3LEVL 1I1AC 1C5CH 2PW2B 3HE7A 1WBXB 5D93B 3PDDA 1ZT4A 2YR3A 4XCFL 2VDPH 4LHUB 1YPZA 1N4XH 4XP6H 3KJ4C 3J7HA 3UJJL 2D0HA 1A6WH 1MI5A 2XNAB 1NAMA 2ZZUT 4G6KH 5DDHB 3RGHA 4HKJB 2V7HA 5GHWH 4U3CA 1NGPL 5EBLB 1IGFH 1ND0A 2QKIB 1QA9A 1LMKA 2CSPA 4XNZB 3PGFH 5F9DC 2H2PC 1UWEH 4IBLT 1OPGL 3X14B 3TWCL 2W9LA 3QUML 2RJMA 3CFDB 1S8DB 3IETA 4U0QB 2MWCA 4XGZB 2OZ4H 4JZNB 2MKLC 4Q97A 1CR9L 1JTOA 2EO9A 1BQHA 1A6TA 3H42L 4JFFD 2OK0L 4WJ5A 4XNYH 1CU4H 3P9LB 4OZFH 4LSPH 5HHXH 5MEPA 3ISWA 4F3FB 1EAPA 2YD7A 4ZXBD 3MUJA 3IDNA 4F7PB 3RX5A 2LAAA 2R1YA 1JL8A 4LPCA 2A6KB 1T7YA 4CVZB 1KCKA 5IKCA 3RJDA 2XTLA 4MD5B 1OSPL 3LKSB 3WS6A 1YEGL 4K8RH 2YN3A 2HH0H 1L7IL 4GT7A 4K7PH 4V1DA 3UPRA 3RY6C 2EEDA 2A6DA 2P5WB 4M8QA 4B0MM 3OAUH 4K94C 2XN9A 4WO4B 1FVEA 4PRBA 4X0KA 4MCZB 3O4OC 3QFJD 2NZIA 3MUY1 3MJ6A 4ORZC 5GRUL 3DROB 1FFNB 3JWOC 1JV5A 5JIPA 1H3UA 3CJJA 5ABDE 4P4RB 4NBZB 1O7SA 2GHWB 3RIAF 1U2HA 4KKCD 3BPNC 3E6HA 3RWFB 3RVUD 2VISB 1YMMD 2B4CH 4Z7OE 5IF0B 4OUUA 4KUZL 3S4SA 2GAZB 2K7PA 3O3EA 4X6EB 4LCCC 5ESVB 4IRZH 3CDGB 1KTDB 1K2DA 2FD6L 1BMGA 3WV0A 1JZ8A 3TPKA 1KF9B 3V6OA 3D2UB 3HI1A 1YNLH 3LEXB 2AK4D 5HHNA 5MP6H 1AD0A 3DETD 1MY7A 3FQRB 4Z76A 3IDGB 4HIHB 1BP3B 3SDAC 1T1YB 4NRXA 2YUWA 1R5IA 3O9WC 3MUHL 4Y88A 3FOLB 3MGTA 1FL5A 1OCWH 4JFOB 4KKBD 1I1FB 3PV6A 3S88H 1U8NA 1DQDL 5SWZB 4F37K 5ID1B 4I3SL 2UV3A 1DBML 4HG4K 1MCDA 1FPTL 4LLYB 4U1KA 3BJLA 1TZHA 3C5ZA 3QG6A 5IJKC 3BRGC 5DRZA 4KK9D 2XXCB 3FTGA 1C08B 4PR5B 1RZGA 3QEUA 2J3SA 5CINH 2VLRD 4PJ9C 2DM2A 3G6AB 1Z0NA 5BRZE 5C0NC 4DUWA 3RVVC 2DYPD 4NO0B 4R90H 1QP1A 2A9ML 4XWOC 1RUML 2CD0A 1DP0A 4X4YA 1ZSDA 4NKQB 5I1HH 2NX5A 2Q6WB 2JIXB 1HSBB 5HHOB 3EYVA 4PV9A 3FHAA 1BQLH 5K9OA 3VCLA 35C8L 2F53A 1QVOB 2PW1A 3T1FB 3P0GB 2X7LB 1OAKH 2GJ6A 2R0LH 3KXFA 3SE9H 1IAIM 1DSFL 2DQTL 1I7UB 3SOBL 3GJFK 3BPLB 4MSWB 4Y19E 3FN0H 1CGUA 1C12A 3D25B 1X5JA 4W4NA 4JANA 3B2UC 3GI9H 3U7YL 4RIRA 2AGJH 5HGAB 5E8OB 1FN4B 2ZCKL 4J3OC 5IMOB 2BNRB 2D0GA 2JELH 1QFOA 4WCYL 5EZOL 2KDGA 3VI4F 1OAZH 3ARED 4QRUB 1IAOA 2AS5M 3BAEL 5KAQF 4FTVD 4YXLL 5D2LB 2WSKA 4L9DA 3EJZD 3H8NA 1HHHA 3B6SA 4NO3A 3VWKB 1NFDE 3EZJB 5DHYA 4PBVC 4JRWA 4P46D 4OFYD 2EEBA 4JQXC 2J1KA 4QRTB 3T4AB 1WC7A 4EVNB 5KW9L 1IGTB 1CFTA 1WICA 1R3HB 2YC1A 2GSIB 2Y36L 3GSOB 1LO3H 4QOKE 2R29H 1XT5A 1INDL 4N5UA 4JDZA 4AZ8A 1RI8A 2XYCA 4QHKJ 1KIQB 4AH2A 5IHZA 5CSZB 5J6HB 5L2KB 4HUNB 4X5WB 1EERB 4HMCA 4AIXA 4WU7A 3TNMA 5ITBH 3BHBB 4XMLL 2FHBA 2V7NA 1U91B 3QAZB 2EDOA 3REWA 5IW1B 1MCFA 1JYVA 2R56L 1MREL 3CCHA 4DCQA 3VXSD 5KTEL 1Z3GL 3KLAA 3WXVL 2EXWD 3U1SL 1U3HD 4KMQA 3F62A 1V7NH 4YPGA 4MQ7B 4L8CA 4NT6A 5EBWB 4H0GA 3DURB 4OZHA 4PJHE 1X5LA 1I1AD 4OM1L 3AB0B 5IVXB 2NY3D 4DKFH 1FCCA 1LQSR 1BGXL 3T1WA 3PWNB 5F7DB 4WI6A 2H6PA 4QGTA 3GSNL 4P5TB 1VFAA 4WFGD 4RFEB 4L9LB 5CIPH 5EUKB 2KUTA 5JW4M 1BIHA 1WBYA 2HT3D 4MHHG 1M1SA 3T0XA 5CILH 2XFXA 1KFAH 2LVEA 3CLEL 4WI3A 3AM8C 3BOVA 2UY6A 2ZOKB 2WAHA 4HBQA 2FX7L 2NY7H 1EV2E 3HN3A 5H2BA 2H3NB 2YWZA 3MRRA 1IM9D 4KROB 2COQA 3QXWA 3VFGL 3MRMB 5IWLA 3LEYH 4YHPB 5KOMC 2E7LC 1R3IH 1K4CA 3CXDL 4OGZA 3MNZB 4FQ1H 4L8SC 3BXNA 3WUWG 2ZUXA 3FT4B 1DDHA 3FFCE 3RX8A 2DDQH 1YJDH 3VD5A 1W2KT 4LNVA 3NCCB 3B9KC 5C70A 1NCCL 2DOCA 3FHQA 3ROOA 1LP9F 3SKMB 5AYUH 3JWNC 1A3RH 3PGCB 4J6RH 3QISA 5I8EA 1K6QL 4RGOL 1F6AA 1FLRL 3QDMD 4P57B 5EB9A 5D7KE 4GG6E 5LWYL 1FZKA 1XGUA 5FO8B 3QXVA 1TPXB 1J1OH 5D7SL 3TCLA 4KVCL 3TZVC 2ICWI 3GSXA 3FJTA 3QCTH 3UX9B 3PGDA 1R24A 1NMAL 2VABB 3WHE1 3LKQB 5ESQB 5D2NC 1DLFH 4OFIA 5F7YC 1A2YA 5C0IB 3MA7A 1E4KA 5L8KB 5CGYD 3WE6A 3HUJF 4Z7NF 2C3VA 2ATPA 5JNYA 1F4WL 3KAAA 5HHPA 3RNKA 1PLGH 1ACYL 1NL0H 4ELMF 2EYSB 3U4BH 3WSQL 1GPOL 1U0QA 2G5BA 1NGZA 2YD3A 2XG4A 3VRLE 3MV8E 3QHZH 3GI8L 4JRYE 1BJ1J 5C09A 5C2BL 4KVNH 3ZL4L 4QY8B 4QRRB 2AJXH 2MKWA 2QQNL 2BVYA 2P24B 1F02I 2UZXB 2W65A 2WANA 3BSZL 3QUZC 4M1GH 4PLOB 1MY5A 1JGLL 3WL9B 3P77B 4L4VE 3AMLA 4U1IB 4P5MB 5JDSB 1WT5C 5E6ZA 4FHBD 3FT2A 5IG7B 3VXOB 2FBOJ 4BSJA 2CRMA 4OB5H 4LSQL 3FKUS 4S2SB 5E2VH 3DECA 1CT8A 5IM7B 1QFHA 4MDIA 1NSNL 4FG6C 2D7MA 1AGDA 1ORQB 4LLMB 3O2VL 2I60L 1REIA 3GMOA 2AEPH 3O9WD 1OSZA 4Z7VF 4CMMA 4PBWD 1F4AA 1JJUA 1NEZG 4DGIL 4YDKH 2Y6SD 2OL3B 4QXTB 4JKKA 3PE9A 4ZNCD 4H26A 5CJOH 3VWJB 3SKOA 4GG6B 4EXPX 1JTPA 3NCBB 5DJYB 1AC0A 3RBGA 4OD1L 1DCLA 2QQQA 1BVLA 4PJ9D 1Z5LA 3UTQA 5C0ND 3SGJC 2ZKHH 3SE4C 4XBGB 2AEQL 4HWUA 3QI9A 3TV3L 3EGSA 4KRNA 1X5ZA 3ARDB 4NQEE 3DVNB 5GGTH 4FQ2L 1GAFL 3I2CH 4GXUM 5DD0H 3VFOA 1SM3L 5J6GA 3QQ4A 1UA6H 4CMHB 2YK1H 1JGEB 3KPRA 5DFWH 3O4LD 5DD6B 3VXMD 5KZCD 4MMZC 2ENYA 4RMQA 1T89A 1C5BL 2J8UF 4URTB 2WW8A 4WUUD 3TA3C 2CKBA 3DBXA 1OAXH 4KHTL 2WNGA 3BO8B 3C9NB 1CD9B 3F7RA 3MXVH 2B0SL 1QG3A 2E8YA 5FGBC 3B2UD 5C2UB 4U1SA 3G5YA 3IU3B 1MAKA 5TE6L 1G0XA 2FO1A 1RZ7L 4YHZH 4R8WH 3D39D 1UWGH 3EZ8A 1NJ9B 4KRPC 1VSCA 4PJGE 3RWGA 3R4DA 1FDLH 3QIUA 3MRQA 2MQ0A 4HQQL 5I1LA 3RZCB 2B2XL 3QIBC 4QLRA 5IR1B 4OD2B 3ZKQD 3TC9A 3CFBB 2E5EA 2UWEF 1ZT1B 1RURH 3C87A 1V3LA 1LO5B 3FQXA 3MODL 2X1QA 2MCG1 1C1EL 4TPRL 3FO2A 4UU9A 1T7XA 4YQXH 2EDXA 2IANE 1KJMB 4MA7H 3QEQD 4HUUA 2NXZD 1JMXA 2DQGL 4KQ4H 3EYUL 1KJ2B 3STLA 2BVTA 4XP1H 4NUJB 4LCCB 4KK5D 5ID0A 4ODXA 2R2CA 3QQ9C 4B41A 4IOFC 5GGVH 1ERNA 3OGOE 3PWUB 4E5XA 3L3DA 1G6RA 4XPGL 4D9RD 1XCQB 1MIEL 4HFUH 4LDLB 3QJHB 1A7NL 3CPLB 4OGAC 3SDAB 1B3JA 1SYSA 3SBWC 2ARJA 3S3JA 3ZKXC 4WWKB 2NY2C 1NCBL 4PJXF 2ADFL 4UIMA 1OTTC 4KMTH 1D5MA 2C1OB 3HNVL 5I17A 2QEJA 1F4XL 3QSKB 4OLWH 3MUGB 1J5OL 1P7QD 3V8CA 3PHOB 3IKKA 4R6UA 1UVQA 3TVMC 3UTSA 2AV7A 3DX8B 4MB4A 5F9JB 4V1DE 2ARJQ 1I9JH 2VITB 4ODSH 4ZFZB 1AR2A 3S37X 1LEKB 3TO4B 4M7ZC 1FFOA 3TBSA 4FXGA 2EDNA 2R2BB 3O6LH 3GUTB 3ARVA 4XCYA 5DJCB 3TLRA 1F45A 4KV5F 3QWOA 3A67L 1Y6MR 1ZA6A 4JRXE 4RQQA 3QCUH 1MHPL 4M7KL 1JHTB 5KSAA 1LO2H 3H0TB 3MOBH 1RUQL 1V3KA 3ET9F 5D72L 1UG9A 4HUKB 3DRQB 3OL2A 2YXMA 5C0JB 5JW4R 1FG2A 2A73B 2BRRL 1QSFA 2LVCA 2GTWA 3VI3F 3UTPE 3B9KD 1PBYA 2ICWB 1RULL 5FGCE 4U1NA 2IH3A 1I7TA 5GS0L 2IMNA 3GSWA 3KPOB 1YEKH 4G6AD 5D7JD 5CEZH 4M7JL 2CIIA 1MCJA 1F4HA 2KZ1B 4UTBL 3K74B 4L4TB 5A43C 2E9WA 2P43B 4KXZH 4JHAH 3I50L 3QUYA 1AGEA 2FSEA 4R7NA 5DSCA 1FORH 5BVJA 5IEKB 3TZVD 5TDOA 1EGJA 4PY8J 3U0TB 4ORGA 4L3EE 4XPBL 2NW3A 5E8EB 4H8WH 2FX8H 3S96A 4H1LG 4YIQA 5E94A 4RMRA 2EECA 5TE7L 4G80A 2G5RA 4QOKB 5GGUB 4IHOB 1YEEL 5IFHL 4O2FA 3CUPB 3T0ED 4LHQB 1MCEA 2EDDA 3WIHH 1CFVL 1KG0A 4KY1H 4EDWL 4P5KA 3AXLA 5GZNC 3VH8B 4TUKL 1YYLH 1IEBA 1MLCA 1OWRM 1JNJA 1XGQA 3VW3H 4NJ9L 4ZAKC 2OP4H 3HR5B 2NZ9D 4HPOL 1Q72L 1IGIL 2IF7A 4QHMB 2F53E 1M71B 5E6IA 5EO0A 4IIQC 2V9RA 1ZLSL 3LQMA 4DTGL 1RK1B 3L5WA 1TZGL 3OAYK 3D0LB 4JQIL 4NQSB 1YEHH 4OIBA 1A9EB 2UZIH 2GT9B 3C09B 5DEFA 4ELKA 4YBHA 5BV7B 4FG6D 3V95A 1FE8L 2ZCLH 2GK2A 4PJHB 5D6DA 1N0LA 1TFHA 4PUBL 3U48A 12E8L 4Y7MA 1ZVSA 1UCBL 4YFEA 4GKSA 3TN0B 4S1DC 5T5FH 1FNFA 4FFVC 4D9QE 4HX1A 2JTDA 3H9HB 5GJTH 2BCKA 4EUPB 1D6EA 4TNWK 3P4NB 3DUUA 1BIIB 1MCOL 5HDQL 3BP4A 4HKXB 2J8OA 5F89B 3GSQA 3QRFM 4ZFGL 2A83B 3SKJH 2X09A 2GUOB 1QNZL 3FQNA 3CSBA 1L0XA 4LP4A 4LSSL 3JWDH 3L3IA 2YHGA 1FNEB 4GAGH 3WLWD 2J12B 3FB5A 4QHUA 3CK0L 3VFUB 3ARWA 1H3VA 4P2RA 2W9DL 2A77L 3C60A 3C8KB 2OL3L 3BWAB 5JPNA 1WAAA 3PWVB 4IRJD 2DWDA 3ZKSD 4Y89A 5D7IF 3DWTA 4RMVA 1OT2A 1E4XI 2AI0H 2C1PA 4R4ND 4X5LA 5AYQA 4JM4H 4KDWA 4J1UB 3ARFB 1OLLA 2OJEA 3STZA 5HYIA 1PKOA 4Z77B 1ZGLM 3UZVB 4X99B 4TVPH 1C16B 5IB5B 1X3DA 1HKFA 3V4PL 3D0VB 3X3GH 2B5IB 5E00B 1WBZB 1G7QB 1GH7A 5T1DH 4NWTL 1BZ9A 4BYHA 3EO9L 4NRYA 4GJTB 1UENA 5B3NA 1V3JA 5KN5A 4CU7A 4XI5C 1IEHA 3QEGH 3MRDB 4F80A 2F58L 4D0CA 3INUL 1MQKH 2J88H 2FBJH 2XWTB 1GC1H 3VFSA 5DHVB 4IMLB 1C7SA 4JM2A 1Q0YH 4EEEA 2UYLA 1FO0A 1P1ZA 1I9IL 1IGYA 5C0AA 4KFZC 3MV8B 2JJSC 5FYJH 3EOAB 3PXJA 5KSBA 1JYXA 4NKIH 3UAJD 5H8DA 5LCVL 4S11A 3M8OL 4AQ1B 2OLDA 2Q86A 4F57L 2VYRE 4X6DF 3RA7H 4P4KB 3QQ9D 4G8EB 3ZZ1A 4EQ3A 1GIGL 4JFXA 4APQD 3ARUA 1JWSA 4NM8H 1A6AA 1RJYB 4LAQH 1ZLUK 2HRPH 2KKQA 4Q9RL 5HYFA 3QO0B 4DGVH 3JTSA 4OGAD 3DMMA 5F96L 2Y7QB 4HD9A 5I1EL 1A1NB 1SJHA 2WMPA 2P7TB 3WXWH 2O26U 3F5WB 4FRWA 4QO1A 4PRDA 4BQ8A 3CZFA 2GK0A 1NUNB 2FGWH 3S37H 1P84K 2L7JA 1EHLH 5D1XD 2YRPA 4JG1L 4X6CA 4OTXH 2Z8VC 4I77H 4PGEA 1MFCL 2WWKT 3SCMC 5ADOL 4ZUVB 3TVMD 1I8MB 1QBLL 3GKZA 1EZVX 4JFZH 1NAKL 4P99A 3ARBC 3MRJB 3V0AC 3EFFA 1ZE3C 1NGXB 2XKUA 4YUEH 4AENA 4L5FL 3ULSA 3TP4A 4PJ7F 4HGWB 1UQSB 1BM3H 2ZCHL 2OR9H 1KLUA 2BXYA 4Y5YB 3LN5A 1DBJH 3ECBA 1N8ZB 3C2AL 1MJJB 1CXIA 3G6DH 1TTUA 1RJLA 4GSDL 5DQJB 1HH6A 4HZLA 5T33L 3IFPB 4YNYA 4U1LA 1N64L 1KELH 2H32A 3OX8B 1GGBL 2VDLH 2YA1A 5J8OA 1P5VA 3FFDB 4NN5B 4NQCD 2P5EB 4WIQA 5L8LB 1D5ZB 1WCBA 4XBPA 4PRPD 4KU1A 1WVZA 3BYYA 4JFDB 1P6FA 3QIWA 1NMCC 5HBBA 2X4SA 5F7FA 5HHVH 4Y1AD 2I9TA 2VZVA 1ZLWK 1MRCL 1SJVA 3DV4A 1W72B 2MHAB 2QSCL 4YHYC 1RJZA 4C4KO 4GKZA 4KZDL 1X5AA 2ICEB 5ADPH 3M17A 3NZ8A 3RDTA 1XGPA 2Z31B 4KRPB 5A2KH 1ADQH 3BIKA 4WTZA 5CFHA 4I4WB 4HIIA 3QIBB 2DQDL 2IPUG 4G7YL 4LHUD 4PJGB 5E4IA 5EUOF 4ZOEA 4UINH 4PP2B 1B90A 4G8GD 5JW3L 1ZT4B 5FUOL 2BJMH 1XF3A 4OGYL 1NFKA 1K3IA 1TJGH 4D0DA 3O8XA 1MI5B 2V7HB 1ZTXL 5C3TA 1BQSA 1W0YT 4Q58C 4UNUA 3UZEA 4YR6A 1NBVH 1MFAL 1QA9B 4K3DH 2IANB 4QTIH 1IKFH 1S7WA 3SDYL 3GHEH 1FYTE 4TNVF 5F7EL 1WUNT 4H5SA 1MHEA 5GZND 3HLAB 2HJLA 3QZWA 3VXTB 4ODVH 4M43L 5IB3A 4ZAKD 5E95B 4EZMA 3KS0H 2AK1L 4P0DA 5ETUA 1CDBA 1BQHB 3PL6A 4O4YL 4WUKL 2CJUH 1CD8A 4DAGL 4LCWD 5JXAH 3H2WA 1CZ8L 1QFWI 3KPSE 3I9GL 5DUBA 1DANT 1OTUC 5MEPB 1JPSL 3MOAL 1EAPB 1AY1L 1UH4A 5EDXA 3IDNB 4ZO8A 3QDHA 2R1YB 4LCUA 1T2QL 3THMH 5IKCB 1NLBH 1A6UH 1F42A 4S1DD 1Q94A 4GRWE 1H3XA 4M7ZB 2QL1A 4V1DB 1KXVC 3UPRB 1JF1A 2A6DB 3E2HB 2PF6A 4M8QB 2Q7NA 5I1JL 2CPCA 3WFEH 2XN9B 4YFLI 3H3KA 4XX1E 4X0KB 4HUWA 4EI5B 4PJIF 5FUCC 5E5MB 2M1KA 4U49A 4JRXB 1JV5B 1DBBL 2D03L 2EO1A 5F7MC 3E6HB 2NY6C 1PSKH 3F7PC 1I85A 1CFSB 3BKJH 4NN7C 3S4SB 2YPVH 3O3EB 3MNVA 4S1SH 4YDVB 2I5YL 9CGTA 1EJOL 4XMKL 1K2DB 1UXSB 3HG1A 2AABH 3RZWA 3VA6A 5FGCB 3HI1B 3ME0A 4LNRA 5LXGL 5HHNB 2X05A 1AD0B 3QHTC 4PRIA 4J8RB 2HN7B 4N0CC 5EBMA 3ZT7A 4M6MH 4F7EA 3IFNH 3OG4B 1HN1A 4JO4H 3SJVD 1A02N 1R5IB 2DQHL 5CP7A 4JDVA 2MFNA 3MGTB 3H9SA 1FL5B 3U36A 3PV6B 1KACB 1UACL 3HC4L 1A7RH 1U8NB 4FFYL 3VD3A 4H0HB 4L3EB 3S5LG 1TQBB 1LNUA 1W0VA 1TZHB 3QG6B 2PETA 5DRZB 5JOPD 4LMQE 3FTGB 4BUHA 5B8CC 3TJEL 2HKHH 2W91A 4WDIA 4NC0B 5TDNA 4ZNEA 1RZGB 5L9DL 4HXAL 2BDNL 4DUVA 1I1CA 1MRFH 3C8HA 2VXSL 2XTJB 2WUCH 4LIQH 4XMPL 2R9HC 1WZ1H 1I8IA 2RHEA 4EXKA 1J8HE 4X4YB 3DSFH 1Z0MA 4RGNB 1KT2A 1GGIH 1IFHL 1V7ML 3EYVB 1JZ3A 2DF3A 4L8BA 4OZFA 2J7LA 3EYSH 1ONQA 3UDWC 2PXYA 3W5NA 2EZ0C 3VCLB 3VXNA 1KNOA 2F53B 5HYEA 2PW1B 3V9FA 3FRUA 1QSFE 2GJ6B 3KXFB 2L7UA 4Z0XB 2Z35A 3VG0H 2B8OT 5TQ2L 1EFXA 4HK3J 4YC2B 1MNUH 3S97C 3X12B 4ETQA 1V3MA 3QPQC 4WHYG 1AXTL 4P2OA 3U46A 1GZQA 3LPGA 1K8DA 4U7SA 1ETZA 3DGCR 5GGSY 4RIRB 5I71B 4XCCL 1HDMB 1NCUA 2AV1B 4F9LA 1MJ8H 2EKSA 4TSAH 4HG4J 2XQYG 1A3LH 3ILPA 1HQRB 3O6KL 1E6JL 3UYRH 4AM0B 3OB0K 2VXTH 4PV8A 3VWKD 1XR8B 1IAOB 4Z5RA 1CFQA 1MRDH 2B1AH 3SCMD 3MV9D 5BS0D 2E6PA 5ACZA 1YNKL 1H15A 2OJZH 3ARBD 1HHHB 4OQTH 4PJBE 5KVFL 5EU7C 4Z78A 3NPSC 5DHYB 4MJIA 3HTLX 5D4QA 3IJYA 3TCXA 3ARGB 3WBDA 4WHTA 5I74C 1CFTB 1A47A 3LPWA 3LD8C 3QDJE 2YC1B 4JFEA 5F9WC 5CD5D 5INDA 1VACA 4NO5A 4JDZB 4AT6B 1HKLH 4JY5L 1A7QH 1K5NB 3VXRA 3LAFA 4E0RB 5IHZB 4AH2B 1WEJL 3KPQA 5IVNA 4R97C 5FYLD 3G9VA 1FZOB 4UAOB 4WU7B 3TNMB 1FJ1A 1UH3A 5IGXL 5FOBB 3RVWC 1VERA 2GW5A 5F88A 1J7VR 1BPVA 4UDUA 3REWB 6FABH 1H8SA 3OZ9H 4K94H 4MD0A 3CCHB 4YDIH 4Y2DA 5HY9A 5D7LA 3ARQA 4DCQB 3LQAH 2FZ3A 3KLAB 3VFRA 5FFLA 1AGFA 2BSTA 2DM3A 3JWOH 2VB5A 2P8LB 4OCRL 4L8CB 3G5ZB 4NT6B 5CJBA 1RZKL 4OZHB 1E6OH 4GFTB 5D1ZC 5SWSE 1JZ5A 1U8MA 3JSSA 1T1XA 1XIWA 1GSMA 4XTRC 3CVHH 3U7WH 4NO2A 1T1ZA 4FQCL 1DN2A 3NABH 3NIGF 1DTUA 3TT1H 3LKOB 4CU8A 1RUKL 2H6PB 4PRAB 4PJ8C 2OTUB 3LV3A 1CD0A 3SGDH 1VFAB 5EN2B 1MCPH 2IPTL 1W72L 5TQ0L 2X9WA 1WBYB 4MLSA 4HW6A 1VFOA 2XFXB 4M6OH 2BK8A 1Q38A 4I0PA 4KROD 4ERSL 3OMZA 1M05A 5DR5H 5C0RL 5H2BB 2F54A 3MRRB 5F21B 4U1MA 3CC5B 1RVFH 5H37H 1QLFA 4M1DH 4OT1L 1IRAY 1K4CB 5DD1H 3L7FA 4DEPB 1Q8MA 2Q20A 4MAUL 1NAML 4OZGA 4QRPE 1TZIA 1PD6A 3OKMA 2ZUVA 3WIFA 4Q2ZA 2I9LA 1UFUA 4S1RL 3C2SA 3Q2CA 4YHKH 4O02H 2R0ZH 4GMSL 2F5BL 4HCRA 3KPSD 1F97A 5I8EB 5J9PB 4NM4H 3DTXB 1BFOB 4M5YL 1J1PL 1J0ZA 5DT1L 1FV1B 3TM6A 2VLME 1YY8A 1FZKB 3EDKA 4UT6H 4KPHH 4NNYA 3GSXB 5C0BA 4YGAB 1MFEH 1VKXA 3TFKC 4P2QE 3PGDB 1I1RA 1R24B 3OJVC 5HYQB 1AXSA 3RPIB 3WE6B 2DBJA 2IAMC 2C3VB 4F58L 3U2SB 2ATPB 5JNYB 3IFOA 3U9PH 3K0WA 2EIEA 5GGQH 4QF1A 3V6ZA 3QUXA 2BHUA 1FCGA 2ADGB 1NGZB 1G9NC 1PG7X 4R9HA 4PRHD 4HIJA 4XNUH 5KJRH 1TJIL 5C09B 4PJFA 3PWPA 5HHMD 1JZ2A 2IEPA 5KSVA 1VFBA 3OSKA 3HNTH 2NY6D 2RCSH 2YRLA 4Q9QL 1XCTB 3O3UN 3UEZA 2W65B 3BEVA 3OHXB 4Q74A 1FBIL 4HH8A 1P4LB 2LU4A 3FT2B 4BQ6A 3NH7H 4WI2A 4YK4C 2EDKA 4XAKE 5F7KC 4D9LL 5J12B 1EDQA 4FFZH 1E4XL 5IB2B 1R3LB 2FL5A 3RQ3A 4MDIB 4ZQKA 4FOMA 1PQZA 1AGDB 1IGCH 3HZYB 4K7PY 4C56E 3GMOB 4D8PB 3WHXA 1OSZB 1B4JL 4CMMB 3U30C 2MJWA 5SX4I 2B39A 4Y4KA 3ZE0F 1P4IL 1A7BA 5GIRA 4L3AA 1A0QH 4HULB 4Y4HD 4H26B 2FHCA 2HT4C 3MLXH 4ONFL 3EKCA 5GRJH 5HYSG 1A4KA 3J8F7 5LGJA 1BFVH 4X80L 3RWCA 4JPWH 5E2UL 3C6LA 5CJQL 5BZWA 1D5IL 4EN3C 1CIUA 2R9HD 5GZOC 2NTSP 3R1GH 1FYTB 3QI9B 1EHAA 2ERJC 1JN6B 1I7ZA 3BJ91 4C57C 2V17H 5F8RC 3UC0H 3KNBA 4OIIH 4XVSH 4DOHE 1J8HD 5E08L 5B39G 3VFOB 4NFBA 5J6GB 1CXFA 4I1NB 3V6BR 3KPRB 3BKYH 1VHPA 1VGEH 1F5WA 4Z7UF 4YHLH 1RMFH 1EXUA 2HG5A 5DEGA 4X6BA 1JP5A 3LEVH 3DBXB 4KI1A 1WJ3A 3HE6B 5CD3A 4M7LT 1CXLA 1EO5A 3ARXA 1PGRB 1ZXQA 5GRXG 4U1SB 2GKIA 4J2XA 3O6FA 5C0DA 1BJ8A 3VFVB 5ICYA 1XF4A 1BX2B 2GI7A 5ISZA 3GMNA 3WLBA 2YEZB 4GRWB 2E6QA 4IRSC 3MRQB 4ODHL 5L0QB 2WLZA 5I1LB 1P7KA 2XRAH 5EU6D 5JQ6L 2QQKL 3UO1L 2M26A 3IRZA 3FQXB 4GLRH 4ZOAA 2QADC 2VKXA 2UUDK 3LZFL 3FO2B 1G7IA 1OPGH 1OGAA 4UU9B 3UYOD 1MIMH 3TWCH 1QSEE 3RGVC 25C8L 1K9TA 5IESL 4XXCA 4HUUB 5K9QG 4NN7B 3BMWA 1WZKA 3L1OL 3STLB 3GNMH 3RTQC 3GBNL 5MEQB 2X41A 2CMRL 5ID0B 3DRTA 4ODXB 2VLJA 3RVWD 5D70L 2DM4A 4F15B 4E5XB 3L3DB 2FJFA 2GCYA 1G6RB 4OCYL 1CLCA 4U0RB 4YHOL 2ESVA 5DRNA 4OLZL 2N7BA 4RFOL 4O58H 1SYSB 3VGAB 3MRKB 3ALWA 5AAMA 5DZLA 5I75B 3VI4E 4UTAH 2NNAA 5F6IC 4WFEE 2VDOH 2W0KA 1YEGH 2HFFB 3NA9L 2YXFA 4HV8B 3RU8L 2VLKA 4JCLA 5FYKU 3TBTA 4UT9L 3OKDA 3CLFH 4KI5E 4MCYA 4PLKD 2AV7B 1UXWA 4ZO6A 4HUVB 4PJ8D 4GAFB 2RB8A 3NZHH 3BMVA 3EOBA 3ZDXF 2Q3ZA 5GRWA 3TBSB 4FXGB 5EOTA 3LQZB 1RZKC 1YNTB 4XCYB 3QWOB 3ZDYF 1CF8L 1OHQA 1ZA6B 4AMKL 4ZFOA 3GEWB 1XZ0A 4KUZH 1PYWB 3H3BC 4P23A 5DUPL 4IJ3B 2X4OA 1S78C 1OL0A 4HBCL 3SDCA 1HXYA 3BDYL 5T3ZL 1NANI 1QSFB 1S7SA 1LVEA 2P1YA 5IJVA 3S9DB 3HG1E 5E8NB 4U1NB 5EO9B 4XAWH 1I7TB 3GSWB 3D85D 4L4TD 4PRIE 2CIIB 1E28A 1WK0A 4NC1C 2NLJA 2HWZH 2ZUTA 1HQ4A 4BELD 1QFWL 3HE7C 3U4AA 3TT3L 3ZTJG 2BNQA 4HS3B 3H9SE 3QUYB 1FPTH 1UM4H 2FSEB 2Z93A 3ARPA 2JE8A 5DFTA 4OCXH 5BVJB 3TFKD 1PG7H 3HAEG 1FH5L 2AJYL 4ORGB 2NW3B 2OSLA 4RZCA 5DJXA 2H41A 2UVEA 2H8PA 5I74B 4PJBB 5JXEC 3S96B 5EH1A 4OF5A 3LD8B 5E94B 2NY1B 2IAMD 4K3EL 5B4MC 5C9JA 2A9MH 1Q9LB 1RUMH 2K9UA 3VGBA 3CFKA 5KANI 2C7UB 2IG2L 1HHJA 3HR6A 2MQ3A 1T20A 3GJEA 2LQRA 4NQDE 4O2FB 1R0AL 2QSQA 3N1QC 4RGMC 3R8BB 1KG0B 35C8H 4P5KB 3B5TA 1XGYH 4XC1H 1UM5L 4Y5XA 1CGWA 1MLCB 1XGQB 3KPMA 3EIFA 3DARA 2DQTH 3SOBH 4QNPF 1URLA 2NW2A 1S9KC 4MLIA 2QHLA 4N0YL 4U6YA 5EO0B 5E6IB 4GOSA 3ZDZF 3BPOB 3R8QA 1T83A 2X9YA 5MENA 2YBRA 3L5WB 1X5YA 1MCLA 5IHUH 4XVUC 4D2NA 5DEFB 1I3GH 4CADA 5CWSA 1WISA 5IP4A 5EZOH 4WCYH 1KLFA 5SWSB 1YECL 1OB1A 2RIKA 1FGNL 3BAEH 3HUJE 4AY0A 4Z7NE 4U7KA 3GK8L 4GKSB 3HAEH 4X4ME 4C56D 4FQXA 1EEZA 5BVPL 3WNOA 4ELME 2H9GA 3KLSA 4HDIA 3Q3GA 3V5KA 4MXWL 2BCKB 4N8VB 3WNLA 1D6EB 1GOFA 5KW9H 4IMKC 1WFNA 4MAYC 2Y36H 1INDH 2DLFL 3G08A 3GSQB 2YPKA 1Q0XL 1QFUL 1TVBA 3RY5A 4HPYH 2VWEC 5EO1A 4HZAA 3ZYZA 2NY4B 4EN3D 4JFEE 3MJGX 4XH2A 3RWDA 3L3IB 4F2MA 2AJSL 4HJGB 1KB5B 1FC1A 5E99L 1M7DA 4PBXA 3WD5L 2EDJA 2R56H 3DXAD 3C60B 4Z8FL 3VXQA 5K9KA 4LHUG 4MA1C 3NCFB 3PP4L 2O5XL 3V6OC 2DWDB 4NNXA 5FUZL 1AKJA 3CSPA 2IBZX 4KUCD 2C1PB 4QRPB 4Z7VE 3O81A 5C08A 4IDJH 4OBSA 3PQYA 1IAII 2IJ0C 2OJEB 3STZB 2BOCB 1SJEB 4OLXL 4OFDA 4OM1H 4JHWH 1HSAA 1K4DB 1L0QA 1BGXH 4F37F 3CH8A 1CVSC 1BJMA 4NRYB 3GSNH 4IRSD 1VADA 4P2QB 5HYJA 4D0CB 5LQBL 4OLUL 4M9PA 3LRGA 3OB8A 2R1XA 4CN4A 2QADD 4MQXC 1G9EA 4RWYH 5FB8A 2CKBL 2UYLB 5CJXA 1B2WL 4QXUL 4AK1A 1P1ZB 1JF5A 1J0YA 2E7CA 2HJKA 5C0AB 4RBPK 15C8H 4EBQH 3A6BL 2PYEA 2A9NH 4J4PA 3EYOA 5C0CA 2PW2A 1WBXA 3RTQD 1YEIL 1ZK9A 2Q86B 1NGQL 3EFDH 3WNNA 4YK4B 4JFXB 1JWSB 2XNAA 2A2QT 3VFTB 5DDHA 1A6AB 4CN6A 4HKJA 5JO5B 1NCCH 1ITBB 1WFUA 2DKSA 5TJWK 1CDHA 2D31B 4HIEA 3JTSB 4GQ9L 4OZGE 3DMMB 1K6QH 4RGOH 5DWUL 1FLRH 2J2ZA 1D9KC 4UOW0 5LWYH 1OOAA 1NKRA 1QBMH 3X14A 4LQFL 4PRDB 1LDPL 3CZFB 2GK0B 3CFDA 4BFGA 2UWEE 2P48B 1C8PA 5I6XB 1NMAH 5IUSA 2WWKO 3KYKH 1AJ7L 4JZNA 3VFWA 1P6AB 4K7FA 5IB1A 5C0BE 1G6RL 3MRPB 1BD2D 5ICZA 4ODUA 3P2TA 3P9LA 4XP5L 3F7YB 3EFFB 3M07A 1GPOH 3DI2B 4F3FA 1F4YL 3ULSB 3GI8H 5C6TL 5KVEH 1JGVL 2XT1B 5C2BH 3WIIL 3U7AA 4F7PA 1AO7D 1KLUB 5J11B 3LN5B 1DFBL 2DQIL 5AEAA 3ECBB 5GGVY 4CVZA 4WENB 3K8LA 1B0RB 4MVBC 1HH6B 4HZLB 4MD5A 4RNRB 3RIFK 4YNYB 3PWPE 2P5ED 2H32B 3HHRB 1S78D 3FQUB 4JQVA 4DOHB 4JFDD 2BSED 2VDML 1DANU 4PJXE 2P5WA 4LPTA 3IXTA 1WCBB 4XBPB 1LE5A 1B4RA 1DEDA 1T0NB 3QIWB 4LSQH 4RAUA 2X4SB 3UJIH 5BMFL 5JLZB 1MCHA 4G43B 1NH6A 5DMGD 3DROA 5C71A 1NSNH 1FFNA 1NMBH 3O2VH 4GKZB 2I60H 4NNPL 4NSKA 4TULH 4XP4L 3M17B 2XWJA 4P4RA 3NZ8B 2AJ3A 2R2HA 2DRUA 1UWXK 3HE7D 4DGIH 5GGSB 2VISA 1ZEAL 1X7QB 2BVUA 4M03A 5HDBF 1Y0LA 4PJCF 5DJ2B 2YPLA 1JGDA 1CDGA 1U42A 3IDYB 5BO1H 2AAVA 1IMHC 5AZEL 1MI5D 5I18H 2VXVL 3IS1X 4WI7A 3SKNA 4G3YL 4KV5E 3CDGA 1KTDA 3LMJH 3V79C 1MH5B 4UILL 4OI9A 1GOHA 4PJDA 5JXED 4D0DB 4U1JB 3LEXA 3KG5A 4OZIA 4NDMA 5B4MD 3RNQA 3RGVB 3IDIB 2AEQH 4OCSL 4YR6B 3TBVA 5T1KB 2E27L 1AC6A 2IQAA 3FRPA 4MJ4A 5EBGA 3E8UL 3HZVA 4X9FA 5GS1A 1QSEB 1MFBL 1T4KB 1RK0B 4FQ2H 1GAFH 2VQTA 1U8JA 4EQ2A 2AXFA 3BQUC 2EH7L 4H5SB 5EA0H 3VI3E 3M1BA 4I18A 5ID1A 3QZWB 2HJLB 4NGHL 2YKLH 2PO6C 5K93A 5IB3B 1DLHA 3LH2L 4X7FC 4LLYA 4AL8H 4X7DC 2O5ZL 5ETUB 2FNBA 4PR5A 3UJTH 2CK0L 2Q8AL 1AE6L 3IRPX 1NBZA 2B0SH 1TETH 3WS3A 3G6AA 5EPMB 3MV7E 5TE6H 4H20L 1IL1B 3SDXA 1OD9A 1K85A 4I3GA 4XHQA 4F9PA 3S34H 1W8OA 4LCUB 1KCUL 2Q6WA 2JIXA 4J3UA 2YD2A 1EFQA 4JFFA 2B2XH 2KQMA 5I8CB 5D96B 4NN6B 4DGYL 3O6ML 3OPZH 1QVOA 4M02A 2XN9D 4KK8D 3MODH 3SEPA 2ID5A 1C1EH 1YQVH 2D9CA 1I7UA 1JF1B 4TPRH 3QFDA 1A21A 5F9OL 5LGHH 4ALAL 4MAYD 4HUWB 3MLRL 5F97E 3IS0X 4BZYA 1D6VH 3EYUH 3CFCH 4MQTB 5HGAA 3RHWK 4UT7L 5BW7A 4OCMC 1QYGL 3MR9A 1KC5L 2GITA 4M48L 1HYRC 4FQJH 3ZKMC 4ZTPL 2WWMD 5HSFA 5I1CL 4RMUA 4QRUA 2I24N 1FRGH 5DMIL 1SMAA 3ZSTA 5D2LA 5GISH 4O51A 4DWHA 1A7NH 3MNVB 4KKLC 3FB6B 3GSVB 3BKML 3I6GB 3I3EA 2X4TB 5DO2D 3HMXH 2ADFH 2R0KL 3GBML 3HG1B 4QRTA 3T4AA 2UZYB 4X7SL 5DQDH 4DW2L 5HVFB 4LNRB 3HNVH 4QEGA 2GSIA 4PRIB 1YMMA 2G75B 5EBMB 1F4XH 4F7EB 3WJLA 1J5OH 1AP2A 2EIBA 5J6HA 4K3HA 1CICA 3RP1A 4XPAH 5CP7B 4NBXB 3H9SB 2PTUA 3QCVL 4N0FB 4PY7A 5FYLH 4KDTA 3C5ZD 2VOTA 3MRLA 5IV2A 5IW1A 3MA9L 2AK4A 3RWHA 2WIIB 5H35A 2F5AH 3SGKA 3SHSA 1J87A 1MWAH 1W0VB 3DGGA 4JKPH 2XTJD 3T65B 3A67H 1S5HB 5C0FA 3FO9A 4MQXD 5FHBH 3QHFL 1MHPH 4I48B 4M7KH 1BLNA 5DRWA 4RGND 2NX5D 1I8IB 3CDYA 1GGCL 5D7IE 5JIIA 3OAZH 4PTUA 2FH6A 3VXPA 1AIFB 3F12A 1KT2B 1MCRA 2GJ6D 3EHBD 3KXFD 1A7PH 4L8BB 3PWNA 3DO3A 3O3BA 4OZFB 1ONQB 3KLHC 2PXYB 1KNOB 5CUSL 1RULH 1IKNA 4L9LA 1BWWA 1NCDH 4KTEL 3QUKB 4FABH 1TVHA 2KPNA 4N68A 2DQUH 1EFXB 1HNGA 4NJAL 5DVNA 1FO0L 2EDBA 1WQVT 4MNHA 4ETQB 1DQQA 4P2OB 1D9KD 3U46B 1GZQB 1K8DB 4XPTH 2H3NA 4YE4L 5EZLA 5I73C 2VQUA 3QIUC 2EKSB 2BNQE 3MNZA 4HF5L 3ILPB 4ELMB 4DFIA 3FT4A 1XEDA 1U58A 4NRZA 5E9DA 1CFQB 2AP2A 3UTOA 5ACZB 1H15B 5TE7H 4GRLC 2DBLH 1IGJB 4Z78B 3F58L 3GIZL 1A6ZB 4N90D 3SKMA 1RZ8B 5GSRB 5IFHH 4WHTB 1KTKE 3DIFB 4X6DE 1E4WH 3PGCA 3P4OB 4MA3A 1PX3A 3AREA 4JFEB 4TUKH 3T2NL 5INDB 4XT1C 1MFDH 1VACB 4FTVA 1OQXA 2ZUSA 4LRIA 1QOKA 4MVBD 4MA1B 4JPKL 3VXRB 4HPOH 1Q72H 1IGIH 3KPQB 3W82A 3BRDA 4PJAF 2VABA 5ESQA 4OFYA 4DTGH 1FJ1B 4RDQG 5J0BA 1TTGA 1MVUA 1TZGH 4WW2F 3AUVA 1IC7H 4MD0B 4HFWB 3D18A 3G5VB 2FH8A 4Y2DB 3LDBB 1UCTA 3MYJA 2EYSA 5D7LB 2FZ3B 5DFVC 1FE8H 4LU5L 1A8JH 3D9AL 3DUSA 12E8H 1KB9K 1J8KA 1QSZA 3IAQA 2F74A 4QRRA 4PJEF 3DX9B 8CGTA 1T1XB 1XIWB 1U3JA 3BZEA 1T1ZB 5T3ZD 1LD9B 3VXSA 4J3XA 1F8TL 1MCOH 5HDQH 4Y16A 2Y5TA 5JDSA 4P5MA 2J4WH 2LU3A 2X1XR 5IG7A 3WKNA 2XICA 3IDXL 4YXHH 4ZFGH 1QNZH 2PNDA 1RFDH 5F3BA 1UB6B 2Y9RT 4LSSH 5IM7A 1TQCB 1ZHLB 3RWIB 4I0PB 1ORQA 3CK0H 4LLMA 1DN0A 2NR6C 1M05B 2W9DH 2A77H 3B2VH 3S7GA 4MNQE 1XH3B 2F54B 3HRZA 4ZD3L 1RU9H 1F58H 1S9VA 1QLFB 4QXTA 1QBAA 2V5MA 2LTQB 1N59B 2V5RA 4WI9A 3KLDA 2OI9C 3DHMA 4WHCA 4U2YA 1KPVB 3RBSA 5DJYA 3QQ3B 3ZT5A 1ZGLP 4OZGB 1S9YA 3T8XA 1U95B 5T3XL 1IM9A 3OKMB 5C08E 3WIFB 4BKLA 1J0IA 3CXHK 3V4PH 3NOIA 4CVUA 5EUOE 3LRSA 5DEZA 5I1GH 3S5LA 4DQOL 5L88L 1PG7W 3L5HA 4U6VL 3DVIA 3CMOL 1EEUA 3DVNA 2UWEB 3MV7D 2LABA 3SO3C 1FHGA 2WBJC 1EMTH 4QWWC 4YX2H 2F58H 2FCBA 5EU5B 1YY8B 3S6CA 1JGEA 1MAJA 4NNYB 5F6HI 5DD6A 5C0BB 1XAUA 3KPLB 1VKXB 4R2GB 4XNQA 2IALA 1MEXL 2EE3A 4IOSD 1AXSB 1I9IH 5I2IB 3QDMA 1LO0L 3IFOB 1YEJH 1T7WA 4G9FD 5DXWA 4MX7A 5DUML 5C09D 2FB4H 3V6ZB 3ZE1F 3QUXB 3N1MC 3IU3A 2O5YL 5KOVC 4HIJB 1IGML 2VH5H 1NDMB 3MJ7A 2PYEE 3RY6A 3PWPB 2WUBH 3V7AG 3MLVL 5C0CE 3ZKMD 5MEOB 1GIGH 4FQHA 1VFBB 5KSVB 4JO1L 1UADC 2EH8H 2VXUH 4ZPTB 3RZCA 4Q9RH 1XF1A 4W68A 5IR1A 2NY0C 1ZT1A 1AQKL 3CDCA 4KKLD 5F96H 3BEVB 3AS1A 1X4YA 1CL7H 1YY9D 1TENA 4LSTH 2MOVA 3WO3B 3NAAL 3X17A 3GM8A 1PKQE 1J10A 2ICES 1INEH 4FNLL 1CFBA 1KJ2A 4ZQKB 1PQZB 2HMID 4LCCA 3WO4B 5DD5H 1KN2H 4LRNH 5ADOH 4PS4L 4Y4KB 1OAQH 3ULVL 3GMRA 5CIPB 5GIRB 3PWUA 5IW6B 4PJIE 4TNWF 4JN1L 2ZCHH 3QJHA 3RAJL 1TITA 3SDAA 1AI1L 4LLUA 3O9WA 1QHPA 1A4KB 5LGJB 2VAJA 3QI9D 1C5CL 3BQUB 5T33H 3JBG7 4KH2A 1N64H 5BZWB 2BY2A 4YHML 1QR4A 3QDGD 1ED3A 1N4XL 3H7LA 4U1HA 4XP6L 5IVXF 5ECJE 1I7ZB 1A6WL 1KCLA 4G6KL 3KPRD 5EIIB 5GHWL 2GY5A 5T1MA 2EDYA 1XGRA 4WVRA 4PJ9A 4ZOBA 4FXLA 3TO4A 2R8SL 4BZ2L 3MV01 4K23L 3PGFL 1SEBA 2R2BA 2VZOA 4AG4H 4TVPE 1Q9WA 1UWEL 3GDBA 5DEGB 4X6BB 5FKAA 2HAZA 3K80A 4HKBA 5BRZA 2QQLH 3U0WH 1JRHH 3FN3A 2Q76A 5CD3B 1JHTA 4YDLC 3P3YA 4B5EA 3VH8G 4EI6B 5CCKL 3O4LA 3O6FB 4W70A 5E1AA 5C0DB 3QIUD 5JW3H 4GS7C 1CGVA 3BP6A 3IU4H 4Q9BA 5ICYB 1XF4B 4GXUN 4TSBH 4OGYH 4XNYL 3GMNB 2YPLE 3WLBB 2A73A 2DIAA 4HJ0C 2NXYB 4JM2C 4KXZI 2GJZB 3LS5L 4GKOA 4Y19A 5FYJE 1YUHA 1MFAH 4FXKA 2BY0A 3D39A 3L5JA 4NZJA 1T6WA 1WZMA 3S36X 1NUGA 2KBGA 4K8RL 5GRYA 4M43H 4LFHD 2P42B 3GO1H 3QO1A 4X8JB 2M8XA 4ZS7L 4DVBA 5CP3H 4HK0A 3DRTB 3U0TA 4J12A 4M9OA 5DVOA 4O4YH 1A7OL 1QLRB 3MX0A 5E8EA 3RFZC 3QA3A 4EUPG 2Q1EA 4JZJC 3MLUH 1NFDA 2FJFB 1CZ8H 2ZP0T 1JPSH 3MOAH 1EZVY 1AY1H 5FIEA 5GRVL 1X4ZA 2OMBA 1U2CA 3MXWH 1N5AA 3IJHA 4KHXH 4M3KB 2X4QA 4QOKA 3VU2A 2UY7A 4OM0H 3DVGA 1BBDL 1G9NH 3CUPA 3SDXE 3REVA 2DJSA 2VUYA 1UJTA 3OB0H 1PEWA 4NZUL 3BRFA 4D3CL 2W0FA 4IRZL 3SGEH 3HR5A 4JFFE 2GJJA 3UTSD 2JK5A 3DYPA 2VXQH 8FABA 2V2XB 4BH8B 1UB5A 2VLKB 5C9KA 4KQ3H 5MP6L 3OKDB 3HMWL 3LY6A 4MCYB 1RK1A 2N7AA 1R3JB 1QEWA 4NQSA 3SQBA 1IEAB 1IE5A 2HKFL 2X44D 4Y5VB 3EOBB 2GT9A 3OG6B 3V6FA 4ZXBC 2X4RA 1DBBH 5EOTB 1OCWL 2K1MA 3JZ7A 5KSAD 4PJHA 4E42A 1P7QA 2NR6D 2YN5A 1EHNA 2FYYA 5HHQA 1BQUA 2KZWA 3GIVA 3IGAA 3SKUD 4P23B 2YUVA 4U05A 2X4OB 3F7VA 2I5YH 3K2UH 4LVOB 4XMKH 3W2DH 1L7TL 4RDQF 3QFJE 1HXYB 1KJVA 3P4NA 4DK6A 1BIIA 2CLVA 1S7SB 3AM8A 3KJ6H 5CGTA 4R90L 5LXGH 3KPNA 4XPFL 2F8OA 2YD6A 4XPHH 2CIKB 5JIHA 3N1GC 1NDGA 3HI6H 2A83A 3RDTC 2X4PB 5I1HL 1MAMH 2GUOA 2E7LA 2DQHH 3NIGE 4K7PX 1YMME 3C08L 5J1SC 1E28B 1FNEA 2NLJB 4L8SA 1BQLL 1G7MA 3HC4H 4QHLA 1HQ4B 3NMEA 3QEHA 4KKCC 3TIDA 4KZEH 2WBJD 1OAKL 3OJMB 2FWOB 4JGMA 2BNQB 3BWAA 2W60B 4G7VH 2ITCA 2Z93B 3B9KA 2DQJL 1B0GB 5IROA 2AKRA 3FFCA 1FP5A 2AK4E 4EKXA 4HUXA 5DVLA 4I0KA 1N6QL 2WIMA 4RZCB 3PUCA 4M5ZH 5L9DH 4HXAH 2BDNH 3G6JF 3HFML 5C9JB 4Z77A 3DETC 4XHJC 4C54A 4YBLB 1I75A 3CFKB 3MRHB 2JELL 4JG0L 1FZMB 2IPKB 3DUHA 1OAZL 1HHJB 4HCRL 3TZVA 4JY4A 1WBZA 5E00A 1T20B 1IFHH 1V7MH 1WTLA 4BZ1H 5D2NA 2C9AA 3O3DA 4PG9B 3B9EA 4ZUSA 3IDJA 4H25B 4ZTOL 1INQA 5E6ID 1JPGA 3KPMB 4P59L 1DVFC 3FMGL 1ZGLB 1WTGT 2VLRE 4M93C 4U6YB 5DHVA 4IMLA 3V52H 3KYNA 1CD1A 1WV7T 4JAMA 4JEGB 5MENB 4YDJB 5I0ZA 5GRVK 1KJ3L 1KULA 3OJDB 1CIDA 3UBXG 2XWBA 1H3GA 1KUMA 4JRYA 4XCCH 4PTTB 5DA0B 3UTTD 5CWSB 5ITBL 3L3GA 3BD5A 3MJ8A 3QUZA 3O6KH 1QSVA 1E6JH 4XB8A 3TYFB 5KVGH 1R5WB 3MZGB 3TH2T 3ZKNC 1WT5A 4CKVX 4P4KA 3QWQB 4G8EA 4NHUB 3ELAT 4FQXB 1EEZB 1QRND 4L4VA 1RJYA 3GKWL 4XP9L 3EOTL 3W0WD 4HDIB 5JHDD 5LJYH 3Q3GB 3V5KB 1IJ9A 5E8DH 2NMSA 5K9JL 1ZHNB 1A14L 4WV1B 2NY4D 2P7TA 4Q6IC 3WCYA 1TJHH 4AIZB 3ROLB 3G08B 1WWWX 5TDPB 4X6FA 1TVBB 3QXAB 3QDAA 2VSCA 3LOWA 2VN4A 4P2RD 4XH2B 3MLWL 4FTVE 3MBEB 2JB5L 5FA4A 2ADIB 5LKNA 5C0EB 4GKNB 4JPVL 3E3QE 5K9KB 3EJZC 3NFPB 3QR2A 1EIBA 1BBJB 3MRJA 1AKJB 1Q1JL 3SE4A 3QXUA 3E3QC 5FXCH 1YMHB 4XNMA 4P46C 1ROWA 4Y5YA 4MNGE 5C08B 5CMAA 4ZUWA 1RZKH 5EUOB 3KPPB 3PQYB 3LEYL 4RISL 4Z9KB 1R3IL 4FQ1L 4MZ3A 3F8UB 4NQEA 3IFPA 1RIVL 4MWFB 4FQCH 1G84A 1HSAB 3SY0B 3NCYP 1R6VA 1YJDL 2XIDA 3L9RA 4HJ0D 1T22A 5JUEL 3S36H 3TA3A 1UJ3B 1VADB 2IPTH 4TTGA 1S9XA 1BQHG 4JM2D 5TQ0H 5EIQA 5FGBA 5L2JB 2R1XB 4LIQE 7FABL 1S7UA 1A3RL 4J6RL 5E8PB 5C0AD 4ERSH 2ICEA 4NZTL 3VGEA 3D6GA 5C0RH 4OD3L 3RWJA 3IJSA 5I8KH 4NOBA 4CDGC 4P3DB 4PFEA 3QCTL 4I4WA 1DQLL 3QIBA 2PYEB 4H88L 4AEIL 3MPCA 3S35X 3EYOB 2NY0B 4PJGA 4Z7UE 5C0CB 3VRIB 3S8WA 2NY3C 4E9LA 4PP2A 4MAUH 4WFGE 1DUYB 2RR3A 1KCRL 1J18A 1X5FA 2YA2A 1NAMH 1DZBA 3VG9C 1A5FL 1PLGL 2HFGH 3U4BL 5IQ7H 3QHZL 2HT3C 4PD4K 1DBKH 3LKRA 5GS2D 2EE6A 4HIEB 3LHPH 1PKQB 4LCYB 4KVNL 1QPXA 2IANA 1J1PH 2AJXL 1WFTA 5DT1H 5I1KL 3BW9A 3HAEA 2BY1A 4MDJA 4GAYA 4XCNA 1Q9KA 3IF1B 4M1GL 2PR4L 5HXMA 3HLAA 3QULB 3VXTA 2DQCH 4HAGA 2ORBL 5EOCH 1JNNH 1ZS8A 1K3ZA 3S4SG 2V5SA 5C07D 3SBWA 3VFWB 4NUGH 3IB4A 4OB5L 2X42A 2AJVH 4K7FB 2UUDH 3EDJA 4M4PA 4F58H 5IB1B 5ICZB 5E2VL 4Z0BH 4ODUB 4Y4FC 1DBAH 2SEBA 2R23A 2C26A 6CGTA 3R06B 4P9HL 3AY4C 3BISA 2AEPL 3QDME 1JPTH 4R96A 5I66A 5IEHB 2ZWLT 4EIZC 3UPAA 4UIKL 1JZ4A 1S7TB 4HIXL 4YDKL 1NBYA 4Q9QH 4HH9A 5CZXD 4LVNB 3GRWA 1GCFA 1B6DA 2BHZA 3EAKA 1QR1A 1L9NA 3QIWD 4MJ6B 2YD1A 1EVUA 4UNTA 5CGYC 4CVWA 3IXTB 1LE5B 2CXKA 1MELA 4DVRL 4RAUB 1XMWA 3I02B 4EI5A 3LQAC 1JNHA 3H6JA 1CFNA 2BOBB 5E5MA 3RDTD 4JRXA 4KGJA 4NSKB 4GS7B 4LLDA 3I2CL 1B4JH 1MCWM 3HPLA 2W0PA 2XWJB 4ZFOL 5DD0L 4NQCA 2AJ3B 2R2HB 3I75A 2DICA 1Y0LB 3BUYA 3BP5A 1CFSA 3ZDXE 2YPLB 2DTML 1JGDB 4PJ5E 4YDVA 3O8XD 1OAXL 3SKNB 1RZFH 3ZDYE 1UXSA 3MXVL 5T3XD 2JCCA 3T09A 4PJDB 1BWMA 4OZIB 4NDMB 1JK8B 4KUCF 3RNQB 5IMLA 1N6UA 4J8RA 2HN7A 4R8WL 4RRPA 4XHJD 3TBVB 2IQAB 3QNXA 3HZVB 1GOGA 1CDUA 5GS1B 1PDKA 1FDLL 4G8GA 1U8JB 2AXFB 1WLHA 1NC2D 5LVEA 3HI5L 3M1BB 4I18B 1RURL 2Y6SC 1WIPA 5EU4A 4L3EA 3OKEA 1DVFD 3PL6D 1DLHB 1JI2A 4FFWD 1ZWIB 5I1DA 1G7PA 4WEMB 2XY2A 2Y1VA 3AFLA 4QTHB 4X5XA 3MRGB 3P0YH 2CLZA 1I8KA 1FIEA 1UEMA 4I8DA 1NBZB 2BVQA 1QLEH 3WS3B 2ZJSL 2XKNB 3B8SA 4UV4L 1NGWA 3LIZH 3MROA 3SDXB 4QCIA 4ZAKA 5GGVL 3EJJX 2W38A 2VDKH 1TXKA 4IIQA 2AXHA 3O4LE 4ODHH 2EE2A 1JIBA 3ZKND 1PZ5A 3FZUD 4JFFB 3VXME 3VRJA 2NY5C 3BGFC 4Z7WF 5JQ6H 1AHWC 3UO1H 4TUJB 4WUUE 3KVQA 2VDQH 4ZXBB 5CS7A 5LBSL 2AQ1A 1NCWL 4BA8A 4Z0XA 1KENL 3LZFH 3QFDB 3MJ9L 2YZ8A 3X12A 1EEYA 5AUMB 4RWHA 3D39E 3BIAX 3ILQC 3L1OH 1HDMA 2AQ2A 5IHBA 1KOAA 2AV1A 2CMRH 3MR9B 5I8OH 1BAFL 5A2LH 3WJJC 3K4AA 3ZDZE 2GITB 3ULVD 1HQRA 4M8VA 2DIBA 4FQIH 5IFJB 3KDMA 5D70H 4ODSL 3RUGA 4AM0A 4LLAA 2AJUL 4P49A 1XR8A 4OCYH 1EBAA 1FAKT 2GY7B 2IGFH 3QFJB 4O51B 1F90H 1IC1A 4RFOH 3H3PL 4N0RA 1CLYL 5I19L 1DE4B 2MNUA 3ORJA 4JREC 4YO0A 3QCUL 3ARGA 3HNSL 3QEQE 1U93B 2C4FT 1LO2L 1U8QA 4OGXH 2HP4A 2W0LA 3WFHA 5E4EC 3NA9H 1YMMB 2DKUA 4FQLL 4U6XB 4AT6A 2PTTA 2NXZC 1K5NA 2DAVA 4WY7L 4E0RA 1AP2B 2XZQL 4HEPG 1CICB 4KK5C 2GSGB 5HDOA 5DMYA 2YUXA 4LGRB 4D9RE 1FZOA 4XVTH 4PY7B 1VPOH 4XWGL 5FOBA 2F19H 2QV2A 3MRLB 5IV2B 2AK4B 3RWHB 1KEGH 32C2B 1YEKL 4K9EL 5H35B 5CEZL 5F70A 3QNYA 2X1PA 4K71B 3S35H 3BYTA 3DGGB 1U8OB 1CF8H 5C6WH 5C0FB 3FO9B 1IM3B 1RIHL 2FIKB 3BH9B 4U6TA 2P8LA 1BLNB 3G5ZA 5DRWB 1FORL 2FIRT 2E7MA 3SGDI 1LEGB 2EYTB 1F2QA 4HBCH 1SEQH 4H8WL 4PTUB 1MCQA 3VXPB 4O5LH 1PVHA 5EZIH 5T3ZH 3F12B 3OF6A 4ZUTA 3LKOA 3O3BB 1YPZF 4PRAA 1E27A 2OTUA 2VLRB 2JJSA 5EN2A 2DYPB 2VUOA 4KJYA 1TVHB 2RFXB 1ZANL 3SDDC 2APXA 1NLDH 1QFWH 3PDGA 4MNHB 3TT3H 1DQQB 4TQEL 4X4ZA 4F8TA 4MA8L 3VW3L 4NIKB 5L6YH 1JMZA 5EZLB 3CC5A 1LO4H 3NN8A 2FJGB 2JJWA 2CRZA 4RMWA 3ARYA 3DSNA 4DK3A 1FH5H 2AJYH 3CGTA 1LHZA 4GXVH 1OP5K 1U58B 1VEOA 1YEHL 4K3EH 1T04B 4NRZB 4Q6IB 4X9IA 5E9DB 4MJID 4NFCA 4Y4FD 1I9RH 3QRGH