5F96H

Crystal structure of broadly neutralizing vh1-46 germline-derived cd4-binding site-directed antibody ch235.12 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
225
structure length
220
Chain Sequence
QVRLAQYGGGVKRLGATMTLSCVASGYTFNDYYIHWVRQAPGQGFELLGYIDPANGRPDYAGALRERLSFYRDKSMETLYMDLRSLRYDDTAMYYCVRNVGTAGSLLHYDHWGSGSPVIVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
total genus 44
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H01
4FXGA 4I9WE 2YMXL 4L5FL 2ADIB 3CU1A 1F00I 4JZOA 4QRRB 3QIWB 2P8PB 4JFHD 4FFZL 1JFQL 2ZOKB 3RBSA 3GMRB 2X4QB 2FYYA 1I7RA 2IPKA 1F3JB 1HNFA 1NCAL 3KPMB 3QFJA 5C08A 3BAEL 2F53A 4H88H 4R90L 1CQYA 1NLDH 2J8UF 1B3JA 3R0MA 4X4YA 2A1WL 4JANB 1I9JH 5ANME 2DKUA 3QCVH 2VOTA 4M8QB 3Q6FB 3FN3A 3D5OF 3MNVB 1WBZB 1GIGL 3WFEL 4X7SL 3QP3A 3MREA 5INDB 3E3QC 4KU1A 5JW3L 1UWEH 1I3GH 5FGCE 3GFUA 4XPGH 1MPAH 2YPVH 3DPBA 3S7GA 4NUGH 1HKLH 4GT7A 1D5XA 3L3OA 1QSEB 3EKCA 5IWLC 5L2KD 1S7SB 1WCBA 3AREB 1DVFC 1K2DA 2EXYD 3SE4C 2DQFB 1R5VB 2MTPA 4JM2C 4NO0D 4UIMA 2I5YL 4IOIA 4J3VA 3OAUH 4U1KB 3RNQB 1T83A 2VLJB 3RX8A 5BVJA 3RRQA 3I75B 4MD0B 5EUKA 3GBML 4L3AA 1PZ5B 4JG0L 3KLHD 4DVBA 2MSPA 4JFDE 2VLKE 2FX7L 3WN5A 2P46B 4APQA 4JQVA 5DSCB 1DVFD 1PEZA 5FKAB 5DT1H 2WBKA 3K3QA 5ENWA 1MF2H 5C6TH 3VFTA 1MEXH 5CILL 3G5VB 4P5KB 1QPXA 4PJ8D 3JUZA 3TF7C 4ZFGH 1YYMH 4QY8A 5ICYA 4CMHB 4PB9L 1KLFA 1QSFE 1SJEA 3WHXA 3QZWG 4LPTA 5GGSY 5DDHA 4ODWB 1XIWD 4RBPK 3TBTA 4CW1B 1QYGH 2DWDA 3KYKH 4DGVH 4E0RA 2FYYB 2IPKB 3MFGB 1OY3B 4XHJD 4XPFL 5E99H 5IFHH 1I8KA 1UB6B 3WO4B 4PJIA 2HRLA 2ZOLA 3B9VA 1RZIB 2JE8A 2AJSL 1FE8L 3QXUA 2ZUYA 3SGEH 3REWB 1IL1B 4RIRA 5DD1L 2BSTA 1F4WH 1PW3A 5J4MA 5HBBA 2VISB 3WS6A 3QNZA 4PJGE 1MCOH 1YEGL 5ESQB 5L9DL 4X6FB 3BO8A 1DBJL 4ZQKB 1JF5A 1I8IB 2W0LA 3RUGB 2R1XA 4HULB 1A3RH 3VFPA 1U8PB 2E9IA 3MBXL 3PV7A 4UB0H 1MCQA 5DI8A 3QUYC 3QI9B 1KJVB 4OUUA 4ZUVA 1UM5H 5ITFA 1A64A 3D85B 1XH3B 4HPYH 2NY0B 1G7LA 4OCWL 4XZUB 2OJEB 3JWOH 2VSCA 5E6ZA 4KVNH 4X7TB 4P2RE 2ED8A 3SPVA 2NX5A 2IADA 1SYSB 1V05A 1KULA 1LMKA 5LBSL 1KTDB 2EYRA 4JPIA 5F9JA 1OAYH 3EFFB 2BFVL 3HI1B 4PJIE 4ZS6C 1JTPA 4PJ7F 1BREA 5GISH 5DD3H 3O9WB 5HYQB 2E6JA 3P4LA 1YPZB 5FAAA 4ZUSB 2AXGB 4DKAA 4MAYD 3VH8G 4XHJC 3PWLB 4OLXL 3F7YB 2R23A 3CLFL 2XWBA 4ZNEA 3DV6B 2CKBL 4RISH 2DI8A 1RQ5A 1INEH 2HA1A 4UNVA 4OLVH 1UVQB 4JRYE 1U8HA 1MIMH 3PQYB 2A6IA 3VE0B 4YX2H 1YY9C 4H5SB 2BXZA 4Z7VF 4A2LA 1IM9D 4GJTB 4P5MB 5IGXH 1VACA 1M71A 4YBHA 5IVNA 1T20B 3CFJB 1Q0XH 3C60B 4Q58C 5CIPB 1HINL 4MHHI 5GPRA 2RFXB 5JOFA 3RWEB 2W60A 4DQOH 1BVKA 4U1LA 4JLRB 4PJGA 3MJ8A 5D1XB 3O6FA 2GSIB 1QSED 4QTHA 4UT6L 4EI5A 2X4OA 3SKJL 5J11B 4BM7A 1JZ5A 5A43C 3GRWA 4IMLA 1B4JL 4IRJC 1A3LL 3BPCA 2VYRE 3PDGA 5HGDA 3D3VE 3QXVA 1OB1B 3ORJA 4YHKH 3VWKC 1FO0B 3S3SA 5FYJH 3L5XL 4P2OB 2BRRL 5HGAB 1A7PL 2W07A 2AQ1A 3KPPB 3IDGB 1IGFH 4A6YB 4N0UB 3MREB 4XNMA 4YAQB 2LV4A 4M6OL 4O02L 4JO2L 2AEPL 3UTSB 4AENB 3MJ6A 4BELD 4DGYH 5JUEL 1KJ3L 1RJLB 4HF5H 2DIBA 4HKZB 3VE0A 1CT8B 3OF6D 1LO3L 3ZKMC 2DTML 3TNNB 5CLWA 3W39A 1OTSC 1CZ8H 5D1ZA 2WUCH 1BIHA 1A5FH 3QIUD 3MROA 4WTWA 4ZUSA 3ZSSA 5IVZA 1EHLH 4XCFH 4FQ1H 2WMPA 4KRPB 5L6YH 3QUMH 3FQWB 1DBKL 2ESVD 5LJYH 3F6LA 4QXGL 3S35L 4CN6A 1KN4H 3F12B 5TFSH 2AXFB 4S1QH 1FJ1A 2OTWA 1CE6B 3VXTB 1U8LB 2VC2L 4OGXH 1MIML 1WIOA 2D0FA 4IRSA 3SDDC 3VFMA 2FIKB 4HCRH 3ZYIA 2DM7A 3QR2A 5TQ2H 1UM4H 4L4TD 2F54B 3MLSL 1WTLA 1ND0A 4KMTH 4X6CB 3IS0X 5T3ZL 2AK1H 1IC5L 2J6EL 1JF6A 3MX0A 3NFSL 1YDPB 5E03A 1TQBB 3IU4L 5DS8A 3VD4A 4F57L 3OV6A 4C4KT 3HRPA 2ZZUT 2VIRA 3GRWL 5L8LB 4HS8H 1A1OA 1CN4A 1KBGL 5KG9A 1KPUA 4QHLA 3S5LA 4HMEA 1ADQA 4ODWA 3V7AG 3EGSB 3F7VB 3C2SA 4KVNL 4FZEL 2JELL 1T5XA 4PRPD 1MJ8H 3D69B 4P5TA 4ZXBC 2Q8AH 5FYJE 5ISZA 2UYLA 4PJBE 1IE5A 2Y4SA 1KN2L 1OGTB 3G5VA 3FT3A 2K9UA 5HGDB 5EO0B 4MX7B 5IK3B 4DKEH 5T3XD 3CMOL 1IKNC 4LSVH 1YN7A 3OKDA 3TT3H 4XCNA 3EDKA 1HHIB 1UWXH 4L8BA 3KPRD 3GMMB 2AI0L 2D7OA 1IGYA 4NSKA 3C9NB 5GIRA 5A16A 1SYSA 2V5RA 5DJ6A 2ATKB 1KFAH 2VDNL 4GAGL 3SO3C 3LDBB 5HVHB 1DQMH 2HVKA 5JORB 4RAUB 1FFOB 1U6AH 1A7NH 1OCWH 5B38G 1KXQE 4X99A 5JZ7C 3DRTA 3CX5J 5L2JB 4ZUTB 2HTLC 4GFTB 4NN7B 3MV9E 1DE4A 2OK0L 2R0ZL 3VXMD 2G75A 2ADGA 1LO5B 3HZYB 3GHEH 2HJFB 3HG1D 1YPZE 3BMVA 5ADOL 2GUOA 4X6DF 1KXTB 5B8CC 1WK0A 1WZKA 1VADA 3LB6D 3D18A 1JP5A 4JDTH 3ZLQC 2PO6B 4RX4D 4WV1C 5FF6A 1ZVYA 3WNPA 3DV6A 3FTGA 3E6HA 3SDYL 5D6DA 3TH4T 5DRXB 1ZS8B 4NZDA 4KKCD 5IROA 1R24B 4HDIB 4PRBA 3S96A 2HWZL 4WTXA 2YK1H 3QULA 1ADQL 5F1KC 1IRAY 1T0NA 3L3DA 4I1NB 4U1IA 5FO9A 4CU6A 2R1YA 2R29H 4U6YA 4YDLC 1ZA6B 2WWMD 2PYEA 3NAAL 5F89B 1JUFA 4NUGL 3EZ8A 4F37F 3HC0A 4LLWA 3SOBH 2NY6B 1UM4L 4FQHB 4PJ7B 4X6BA 4M7JL 4Y4KD 4YDVB 4ZAKA 2MPAL 4BZ1H 2RJMA 1GGBL 4DVBB 2R2EB 3PQYA 3H6JA 4GRLC 4QXGH 5TPWH 4P2RB 3UZEA 3T0VA 1L6XA 3N85L 2JIXB 4NHUB 3WDHA 4YE4H 4CADB 5BQ7A 5MEOA 2P5WE 5KSBF 4JKMA 6FABL 2CDEB 3HN3A 3NA9L 5K9QG 5HDQL 3ZL4H 1A7OH 3G6DH 1I4FB 5I8CB 3RJDA 5F97E 3VFWB 5H37G 1QBLH 4U6VH 4Y5YC 5E7BA 4C56D 4RMRA 1U6AL 3BO8B 3WDJA 1XFPA 1MJ8L 1HQRB 2APTA 4GS7C 2R0LH 3GI9L 4LMQE 3QZWA 5DQDH 1KTRL 3VXSA 5LVEA 2Q7NA 3NIFE 3GM8A 2EKJA 3NIDF 5J56B 1D9KC 5I17B 1DQTA 2UZIL 5TQ0H 3M07A 3WBDA 3BUYB 3AY4A 1V3KA 4D9QD 3KPTA 5GS3A 3KYMB 5EN2A 3B6SA 2IALA 5HYIA 2CK2A 3K0WA 4K94L 3ARED 5DEZA 1MWAH 4HC1H 5FV2A 4JPWH 2I9TB 4MNQE 3FTGB 4C4KO 3IDMA 4ALAH 5ICZB 4OD1H 4NO2B 5I71C 5C0CD 1J10A 1X4YA 2EDHA 3WYRA 3V6ZA 1CXFA 1AGFA 5F6HI 1P5UA 4F3FA 4MQSB 1YA5A 1L7TL 4GMSH 2C4FU 2VXSL 3IB4A 4PS4L 4UV7L 5E5RB 1GGBH 3ILQC 2HT2D 3R8QA 2OR9H 3G9AB 5KG9B 1IKFH 2IGFH 4LCWE 4QCIA 1NCCL 2MQCA 3FONB 5AYUH 3UDWC 5TDNB 5CD3A 3TYGL 4R8WH 4WW2A 1HOCA 3VFGL 2AXFA 4D94A 5F72S 4PJCF 1YDPA 3HAEA 4NC1E 3SDCB 3KXFE 3ULVF 1J1XL 4NWUH 4X5LA 5I75B 1R6VA 5T1DH 1A0QH 2AK4A 1MCEA 3U79A 4HS3A 2OSLB 3V5KA 2WM0A 3KDMB 3U2SB 3U7AA 3ARPA 1VFBA 3OKMA 2CLVA 3JTSA 4TUOA 3RVTD 3RZWA 3JBG7 1ES0B 2X4OB 1D9KB 2ICWJ 5IEHA 2ICEA 4DGIH 5ADPL 4XPHL 3IFNL 3IXTA 4ZAKD 3O6KL 1NMAH 2VDQL 2XN9B 3BUTA 4G80B 3TYFA 4ZUWA 4EVNB 5I1DA 3LVEA 4F58H 4OZGF 4JRXA 2IWGA 4MJIE 4Z78A 1RU9L 1A7QH 5GRWA 1GZPB 3MOBH 4Y5YB 1A9BA 1RULL 4GRWE 5DUBA 5T33H 3N9GH 4QRSB 4HJGA 3V0WL 2B8OT 2A9NL 2XT1B 4ZNEE 1DCLA 2D4DA 4R97B 4F37K 1Q94B 1I9EA 3LPWA 3KPRE 5E6IB 3NIGF 5DC4B 3LN5B 5FM5O 4RX4A 1J5OH 1QSZA 2HJFA 3SJVA 4N0FA 3BP4A 3RKDC 3EYSH 3MRGB 3OKOA 2X4PA 4TN9A 1JFQH 1S7RB 1SJHA 1QNZL 3HZKB 1YEEL 1UXWA 3HG1A 1HSBA 1BF8A 2X1WL 2Y06H 1FZMB 5JDJA 2YC1B 1M7IB 4JFYB 4PJ7E 3T3PF 2MFNA 1A6UL 1OGAB 5DUPL 2AABH 4F3FB 1JWUA 5FO8A 4NJAL 2B4CH 3T4AB 3B8SA 4PB0H 3GNML 3AB0B 5C7XH 3DX9B 1WZ1H 3GSOA 5JOPE 1ED3A 3HR5B 3OZ9L 3BFOA 3LV3B 4PJ8B 1HILB 4JJ5A 3PWNA 1FC1A 1R24A 1YYML 4PRBB 1MCWW 1I85C 3HFMH 1NMBH 1U8KA 4XCEA 3U7YH 3EJJX 3SDXF 1D5ZA 1BFSA 5MP6L 3LKPB 1P4IL 1EGJA 1LDPH 4OZ4B 4XNQA 4ZUUB 5FV1L 3E8UL 1GHFH 1RZIA 4JCMA 3P4OA 4JO4H 2BY1A 1BBDH 5IQ9A 5HI5D 4F7CA 3MMEB 4L8CB 4XZUA 2ADIA 3BISA 4HT1L 2XNAB 4P9MH 3RTQA 5IV2B 3SO3B 4PRHE 3S96B 2H26A 3KPQA 3H9HA 3P4NB 1EUTA 1B0GA 2F54E 3CMGA 4U1JB 1FIGL 1A6TB 4QTIL 4ZO7A 3KHQA 1K8DA 5C09D 4FABL 1SBSH 2E7HA 4H20H 4LRNL 4RRPA 4E41A 4BKLB 4JZOB 1HYSD 1AXSA 2O5YH 4N8VA 2HAZA 4XP1L 2DLFH 1EEZA 4ORGB 1GGCH 1KF9B 2R69H 5I1JH 1INQB 4ZDHB 1MCRA 4KJYB 1ZOXA 3U1SH 3D85D 2IBGA 5FHAL 3T0AA 3D6GA 1JNNH 1EEUA 1LO2H 1BAFH 5F7NC 2CRMA 4ELKB 3P11H 5E2TH 3OB0K 4M8QA 4IRSD 1K2DB 3MRHB 3BP4B 5HYFA 4Z5RA 1RULH 5JLZA 1AGBA 3MZGB 4MX7A 1W2KT 3KLAA 2ARJQ 4WO4B 3SCMA 4L4VE 4C83B 3H3PH 1QEWA 1A6VL 43CAB 4Y1AD 2Z8SA 5F7LB 2DYPD 3C8KA 4XNZC 1WITA 5HGGS 2DMKA 4N9GB 3LRHA 1ONQA 1AKJD 4Y5VB 2Q86B 1D5ZB 4JM2A 3H9SB 3ULUH 3EYFA 4IS6A 4LSPL 1DBML 4DGVL 4G9DA 1T83C 3SKOA 5DURB 4S2SB 4JREC 3GB7B 3M1BB 2D31A 1FAIH 3TLRA 1AI1H 2HT4C 3OF6A 5EZJA 2DQFA 3BGMA 2XKNA 3BWUC 5EZIH 5C8JB 1EHXA 3GHBH 4EEEA 12E8L 1T3FA 1FRGL 3STZA 2NXYD 1Q72L 4RNRA 1X5JA 3MV01 5FOBA 3FQNB 4ELMF 3DURB 4XVSH 4KRPC 2EE9A 4FQJL 3RKPA 1IGJB 1CR9H 4KK5C 1E6OH 1LEIA 5IMOA 4YZFE 1RZ8B 3G6AB 2X44D 4HQQL 4MXQD 1YNKL 1T0PB 3BRFA 3RP1A 4Q9RH 3O3DB 3TWCH 3BMWA 3GSNL 4BSVB 5GGRB 3NH7L 1CU4H 2E7LA 3O6FD 1AD9A 4XCYB 3WFBL 4I48B 3KPQB 4EIZC 3BKCL 1LE9B 3NIGE 1OP3H 3P9MA 3DVNA 3T3MF 3NCEB 1T2XA 3TA3B 1L6ZA 1OARH 1JN6A 5D2NA 5DD3L 1MJ7H 4W81A 2C3GA 4GSDH 3ARGA 1SY6A 4KKNA 4QRUA 1ZLUK 1QFHA 3JTTA 1U42A 3U9PL 4P49A 4GKNA 4XBGB 1D5BA 4I5BA 1QEWB 2P8LA 3TT1H 2RR3A 1FZKA 4PRHB 3DX7B 4BUHA 1BLNA 4EQ3A 5C0RH 4XPBH 3LKQB 3ULVC 5CINL 3WFHB 4X4YB 3PDOA 1KTDA 3OB8A 4TPRH 2N1KA 3QFDB 1HWGB 1MVFA 4EIGB 1RIVH 1UXSB 4OCSL 3BESR 3VFNA 2N56A 3UPCA 4PREA 1F3RB 3O3EA 2P43B 3G08A 4UQ2A 4POZD 2EH7L 1T03L 3QEGH 1U3HB 3U0PB 5KBNC 4X6EA 3TEUA 3ULVE 5AZEH 1A6PA 5EU6E 1IQWL 4K8RC 4RGND 1MELA 1G7JA 5TDPA 5I8EB 2YBRB 1K5NB 1IGML 3ARBB 4G5ZH 4WIQA 1XR8A 5FK9B 4GO6B 4G6AD 2R0LL 5D7JC 4KVCH 2X4TA 1S7SA 4KDTA 4YHZH 1AHWC 3O8XB 3RVUC 4LLUA 4LLQB 3B2VL 1VACB 1RJZA 2VWEC 3NH7H 1CICD 3QDJD 4M00A 4ONFL 1U8JB 2B1HL 2QKIB 2BVQA 5A2LH 3GMLA 5EWIL 4UU9B 4KJPC 5FHAH 5CZVL 5MENA 2VQ1A 1U8QB 4S1QL 4Z9KB 1OAUH 5DTFB 5GRZA 1MRFH 3ZE2F 2MWCA 2Y25A 1KN4L 2W0FB 3TN0C 5KSAD 3CFBB 4LLMA 1NBQA 4TSAL 4RGNB 1MF2L 5C6TL 15C8L 1CXIA 3BGFC 3F62A 2AXJA 1TQCB 3CFKA 1RUML 1WC7A 4JRYB 3GO1H 1BZ9A 1H0DA 5BS0A 2XQBL 5ICXB 2DL9A 1CBVL 1NLBH 4O2FA 3OTTA 3KPPA 3EIFA 1D5BB 3VG9C 3I6KA 1N7ML 1MIEH 3QUYB 2XI9A 1XF2A 4KFZC 3QUXD 3EYOB 1DR9A 3ROOA 5DEGB 4WCYL 3GSNB 4X8JB 5HYJD 4G43A 4IOSD 5I30H 3BPCB 3SKNA 5C1MB 5IHZA 4AMKH 1C12B 1N64L 4XXDA 4Z95L 4NZTL 4AK1A 4UOW1 3V6FB 3ULUE 1U8JA 1AXSB 3U36A 3MJ8B 5D1XA 5H2BB 4X6CE 1RK0B 3JWDC 3MO1A 1FL6A 1HHHB 3NZ8A 3BRGC 4PLOB 3DBXB 2E8YA 3O2DL 4KZDL 5D1QC 1QRKA 3ZKXC 5FM5M 1UACL 1C5BL 2DDQL 4QHKI 3RY4A 1HNGA 4Y1AE 4IDLA 3S34L 4MNQD 1NGPH 1NMAL 5D5MB 2F58L 3IU3B 4PJEA 3NPSB 1EJOH 1BZ7B 3KLDA 1ZLVK 4JJHA 1MFNA 5MENB 1RZKH 3C5JB 1MEXL 1Y0LA 4PGCB 5CILH 3JV5A 1ZHNB 4WHYG 1W0VA 2NXYC 5CZKA 1OTSD 3LKOA 2R39A 2R8SH 4NHCH 5D7IA 5MERB 4UQ3B 2D31B 4JRXE 2X4RB 2YD8A 3CXDH 3SKNB 1W0YT 1N8ZA 2ADJA 4AIZB 2YK1L 2BNRE 2N7BA 5DQ9B 4EDWL 3MJ9H 3IFPA 4FFWD 3MNWB 3SKUD 4X6DE 3K46A 4DKEL 4AJ0A 4GG6B 1RUAH 3C8KB 2VDRH 3QDJA 5DD5H 1XT5A 3I6GB 2IGFL 5EU6B 3FB7B 4KKLD 1U8QA 2XQBH 1GXEA 4HK0A 1IGIL 5IVXB 5FKPA 1GAFL 1SY6H 4RNRB 3ZDXF 1XGPB 4OGAC 4RFNB 4WEBH 2FD6L 4R6UA 2FEEI 4I3SH 1XGYL 5DD0L 3VXRA 3SE3A 1YY9D 2CDEA 2Y23A 4O5LL 4OKVA 3BIKA 2GQHA 4N1CA 2NY1D 5D5MA 4P4RB 1R5WA 1P69B 5I1CH 2IF7A 2JF1A 5DYOB 4D9RD 4OLWL 4PRDB 5SWQB 4F80A 1YQ2A 3CUPB 2XA8L 5D8JL 5MEPB 3T77A 2UY6A 3VXSE 3FQRA 4DVRH 4KK8C 1KCLA 3HPJB 4ZXBA 1E0OB 2G5BB 4JN1H 3ESVF 4EN3D 2CD0A 4KKBC 1HDMB 3MA9H 1GGYA 3ALPA 4LSTH 3R4DA 3GSQA 3MJ7A 1ORSA 4AEIH 3QQ4B 4O4YL 5DD1H 3EYUL 4G8GB 1CIDA 3ARGD 3C6LC 3QDME 3PNWA 1BLNB 3OPZL 4KY1H 1OAYL 2KKQA 2VXUL 4PGDB 1CD1A 3FB7A 4MAYC 2UYLB 4HT1H 5D7JA 5INCB 1ADQH 1ZVSB 4WDIA 1IAKB 1MLBA 1YEKL 1RJYB 2AKRA 4NN6C 4L4VD 3FMGL 5BO1L 2NY7H 2OP4H 2CUHA 3VMNA 1FYTA 2P8MA 4M6AA 4RGNE 1N5AA 2BDNL 4YUEH 4LDEB 4POYA 2XWTA 4TRPH 5CEYA 3WHE1 1T80A 3RNQA 4JO1L 3U6RB 1KOAA 1FZKB 4PRHA 5CJBA 4Y16B 4H20L 5B8CA 1EZVY 3IETA 3NFNA 1AIFB 2KZWA 3ARBA 5FK9A 1BOGB 3MV7D 2X4TB 2P5WB 5DD5L 3ZTNH 3PWJB 5TH2A 3QEHA 5F1IA 4BSWB 1GSMA 4D9LL 3O41B 1FAIL 4HKXA 3HA0A 4NJAH 1GC1L 3CVHA 1V7NL 1MVUB 2VXQH 4UU9A 2NLJB 3CZJA 5I75C 1X9QA 4Z7WB 1IGTB 1Q9KB 1F8TH 4EJ1C 1KJ2A 3SO5A 3MLSH 1J1XH 3STZB 3TPKA 1QHPA 4HCRL 4HGKC 3BEWB 4N0CD 2DBLH 1MHPL 4Q6IB 1A6VH 1EJ6A 1I8MA 5HGHB 1E4XL 1BX2B 4K7FB 4HLZG 4D0DB 4UAOB 3CFKB 3CFCH 4LSSL 4DCQA 3QJFB 3VRIA 5DWUL 1JZ6A 3S97C 2YPKA 4FOMA 5TFSL 1IC7H 3F8UB 1RZFL 5ITBH 3LPGA 3QIWA 1I8LA 5DT1L 5I71B 2X09A 1DSFL 3QXWA 3I6KB 4OFIA 5DFTA 5F9OH 3QG6B 3LRGA 1G9MH 4LF3B 2DTMH 1O0VA 3HLAA 2A1WH 2X1QA 4Z0BL 4PJFF 4X4MA 1NFDF 5IJVB 1HK6A 3EFFA 3EYVA 3RGVD 4U49A 2AJXL 3VFWA 1S5IH 1M6OB 2EC9T 2EYSA 4GRMB 1IZJA 1K4DA 4MJ5B 4PJBB 3L3GA 3QCUH 2C4XA 5ESVB 1A14L 1KCVH 4DGIL 3EYSL 3QO0A 5CWSB 1XGUB 1IGCL 3NN8B 2F8VA 4OKDA 2VLMD 4JHWH 4EKXA 3KPSE 4G43B 2GCYA 3RWIA 4OGYH 4DKDC 2YA2A 4P2CG 2XQYK 1CU4L 2R0WL 1PY9A 1SMAA 4QF1A 3F7QA 3IGAB 3FT4A 5LGJB 3RU8H 1OF2A 3ECBB 1I3RB 4F7PA 5KTEL 1GPOL 5F9DC 1FGVL 3RBGA 3TIEB 5J1SC 3JWOC 1UEYA 3UTTD 1QSEE 2BVYA 4R4FH 5EBGA 5TDPB 1W0VB 3RNKB 5EO9A 1OLZA 1KNOA 1R3LA 4FHBD 2YD7A 4XPHH 1ODAA 5J89A 1SVZA 3GNMH 5C7XL 2F9BT 2NY6C 1X5XA 4KQ4L 5AYQA 2Y36L 3P4OB 3O2VL 1I1AD 4TUOB 1QFWI 2ZNXA 1FDLL 3GSWB 5DVKA 3CXHK 3O9WD 3SQBA 4O4YH 2EYSB 2Y7QB 3A6CL 1F5WA 3IDMB 5DUPH 1KTLB 2DOCA 3VRLF 4QO1A 2DJSA 1NUGA 1S9XB 1MLCB 1U2HA 3CH8A 1LQSR 1S7WA 2DI7A 3AAZB 5EC1B 3L3HB 2GJZA 2CUMA 2EEAA 4J4PC 3FB6A 2OI9C 2GY7B 4MQXC 3DETC 3GI8L 5HDBF 3T0EA 1R3HA 2XTJB 4LLAA 4W68A 32C2A 1XIWB 1H3PH 1IQWH 4YC2B 3PV6A 5IBUG 1FH5H 1KCKA 5F7MC 1NMBL 3U7YL 4G3YL 2FO1A 4P4RA 4U4BA 1NGYB 3PWUA 3NGBC 2IFGA 3ARTA 4M9OA 3NFPA 1HHKA 4Z7NE 1EX0A 4QOKB 5EUOB 5IG7B 3LQZA 4NN7C 5F96H 3OXSA 4F15C 3VG0H 4XB7A 4MD4A 1AQKH 1A9BB 3B43A 4OLUH 1A7BA 4LKXA 4X83A 3WKMH 2R0ZH 4F33A 3BWAB 3VXUD 5CEZL 4J2XA 5BVPH 4FP8H 1R3JB 1KIPB 4R4BA 3GK8L 4H8WC 2GJJA 3WJLA 2MKLC 3U4BL 5INCA 3NPSC 4PJ5B 2Z31D 1N26A 1T1WB 3SOBL 3L5XH 4M7KH 5GS1A 1G7MA 1INEL 5I8OH 4JFDB 5K9KB 2DKSA 4JPVH 1RIHH 3CDCA 3VWJA 3O3BB 4GRWH 5T1KB 3KPRB 4PV8A 2XWTB 1QD0A 1FNAA 3HR5A 2LFGA 4DKFH 1A1OB 1EH9A 1ZT1A 1O5DT 2UZXB 1LO2L 2HWZH 1JGUH 3AS3A 3O0RH 4RDQG 1MQKL 5DHVH 1ZT7A 3CK0L 3U0WH 3UTSE 1MCPH 4FQIL 1ZVSA 5D71H 2IADB 5SX4I 4CBPA 1IT9L 4KRNA 3GKZA 2CMRL 1FORH 3CX2A 2ED9A 5DO2C 5F7UA 5JZ7D 4U05A 5IT2L 5FDWB 3DUHA 4OZIE 4JFDD 4DUVA 2VDRL 2W60B 3TH2T 1H9VA 1DBMH 4MA7H 4JZJB 1U58A 2V17L 1K6QL 2O5XH 2ZUUA 4S10A 1OAQL 1NEUA 3L5WB 4EXPX 4HS3B 3MLRL 4KUZL 1XR9A 4U1NA 5JDSB 3R1GH 3WNLA 5F1SA 5A3ID 4IRZL 3P77B 1KLGB 1ZHKA 5A1AA 3A6CH 4M6ML 1RUMH 1JWMB 1I75A 1OSPH 2R23B 5IFJA 3I50L 2MQ3A 1C08A 1NDMA 4RA3A 2PCPB 5ILTL 3MV7A 5IM7B 4F9LA 2XACC 1KGCE 5CIPH 1PGRB 5EDXA 4ZO9A 3TYFB 1QP1A 1T22B 4HIEB 4LSVL 5SWSE 2DWEA 4PRHD 3S35H 1AHWB 2XY2A 4RBPH 4M1CD 1KCSL 4JY5H 3ARBC 2CLVB 3JTSB 4C56A 4OD1L 3D18B 4KJYA 3MFFB 2GEEA 5GGSA 5C0IB 4Y5XC 5LCVL 5T33L 2R56L 5J12C 1XGYH 5DD0H 3BZ4A 1IBGH 3HHRB 1CXHA 5GSRA 3EHBC 3OKNB 1NGWB 1Q0YH 5CSGA 4KGLA 2P5EE 4OUUB 2VZVA 1ZANL 1OQOA 2F5AL 4N5EC 5DGQA 2JKXA 1MCWM 4HIHA 4OZGE 3VWKB 4U1MB 3WNOA 3ULVH 1CLZH 3HS0A 3PWPB 2GAZB 1RFDL 3NABL 5MHSD 4ESKA 5FUOH 4ZTPL 3UYOD 1SQ2N 3TWCL 2CO6B 3W0WE 3UTPE 1QBML 2CIIB 1T1ZA 1A21A 5EU6D 2BSSB 5EU7C 5HPMB 1F3DJ 1T4KB 4JDTL 4NNPL 4MDJA 2W9EH 2OL3H 2DI9A 4MAYB 2X4PB 3SDDD 4WWKD 5I1IL 5KSVA 5A3IC 2VL5A 1NANH 3RHWF 3G5YA 3H3KA 4MD5B 1WZ1L 5H35B 4C56E 3O0RL 4LSUL 1TETH 5GGRY 2V9QA 3W11D 5BJTA 3I3EA 1RUPL 1JPST 3MRKA 5CEXA 2IAMB 1NKRA 2ZCHH 4GXUM 2I27N 5EZLB 3U83A 1NMCC 1B4RA 2DQCH 3TIDA 3KHOA 4HWNA 4XBEL 3S88L 3B2VH 2E7LC 4IRSC 1T04B 4UDTA 3GIZL 2FIKA 3WNMA 1W0WB 4WUUB 3ZKMD 3QG7L 3KJ6H 4BSVA 1GOFA 2P8LB 2HFGH 9CGTA 4PJ9A 1EEYB 3KNBB 3SBWC 4ONGL 5SWZD 4IMKA 1FSKB 4OBRA 2PW1B 5E8DH 5E1AB 2ZCLH 2Z35A 4NM4L 1U93B 4URTB 1C7SA 3EO9H 4OM1H 5DUMH 3KGRA 2Y72A 1T7XA 5EO0A 4ETYA 5I66A 4WUUE 1HHGA 1WWWX 3AS2A 4G8IA 3V6OA 1WT5A 3HUJF 3S4SG 1RZJH 3D25A 2OK0H 2GSIA 4QTHB 4KPHH 5EOTB 2W9DL 4PGBA 4LIQH 3P4NA 1JNNL 3G04A 3WSQH 5FXCH 5EIIB 1CL7H 3DYPA 2A0LD 5GS2D 3H9SE 3QQNA 5C07A 1Q38A 3V4VH 1E27B 2Q6WA 1ACZA 3VXUE 4PB0L 1F11A 2AEPH 4OV6F 1OP5K 3QB7C 4X5XB 2QBWA 4QXUL 2QQKL 4X6DB 3WV0A 5KOMC 3HNVH 2VDKH 3R8BB 4Y4FB 2ZUQB 3LKNA 1WEJH 4M6MH 1MHPH 3QRGL 4V1DD 4DTGL 4MS8C 4LPVA 5DTFA 3T0EC 4NRZB 1RPQA 1ZLVH 5JHLL 5HYJA 4KXZI 3QDJE 4GQPH 2NXZD 3PHQB 5ID1A 4YDKL 5T5NF 1QBAA 1JNHA 4OIBA 3W2DH 4XTRC 2IBBA 5DC9B 4X9HA 1CDUA 5CUSL 3ZKXB 3Q1SH 1U8LA 3TBVA 3UROR 1IKFL 3UJJL 4JHZA 1FC2D 3GKWL 4LHQB 3TESA 3GSVA 5AYUL 5BV7C 4AQOA 2Q8BH 4L4TA 3FT4B 2APWA 4MSWB 1AJ7H 4PLJD 5BV7H 5CBEA 5TF1H 1CGSL 2R2EA 4IIQA 5KSAA 1X5ZA 3P9LB 1WWBX 2QV2A 3LPFA 3VXPA 1H15B 1NCWH 4NIKB 3RVXC 1MI5B 3AXLA 4YGAB 4LCWA 5DJ8A 1XF3B 5F1NA 3RPIB 5JPMB 3OGOE 4H1LH 2GIYA 2OTPA 4J6RH 1NCNA 2DQDH 4R2GD 5DJYB 1Q9WB 3I9GL 1ZA6A 3CIQA 3U36B 3VG9B 5DUBB 3QIUA 4NQTA 1UWXK 3Q5TA 5F7DB 2V7HA 5D6DC 4RAHA 2A9ML 5JMOC 5AWNL 1XCTA 4WY7L 3FRPG 4ZFOA 4N8VG 4HWZA 4K23L 3Q2CA 3FQNA 1NFDE 4YC2C 4PJFE 5IVXF 1RZKL 1RK1A 1J0ZA 4YHPB 4I2XB 3WL9A 3WFBH 1J1PL 4NQCD 3VXUA 2FGWH 1W72B 4HWUA 1TXKA 4MZ2A 1XGTB 1Q1JH 3DX6A 1M4KA 3U4EA 4QRRA 2ICWA 5BVPL 3EGSA 3F7VA 2YD3A 3ZDZF 2W1NA 5L8JB 3FFDA 5CJQH 1RUPH 5I1JL 2X42A 3MUHL 3DROA 4NM4H 4XX1G 1CFQB 2R0KH 2QQLL 5EIIA 3FL7A 1T1WA 1OGTA 1DUYA 4S1DC 2I07B 3ZMRA 4K9EL 4XP6H 4ZUUA 5DRNA 1MY7A 4KK6C 5C0EA 4FFVC 4JPVL 4X7CC 2V2XA 4Z7UE 3CSYA 3DTXB 1KFAL 2FD6H 5DF0A 1IAOA 5IW1B 5KVGL 5CZXC 2AJYH 2VDOL 2EKSB 3FQUA 4IOFD 3IDYB 4MD0A 1JTOA 5E2VH 4G6JH 4YIQB 4L3CA 4LFHG 4X6CF 1I7ZA 5D96C 4OV5B 1LD9A 2APBA 1HEZB 2QR0B 3P4MB 4PGZA 5EFIA 1N0LA 1VENA 2W65A 1I1AA 2R2CA 3P3YA 5I1HL 1M71B 3B6SB 5SWSB 1RZGB 2C5DC 1NL0L 3O3EB 4JFHE 5IT2H 1JGDA 4XH2B 2EXYC 3QFJE 4M3JA 1P4BH 5ICYB 1OAZL 1KB5L 2JELH 4OGAD 4YPJA 5HHQB 1AC6A 1PKQA 3WIHH 3OJDB 3VD5A 3JWDL 3DIFA 3GMQB 1W8NA 3Q3GA 2W9LA 4HKZA 4PJAB 3RIAF 3IDJB 3S4SB 5J12B 5D93B 2VKWA 1MCPL 1DL7L 2P1YA 4ZFOL 1NH6A 2NY3C 3GI8H 3WHE0 5HI4D 1MQKH 5KSVB 3VDBA 1FPTL 1ZGLP 3F58H 2M1KA 3SE3C 2ICWB 3OKEB 3U9PH 1OAXH 1Q94A 4I77H 1F4AA 4XHQA 4E42A 5DJZB 1TVBB 4L3CB 5ANMA 4X6FA 3AROA 2JJSC 2VLKD 3UAJD 4G42B 1AKJA 3HI6H 3RWJA 2DQJH 2VDNH 5MEPA 3GMNA 3L5WA 4PJCA 2E9WA 2V6HA 2CH8A 2O61B 5I0DA 2EDFA 4QHUA 5FYKE 4UV4H 1CDGA 3ABZA 3QQ3B 1QZ1A 2EH7H 1BAFL 3IGAA 3M17B 4WW1B 2UZYB 2XICA 3MRLA 3CDFA 4WI7A 4KK9C 3MYJB 2EIDA 3QIWD 1JHKH 1R3IL 1C16B 2PF6A 3CAFA 3HPLA 4JZJC 3DNKA 3D85A 4MXQC 2WWMC 1YMHB 3IS1X 4WTZG 5E2WH 5DRNB 5FM8A 3VDAA 4KK5D 4QNPE 5ID0B 1XIWA 2IPTH 3DO7A 3HZKA 3MLWL 2D9QB 5EZJB 1JGDB 4XH2A 1MREH 4E41D 2Q7YB 5I30L 1T66D 3D0LB 3TBWB 1CGXA 4PJ8A 3WFZA 1DDHA 4P2QD 4P2QE 1XGQA 2D0HA 2IG2H 4GAJL 1JPGB 3MPCA 4U31A 5E94A 3RWJB 4JVWA 4APQD 1QSFA 3OXSB 4Z77A 3V95A 5F9JB 5AAWA 2P45B 3O11A 3ULUC 3MSPA 5ERWB 5M94B 5D2NB 1JWUB 1RUQH 5HI3C 5C0ND 1A6WL 4WI9A 4YDJB 5HHNA 4WEUD 3MRPB 1ITCA 4NO0A 2GAZA 2FBJH 2CRIA 1EGJL 5LQBL 4LHUB 4OLYH 1TETL 4G6MH 3X14B 1XCTB 4RGOL 1CR9L 4NSKB 3ZKSD 2V2WB 3H7BA 4YZFF 2BXYA 2WP3T 4ZPTA 4JR9L 1XF3A 5F1NB 3IJSA 1P7QD 2NR6D 4ELME 4FQ1L 3RFZC 4Z7WA 3FQXA 1PBYA 4HG4K 3ULUF 4HJJL 1WBXB 1G9MC 2WLYA 5JPNB 4U1GC 1F45A 3H9YA 4XP5L 4U3XA 2OMNA 3CVHH 1UM6L 1UKQA 1G9NH 4K7PL 1BECA 5B3JF 1MNUH 2F54D 2F53D 2CPCA 5GISL 2C3WA 4LCYB 1PLGH 4W6XB 4WCYH 1FN4B 5IB2A 3MRNA 4X9FA 4TULL 1CGYA 1ORQB 3ILPA 3PF2A 4EI6A 2V7HB 3GJEB 2VKXA 5F7EH 2J6EH 2FWOB 1KB5B 2UVFA 3BKCH 5E2WL 4HXAL 1YZZA 3GSRA 1S78D 3SJVD 3VJ6B 1CFVL 2XTJC 1JYNA 1AXTL 2EEDA 2OI9B 1VFMA 3UJIH 1VPOL 1GGTA 4QRRD 3U48A 3MLZH 1R3LB 4BQBA 3ZE2E 3FO9B 4Y19A 2BHZA 3V8OA 3EO9L 3ULSA 4PV8B 4OCXL 3D2UD 3DYOA 3BHBA 5EBMA 4ZFFA 5F6HJ 3GSUB 1FP5A 3BP7A 1MH5A 1RMFH 12E8H 1T5WA 4YIQA 3KYOB 4I3SL 2UV3A 3OGCB 4CN4A 2YD4A 2MMXA 4AEIL 5GGVL 3MV9A 4CRPA 4KZEL 4MB3A 2NY5L 1LVEA 3GRWH 1XCQB 1CLYH 3MNZA 4RFOL 2OJZH 3E0GA 5E6IC 3WIFB 1K6QH 4F57H 5HHVH 4MSWA 4HW6A 1V7NH 2VXQL 5I8CA 5D2NC 5D8JH 3VH8B 3CC5A 5DMIL 3MJ9L 4D9RE 4M3KB 3V4PH 1QVOB 4EUPB 2GK0B 5EORH 4DEPC 3SY0B 3L3HA 5C07E 4MQXD 1NCWL 1HKLL 3ALXA 3EYQC 4IM8A 5FYKD 3CU7A 2GKIA 2DQIH 3ET9F 3L3JA 4ZFGL 5I17A 1K8IB 1RHFA 1J9CT 5EPMB 1TQBC 2ZPKH 2Y1VA 1LO0L 3JTTB 4HCRA 32C2B 2NY3D 4HS6A 1MRFL 4QYOA 4Q97A 3AUVA 3UJJH 4ETQB 2F19L 3QNYA 4DK6A 1QR1A 1YEKH 2VITB 2WNGA 4JPKH 4DWHA 4V1DA 4G8EA 5FUZH 5TDOB 3RGHA 1IC7L 3DXAB 1TQCC 3TFKD 5ACLA 5HHOE 5DJAB 3O3BA 2FJHA 4TTDD 1OW0C 5EU7E 4G8FA 3VWKD 3QRGH 4OZIB 2Y9RT 4NKOB 1QFUH 5D7LE 4X99B 3RDTD 1AY1H 5GGTA 1J8HB 1LK3L 1F6AB 1YEGH 1YEDB 4YFLF 3T2NL 5D6CB 1KIPA 1A02N 1LGVA 4JFOA 1E28A 1T21B 4X6EB 5EUKB 3S35X 1VEMA 5LAXA 2COQA 1R5IB 2QQLH 4IBLT 1E6JL 1KCSH 4AH2B 4FQPA 2X10A 4QHUB 3B5HA 4OAWB 5TGBB 4WRLA 4NCC2 4DN3L 1I9IH 4HK3J 4DZ8A 3QUKA 1YQVL 3EFDL 2QSCL 1K85A 2F5BH 2YD5A 1QBBA 2NY3B 4MCZA 1P84J 1IVLA 5IVZB 1Q9LB 1FFQA 1U3HC 2R0WH 2R2HA 4GOSA 5F7FA 4L3EE 4PRPE 3S9DB 1J1PH 5FGRA 1S9YA 5D2NE 2OL3L 4I3RL 4DQOL 4Z77B 3O6FC 3MRMA 4ZSOE 2DB8A 2ZOLB 1T66C 2E8ZA 4OM0H 4WUUD 5K9OB 1D7FA 4Y16C 4Z78B 2A9MH 2GUOB 3LD8B 5IOPA 1QOKA 4LQFL 1ZGLB 1NAKL 5ALBL 5EOQH 1W0WA 1QRNE 1EO8L 1QQDA 1GC1H 3V5HB 2ENSA 1MJUL 4MB4A 2P4AB 2CK0L 2M8XA 4PJ5E 1IQDB 2BNRA 2EYTB 3OQ3B 3K1KC 4KRPD 4NN6B 3E3QE 5D1XC 3RZCC 5L9DH 2UZIH 5TQ0L 4GAGH 3VFPB 5E2VL 4GXVL 1BVZA 3K80A 4R3SA 4LPWA 3VA6A 3FB8B 3D3VB 3TA3C 1CFTB 1AP2A 3C6LB 1XH3A 4HKBB 5JW3H 3KXFA 5TE7H 4EBQH 2HJKA 2HT4D 4S0TD 1G0XA 3UMTA 3W9DB 2R4SL 2Z92A 4PGBB 1U0QA 2WUCL 1HHHA 5EC1A 2MNUA 1LEKA 3NFNB 1L0YA 1T22A 2H8PA 1WFTA 1A6UH 2LABA 3MACL 1IARB 5DHVA 3ARVA 4F7EB 4WJ5A 3P0VL 2DQHL 4YLQT 2UY7A 3LRSA 1N5AB 1AGEA 1BZ7A 3BPNC 2R4RL 4M43L 2PO6C 4WV1B 3WNKA 3CFIC 1W72H 5D9SA 5HYJE 3GSRB 4Y1AB 5B8CB 2B2XL 1NGWA 4OUOA 5E6YA 4Z6AT 4H26B 5DK2B 3LKOB 5DFWH 3KPRA 2CRYA 5DRWB 4S1RH 4JO1H 4MDJB 5F3BB 5E8NA 5HHMD 1RJCA 3MV8A 2BJML 4KKAD 2P5ED 1N4XH 4L4TE 3SDAC 4J7RA 1WUNT 2GHWB 3V9FA 5IFAL 2QQNH 3VFVA 5CEXB 3TYGH 5IIEB 4OLZL 4L3ED 1TPXC 4OZHE 5JW4M 1G6VK 3MYJA 5ISZD 1QLFA 2VR9A 4FXLA 3LDBC 5HVHC 3QJHB 2NXYB 4P5TD 4KHTL 3WIIH 2CMRH 4FRWA 3DXAE 3QHZH 5C3TA 4BK5A 2HT2C 2OLDA 3GJFA 3KPNB 1VKXB 1I1YB 4KTYA 2DM4A 4AT6A 5BV7B 1JRHI 1WCBB 5C09E 1T20A 3CFJA 5JA8B 4DAGH 4PJHA 2BOCA 4FQQA 3T77B 1FL5A 2MQ0A 2DYPA 2EDTA 3PGCA 4Y1AA 1IZKA 4PRDA 1FCCA 2A6DA 5LKNA 4IMLB 4CVWA 1P7KA 3CFBA 4IEFB 2MHAB 3HE6C 4PRIB 1Z9OA 1BJ1H 1XF4A 3D0VB 4RMSA 1FLTX 2JB6A 1TZGH 1A1NB 1NC2A 2AJ3A 1ZSDB 2ZUQC 3UYRH 4Y4FC 1JPSL 1MRCL 1B6DA 4ONHB 1UZ6F 2BHUA 5DDHB 1NAMH 3BXNB 5CD5D 1CK0L 5GRYA 3TGXA 4GRWF 1KGCD 3MUGB 4TRPL 4L3EB 4OFKA 2ENYA 1NLBL 2F15A 2ESVA 2DD8H 4GKZA 4JM2B 2YXMA 4NP4H 1A4JA 1YEHH 1ZEAL 1MLBB 2W0PA 1JGUL 4WNQB 4XAWL 4BUGA 4FXGB 4I8DA 3OAUL 1T89A 5ITBL 5IJKC 4QNPF 1BIIB 3LRSB 1DBAL 3NBNA 5K33A 5GHWL 1EEQA 3ECBA 4F7PB 4K3JL 3BGFB 3FKUS 2PCPA 4KDVA 3UTSD 5C8JA 3AB0C 1IM3B 3BP5A 1MAML 1JJUA 2EDBA 1EHNA 2OS7A 3EDEA 5D72L 4LCCA 3L7FB 4NKMB 4JVUA 3BPNB 5GS0C 2PETA 4TVPE 1S7TA 4LOUD 4R7NA 2DBLL 3N0PB 5C0JB 3IXAA 4TNVK 3KPNA 1VKXA 3P40A 5F9AC 3B9AA 1IAMA 4OT1L 4WU5B 1UEMA 1QLEL 3MFFA 1N59A 1MCLA 5KJRH 2BCKA 3QH3B 3DUSA 4UT6H 1FVEA 1NMCB 3O8XC 3WJJA 3PWLA 5ANMB 5GQBA 5D7JB 3AS0A 3BSZH 1BFOA 1UJ3A 1P84K 4MNGA 1P4IH 1VFOA 4QOKA 2LU7A 3RVWD 5D2LF 4HZAA 2H2PC 4EI5D 1QSEA 2WIMA 4MQTB 2XZZA 1YN6A 1OAZH 1PAMA 3T0ED 3I50H 1A6AA 3FB5B 1J8KA 3TZVA 4PJBF 4OI9A 2ADFH 1M7XA 4L9LC 5E08L 4XPTH 1OPGH 4R97C 5BZWA 3W9EA 1T7YA 5FYLE 3L3IA 1KJ2B 2VUOA 5BMFH 2WWKT 4ERSL 2XIDA 1G6RB 4MJIA 1HSAA 3TNMB 4JHAH 4OF6A 4YO0A 4ZYKA 1ZMYA 3EW3B 5FGSA 3PG2A 3P9WB 5I1AB 5EUOF 5GGUA 3RWFA 4V2CB 4OJFL 2O5ZL 4MAYA 4QLRA 3LD8C 1U95B 3BIKB 3KJ4B 3SHSA 4GKSA 5AG9A 1CFSA 1M6OA 1JVKA 4GRMA 2X1OA 1QVOA 3HI6L 5I18L 3DWTA 5CD3B 3BDYH 4JB9L 3MOQA 2A83B 3LEVL 4M6NL 3NA9H 2G9HA 4BFIB 5KVMC 4MNGE 3QG6A 5CJOL 3OWEA 5BZDB 2NCMA 4QRTA 4U1HA 4Y5XB 1OD7A 4ODVL 1ZXQA 5IMKA 1ZWIB 3WD5L 5C0EB 1NBVL 1X5AA 5C6PB 4RGMB 5F3BA 2CLRB 1MHCB 1FFNA 2Z31C 4OF7A 4JG1L 4LF3A 2GCYB 3L9RA 2NZ9C 3IRPX 4IS6B 3X3FH 4D2NA 5JUEH 2BVEA 3QUZB 1OTTC 1KIRA 3NCYP 5HHOB 4JO2H 1TFHA 4PJBA 3QEQB 4PRNA 1QLRA 3ZO0A 3EJYC 4ERSH 5E2UL 4X7FC 4HAFA 1BJ8A 1EFQA 2EICA 2AJUH 1CCZA 1C08B 1NDMB 2NY0C 4YDIL 3FOLB 3ZDXE 1J1OL 2QADD 4GXUN 5E08H 4HEME 1P1ZB 3P73B 1HI6B 3P2TA 1CFNB 3QXDA 4WWID 3WUWA 5EBLA 2OM5A 4ELMB 4LNRB 1UADC 3O4LD 3OKOB 5JO5B 3N85H 5BQ7B 4ODHL 43C9B 4A6YL 1DQLH 4XXDB 2OJEA 1BD2A 2A77L 1CDBA 4GS7B 4NQCB 4BQ6A 3CK0H 3RDTA 4ONGH 4FA8A 1DN0B 4DZBA 3KPSD 4H1LA 1ROWA 2WINB 2GK2A 1LE9A 4DEPB 3NMEA 3QI9D 1DVFA 5DJXB 4BFGA 5FFLA 4E41E 1I8MB 4PJFB 4HBCH 3FN0H 3O2WL 1OCWL 5A16B 1T1XB 3X3GH 5MENE 1A8JH 1DQML 5JHLH 1A6WH 1RHHB 2DQCL 3LZFH 3X11B 3DGGA 2YKLH 3BXNA 2C26A 4IDJL 2N4IA 3ARBD 4JG1H 3BJ91 1UA6H 4A2MA 1N5YH 5B38B 1UJTA 1OP9A 4CMHC 3U4BH 2YA0A 2OXHA 3MA9L 4L4JA 5BS0E 3ZE1E 1WLHA 2MHAA 3RX5A 5FUZL 2APXA 4C58B 4OZ4A 4XNQB 5C86A 3WUWB 4YDLB 3OAYK 5MERA 4L4VA 2AQ3A 4PJIF 3TCXA 3PABB 1F4XL 2APFA 1C1EH 1NC4A 2FLRT 1CD9B 5DEFA 1QRNA 2O26U 4XBPB 4FFYH 2ATPB 3MLTA 4YWGL 2ADGB 1R0AH 4F15B 2WQRA 1DVFB 1MHHB 4Y4KA 3QFJD 1G7JB 2AERT 5KAQF 5IVXA 5JIPA 2HVJB 2VSDA 3IJYA 4HMDA 4XNUL 3NCJL 3GKWH 2D7TH 4HIJA 4PJ8C 2HVKB 2VXVH 4ZOAA 4NZJA 1R5VA 1RJZB 4FTVA 4Y19D 2EECA 1MUJB 3HZVA 4PJ9B 2JCCA 3HMXA 5TDNA 1SMOA 2B5IB 4U1GB 1WIPA 4WI2A 5C0BE 4NT6B 2JB5H 5HTSA 2NY5C 4ZUWB 2H41A 5HYSA 4NQDA 15C8H 3VXRD 3QYCA 1KCUL 3U9UB 4EDXA 1IEBB 3KYKL 2R4SH 3DI2B 1AO7A 5K9QI 1HHJA 4R26L 1RSFA 3QQ9D 4NNYA 3V0VA 4FQHA 3EDJA 3P0YL 5I8KL 1LP9B 3L95A 4Y8AA 1F90L 3MR9A 5F7WC 3A67L 2DQIL 2DYPB 2VB5A 3FO1A 4NOFA 1NCUA 1P4BL 2M26A 2ARJB 4Y2DA 4LPXA 2W9EL 5IB3B 3CLEH 3QDMD 2A9NH 1RVFL 5B39B 3QFJB 4RA0C 1CFVH 2EO1A 3INUL 1DLHB 2Q6WB 2E7CA 2H32B 1EPFA 5HHXH 1HYRC 2IQ9L 3P77A 4K3DH 1NC4D 4HUVB 1JK8A 5H2BA 2GYSA 2MOVA 1BBJA 1P7QA 5H8DA 2WV3A 3TO4A 1FL5B 3ZT6A 3BN3B 1IGCH 4NHCL 2A83A 5DR5L 4ZAKB 3O45B 3NCFB 5FOBB 1J88A 2CJUL 1P9MC 4PPTA 2QL1A 2KH2B 3V6ZB 3LHPH 4GQ9L 1IJ9A 1XGRB 3ZYJA 2DS4A 3D2UB 4OAWA 4ZO6A 5IR1B 3K2UL 3T4AA 4CADA 3MCKB 4PRIE 5E2JA 5GJSL 3FHQA 3VXME 5IB1A 2NY2D 2XZCL 1I3VA 3C87A 1YEJH 5C0FB 4NN5C 1I7UB 4WVRA 4PG9B 5KZCB 3RZCD 5D1XD 5CJQL 3RKDD 3QHFL 2NY1B 1NDGB 4D3CH 4XTRD 2FJGB 4J1UB 1RIUH 4LRNH 1UKTA 4Q9QL 4HG4J 4ODUA 3LEXA 3LN9A 1CIUA 2DJ4A 4BH8A 5CMAA 2I60H 4Y8DC 4UDUB 3WLWC 4JRWA 4YX2L 1S9WA 1QQDB 1FFNB 3QUXA 4Z7QE 4XRCA 2XNAA 5CJXC 1J86A 2YZ8A 3MR9B 4LU5H 3MXVL 4Q6IC 4PJ5A 3JV0A 5HDOA 4UUJA 2OTUB 5GRJL 4ORZC 4R8WL 5K93A 3ARRA 3QXAA 2BVOB 3C2AL 2RCSH 4NNXA 2DLTA 3LQMA 1TMCB 1AP2B 4LSQH 5GRVK 2FBOJ 3SE9L 1DN2A 3RVTC 5TQ2L 3V5KB 3G08B 4EN3C 3EO0A 4LP5A 2EDOA 1J0JA 1T5WB 3BN9D 5MEND 1L7TH 4OQ1A 4RWYL 1KB5H 3UBXA 5GJTL 4XNXL 4FNLH 2YBRA 3FOMB 1B0GB 1VERA 3HMWL 4J23A 5D7IF 1EZVX 4KK6D 3QWOA 2A73B 1U8PA 2XZAL 1JWSB 3IFNH 4HK0B 2PYFB 4FFWC 3S34H 4OZIF 3IVKB 1XCQA 4K3EH 3LS4H 1E6JH 4IRJB 5C0DA 1TZIB 3X13A 4UOJA 2YD6A 1YEJL 2VLJD 2OSLA 4N8VB 5KW9L 4P3DA 3H42L 5FF6B 3DO3A 2DLEA 4HS6B 4XC3L 3W9EB 3HG1B 3TCLB 2HJLA 2CO7B 5D96B 3O3AB 1N3NB 1SEBB 4NRXA 3H3PL 2CR3A 2V2WA 1S9KC 4YXKL 3LQAL 4M7KL 4HAGA 3HAEG 1RZ7H 1FVDA 1HIMH 2DQJL 3FCTA 4FQCL 3GB7A 4CVXB 1X7QA 2VDKL 1IAIL 4MQ7B 4PJDE 4X7DC 3U46A 2OR9L 1YMMB 5E99L 4P4KD 3IJHA 5D1ZB 3AC0A 4WWKC 4YPGB 1FFRA 2NY2C 4M02A 2E6PA 1CD1B 2D7NA 5D1QA 3VJ6A 1XF2B 5I1KH 5DMKB 2C4FT 3T0BA 1NLDL 1E28B 3IAGC 3AMKA 3N9GL 5J9PB 3WFDL 1Q9OB 3UJIL 2H9GB 4CMMA 4WHTB 3WN5C 1Q1JL 2BMKB 5DK0A 1VGKB 4O5LH 1FN4A 2XKSA 4R9HA 2NTFA 5TE4L 3E1F1 1LNUA 1TENA 3LS5H 3MBXH 3BHBB 4ZFFB 2UUDK 1JBJA 4LEOB 4LFHD 3HRZB 4RFNC 5DQJA 1YEFH 1EAPB 3PIQA 1F6FB 3VXSB 1R3KB 1CDCA 1RFDH 3ARFD 5C0GA 3FB8A 1EA9C 4BJLA 3PWJA 5CCKL 3VRJB 3L7EA 4LHJB 4JKWA 5GSVB 3FO0L 3O3UN 5E8EB 4YHKL 4MNHB 3X12B 4DAGL 5EIVA 5EOCL 2AJYL 3BD3A 4NQED 3MACH 4HV8B 3EYUH 4OQTH 4P9HH 3RWEA 5INDA 4HUVA 4PRID 3OKEA 4V2BA 4YNYB 4QHLB 3S5LB 4ZTOH 2GT9A 3OKYA 3QQ9C 3WIIL 5H94A 3VRLE 4OCXH 1DZBA 3MLXH 3QHZL 4R4ND 2VH5L 3I2CH 3T3PE 1DBBL 1SVCP 5L2KE 2H2SD 4JQXA 1E4XH 3OXRA 3AFLA 4JM2D 2B1HH 4E9LA 5FCSH 3BPOB 1R3JA 5C0CB 3MRIB 2FH6A 4P23A 4KQ3H 3SJVE 1PYWA 5E1HB 2R1WB 4Z8FH 2NW3A 5KVEH 4YAQA 5GGTH 5KS9F 4JDVA 3RPKA 1I9RL 3O4LE 5JXAH 4R0LB 3HPJA 4ZXBB 3GSXA 2F5AH 4W70A 1C7TA 5AZEL 3W5NA 1TZGL 1VGKA 4YHPA 4P2OA 3X12A 5T3ZE 3KXFB 3MLUL 3I02B 1TJHH 1NC2D 1MCOL 4YK4C 4JN2A 1Y6MR 3T0EE 4S1SH 1IAOB 3GGWA 3HE6A 2YS4A 4J3WA 5IKCA 4KMTL 4YWGH 5IVOA 5DQJB 4NP4L 5D7LB 3P4MA 3JV4B 4GAFB 3GJFB 2YA1A 4KTDH 5E94B 2KZ1B 2PXYD 1U92B 3IRZA 3L3DB 4YQXL 1CWVA 4JRXB 1JYVA 1E6OL 3L5JA 3ZHDA 1IGJA 3G5ZA 5HI3D 2X4NB 2WUBL 4X4XA 2C3VB 1IEAA 3QNZB 1EIBA 3SDDB 1KUMA 4GRWB 4QT5A 4HIXH 5TF0A 2DIAA 5BZWB 4WFED 3HI5L 4KROC 3IYLW 1DUYB 2ICWI 3B3IA 4YXKH 4M1DL 4OZFB 4ZTOL 2LVCA 1Z3GL 1EBAA 4OT1H 4MJ4A 3C6SA 1JPTL 3S3PA 1N6QL 1Q8MA 4DZ8B 4YFEA 5L2KA 1WWAX 3LY6A 4P23C 4YHIB 4DVRL 1A1NA 1NC2B 2AJ3B 4K94H 4Q9BA 2OZ4H 4F7MA 4GAJH 4O51A 2IAMC 4OZGB 3QIWC 3HZMA 1PVHA 2A6DB 5ACZB 3UC0L 2IH3B 1NCBH 3FHAA 3DURA 5SWZA 4DFHA 2R8SL 5EG6C 1FRGH 3RY5A 4PTUB 1U8MB 2ATKA 3BKJH 5EZIL 4GAYB 1YJDL 3O41A 3OR6B 2I24N 2PW2A 4JEGB 3WE6B 3WKML 1FBIH 3MRFB 1NUDA 1EXUA 3I02A 1SJVA 4L4TB 4U7MA 4PY8I 3DX9A 3BZFA 4BFEA 3GMMA 1JV5B 2AXGA 4OZFH 5IMLB 4KHXL 2EE2A 3C09C 1GOGA 1I7TB 1H8SA 4Q6YA 2BDNH 3CCHB 3MRJB 1S3KH 4MA8H 4JR9H 3PGDB 2XOTA 4PJCB 4OFDA 2ZJSH 2AK1L 1Q9OA 2Z0BA 1KJ2H 1PQZB 4N8CH 3UP1A 1W72A 3I3DA 4PREB 5J11C 4CVUA 1A4JB 2H1PL 1YMHA 2FDBP 1OARL 2HKFH 4YPGA 4X80H 2VZ3A 3GJFH 1HCVA 3SDDA 1UM6H 4XVUC 1DDHB 5EA0H 2J4WL 3VFOA 5BJTB 5GS0H 2H26B 1WCQA 3EOAB 3I75A 3QUMA 3G6JE 4BZ2L 3SY0A 3C5JA 2BNRD 1V3MA 4HDIA 4JGJA 1NAMA 2FJFB 5BOZG 4Z7OE 3PGFL 1NAKH 3WS3B 4JHAL 2E27L 4HQQH 2D7MA 3WXWH 3TM6A 5ESAA 2JTDA 4I0CC 3TJEH 2IMNA 1N2RA 5E4IA 1OL0A 2WIIB 3RL1A 3O9WC 4DN4H 1IEHA 2NQCA 3GMPB 2MPAH 1I7UA 4N8PA 2AJVL 5F6IC 4UNUA 3ZDZE 3PIQB 1ZT7B 1JGVH 2XN9A 1LO5A 3HZYA 5DO2D 2Z4QB 4Z95H 4KAQL 1K5NA 5CGMA 5J13B 3C2AH 5CP7B 2D3VA 3VXQB 2AK4D 5DMIH 3GBMH 4NHUA 4MNHA 2EH8H 1HYSC 2VMFA 1EXUB 4UDTB 1U95A 5IF0B 2YN5A 3EO0B 5EO1B 1L0QA 3BGAA 4ETQA 1BJ1J 1IC5H 1T3FB 2RIKA 5IQ7L 1YPZF 3MLPA 5GGVH 1TIUA 3MRDB 4Y5VC 2OBGA 3O4OC 2RGSA 4MCYB 1A4KB 1A14H 1KCVL 2FEDC 4XNZB 2FSEA 4AZ8A 5T1MA 4U6YB 2YKLL 3MLVL 1OGAD 5DJAA 2DLHA 5F89A 5IHUH 3IDNB 4X5XA 5FO9B 3CDGA 3KPLA 1CF8L 4YEEA 5IB2B 2VZUA 2DF3A 1JMZA 5C0CA 4P0DA 1A6ZA 1I4FA 4U1SB 3U0WL 2BY0A 5HHQA 2FX9H 2FHBA 2MCG1 1HHKB 4YHYB 3GMRA 3K4AA 4ZS6D 3WO4C 3BVNA 3DXAD 5E00A 5GZOD 3WFCH 3IFLH 1F02I 3O2DH 4KZDH 5GJTH 1PQZA 2CGRL 4FQCH 4MQ7A 4LSSH 4AL8L 4PJAE 5CJ5A 1KPUB 1LK2A 2V2TA 4PRAA 1MFAH 2FR4B 1YUHA 4OFVA 4ISVA 4WHTA 2XZQH 3KR3H 3GMNB 4NRYA 5DJ8B 3DETD 2QQQA 4D0CB 4JFZH 3WUZA 4L29A 3OR7B 4MJ6A 3Q48A 3D3VA 4N0CC 1NEZA 1T2QH 4TUJB 3RWCB 2J1KA 4B41A 3HR6A 4FFYL 4IJ3B 2Z91B 3MRCB 4GLRI 1T6VN 1T0MB 3PQYD 4PY8J 6FABH 1BBJB 5CD5C 3M17A 4WW1A 3MV9D 2N7AA 3MNWA 1NFIA 2X4UB 5B4MC 4XMPH 2IH1A 3V52L 4Q0XH 5KAQG 2I9TA 1XGQB 4X7EC 3H0TA 4E0RB 4PLKD 4R26H 4OCNC 5DK0B 3UYRL 1JIBA 3C6SB 2AV7B 2ICCA 4OZFA 2PYED 4QRQB 5IJVA 2OR7A 2Q3AA 4H5SA 1JYWA 5F9WC 5BW7A 1OT1A 2VUYA 4PJDA 1NCDH 1XIWC 3DO7B 4QWWD 3U0TB 5ALCH 5DJYA 3WHXB 1IM9B 3NZHL 1YECH 3DRTB 1WWCA 2J7LA 1HXYB 2F74B 5DJDA 3TBSB 2EDWA 3MRKB 1KC5H 2A0LC 2X05A 5B38A 5H94B 4PG9A 3NN8A 4Y19E 2OX5A 4LSPH 4JAMB 4F8TA 4XPGL 2PW1A 1YC7A 1WFNA 3HAEB 4LGPB 4AM0B 5MEOB 5DR5H 2FL5A 1NCCH 2FX8H 2WBJC 4HV8A 4NKIH 2FZ3A 3CSBA 4MHHG 3L1OL 4XMLL 3QRFM 4LPCA 4F9LC 4KPHL 3SKMB 5DJ0A 1ZV5A 3GUTA 1P2CB 5C0FA 2IH3A 1FFPA 5KTEH 4HJJH 2DIJA 1C5CH 4HJ0D 3MXWH 4X8JA 3EJZC 3S5LG 2DD8L 2P5WA 4PJEE 5DI8B 3OKKA 5FYLH 4ODVH 3BZFB 3W82A 4HF5L 1DBBH 4ZG1A 3O6KH 5CSZB 3O9WA 2V5YA 5LXGH 4G3YH 3W0WA 3VFOB 5IROC 4EUPG 4PP1D 5CEYB 2BSRA 5E6IA 5ABDE 5I8OL 3SQOH 1NGZA 2EYRB 3N1FC 3BYYA 3STBA 2PTUA 1T1YA 2GTZA 3D87B 3JVGA 2VRAA 1NDGA 5FCUH 4O2EA 1NBYA 4BZYA 4X6DA 5D7SH 3SGDH 3RWHB 5LWYL 1RUQL 1AHWA 3IKCB 3MNVA 3WS6C 3INUH 3X13B 3TBVB 4EXKA 5C0DB 4EDXB 1P6AB 4LVNC 4X7SH 3HNTH 3RVVD 1DSFH 5HVFB 4LBEB 5E5MB 1HH6B 1MCKA 1JF1B 1MFBL 2IANA 4Y2DB 5EULV 1NFIB 2X4UA 3NZHH 1BVKB 4U1LB 3SDCC 1F3JA 3JV4A 1H3UA 5HYJB 4JPIB 1T6WA 5HD8C 1PDKA 4LRIC 1RIUL 1F2XK 4TVPL 1U9KA 3LQZB 3D9AL 3MQIA 1XZ0B 3V6OE 1WTGT 1MI5A 3AXLB 5I2IA 4JY4B 1AO7B 1DEDA 4XNXH 1PD6A 4M7ZC 5KANI 2NY4B 1OB1A 5IF0A 2OR8A 2BVUA 2QQNL 1JPFB 1DTUA 4HPOL 2K7PA 5E7FA 4O51B 5F7DA 4G9FB 4E42B 2JCCB 2ZUWA 1UM5L 2B4CL 1CDJA 3WLBA 3UBXB 3UTZB 3OKLA 1DUZB 3STLA 2IJ0C 1KCRH 1MOEA 1JPSH 2E7BA 2H9GA 3BEVB 5CP3A 5IB3A 4LCWB 2BOBB 3LB6C 1A7NL 5J1AB 4YH6A 4TULH 3JXAA 3KAAA 4F7CB 3IKCA 4M1CC 3NTCL 2A6JA 2I60L 3PP3H 1LP9A 3L95B 4YHOH 2NY0D 5DURD 3RQ3A 3W39B 4N90E 4NPYA 5C70A 5E4EC 3QDJB 5FYLL 1RIVL 5E56A 5ESVA 2HTKD 3CVIL 4GUPB 2VLKA 4GG6E 5D1ZD 4H26A 1FYTE 3QO1B 1MWAA 1NJ9B 4HC1A 1S7XA 4K3HA 4NKDB 1GOHA 3FCTB 3IXAB 5FGBC 3WEXB 3MCKA 1H3VA 1FGNH 3SE8H 2E3VA 5C71A 4PGEB 4WV1A 1XGTA 5I73B 1TJIH 3GJFK 1Q0XL 4ZQKA 1CLCA 1U2CA 2J4WH 3KWWB 5LAXB 4CU7A 4OLYL 3LQAH 3SGDI 3HB3D 3VXMB 1U41A 5DMYA 1TJGL 2P24A 3TFKC 3UJTL 3N06B 5ITFB 5I1HH 1MCBA 4X98B 1KG0B 1MCSA 4I77L 2ZJSL 4YFLI 2NTFB 2V17H 5EU5B 5LXGL 4R96A 3BPLC 3LCYA 1IAIM 4WHDA 5AWNH 1CGUA 2YOCA 1OAQH 1LP9E 4EOWH 3MRCA 4OD3L 5ESQA 2HG5B 4UBDC 1J8HE 4AEHL 3UZQA 1M7DB 3LN5A 3QJHA 2E7MA 4E5XA 5D7JD 5GZND 4U6HA 5E24E 2BFVH 4D0CA 3SKOB 5J06A 4TTDC 5SV3A 2OTUA 2NXZB 1IM9A 2HFTA 3H3BC 2K7QA 5C0AE 5DHYB 2OXGA 1X5LA 1XR9B 1ACYH 1DLFL 2EE3A 2RHEA 1QBLL 4U6VL 2F58H 2HTKC 3CH1A 4Z7NF 5I8KH 2BOCB 1JHKL 1R3IH 4OI8A 2BNQB 1S9XA 2FATH 3SDXE 3MRRA 4ZXBD 5I1KL 2IQAA 1DQDL 4GUPA 1JNHB 4Q6IA 4NRXB 4JZNB 4PUBH 2FSEB 4Q74A 1K4CB 3MV8E 4NNXB 3G9VA 3SGJC 5KZCD 2GW5A 3CXDL 2DQEL 2V5TA 3BIBX 5DJCB 3QUZA 3V0VB 5HDBE 5IMKB 1LK3H 3ARZA 2P48B 4NZRH 2X4NA 4IRJA 1MJJA 3WXVL 1MWAL 4HC1L 4U1SA 3T2NH 3LMJH 1INQA 4Y88A 4PTTA 4OGXL 2WK2A 1F2QA 1CXLA 1JTTA 4OFYA 2NX5D 1I3GL 2YSSA 1MAMH 3SKMA 2EDQA 1NGXA 2J8UE 1DE4B 4Z7WE 2DM2A 4Z7UA 4X5WB 3DBXA 1KCRL 3RAJH 2CRZA 5T1MB 3L7FA 5IG7A 4XAKD 3L3OB 1UJ3C 4U6TA 5GS0D 1RZJL 3GI9H 4R2GB 5DQDL 1EHLL 4JFED 4PJHE 5HD8D 1MRDL 4HUNB 4XP1H 5T1KA 4KTDL 1C1EL 3CLEL 1KLUB 5D1QB 3DVGA 3CXHJ 4LCWD 1IGYB 1PX3A 2B7DT 1CGWA 1CFQA 2B0SH 5E8DL 2GFBA 2NYYC 1I8KB 1G7QB 3SE4A 1JHTA 3DVIA 5LG1A 4DGYL 4GW5A 1SYVA 1CFNA 3QXDB 1YC8A 2PKDA 4QXTA 1LDSA 3KLSA 2HKHL 2XRAL 4P3CH 4BH8B 2UWEF 3ZKND 4LLUB 2L7UA 3IDGA 4KJPD 1FZOA 3R06A 4PP1C 2OMBA 2ZSVB 3PL6B 5DRZB 3QISA 4MJIB 5F71A 2FH8A 5CGYD 4WGWB 5KN5B 2C1PB 3VRJA 1RVFH 5DLMH 3CUPA 3DHJA 5EOQL 3PHOB 2W65B 2VIRB 4TNWF 1NSNH 4Q2ZA 4P99A 4GBXB 4K8RD 1CDYA 4HH9B 4RGNC 4LP4A 3MJ7B 4LLQA 2KUTA 4HIXL 4JM4H 1OF2B 4PR5A 4FQLL 3TN0B 3GHBL 4NO5B 3RI5F 3TV3L 4PJCE 4UMGA 4LLDB 2JLLA 1MLCA 4P2RA 4S1DD 3TVMB 2R9HD 5FA3A 1QPPA 3K2UH 5CJOH 3FN9A 4K71C 4AIXA 2DQGH 5HHME 4LK4A 2JJTC 3IDIA 2AKRB 4P5TC 3CD4A 2HP4A 2I5YH 2VXTH 4JHWL 1E4KC 5L0QB 2P8PA 1WBZA 1CLZL 1FL6B 1W72L 3QUYA 3PL6A 2ZUTA 3C5ZB 2ATPA 3MLTB 1H3GA 5CSBA 3PNWB 1KJ2L 4OCLC 1I8IA 5GSRB 1PSKH 3WFHA 3N1QC 1B90A 2J3SA 3MCLH 1IBGL 2HYMA 4R4NC 4V1DE 1G9NL 1U3ZA 1N6QH 3IFLL 3QEQA 4PRNB 1ZSDA 1UCTA 1NANI 1UCBL 4M1GH 3B83A 4P2OC 5HHOA 4P3DB 1K3IA 1E4WH 5CS7A 4B0MM 4R4BB 2NLJA 3V79C 2C3VA 2C9AA 2W38A 3TT3L 3WXWL 4HUXA 4GRLA 4XP4H 3DLQR 5BOPA 4O00A 2XA3A 3BAEH 4Y4HD 1P53A 4WI4A 1REIA 5GS1B 5K9KA 4GW5B 4OFYD 5HDLA 2XWJB 3T0WA 1MCNA 3F5WB 3C60C 2OZ4A 4NNPH 4WI8A 1VDGA 1JGEB 4JFFD 3QUZD 2HLFC 4YFDB 4CN1A 3LZFL 3I6GA 5EU6A 1EAPA 4U0QB 5EORL 3O4LB 4EI5B 5JMRA 3C9NA 1DQQA 2BVPB 3TVMA 3FN0L 3O2WH 3KNBA 3RI5K 4ELMA 3OGCA 4R3SB 5L7XH 1K8IA 3AY4C 3OMZA 4LVOC 3ZTJG 2H32A 5HHPA 4BQCA 1BF2A 5L2KB 4I9WD 3UBXG 2X4RA 4WI3A 3TZVB 1EAJA 5MP6H 5ETUA 1CXEA 4NO0B 4LBEA 3WIHL 2ZPKL 1SJEB 2GK0A 1KEGL 4G8EB 5LBSH 2VXTL 4P4KC 3K81A 3VDCA 3KLHC 4ZYKB 4K7PX 4FZ8H 5KVFH 2FX7H 1J05A 3CZFA 5DMJB 3WDIA 3DX8B 4LCUA 2A6JB 4HSQA 1N0XH 3ULVL 4JREB 4MMXC 1PX4A 5BS0B 2E27H 1R5WB 3HNSH 4G8GA 2BVQB 4ZSOA 4XVJL 5LGJA 8CGTA 1CZ8L 2WANA 1G7PA 4LEXH 1FNGB 1I7RB 3D25B 5FCUL 5E9DA 2F8OA 1VESA 4GQ9H 3BP6A 3NOIA 4PD4K 2ZP0T 2BZDA 5JQHC 1I9RH 3JZ7A 5BZDA 2MCPL 4Z76A 2C3XA 2J6EA 1B2WL 1R5IA 4XNYH 4B7IA 3VU2A 3EDFA 3NCJH 4WO4C 4NJ9H 3VWJC 4RMVA 4NGHL 1CD0A 2VDML 5F93C 3SGEI 4DW2L 1A0QL 1MCIA 2Z8VC 3DTXA 3OAYH 3BDBA 5HJ3A 4DOHE 4AIOA 4KV5E 1INDH 4ZPVB 2FX9L 2ZSVA 4NM8L 4X5WA 5EU3B 4H1LG 4U6XB 1U8KB 1DQQB 2BVPA 3FZUD 4XCEB 3S36H 4PP2A 4XVSL 3VG0L 5FB8A 3MRGA 4JAMA 4QRTB 4QWWC 2IPTL 1UQSA 1QKZL 1BMGA 3T2QA 1AR1D 2IBZX 3MLVH 5A2JH 2X1XR 3HMXL 5F1IB 5C2UB 4KV5F 4Z7VB 3OJ2C 4OTXL 1HXYA 2CDGB 2Q8BL 5BXFB 4KXZH 5C6WH 1S5HB 4LQ1A 5B4MD 1ETZB 3BIAX 3QNXB 1H3PL 1NBZA 4BH7A 5I1EH 4AEHH 1D9KD 4Y16A 4OCRL 1FZJA 3HC3L 4I48A 5D5MF 5HSFA 1CVRA 4NBYB 3P9MB 35C8H 1EFXA 4HHAA 1QA9B 4P46A 2D0GA 1DJSA 5CLTA 4L8SA 5C9JB 3G6AA 3W9DA 5HJ3B 1FL3A 3AREC 4KDTC 1F4YL 5SWQA 5H37H 2ZUXA 5C09A 2VC2H 1FFPB 1NKOA 1KJMA 3EHBD 3P9LA 4HKJA 4FP8L 5DMGC 4OCMC 2IAND 4LIQE 1ULVA 3D39D 3QHFH 2YRZA 5C0JA 3E2HB 1G7IA 3RTQD 5HYSG 3WD5H 4WU7B 3BT2H 1KPVB 3TA3D 2H3NA 3ROLB 4HIIB 4PR5B 2FO4A 1DEEB 3JV6A 5T1LD 4P59L 1I85A 4PRAB 2BNQA 1HHIA 1QHOA 4FNLL 2HJKB 4YDKH 1CDIA 1JF1A 2WINA 5TE7L 4PLJC 5CEZE 4I5BB 4NQDE 4WFEE 1HIML 3BDXA 3QUXC 1CD8A 2QLVB 1XGUA 4N9GA 4G6KL 3SDXB 4Z18A 3MBEC 2AK4E 1L4IA 5DZLA 4HS8L 3CGTA 4KKCC 4DK3A 2YPLD 1IAII 3TNNA 5A2FA 1UXSA 3MV8B 5J3HC 1QRNB 4N1HB 1A6AB 3FB5A 1A7PH 2AVGA 3FFCE 4QHNA 1QFWH 4QRPE 1D6EB 5E70A 1IGFL 3P0VH 2OJZL 3LN4B 1OPGL 1BBDL 2BK8A 4ELKA 4G6JL 4U0RC 2FCBA 4WEMB 1WAAF 4J1UA 2BVOA 1Z3GH 2MKWA 1PKQB 4OCYL 5T1LB 2EC8A 4J3UA 4JCLA 4Y89A 2HMIC 3DSFL 3B9KB 3FAWA 3MYZA 1BP3B 2D7PA 2R2BB 3ZHLA 5E8EA 4YJZL 5BRZE 1CK0H 1RMFL 3TBYB 3HFML 3LIZL 3VFUA 3ARDA 2V9TA 5MHSE 1JGEA 3FQXB 3VFVB 5KS9B 1S7VB 4JFYA 3S3JA 5I9QB 3MOAH 3QDAA 3KJ6L 4HUWB 3WLBB 2BNQD 2E6QA 4UT7L 3BQUB 3FO2B 3PWVB 5JXEC 4ODBD 4HKJB 5LWYH 4MA1B 4P3WA 2DTSA 3U4AA 4G7VL 3RWFB 5IMOB 7CGTA 4BYHA 3H7LA 25C8L 1Z6JT 5I6XB 3DX8A 5KSUB 3KYMA 1L9MA 2Z93B 3I6LE 4LDLB 3QIBA 2HTLD 2P5EB 5DA0B 3T3ME 2JJUA 4K8RH 4G5ZL 1FPTH 2HKHH 5K59E 2YC1A 4WUKL 4PJ7A 3LAFA 1T7VA 5I0ZA 5AUMB 4LKCB 3ULVD 5T3XL 5DJZA 2I9LA 3MBEB 4FS0A 1CFBA 3DHMA 4MAUH 3MRQA 1HZHH 1ZA3B 4OIAA 5CGYC 5FDYA 2F53E 1AD0B 2W9DH 1X7QB 4LCUB 3BEVA 1ZLWK 1CL7L 1FG2B 1G7MB 3FO9A 4KQ3L 4PV9A 3MRNB 3RGVA 4L8CA 5EN2B 5EU5A 2WBJA 4GKNB 1VB9A 3D3VD 1WVZA 1J0HA 3P11L 3DSNA 1CGTA 3E2HC 3FQTA 1URLA 3HC4H 4GKZB 5CHNB 1QFOA 3BKYH 1UC6A 4OB5H 3PP4L 4HFUL 4K7FA 5CJXA 3JWNC 3MLYL 4LVHB 4O58L 4PG2A 5D4QA 1RUKL 1S7TB 5MI0C 4TTGA 2VLLA 3LKRB 1MJ7L 2CXGA 1S9VA 5TE6H 1ZT4B 4U2ZA 4M7JH 5JIKA 1CICB 4YR6A 5JW5B 4G9FE 3ARSA 4JKKA 2BRRH 5I74C 4Z8FL 4OF0A 1AH1A 2Z92B 3FFDB 1G9NC 4H1LB 3QWQB 2BCKB 3QH3A 3UPRB 2B1AL 3UEZA 2DKMA 1YNKH 3GSNH 2OQJB 3QCTL 1G84A 1ZHBA 4JFFE 1DQJB 5FO7B 3VCLB 3F58L 5I2IB 3AGVA 5FHBH 4UI2A 3O8XA 3WJJC 1QA9A 2ADJB 4AIZA 1Z9LA 4WFFD 4UT9L 2Q8AL 4DUWA 1CL7I 3SCMB 4XPTL 2XKNB 3M8OH 2B39A 2BSRB 3UCRA 4GW1A 2ADFL 3ARUA 3V6BR 4GRLB 1JZ3A 2YSSB 1ACYL 1DLFH 1S5HA 3OBAA 3MZTA 4LLMB 2VZSA 3DSFH 3LKSA 3VXSD 2FHFA 4NZUL 3ZDYE 4H25A 4TQEL 2CDFA 2W0FA 2YHGA 3BSZL 4JPWL 2Q87A 5GRJH 1FYTD 1EO8H 1CXKA 4P46B 4NUJA 2RCSL 2IG2L 4OD3H 5F7EL 4Y4FD 1TLKA 3GJEA 1ZLSL 4MWFA 5KSBB 3TIEA 4ODSH 4K94C 4DFIA 1WGOA 2YR3A 1U8IA 1X44A 4NQXB 4Y0GA 1WFUA 4MVBD 2VLRE 3SN6N 4UT7H 4D8PB 3STLB 3CFDA 1JHTB 4NDMB 2VZ1A 4LCIL 1SEQH 1VGEH 2CGRH 3VD3A 4K7PH 2FJHB 1A22B 4PYHA 4GMTL 1AE6L 3SDAA 4C57C 2UVEA 2JK5A 1S7UB 4XPBL 1WBXA 1MJJB 3T8XA 4EN3A 3T1FB 4JN2B 3PDDA 4JFEB 4NRZA 5FUCE 4MGXA 4PJXF 1M7IA 1A1MA 1MQ8A 3GSXB 4FQXB 4HUUB 3LKPA 1UH3A 3KPSB 2Z4QA 5FOJA 5GJSH 1KG0A 4P4KB 2H2SC 4RAVA 4QHKJ 1LEIB 3O6LL 4M7LT 1KACB 1FYTB 2P8MB 1EGJH 1NGQH 5GGSB 4GW4A 5C0IA 2B2XH 4KKAC 1BM3L 4LPUA 3FRUB 4Y4HA 5LGHL 3KWWA 5I76A 3DV4B 3IAPA 5JW4N 1MJUH 3B3IB 3NAAH 2FX8L 2YUXA 1I1FB 3BJLA 1AGFB 3CLFH 1ZLUH 3T0XA 4OJFH 5SX5K 2IAMA 4M03A 2DL2A 4H0IA 4GH7B 3W81A 3W5MA 1C8PA 1HI6A 1GHFL 4GBXD 5DSCA 4X4ME 3EZJB 1GZQB 4QXTB 4F2MA 4X4XB 5CEZD 1KC5L 4KZEH 3BWAA 4Q7DA 1CTNA 1XAUA 5F7HA 4JRYD 2AXHA 3ZT5A 1JGVL 1MCCA 4N0UA 4QYOB 5EBMB 2EXWC 2EZ0C 1VSCA 3VGFA 3OX8A 3QUYD 1Z9SA 2VLRA 4R7DB 4LOUC 4XVTH 3NPZB 4YDIH 1NBVH 3KYAA 5HY9A 43C9A 3MV9B 1FCGA 1OT2A 1HCFX 2AK4B 4NM8H 5DJCA 4MJ2A 4K2UL 3PWPD 2PUQT 3T2OA 4HX1B 4KI5C 2DLFL 4WFHD 1ZVHA 1CLYL 1TCRA 3QIUC 4RFOH 4AEFA 4ZO8A 1AO7E 2NY5H 4JDZB 5C0AB 4P2RD 2EZ0D 2VZOA 2DQUL 4FN0A 4V1DB 5EA0L 3FQWA 1AGDA 4O2CA 1ZE3C 1T0NB 3SDCD 1U8MA 1A2YA 3QA3A 2WAHA 3EYFB 1TVHA 3R0NA 1KJ3H 4PRPA 3OG6B 2LTQC 3HE7C 2HFFA 5IB4B 1Z5LA 2JCCE 3PHSA 3RVVC 1WF5A 5E8OB 3HNVL 1X5HA 4H0GA 4P3CL 4YDJA 5HHNB 3H8NA 5E8NB 2L0DA 3NACL 3RGVB 4YEFA 1U91B 1FV1B 3I3BA 1JYXA 4O2FB 3FRPA 5JPNA 4NQUA 4QGTA 1R0AL 3MRRB 4J3XA 3WO3B 3FRUA 4Y4HB 1KSRA 4GMSL 3B4NA 1C5BH 2KBGA 1ZGLM 1ZA3A 1LDPL 3OHXB 2BJMH 1S7XB 3QWRD 4M1GL 2WLZA 3HE6D 1HDMA 1AE6H 5C0AD 2PTTB 5JQ6L 2PYEE 4JY5L 5K59F 4HGWB 3BUYA 3S37X 3HCVB 4YE4L 4D0BB 5C92A 1MRCH 1KLGA 1KLUA 2Z91A 2LTQB 2VDMH 1NAML 2DICA 3K4ZA 4XGZA 4JFOB 1B6UA 4ODSL 4N0UE 2X89D 4HJ0C 1U8HB 4KKBD 4NYLB 1UKSA 1Q0YL 4IIQB 4M48H 1NUFA 3UPRA 3QDHA 5T3ZH 5DFVD 2VABB 2A73A 5FYJL 5AD0B 3EBAA 5I1GL 2DQDL 3E8UH 1FJ1B 1CICA 2DQGL 1OAKL 4XWGH 2VR5A 5DVMA 3C6LA 2GSGA 3NIDE 4YBLB 1KT2A 1SBBA 4XCNB 1F4HA 3NIFF 1MAKA 5CAYB 4JPKL 2XPGB 4PY7A 4XBGA 1TNNA 2C1PA 4K2UH 4QXUH 5CBEB 1P7HL 3UYPA 2E9JA 3MLXL 1FLRL 5I19H 3LEYL 1AFVL 3IFOA 1TITA 2GJZB 4JKPL 3BKMH 4JB9H 3O6ML 4I3RH 1GPOH 5KSBE 3L6FB 4LDOB 4O9HH 4HH9A 2EIEA 2JB5L 3FFCA 4QRPA 1YEHL 5FIEA 4NQEA 4U3HA 5CSZA 3RTQB 5IV2A 3C5ZA 4LAQH 1LE5A 2JJVA 4AEEA 3TP4A 3T4YB 5DVOA 1RUAL 3VGDA 4XNMB 3K4DA 3C8HA 3MGOA 5E9DE 2AJZB 3EYQD 4U2YA 5ALBH 1HZHL 5J7CC 1D5IL 4LSRH 5B21A 3VXRE 1CE1H 3UC0H 3HPLB 2G2RA 4LARL 5JR1H 1VHPA 3OPZH 4KY1L 5KSUA 2BSTB 5IW3A 2V2XB 4E41B 4F33B 1W8OA 3KPLB 1QFPA