5F96H

Crystal structure of broadly neutralizing vh1-46 germline-derived cd4-binding site-directed antibody ch235.12 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
225
structure length
220
Chain Sequence
QVRLAQYGGGVKRLGATMTLSCVASGYTFNDYYIHWVRQAPGQGFELLGYIDPANGRPDYAGALRERLSFYRDKSMETLYMDLRSLRYDDTAMYYCVRNVGTAGSLLHYDHWGSGSPVIVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 44
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H01
3HLAB 2IH1A 2Y23A 1LO5B 5EBGA 3KPRE 5IV2A 1VCAA 2P47B 3B3IB 4JJHA 4KJQC 3F7YA 5CHNB 4KU1A 3ALPA 4X6DB 3O41A 2HMID 1A64A 5BCAA 3OPZH 4HC1A 4PJ5E 4LLYA 5EWIL 1HI6A 4N8CH 4QRPE 4CMHB 1MFBL 1CR9H 1Q9OA 3L3KB 4N0FB 2C3HA 5F7LB 2VDRL 3OKNA 4UTBL 1P7QD 1X6LA 4M8QB 1JPFB 3SOBL 1BJ1H 1QLFA 1UM5L 3X17A 2V2TA 2UVEA 4Y5YA 1ZMYA 2A6KA 3P0YH 3D18B 4ISVB 3S9DB 3I85A 2IQ9H 4G80B 2RGSA 4NJ9L 2I9TB 5E70A 5A16B 5IESL 4MLIA 1A0QL 3VWKA 3UROR 1RD6A 4QOKE 3PGDA 2PR4H 2OR7A 3RVTC 3VI4F 3EJJX 4DKDC 2XNAB 1MIMH 1CYGA 3LS5H 4OCWL 4FFYL 5D7LA 2OLDA 2FBJL 3G5YA 3B9AA 3BD3A 3HE7D 4UI2A 5DMIH 3DMMC 1ACYH 3HZKB 5CEYB 1GJIA 3IDNB 3QXDA 4LVHB 1S7VA 5GS3A 4AT6A 1HH9A 3V95A 3QUYC 4OZHE 1N0LA 2CLZA 5CKGA 2HWZL 5DQJB 3SGJA 1KENL 3HI5H 5DYOB 3CZJA 4Z77A 2EH7L 4NZJA 5EN2A 1BD2E 2R8SL 2YD3A 3HI1A 2XKUA 5HI5D 2EXWD 1DSFH 1KLUB 4JG1L 5IHLB 3T1WA 5TQ0H 4ELMB 3QXVA 1BBDH 1NEZG 3MRFA 1JYXA 2DQDH 3VRLF 3RWEB 5FYKU 4G7YL 3BKYL 4LLDB 2ZSWA 4O51B 5BO1L 1EUTA 4QRRB 3MJ8A 5EC2B 3RX8A 5CWSA 5GZOC 4CAGA 3I6KA 4TVPE 1SEQL 3VXRB 1HOCB 5T3ZD 1I1YA 1KB9J 2H26B 3KPOB 4PGZA 1Y6NR 4K3HA 5IG7B 2GSIB 4H20H 3MLVH 4UT6L 5I30H 3NFNA 3WKML 3X12B 2EEDA 3C60A 5JLZA 3D39E 3ARDD 4Y88A 5CMAB 3MPCA 1U58B 4OGZA 1V3LA 1CFQA 3VXTB 3QFJA 1RUPH 2YC1B 5DUBB 1DDHA 2IMMA 2QQLL 3SJVE 4MNHA 5T3ZE 4EI5B 2HTLC 1I85A 3AU1B 1A1MB 1VHPA 1PEZA 2R0KL 1FAKT 4AEEA 2FYYB 5JUEH 2RFXB 2EIZB 4ZFFB 2APVA 1SY6L 1E27B 2B0SL 4PRPB 2IAND 4AIZA 1MAMH 1HDMA 2J8OA 1I7RA 2Y9RT 4AMKH 2GITB 3ZMRA 4M7ZC 3PNWA 4Z5RA 4M7KH 2OTWB 2VR9A 2O61A 2DQEL 5INDB 3MFFA 3RZWA 4HKJB 1V7NH 2NY6B 4KRPC 5C0CA 4S1SL 4K3EL 3GBNL 2ZKHH 4FFVC 4NQTA 3WN5A 5D2NC 3UJJL 2O5YH 3DUSB 3MV7A 3Q6GH 1ZANH 4GRLB 4EDWL 3WS6C 5GSRB 2A6JA 2Z4QB 3GSXA 1FGNL 2P5ED 3S5LG 1F4YL 5IEHA 2WINB 3HCVB 2UWEE 3PWLB 2DQTL 5D96B 1A7NH 4PR5B 4TUKH 2M8XA 4PB9L 1O7SA 3CLFL 5C6TL 5I18L 3WFHB 3KXFE 5AEAA 1IEBB 5K9QI 2EDNA 3THML 3I75A 4L3CA 5F7KC 1FZKB 1UQSA 3A6OA 3WIIH 1U3HD 3VFMB 3UTZA 1XR8B 5ELIA 4KY1L 4MS8D 2ZOKA 3WUWB 3RVXC 5C70A 3OHXA 2V9QA 2R0WH 4X6CF 1UH2A 3SBWC 3QCUL 3SDCB 4C83B 4LPYA 2FB4H 4ZTPL 1QHPA 4P5TD 2HLFC 4Q2ZA 1P5UA 3F12A 1J88A 4HIXL 2GK0B 3S35X 1NGPL 2XWJB 4FQXD 1V7MH 3NTCL 1MOEA 1X5ZA 3D2UA 5EO0A 5FGRA 4X5WA 1NFKA 3FB6A 3WLWD 1UC6A 2VXSH 2AKRA 4RIRA 1LO3H 1YNLH 4OTXL 1JUFB 4NRZB 3QDMB 5F71A 5E56A 1JMXA 3Q1SH 4KMTH 4DKFH 1F3DH 3RTQD 2PXYC 4OT1L 3EYUH 5LCVH 2GTZB 4I77H 4OCSH 4K3DH 1BVLA 5IMKB 5JHLH 4S11A 3VE0B 2DM2A 1YQVH 5I1LA 3QDAA 5MHSD 3EZJB 1CFTA 5ETUB 2VKXA 1MIEH 1MVFA 3W9DA 3OX8B 4L3ED 3EOBA 2ICWJ 1TJHH 1QQDB 1OAXH 4LGPB 5F8QC 4F3FA 5BW7C 1IC7H 1SMAA 5FYKH 1G7IB 5F1NB 5GGRA 2EDOA 4HCRH 2EE3A 2OP4L 5KSAA 3BXNB 3GIVB 1XT5A 2P5WA 4L3EE 3ZE0E 2ARJQ 1BF8A 2A74A 1YMME 3SDAA 3TZVB 4PS4H 5FUCC 2VXUH 1X4XA 5KSBE 4XCEA 1AGBA 4KI1A 3JTSA 3QJHA 2EYTB 1X5LA 4RGMC 4NO0A 1U93B 2HKFL 3WBDA 3T0XA 3KYMB 3QUXA 4GW4A 4K9EH 1I9RH 4IRSD 4NRYA 3U30B 3TBYA 4PLKD 1DVFC 1T0NA 3GSUB 3VRJB 2EH8L 1KXTB 3UBXG 3QHFL 1FC2D 3RWHA 2PF6A 5EBMA 4LIQH 1OAYH 2F5AL 1RZFH 3PHOA 2EKSA 1NC2A 3LRSA 1XF1A 4KGLA 3QXWA 1LGVA 4KK6C 2AJZB 3ZT7A 1DTUA 4ZO8A 1FYTB 2GAZA 4LEXL 1WBYA 3ARPA 4GKZB 4WWKC 4NGHH 3WNMA 4UQ3B 4KUCD 3W81A 4E41E 4RGNC 1XGYH 4PRIB 5F7DA 1QSFE 3NFPB 2Z0BA 4NN7B 3ZSTA 1MHPH 3D87B 3MZTA 4ZUUB 4XPHL 1B0GB 5D5MA 1T1ZA 1JF6A 5I76A 1TVBB 2WW8A 3LKSB 1G9NL 1UWGH 2XZCL 2ZOLB 4JANA 4ZXBD 5JIIA 3HNTL 2Y06H 5D1XC 3QEQD 4NQEE 4DVRL 5C0NC 5MENA 1DBML 2Y07H 1SBSL 4U2YA 3IJYA 1I9IL 5FYJE 5GJTH 2P8PA 4R97C 3T0EB 4XI5C 1CQKA 1LO4H 4L29B 1UM6H 4LSQH 4C54A 1IAIH 3DWTA 5BV7C 2V2XB 2NY5H 1KC5L 1KIQA 2F54B 4NDMA 5KG9A 4KHTH 4RCAA 2NX5E 3MYJB 4ZSOB 12E8L 5DEGA 5F1IB 2L7JA 2VITA 2YMXL 2VUYA 2GKIA 2UZIH 4WRLA 1XF4A 2VAAA 3ISWA 5I71C 3O6LH 3QIBA 2W9EH 2C3VB 4MGXA 1WV7T 4M6OH 2DQHH 4LLMA 5ICXB 3S5LA 2PYEB 3T1FB 3V7AG 5IM7A 5L88L 2FH6A 1KIPB 2BERA 4M02A 4X98A 1AI1L 2DTMH 1OP9A 3MLUL 3BZEA 3NCCB 4CN6A 5KOMC 1LE5B 1I3GH 3EYFA 2NW3A 3ZHKA 1U42A 3PJSB 1OCWL 4AL8H 3NIGF 5DMYA 1CD1B 3DROB 3QAZB 1HN1A 3ZKQD 4I4WA 1QBML 2QQNL 3H9SB 4IDJL 2B1AH 4JY5L 3TBSA 1MJ7H 1MCBA 3LD8C 4N9OB 3CVIL 1F8TH 2ORBL 4JZJA 1BVKB 1QLRB 1FP5A 3B8YA 4NUJA 2FJHA 1AXSB 1LO0L 1TCRA 3RI5K 5BS0D 1C1EH 3NZHH 1CZ8H 4ZTOL 5C0AA 5DMKB 4EIGB 5KVFH 2HLAB 4P3WA 3HMWH 1KCRH 4HULB 3MMEA 4UINL 4OLWH 5E08L 4MA3A 5DD1L 3QDGE 5C2BL 2C1OB 3VD5A 4D9LL 4NO2B 1HEZB 3KDMB 1CDJA 3WYRA 1IAOB 3TO4A 1FVEA 1UXWA 1I3RB 5BS0E 1JGDB 2NZ9C 1I9JL 5DI8B 1JWMA 2XYCA 4PRHA 1ED3A 4O2FA 3RZCA 1T66D 1KJ2B 1DUYB 3T3MF 4OZFH 5KSVB 4Y16B 5IT2L 2V7NA 3S34H 1OHQA 1NDMA 5I75C 4WHYG 3CCHA 4AM0A 4YO0B 3VXOA 5I17A 3ZKMC 3MV9B 3MNZA 2FH8A 4KDWA 5DJ2A 1DBAH 1PEWA 3I9GH 1LP9F 3FRPG 4P99A 1Q1JL 3RL1B 4X4XA 1A4JB 1VESA 4Z95H 5B4MC 4HIHB 1K6QL 3FN0H 4M1DL 2ZZUT 5F9JB 3E3QC 2YN3A 4JRYB 2VE6B 2X1XR 1OAZH 4O4YH 1EV2E 4MJIB 3EYOA 2PO6A 2BXYA 5JA8B 4PTTA 4ELKA 3TVMB 2BVPA 4HGMA 2BDNH 1B6DA 4RFEA 4P9HL 5E5UB 4NHCH 4YHML 4W70A 5L0QB 1BQHB 2XQYG 1WLHA 3B9VA 2WBKA 2HFGL 4RBPH 4WFHD 4LLWB 3KPLA 1NMCC 5BXFA 4PJEF 4LPXA 1WVZA 3UBXA 3X3FH 1LD9B 3WO4B 5KOVC 3T65A 4R9HA 5L8LB 3FB7B 4OCLC 4R4BA 5F9DC 4P2QB 5EU5B 2DD8H 2ZUUA 4Q97A 3MOBL 1QBBA 2HVKA 4XP6H 4PJIA 5IVXB 3CC5A 3X3GH 4HUXA 1EHLH 3CFEB 4QRUB 2H2PD 1CGVA 3EYSL 4WFHE 3RUGF 2X2YA 1UG9A 5GS0D 4RAVB 3ULVF 4ODSL 4S1QH 3MLXL 4I2XE 1R3JB 3B8SA 1UB5A 4L4TA 1J0YA 4OCMC 3WXWL 1VEPA 1GC1C 2JJWA 1HQRB 4PYHA 3CXDL 3TYGH 3VXPB 4P3DB 4V2CB 5C86A 3VXMD 1G0DA 3BW9B 1CGYA 2W92A 5AAMA 1MRFH 1BREA 2AK4A 3OAZH 4PP2B 2VC2L 3NH7H 1P69B 1NFDE 2AP2A 1XCQA 4JKMA 4PJGF 5DXWA 3TPUA 2YRLA 1SVZA 1CDHA 3I6LD 1NGWA 3U83A 2HVJB 3IFOB 2P48B 3VXME 4KRNA 2BCKA 5DC4B 4RISH 2FX7H 5FKPB 4MD4A 5D7SL 3BZ4A 3PWPA 1YMHB 3IYLW 1EGJL 4WW2F 4KKCD 2ESVD 1I3UA 3MA9H 3MBEB 1XR9A 3FO9B 4JM2A 3QIWC 1C08A 4X80H 4WUUA 1RUKH 2YBRB 2AXGB 4Y2DD 4QHLA 1FLRH 5KJRL 4ZYKB 1RUAL 5DFVC 3HZVB 3UPAA 3C6LB 2Z91B 3VFTA 4D3CL 4DKEL 4J1UA 4FZ8L 3R4DA 1A14H 3INUL 1KJ2L 1CICB 2XTJC 3IDGA 5ANMB 4JO4L 4G9FE 1FIGL 4PLOB 3HPJB 4WU5B 3WIHL 2VQ1A 2FIKA 3HMXL 3U48A 1FFQA 2PW2A 1CXKA 2D3VA 4H25A 2DQGL 4QYOB 5CJ8A 3DVFA 4GS7C 5MP6L 4MD5A 4WNQA 5DRXA 5E5RB 1CDYA 3TT1L 3MRMA 5AZEH 3N1QC 1ACZA 1U8JA 4X6FA 1EZVX 5DQDH 3LMJH 5DO2C 1CXFA 5HDQH 3HE6B 4EUPB 2IH3B 4X5XB 2J5LB 1SM3H 4EBQH 1ZS8B 1TZIB 3QJFB 1I1FB 3WLBA 3WHE0 3PP4H 5EFIA 4Z7WA 3U46B 5IB1B 4JREB 4NIKB 1YY8B 1DBJH 4NKMA 3UXFA 3MRIA 3RGVB 4XBEL 4WI4A 5KVEL 2LQRA 1VADA 4GOSA 3CDFA 4HD9A 4WI7A 2OYPA 5J13C 1CDIA 1BFVL 2VDNL 1NFDF 4LVNC 1MCIA 3OKMB 1MI5E 2VSCA 4DUVA 1UZ6E 2N7AA 4QCIB 1FO0H 5DZOA 3TCLB 4UDTA 1N3NA 3BGAA 5EA0L 1ZHLB 3FRPA 4NZRL 5GGTL 1IEAA 1Q0YH 4R2GC 3S4SB 3TV3H 5EULV 5CD5C 5FDYA 3CFBB 4I48B 4R8WH 5JMOC 1BJ8A 1RZGA 1U8KB 5SWSD 1XH3A 3QEQA 1FNHA 5LXGH 4P4RA 1EMTL 2WP3O 3DX7B 5KVDH 4BFGA 1CU4L 2R39A 3VD9A 1U6AL 1AIFB 1QVOA 5EZLB 5IUSA 5IB4A 3CGTA 5EOCH 4PB0L 2OK0L 2NPLX 1JP5A 3NOIA 4M7JH 4JRXB 1MJ8H 4R0LC 4R7NB 2D7PA 4OI9A 4YDKH 1TPXB 5EOTA 3H7BB 4D9QE 2YR3A 3W9EA 5LVEA 2EE2A 1XGRB 3EHBC 5DJYA 2VXQH 5E1AB 3QIUD 5I15H 2B4CH 4Q6YA 5DJDA 2EDDA 4Q9CA 3FQTA 1UJTA 3LKRA 4RMSA 2WK2A 2VDKH 4X6BB 3IDYB 3SQBA 4U3CA 4E0RA 3DVIA 1FZOB 2ENYA 5CUSH 1LEIA 4HJGB 1B9ZA 5EUOE 3W2DH 2F19H 1VPOL 1OARL 1I8IA 4DEPC 2C3WA 3MJ7A 1T22A 1P4IL 1HWHB 1TQCC 1FL3B 1FNFA 3RKPA 2LAGB 2X1OA 1K8IA 1PJ9A 4PV9B 1I7TA 5J12C 5AAWA 2CGRH 1B0RA 1X5XA 2E9IA 2MQ3A 3P4NA 4PJ9C 1NMAH 4ENED 1X3DA 4IMLB 5GGVH 1OY3B 1OGTB 4HUWA 4LSRL 3RY6A 1TQBC 1JRHI 3PDOB 3WMSA 4NKQB 4MQXC 2EC9U 4KXZH 2J8HA 2LU7A 5DJ0B 3BFOA 1F11A 4ZO6A 4OBSA 2DLIA 4GRWB 4NQCE 1INQB 4WHYH 2R56H 4F9PC 3MLSL 5D1ZC 4WEUD 5GRJL 4YHNB 4P59L 1YEHH 2JIXD 4JFEB 4Z6AT 5HYJD 4TPRL 3DIFB 3IGAB 3SDDC 2SEBB 3HZMB 4K2UH 5J6HA 4PJFF 1JIBA 3FB5B 3LN9A 4JHWH 1TZGL 5SWZD 4FQCH 3FN3A 1G7MB 4M1GL 5TQ2H 4MDIB 4LRNH 3IXTA 1EEZB 1IKFH 1JCKA 2XY2A 4ETYA 1CFNB 5BRZD 3Q5TA 1I8LA 2ED9A 3BZDA 5C08A 3RWJB 1H3WM 3JV6B 3HPLB 1D9KB 2EDXA 3T08A 2R4RH 5E6IC 5DUPL 1RJZB 5C9KA 4O58L 1OQXA 3N50A 1GHFL 4HMDA 4J6RL 1EO8L 4ZNEA 2F74A 4P3CL 3WUZA 5DZNA 5J3HC 1EHXA 3HA0A 1OP5H 1RY7B 5T3XD 1GGIL 1U95B 4HS3B 4D0CB 2XN9A 1UVQB 3NCYP 2V5SA 3SBWA 3N1GC 4JFYB 2CUHA 2A38A 4Y4HC 1AO7A 4ZOBA 1AGDA 3MV8B 5DRNA 5D8JH 2EIEA 1QTYT 3BUYA 5H35A 3SE4C 5EDXA 4LVEA 5I8EB 3VFSB 4JDZA 4G8IB 4Y1AD 2R4SH 1FG2B 5BZWB 2CSPA 1VKXB 4TSAL 1IEHA 4JHAH 3GHBL 3L3JA 3O9WC 5LJYH 1WIPA 3ZHDA 5F3BA 5EG6C 4WTWA 4AEIL 4XPFH 1M05B 3RDTB 5CBAA 3MRQB 3NACH 3Q5YA 4U3XA 3W0WE 3SO5A 5DRZB 1FRGL 5FGCE 2W59A 5JO5B 4HBCH 2VR5A 1T7VA 5EIQA 3U6RA 2VLKD 1JHKH 2DDQL 3T3PF 5CP7B 1D5ZA 4XP1L 5FYLH 3GKWH 3TH2T 1JNLL 1RUML 4IRJB 5JIPA 4JPWL 4P23C 1A7OL 3K80A 4OLUL 4O2CB 1OLLA 1CT8B 4M9OA 4YPJA 4FTVE 1A02N 1T1YB 4JB9L 2Q7YA 4S1RH 1ONQA 5L9DH 2VLKE 2Z93B 1H8SA 4DWHA 5B38B 3N9GL 1LK2B 1T80A 3HI6L 4I0PA 5F7FA 1A47A 3MSPA 4X0KA 1OTSC 1ZOXA 3LEVH 3RWIB 3HC0B 3WXVH 3QFJE 4N0UB 1H8NA 4PJ8B 4NRXB 5JXED 2AGJH 3J7HA 3Q48A 2QADB 1MVUB 3BVNA 5FV2A 4O00A 2YPVH 5E9DA 4D9RD 4WI5A 5TDNA 3QH3B 4OV6F 4RAHA 5IFHL 1B2WL 2XPGA 4QLRA 3MO1A 4OSUL 1EFQA 1DVFA 5C0BB 4CN1A 4ONHB 3PGFH 3ARGA 3DYMA 3KHOA 1VFBA 3X11B 4AY0A 4B7LA 5DRWB 4C59B 5B8CA 5C07D 3HC3H 2ITCB 1LMKA 4XGZB 5IGXL 4NKIH 3O6FB 1A5FL 1YZZA 3ORJA 3PWJA 5F9WB 4Y5XC 1S9VA 2AEQH 1WEJL 3JVGA 4MAYB 4OUUB 2ZSVB 2ZP0T 1F3RB 4F7MA 2BZDA 3VCLB 2WWKO 5ESQB 5FYKE 5C0CE 5I2IB 4NO5A 5IQ7L 2FD6L 2X4OA 5HI4C 1MCEA 2VLRA 1KCSL 2FLRT 3G5VB 3C6SA 1IC1A 3KLSA 3MV7E 3F5WA 4XH2B 4HWEL 4PRNA 3AY4A 3DBXA 3O11B 3IFPA 3DYOA 3BWAA 4HS8H 5DEFB 4DGVL 5FEBA 1XF2B 4Q0XH 1UA6L 4LCCC 1K2DA 4HFWB 4D8PB 4HDIA 4QRTA 2QR0B 3JV0A 2AEPH 5DK2B 4DW2L 2FR4A 3KJ4C 4F33B 3G6AB 4P2RD 1NCWH 1OD9A 3GMQA 4XAKD 3AM8C 4P9HC 5IF0B 1QFUH 2K3TA 1IM3B 2IFGA 1LNUB 1T04A 3LB6D 3S3JA 3OJDA 1JFQL 4JFQA 4U6HA 1TJIH 1S9WB 4P46D 3NIDE 3KYKL 5B21A 3KGRA 5AD0A 4YIQB 4YR6A 3PHSA 3U9PH 3SKUD 3QPQC 3FTGB 3DXAB 1BM3L 5AUMA 1H15A 1N59A 1R3IL 4A6YH 4ZUWB 2X4RA 3FFCB 4HIIB 5K9JL 4JAMB 5LGKA 1JV5A 3O45A 3FAXA 5D93C 1T1WA 3RPKA 4HWBA 1NSNL 4MQ7B 3AFLA 3WSQH 4RFNC 3QWQB 5DD0H 3BIKA 1X5KA 4OM0H 2DYPD 1KV3A 1N8ZB 1LO2H 3MROA 5IJVB 3H42L 3HNSL 2E6QA 4TTDD 4FMFA 3GSNB 4KKAD 2DBJA 2W38A 5HGBA 4QRQA 1FVDB 2Z8RA 5DHVB 1Z9SA 3FHAA 4EI5D 1D5XB 1W72B 5F6HI 4C56D 5SX5H 1S7XB 3RKDD 4YHYB 1LHZA 1MWAA 4QHKI 1MCSA 3DSFH 3KPSD 1Q9WA 3TT3H 2C1PB 3CX5J 4WFFE 4L1DA 5FF6A 2R2CA 4PRPD 3TLRA 1OWRM 3MCG1 2FJGA 1INEH 1BWWA 3M1BB 4PREA 4K8RC 2C4FT 3EFDH 4PY8I 5I1HL 3B2VL 2D4FA 2DKMA 1JN6B 3BPLC 3PABB 1AJ7H 2MCPL 4RSVA 4KJWD 2MTPA 2D0GA 3F6IA 5BV7H 4UT9L 3TN0C 1PLGL 1RZJC 1I1AA 3VFRB 4FMKA 5D2LB 3Q3GA 5E99H 1E4JA 2VOTA 5JDJA 1J11A 4PTUB 2JELL 4L8SA 5T1LB 4JG0H 1C8PA 4G6ML 4WVRA 2AQ2A 5D70H 3VFVB 4FXKA 2O5XL 1SJHA 4JPIA 3SDXF 1FJ1B 4CRPA 3TBTB 4K3JL 4YHPB 1CGXA 4DZBB 4CMMB 5JW5A 1MEXH 1EVUA 3L3IA 4BUHA 2YUZA 1NUNB 2Y7QB 3SE8L 4GBXA 5D5ME 1KJMA 3E6HA 3CFKA 5FOBA 3VW3L 3SCMB 1QR1A 4H1LA 3U7YH 3BAEL 2PETA 5TF0A 1IE5A 5IEKB 5MENE 3VD4A 3QUML 1NC4B 5ITBL 3DTXB 1QRND 3T4YB 2CIKB 1BIHA 4QXGL 5T1KD 5GGRY 4YAQA 3BI9X 2V9RA 3DX9B 3RNQA 4POZC 4R3SA 2MFNA 1RQ5A 4OCXH 1JF1B 1YJDL 1A4KB 4JKLA 4M1CD 1D5IH 1RK1A 3CDYA 5IMOA 1JHLH 5HXMA 2XQBH 4KQ3L 3CAFA 1U8IA 1FNEA 1LEKA 2QSCH 4IHOB 2H9GA 1RULL 3IFNL 4LMQI 5DT1H 4M3KB 5HVGB 1AY1L 1IGCH 5JDSB 3ZZ1A 1BQUA 3FT2A 3GDBA 1YYMH 4MNQB 4EXPX 4Y4FC 3FOLB 2VDOH 1MWAH 1U8PA 4LSUL 1JYNA 3AS1A 1GL4B 4IRZH 1MCFA 3IETB 4LASH 1KACB 4NNPH 1T3FA 1MHCA 4PLJC 5IMLB 4LSPL 4HJJH 3RY4A 2GYSA 4Q7DA 4IOIB 1LDSA 1U8OA 3DRQB 2NY4B 2ICEB 4NYLB 2F8VA 4UBDD 3S88L 3V0WH 1NGYA 1MRDH 4XPBL 4L4VA 4P57A 4OF6A 5FGBA 1W72L 3GBMH 2VB5A 4UIKL 5ID0A 1UT9A 1R5WB 2WWKT 3WHXB 1YC7A 4K7FA 4U1SA 1UCTA 2XA8L 1MHHA 5F44A 5EU3A 3FFDB 3V52L 5HGDA 2FZ3A 2DLFL 4AIOA 3OKYA 3MRCA 1RFDL 3F7QA 4KKBD 3TJEH 5EWIH 1T0MA 4Y19A 3MRNB 1V3KA 1LILA 2YPLA 5DURD 3LPGA 2YUVA 4JFDB 5F1KC 4DTGH 2Q3AA 3RVUD 2H2SC 4LKCB 3U4BL 2VDRH 4HS6A 4UTBH 2RAMA 1RJCA 4FN0A 4OZIA 1PG7X 1RSFA 3SOBH 2Z31B 3LDBC 3ZDXF 1EEQA 3HLAA 1LO5A 1IGYB 1SY6A 3VXSA 5IJKA 3SDYL 3B3IA 2EDFA 4OD3L 4CADB 3I6GB 4FXLA 4N0YL 3GHEL 4NJ9H 2PN5A 3U79A 5IESH 2YD4A 2RBLA 1ORSB 4PRID 4X6DA 4Y4KD 1A0QH 1G9ML 4GAJL 4XHJC 5DJXB 1ITBB 4CDGC 3HG1B 2ICWB 4KJYB 1PDKA 1RIVL 2X89D 2Q7NA 3RAJL 4WWID 3L3KA 2ADIB 4N0FA 5DLML 2VDPL 1GC1H 2QQKL 1X5HA 4TQEL 5E7BA 5TE6L 3TNMB 4HPOL 4M8QA 4KI5D 2FBJH 1GGTA 3FQRB 5K59F 3LS4L 1BECA 4FQPA 3D18A 4HAGA 1QNZL 4ISVA 3IAGC 2FX8L 4G80A 2G60L 5IMMA 2I9TA 2F54D 5A16A 5FAAA 1JWSB 3MLZH 2XZQH 1NCBH 1MFCL 4LHJB 2HWZH 4N8VG 4U6VL 4K3GA 2QSTA 4JFZH 2VZTA 3UMTA 1AFVL 1NMBL 4NUGH 2R8SH 5FO7B 4DGIL 1VDGA 3U1SL 2VDML 4PJIE 5I8OH 1HYSC 3IJHB 1MCCA 3SY0B 5IQ9B 4LLQB 5JORB 5JPNB 3ZDYE 4NN6B 3ULVL 4G7YH 3BKYH 4GMSH 3CIQA 5BO1H 5LQBL 1KYOK 1IZJA 5GHWL 3HZKA 5CEYA 2Q1EA 3OQ3B 3OXRB 1G7LB 1MJUL 3GK8H 4L4TE 1CLYH 4WHCA 5DQJA 1DQML 3B9KC 4U6XB 3SO3B 1QACA 5DYOA 4PYGA 3GJEB 3A6BL 4OD1L 4JQVA 2VN4A 1KLFA 5TE7L 3WKMH 1KLUA 3H9SD 2OL3L 5GPRA 4ELMA 2AK4E 3M07A 3BP4B 3C5ZB 4M62H 4FNLH 2WUCL 3BHBA 5IHUH 3W39B 3RWEA 4AQOA 3GM8A 3HNVL 4FXGB 2G2RB 4LLDA 4O51A 5F89B 1JPST 3L3HB 4KROB 4QRRA 2AJYL 5A3ID 4ACPA 5EC2A 1GGUA 2R0KH 2VERN 2C9AA 3ULUC 2JJUA 4LCIH 1QBLH 5EIIB 3WEXB 3HHRB 3PWPE 3VXRA 4GKSB 1HOCA 1SY6H 2H26A 1OAQL 4GAYB 3KPOA 5IG7A 4PJ9A 2GSIA 5D7JC 2J1KA 5F7EL 3V7AE 5BQ7B 2NR6D 3X12A 3F8UB 1OSPH 4ZS6D 1U58A 3VXTA 2X1WL 4HK3N 1R3HB 2YC1A 4AEHH 5DUBA 1JYWA 1AD9B 2DQEH 5IBLD 2NXYC 3MRPA 4Y16D 2ADJB 5GJSH 4EI5A 4WHTB 4KJQD 3AU1A 1A1MA 3S36L 1CDUA 4S1SH 1G7JA 3GBNH 2FYYA 2RFXA 3MV9D 4ZFFA 1FGVH 4OF3A 4NM4H 5DVOA 1E27A 3VU2A 4PRPA 4M5YL 2F8XC 4EDWH 5C0JA 4H0GA 1CE1H 5TH2B 1IC4H 4V1DB 3EYVB 4PPTA 1FGNH 4JRYD 4M7LT 4HWUA 5KTEH 2DQTH 3BQUB 2OTWA 2KBGA 4KWUA 4YEFA 4W68A 5INDA 4HF5H 1CGWA 4NOFA 1RI8A 1CTNA 4RZCB 4HKJA 3TVMD 5IROC 2VDLL 3THMH 4JZOB 1C5DB 1HZHH 1NJ9B 5TPWL 4G6FB 2QL1A 4KV5E 4FFWC 1YUHB 3DUSA 3SGEI 2GFBB 3EO1B 4KY1H 4Z7WE 4GRLA 3TA3C 1WITA 4M3JA 1EJOH 5E6IA 2Z4QA 1J9CT 1CXIA 2VXVL 1NAKH 5JPMB 2WINA 5LGJA 3HCVA 3PWLA 4HIXH 4ONGL 1VGKB 3QI9B 4PR5A 1NGPH 3REWB 3NPSC 4K07A 1JZ7A 4X7SL 2XKSA 2VZ1A 3WFHA 3EOYG 3ESVF 1BZ7B 2COQA 3D48R 4XVSL 1IEBA 3DMMD 4LAQH 1AGCB 3BRFA 1FZKA 4OTXH 3L5WB 4PJAE 3QUYD 4LQFH 4ODXB 1T2QL 4GKOA 3KYAA 4XP4H 4UIMB 1XR8A 4YBQC 3WUWA 1WZ1L 4NO3B 4FZEL 4WCYH 5EU6D 3SDCA 5JHDB 1NGXB 3MLTB 4OIAA 4BFBD 4MXQC 3ZLQC 3QB7C 3VXQB 2FGZA 5LBSL 3SKNB 2GK0A 3G5ZB 2XWJA 2X9XA 4J4PC 3CFJB 1CDCA 3VG0L 4PRDB 1VSCA 1I1CA 4FQQB 3VWJC 2GTWA 4QHUB 4N8VA 5GZOD 3KPMA 1JUFA 3GI9L 4LCUB 2IG2H 3F62A 2ID5A 4NRZA 3QDMA 1A3RH 4YGAB 5ESAB 4P23A 5FIEA 2HFEB 2JB6A 2OSLB 2Z8VC 4LEOB 3GB7B 4PJHB 3QP3A 2GTZA 4WEMB 5IMKA 1HSBB 2DWEB 3VE0A 4EOWH 3TEUA 2HRPL 2AK1H 4FHBD 1CGUA 2WZPD 3EZ8A 1FORH 5ETUA 2HKFH 3I3BA 2HTLD 3OX8A 3GNMH 2V5YA 4MQSB 1QQDA 2NY1C 1CICD 2YRPA 2IBZY 1UJ3B 2EH8H 3QHFH 2J88L 1G7IA 5F1NA 2F5AH 3BXNA 3GIVA 1CF8H 2ZUXA 4NM8L 4X9IA 3TZVA 4LEXH 1VEMA 5FYLE 5I1KL 3PL6B 2OR8A 3KYMA 2YD8A 1A7BA 2EDHA 3R1GL 2GQHA 3RBGA 3ZTJH 2E8YA 4FFVD 1BQHG 3HE6D 2X4TB 5GS1B 1XIWC 3EDFA 4M6NH 3JWOC 3GSUA 2XZCH 4LQ1A 3VRJA 4Y5VC 2JB5L 3AROA 1D7FA 1N7ML 4DVRH 5F88B 4FFZL 1DBMH 1SBSH 1I9IH 5IBUB 4EKXA 3NFSL 1U41A 1FYTA 4KK9C 4WU7B 1KC5H 4GKZA 2NW2B 5CIPH 3QQ4A 4DK3A 3QHZL 1TMCB 2OI9B 1ZHKB 3NFPA 1V8HA 1EO7A 5F6HJ 4ZAKB 4ZUUA 1IGFH 4YEEA 1DFBL 4QHKJ 1EVTC 3LKSA 1JF5A 2ZOLA 3NCEB 4ODVL 5F7UA 3NN8B 1RK0B 2IF7A 3B9EA 1G6VK 1AKJD 3OR7B 2WM0A 4LVOB 3O0RL 4XC1L 5GRVK 2WBJC 4JZNB 5EBLB 3T0EA 1J87A 1DLHB 2J6EL 3QRFM 4L29A 2ZUYA 4Z7VF 4PY8J 2R0ZL 4KZDL 4QWWC 1AHWC 4QHNB 2YRZA 2V2XA 5DMJB 1AI1H 4ZNEE 1FE8L 2QQQA 4KPHL 1JZ3A 15C8H 1ZSDA 2F54A 2OZ4L 3MYJA 4JFFB 4ZSOA 1R0AL 2APFA 4DVBB 3D0VB 1UFUA 1OP3K 5B39G 1PX4A 2XN9E 2YK1L 1HCFX 5F1IA 4DGYL 5C7XL 3EDKA 1AO7E 6FABL 3MGOB 4XCFH 2D7NA 1QBMH 2QQNH 5F70A 5ICXA 2PYEA 3T1FA 2N7BA 2PXYD 2ORBH 4F15B 3FT3B 3BPCA 5DF0A 1YJDC 4BFEA 1KIPA 1CG9B 4P2OC 4TNVF 1LO0H 4ZTOH 3KAAA 3LZFH 3CXHJ 5D1QB 3IS0X 2X09A 2JKXA 4XBGB 5E08H 4UINH 3SGDH 2EZ0C 3PJSA 1UCBH 4APQC 4X8JB 1KTLB 1CD1A 2FHFA 2F53B 1JHTA 1T5WB 1OM3L 3QRGL 4KQ4H 3H9SA 4X9BA 4CL7A 4KTEL 5DHYB 1TTUA 4L8DB 1TVHB 4HXAL 5HHPB 4I8DA 4LHUB 1BVKA 1QLRA 1UB6B 2A73B 4QNPE 4GLRH 2B1HL 1IBGL 5I0ZA 5IT2H 1EGJA 3VXUB 5GISL 2FJFB 3ZKXC 4HZLB 1BBJB 4PBWD 5DMKA 4KVNL 4YC2C 5T5FL 2CLVA 2HLAA 3CUPA 1WC7B 2CH8A 3CK0L 2MJWA 1Q0XL 3CLEL 4GG8B 4OB5L 3GSQB 1G84A 2C1OA 2PNDA 1Q1JH 3MLWL 4NO2A 4H8WL 1H5BC 1HEZA 1WQVT 3KDMA 4LRIA 1N5YL 2JCCE 5EZIL 1IAOA 5ISZB 1YECH 3ARBB 3CZFB 1K6QH 3RX5A 1JGDA 5DI8A 3MOAL 4EXKA 1KJ2A 1YEDB 4B5EA 4KK6D 1DUYA 5E9DE 5KSVA 4OFVA 5EU7E 4GKNB 3WIHA 3HMXA 4WWKD 4LP4A 1NANH 5CZKA 3C5JB 4P9HH 4YO0A 3BDBA 4YHMH 3QUZC 3U2SB 4C57C 4HMEA 2DM7A 3RL1A 5DC0A 2I60L 3HAEB 4X99A 4RMVA 1A4JA 5F96L 2DKSA 1TZHB 4HIHA 5D1XD 1MQ8A 1S9XB 5C0ND 5F9JA 4WEBL 4JRYA 35C8H 2VE6A 3MOBH 4RGNE 4RMWA 4XI5D 4MJIA 1J1XH 6CGTA 4BQ6A 4YNYB 3TVMA 3BD4A 3GKZA 2VLRE 3BH8B 3BPNC 3SDXB 3CFCL 3H3BC 4TULH 3QYCA 1BQHA 4ZS7H 3MLXH 5T1DL 1CLOL 3IT8D 5I73B 4GG6B 3WXWH 4LLWA 3P40A 2DQFB 4WO4B 1LD9A 1F3DJ 3QNYB 4Z8FH 3FB7A 3MV8D 1S7SB 2IMNA 2P4AB 3DOSA 4P2QA 1E28B 1MRCL 2R29H 5EU5A 4OQTH 4JO3L 5AWNL 5IVXA 5GGTA 1AQDB 2J12B 2NY0C 3DI2B 4X9GA 2VL5B 3CFEA 3FCTB 1GIGH 2X1PA 4QRUA 4HKXB 3B2UC 3WCYA 3UTPD 5FHBL 3HUJB 4MVBC 1R3JA 5D7SH 1DE4B 3ZSSA 1HQRA 3MUGB 5J89A 1KCVH 5IVOA 4LLAA 2Y36H 2R1XB 1TXKA 2VZ3A 4P3DA 3BW9A 4PJXF 5TF1H 3NA4A 3ULVC 1A6AA 1HIML 2NY2B 1DZBA 4PP2A 4IRJD 3FO2B 4YXHH 3MX0A 4K8RH 5DS8B 2BNUA 3BSZL 4UNUA 3JSSA 3LN5B 4DKEH 2BNRD 2HVJA 5ESVB 5SV4A 1WIUA 3IFOA 4RA0C 3KR3L 3CFDA 1XGTA 1KJ2H 4HUKB 4JO4H 5FKPA 1R6VA 1OT2A 3BUTA 3WIHH 3DHMA 3KPRB 4I3GA 4NQDE 4K7PL 3MBEA 3IJSA 1Q9KB 3E8UL 3TGXA 4KTDL 3TT1H 4YDLC 3FZUD 4PJ5B 2AXGA 2GHWB 4QRPB 2UZXB 2XIDA 4WW2C 4ZYKA 1JZ8A 4U6YB 2FATH 3HZVA 3C6LA 5DD5H 2GJZB 2Z91A 3D3VA 4HPYL 1A9EB 3KPTA 1JPSL 3L3OB 3ZKMD 1CICA 5ANMA 5C0EB 2P46B 5FECA 4WU5A 1YNKL 5D72L 5TGBB 4V2BA 1BFTA 2AW2A 1J12A 3IB4A 3O6FD 2K9UA 5B4MD 4QYOA 5I0DA 4ODTL 5KVEH 3O8XC 4BSJA 4MAYD 1BFVH 2VDNH 4YK4C 4QOKB 4LSTL 3VA2C 1JL8A 4P49A 4OLZL 3SE3C 1L0YA 4EUPA 5EA0H 1ZGLB 4NZRH 2BNQD 3ETBF 1NLBH 1ZS8A 1EFXD 2ZG1A 3WJJC 1E4KC 3N85L 4EN3B 1PD6A 3QJFA 1I1FA 3TM6A 5IB1A 2CIIB 1RIHL 2A0LD 5JOPD 1N5AB 1YY8A 3O81A 3UTSD 1CU4H 4HUNB 1F4AA 2FNBA 3RGVA 3WDHA 2DF3A 3T8XB 1CXHA 2GEEA 2KQMA 4ODUB 1ZLUH 2WV3A 3A6CH 3RIFF 2RCSL 4N90D 4OZHB 4Q9QH 1E6JH 2BNQE 3IF1B 3OB0K 4MJ2A 3OKMA 1BD2B 1NFIB 3VDCA 4QCIA 1KJ3L 1Z3GL 3DV4B 3JZ7A 1T89C 3TCLA 1ZHLA 2VZUA 4OGXL 3NBNA 3CFBA 4I48A 5HVHB 4X4YB 4WY7H 1F58L 2BFVH 4Y8DC 2WUBL 1A9BB 3DX7A 4CUCA 4BSVB 3BGMB 1AIFA 5EZLA 1P7HL 1MLBB 4JVWA 4QY8B 3QEHA 2HKHL 4JRXA 2VN7A 3VXNB 4R7NA 5MI0B 2IC2A 3QEGH 1VPOH 3H7BA 4YQXL 1OARH 4LMQE 3C09C 1J0KA 3TO2B 1XGRA 2X5PA 4RMUA 1LDPL 1P4IH 2BOBB 5E1AA 1RIUL 1D6VL 1EO5A 4PIRF 3SJVB 5KANG 1OWWA 3VGFA 4LBEB 3WJLC 4LSRH 3QIWD 1F2XK 2FO4A 1FZOA 3ARDB 4HJGA 2CJUL 3O4LD 5DFVD 4ZPVB 3KVQA 3GRWL 5E1HB 1DANT 3UZEA 3MXWH 3OAUH 3B9DA 3IFLL 2HN7B 1A6VL 5D7JA 3AS0A 5M95B 1T83C 4UOW0 2XTJD 3OKEB 2NY7H 2BSTB 1FL3A 3L5XL 5GRZA 5KN5B 4GW1B 4NT6B 4PV9A 5HI3C 3MLSH 4HFUH 4UMGA 2LAAA 4NQSB 2EDQA 4P59H 3IS1X 4OFKA 1SBBA 4FQHB 1GZPB 5I1AB 2CR6A 4IMLA 3V0VB 1OGTA 5CJXA 5JMRA 2XTJE 4OLXL 3PDOA 1JGEB 4Y7MA 3CSPA 2NLJB 4ZODA 1BX2B 5DJ0A 3A0OA 3ZKSD 4NKOB 1QEWA 1TZGH 5F9AC 4Y19E 4X9HA 3WFZA 3SN6N 2YPLE 1SJXA 4M1GH 3PDGA 3ZE1E 4XT1C 2UWEB 1INQA 5EZJB 5CFHA 5MEQB 5IK3B 3R8BB 4OZIE 4YHNA 3T2NL 1PSKL 3RA7L 3UJIL 1URLA 4JFEA 3S35L 4G7VH 4XCYA 3VXSE 2Q8AL 5DUPH 4OKVB 3DIFA 4O58H 2SEBA 3HZMA 4ZD3H 1GHFH 1ZHBB 2P5EB 1NAMB 3AC0A 4U1JB 4X6DE 4P3CH 2AQ1A 1EHNA 3FB5A 4XB8A 1GGCL 1F02I 4FG6D 4JDVB 1G7MA 1ODAA 4R2GD 4MDIA 2JK5B 5CD5D 3L1OH 5K9OB 1EEZA 3UO1H 1U3HB 5AYUH 2JJTA 1CFNA 1NC4D 4YX2L 3RWJA 3GMLB 4TSAH 1AQKH 3HPLA 1D9KA 2R2EB 3N1FC 3NA9H 3GHBH 5FKAB 4RQQB 4UILH 1RJZA 4YFDB 4NP4L 1CGSL 2F58L 4XMKL 4P5TB 5GS2D 4YJZL 3GSOB 3I02B 4AEIH 4ALAL 4FQXB 4FQJL 3H0TB 1YEKL 1U95A 1C5CL 4HS3A 3N1MC 4D0CA 4MAUL 1UVQA 1FRGH 4TSCH 1U3ZA 4LSSL 3EHBD 3T09A 3PIQB 3FQNB 1DN2A 1A3LL 3MV8A 2DMKA 1QKZL 5IIEB 1NDGB 2IEPA 5I8EA 4XP1H 4U0RB 3VFSA 4JY6B 3UZQA 2Y1VA 4G8IA 1RUMH 5BZWA 1VKXA 4JPWH 1A7OH 1UYWL 4JKPL 4X6CA 2E7LA 3AB0C 1HNFA 3ROLA 4BH7B 3HFMH 1M05A 5T3ZL 3CMOL 1ZLVH 3RDTA 4BZ1H 2I27N 3MRQA 1NH6A 3HB3C 2JF1A 3R8QA 1L9MA 2VLJD 5DRZA 2VYRE 3N9GH 3UPCA 5JO5A 4ODHL 2DQIL 2NY4D 1RZ7L 4L3EB 2D2OA 4Z9KB 3ZE1F 2DM3A 5D6CB 3DETC 5KSBB 4YDVB 3D85D 2CKBL 3RX7A 4YFEA 3DO7A 4ELME 4R96B 1N64L 2EO1A 3BKJL 4F7TB 1HQ4B 1KPVB 4ZOEA 4GRWH 4EDXB 4JR9L 1CT8A 3IU4L 5E94B 4QRRE 4TUJB 4MB3A 1T1YA 3QWRD 4MQXD 4OSUH 4YHKL 2NY3B 4X6DF 1Q38A 1QHOA 2Z93A 1RU9L 3VXRE 5I19L 5B38A 1LK2A 2V5RA 3T0BA 3U4EB 4W6WB 5D7IB 2BHUA 4IRSB 4AG4L 4H26B 1DQLH 4HH8A 3PDDA 1QOKA 3MLPA 3IDJB 4E41B 5F3HB 5D1ZD 3RWIA 3HC0A 1H3XA 1QSFB 1EA9C 1HXYB 4N0UA 5GQBA 4PJ8A 4F7EB 3VI3E 1MVUA 1MPAL 4GXVL 5JTWA 5F93C 3B43A 5IQ7H 4PJDE 1XIWA 2FD6H 4H8WC 2Q87A 3KLAA 5C0BA 4NQEB 1KCSH 4ONHA 3LEYL 4HWEH 5DRWA 5C6PB 4BJLA 2ITCA 4Y5YC 2FX9L 3LKQB 3FONB 4OI7A 1U92B 1UA6H 3O6FA 1T03H 4PGBB 3MJ6A 4ZXBB 2B8OT 4B41A 1INDL 1DEEB 3GMOB 3KPQB 4PJBB 1CL7I 2ZSVA 5AG8A 2V17H 3VCLA 2MHAB 4ZFGH 1WZKA 2LABA 4QT5B 5I2IA 1CN4A 5I16B 3ZL4H 4MZ2A 4I18B 3G5VA 5CEZD 4FS0A 3H9ZA 4XH2A 3O11A 4U1GB 1EEUA 4K71B 5DEFA 5C6WH 1XF2A 4KK5C 4Y4HD 1XGQB 4HFWA 4D8PA 4JVUA 2QR0A 3C8KB 5DK2A 1FVCB 3VDAA 4F33A 3G6AA 4RX4A 3CNKA 3SPVB 1R3IH 3SGJC 2BRRL 3VG9C 2VXTL 5GSVB 1IM3A 5E4EB 4Z7VB 5IFJA 3QUMA 1G6RB 3IKKA 4DUWA 4LU5L 3MGTB 3ARQA 1NCUA 3OL2A 5F97E 1JI1A 4HG4K 1NSNH 3QXUA 4OZ4B 2DQJH 4K94C 5HD8D 4JQXA 4YIQA 2BVTA 2H45A 2J4WL 3E0GA 3EYQC 4JVPA 4P2OA 2B5IB 3FTGA 3DXAA 3H42H 3QDJD 4QXUL 4QEGA 1TVDA 2ZUWA 3H9HA 5HHOD 4ZUWA 1VGEL 3FFCA 4HUUA 4JAMA 3C60C 5BS0B 4XNXH 3LY6A 4PRAB 2H6PB 1D5MB 2RHEA 3V4PL 3QDME 4EQ3A 2W0LA 1J10A 4MQ7A 2GJ6E 1KN2L 1X5JA 5IB2B 3KYOB 5CJOH 3RVVC 5KS9E 3KG5A 1KPRB 3FOMB 1RZKC 1N8ZA 5ACMA 3JWOH 1I85C 5HHOE 5IJVA 5I1HH 2DMCA 3W11C 1AH1A 1DUZB 3GSNA 1FVDA 2WQRA 5DHVA 1WBXB 4XPGH 3HR5B 2XI9A 1A1OB 1D5XA 1W72A 2FIRT 1JTTA 5DVKA 4LOUC 1OL0A 1S7XA 5I1GL 1CE6B 4NKDB 2C1PA 2WMPA 4GMTL 1T7ZA 4Y2OA 3LOWA 5INCB 2MCG1 3VFNA 4O5LH 3GZKA 4FOMA 3M1BA 1UZ8A 2XOTA 3VRIB 4UOW1 4V1DD 2ARWA 1F90H 5BZDB 2FLBT 1VACB 1JN6A 4K3JH 5C71A 3PABA 4YFLI 3QUZA 5HSFA 4ZFZB 3HRZB 4JPKL 3FKUS 5I74C 1DL7L 4NNYA 4MA7L 3MFGB 1ADQL 3SE8H 25C8L 5DJAA 1WFNA 4F58L 1U8HB 2CK0L 5D2LA 4XC3L 2X1QA 3QUMH 2M2DA 3QXAB 4PTUA 2XICA 5T1LA 1KT2B 3FMGH 1NKOA 1BGXL 2XZZA 4QXGH 1KB5B 3VFVA 3P30L 4Z7OE 4I2XB 3TBTA 4J23A 4YHPA 1NL0H 4G42B 4OFIA 4DZBA 4CMMA 5CLTA 3QZWB 2AVGA 4XP9L 1YJDH 4Q9RL 4GXUN 4KQ3H 2Y7QA 3V9FA 1IGIL 1M7IB 4MA1C 4XMPL 2E27L 2AJXL 5E8OA 2EEBA 3KNBB 3SCMA 1AY1H 1K5NB 2W9DH 1L7IH 3RIAK 5IEKA 3ELAT 1NC4A 3DTXA 1G6RL 3T4YA 4RWYL 4CVXB 2CIKA 3LQZA 2GSGA 1I7ZB 2EIDA 1X4YA 4IOFD 3VXMB 3BJ91 4XPAL 3DX9A 1P1ZB 1F6LL 4HZAA 2YN5A 2CLRB 1ZT1B 3DVGB 1JF1A 1A4KA 1YYLH 4HK0B 4UAOB 1LEGA 4LSPH 1CK0L 1BEYH 5I6XB 5C09A 4M93C 5E2VL 1J5OH 5ADOH 4IHOA 4F7PB 5JDSA 4PV8B 4C55A 5DHVH 4Y8AA 4XPBH 2D31B 1NCDL 2PYEE 1JRHL 4TSBL 3FQUB 4MNQA 1R3KB 3QNXB 5CJBA 3FOLA 4ZUVB 1X4ZA 4G6KL 2OTUA 5D7KD 4L8CB 3C2AH 4LF3B 4I13B 5JIHA 4G9FB 1F6FB 2IPUK 3NGBB 1S5IH 2NY2C 3IETA 4BELD 1I9EA 3V52H 4Y2DB 3NIFE 5IMLA 2DLFH 2CDEB 2FWOB 5KSAC 3HS0B 5C8JB 4IOIA 4PJGA 3DRQA 5HHVL 2ICEA 4NYLA 2Z9TA 1KIRA 1L7TL 2A77L 3NAAL 3SDAC 2NXZB 2R2BB 5I1IL 1UKTA 2LTQB 1G7HB 5L6YH 1BJMA 4M5ZL 3U4BH 3IDXH 1PAMA 1T4KB 2APXA 4WFGE 2ICCA 4WW2A 3LRGA 1CDGA 1R5WA 4K8RD 43CAA 4NQXB 3QCTL 3SDYH 4OD3H 4N0YH 3VH8G 2IAMB 4WGVB 1DEDA 4YHZL 3D9AL 2ITDB 1RIVH 2UY6A 2YKLL 2OXHA 3RGHA 4JFDA 3RAJH 3FO1B 4RFOL 2R23B 4LFHG 4LKCA 2VDPH 4H88H 2QQKH 2HMIC 2AJVL 4TQEH 1CLZL 5DD3H 5M94B 1MUJB 4HPOH 4OAWA 3QUKB 2Z31A 3LKNB 2FECI 1IGYA 3SGKA 3DECA 3LS4H 3TNNB 1QNZH 4WI2A 2FX8H 4CADA 2NMSA 3I6GA 5EO9A 3WJJA 1XGUB 3BRDA 1ORSA 1IARB 5DJXA 4NWTH 1KB5L 1MFCH 1L9NA 2APWA 2OTPA 4KUZH 3HG1A 1TJGL 2ICWA 4KJYA 1UACL 1GOGA 5E5MB 1EJ6A 1MCOL 2ADIA 2PCPB 4MB4A 1TCMA 4L9LB 3U1SH 3WE6B 2VDMH 3TNMA 2XRAL 1NKRA 3L3DB 1A7RL 4MJIE 5GS0L 3MRRB 3FQRA 3ARSA 2HFFB 3X14B 1A2YB 3IRZA 3ULVH 1LE9B 3QIBC 2ADGB 3R06B 5GXBB 3GJFH 2CPCA 1YEEL 4MLSA 1U91B 1JWSA 1QSED 1Y18B 5JIKA 2GUOB 3NIFF 1M7XA 1MJUH 3LV3B 1ZVSB 1DQMH 1RJLB 3HE7C 4WW1B 5EBWB 1CTOA 4JN2B 1R3LB 3A6BH 4OD1H 4IIQB 3QO0B 4TNWF 4P2QE 5FO7A 5TE7H 1BMGA 2OL3H 5IVXE 3QIUB 3O3DB 1KN4H 2VLMD 2I5YL 4Y4FD 5E8NB 1J86A 3IJHA 4HJ0D 3ARFB 3AAZB 5IQ9A 4LLQA 1OAUH 1QSEE 1RZ8B 5JORA 2WUCH 1GOHA 5JPNA 3BIAX 1JZ6A 5F7MC 3HNVH 1P7KB 1WAAE 3OKKB 2AJYH 2Z92A 5D1QD 1XCTB 3OXRA 5EZOL 1G7LA 4JZJC 4U6XA 1OF2B 1OAQH 2X4SB 4ZDHB 2F53D 4AYFA 3H6JA 4PG9B 5F7EH 5LGHH 2MMXA 3T77B 4OZGB 3G04A 3F7VB 3PHQB 4XXDB 2Q86B 1GXEA 5C2UB 3BP4A 4IJ3B 3C5ZA 4J2XA 2BHZA 3W39A 1S3KL 3BPOC 4FXGA 2G2RA 3OZ9H 1UM4L 5F89A 4NQCB 1K3ZA 3VXUD 1T83A 3DUUA 1TITA 1RZIB 4KAQL 3TO4C 4U1NB 3S36H 3EGSB 4PD4K 1IC5L 3BN9C 4J3OC 3ES6B 3WEXA 5EIIA 1MF2L 3RZCC 1O5DT 4GKSA 4YZFF 2KKQA 1KBGL 3KS0J 4BZ2L 3LCYA 5BQ7A 5TE4L 1N0XL 1Q72L 3KPPB 3S98A 5C92A 3QCVH 5F9OH 1JNNL 1PW3A 1W8NA 1ZLSL 1AD9A 1LWRA 5IWLC 4PJCE 1EPFA 3AREB 4P4KB 2ADJA 5B22A 3D3VE 2BOCB 4WHTA 5HYJB 1QFWH 1OT1A 4GQPH 2VDLH 2X70B 3DHJA 5ANME 4XHJD 3O2DL 1HNGA 5EU4B 3T04D 4GJTB 2V2TB 1A6TB 5DD6B 5SWZB 2PO6C 1A7QL 5TH2A 4YBHA 4V1DA 3EYVA 1MCRA 3VWKB 4D2NA 3IDUA 5IVXF 3X13B 5BRZB 1KXVC 3BQUA 2WANA 1FFOB 4GSDH 3WO3B 4X7SH 4RZCA 5L2KD 5F21B 4JZOA 5FO9B 1C5DA 1VB9A 1NJ9A 3LIZH 1XAUA 1YUHA 1T2QH 2GFBA 3G5YB 4RAUB 3P0YL 2WBWB 3EO1A 2YHGA 3DUHA 4FZEH 5KAQF 3LQAL 2PTTA 4UT7H 1FZMB 3QXDB 2ZCHH 5L2KE 5FDWB 5LBSH 4AT6B 1HYSD 5JPMA 3MLYH 1ZVYA 1ETZB 3K2UH 3QI9A 3S37X 3W0WB 3REWA 1PZ5B 2YA0A 4N1EA 2X4UA 4URTB 1BZ7A 1FNSL 1WFUA 1MIML 4HWBL 1AGCA 3LS5L 4PBXA 1KJVA 5EC1A 5JA9A 5DJZB 3L5WA 1S7WB 2EDBA 2J6EA 3GI9H 4ODXA 3B9KD 5HHQB 4UIMA 4OBRA 3NMEA 4ORGA 1JBJA 2ZJSH 2OZ4A 3WLWC 4FTVB 5JHDA 1AR1C 2EDLA 3MLTA 3VXQA 3I6KB 2VLKB 1WICA 3K81A 3G5ZA 3C9NB 3GMMB 1UENA 2JJSA 5HJ3A 4JGUA 3CFJA 1P6AB 3ZDZE 3DJ9A 2IQAB 2Y5TB 4PRDA 3RTQC 1DSFL 5DK0B 1H0DB 3ULUD 1BBDL 3G5XA 4OF0A 1GVIA 4LCUA 2XT1B 2DQDL 5F1OB 5ESAA 3QQ3B 1ZA3B 1QR4A 2J88H 2HFEA 2OSLA 4LEOA 3GB7A 5ITFB 4PJHA 1FDLL 4PRBB 5CJ5A 1HSBA 2DWEA 1C12B 4ZG1A 4H20L 3MLVL 1NBVH 4AIZB 4CVWA 3VRLE 5I1KH 1TTFA 3NCMA 1LK3L 4JLRB 1MFDH 1DQJB 1C16B 5A43C 1RUPL 5K9QG 1D3CA 1U8MB 3V6ZB 4RBPK 1UJ3A 2VLLB 5CZVL 5C07B 3MCKA 2DN7A 4WI3A 1G7PB 1HH6B 2BXZA 3WN5B 2CRIA 2D0HA 3NFSH 1ZHNB 3MV7B 1TNMA 5EB9A 4OFYD 1OTUC 1YEJH 4K7PX 1JZ4A 4QOKD 3QHZH 1SJVA 1MAML 2A6JB 4FQ1L 7FABL 4S0SD 3PL6A 3RJDA 4LDLB 4GRWE 5IEHB 2X4TA 3PG2A 4FFWD 5GS1A 5JW4N 1YEIL 1DFBH 3DVNB 4JFOB 4U1IB 5SX4H 1CFSA 3MBXL 4ODVH 3VGAC 4EN3D 3TA3D 3QSKB 4XP5L 1N4XH 2R2HB 5F88A 1V7NL 1Y0LB 3O0RH 3UEZA 2C3XA 5J9PB 4JFEE 3I75B 2ZKHL 2J6EH 4WV1B 2R0ZH 3EDEA 4WU7A 3OAZK 3Q6GL 1L6XA 5T3XL 3MACL 2NW2A 4KPHH 4P2RB 1KFAL 3L5JA 1FV1B 5AYQA 5E0QA 1ZHKA 3ZDZF 1BD2D 1R0AH 2O5ZH 2Y6SC 3EO9L 4ZAKA 5E03A 2P8LB 4DGYH 4Q2ZB 3GI8H 4XVUC 5C7XH 5E2UL 1A6WL 1A7NL 3R0NA 4TUKL 3LSOB 5JR1L 3QT2A 1H8OA 5AG9A 2YWYA 3NN8A 1RK0A 4P46B 5FA4B 3OR7A 4HXBH 4JZNA 2MNUA 4PBVC 5EBLA 1DLHA 4HWZB 5H2BB 2XWTB 4QHNA 4XCNB 2ZUQC 4TVPD 2X7LA 4J4PD 1DLFL 5HDOA 4JFFA 3BYTA 1G9EA 1PX3A 2FB4L 1HKLH 3D0VA 4JM4L 2VUOA 3VWJD 3U0PB 3MA7A 3PV7A 2Y72A 3D39D 4C4KO 3MGOA 1V7ML 1OM3H 3QRGH 4D0BB 2VXSL 3SJVD 3DRTB 4O02L 2DYPB 1S7RB 4X6CE 1I1RA 3JTTA 2B1HH 1CG9A 2E7CA 3MTRA 1IBGH 5F1SA 3KJ6L 3ILQC 3Q1SL 4BA8A 4DKFL 4HC1H 4OF7A 5C3TA 5D1QA 4KVNH 5T5FH 2EO9A 4OB5H 3OV6A 1NEZB 2HFTA 2YUWA 5K93A 2OR9H 4I77L 4OCSL 4X8JA 1KTLA 3D5OF 4H8WH 4GRWF 3RY6C 1DN0B 2NY1D 1WZLA 4C56B 1N5YH 1T5WA 2CXGA 2LU4A 2W60A 5EZIH 1YQVL 5FUOL 2I25N 3JTSB 1YPZB 2NTSP 2VH5H 3KPSB 3NCJL 4AJ0A 5DHYA 3QUXB 4L8DA 3RHWK 2FEDC 3E2HB 1TVHA 5HHPA 4MB5A 4LHUA 3STLA 1OAXL 1UB6A 4JN1H 2A73A 3P77B 4NZUH 1T0NB 3VXUA 1BBJA 4WJ5A 1WTLA 2EDJA 4Z0BH 1WC7A 4HCRL 4Z7UB 3L3GB 3GSQA 3LRSB 1MCLA 1P84K 2EEAA 2N4IA 4FA8A 2I60H 2G5BB 2V2WB 1AC0A 5ISZA 4YHLL 3IRPX 1YEGH 1UKSA 3ARBA 3CZFA 2DL9A 4N0UE 3WFBL 4WEBH 3QISA 2C7UA 4K9EL 3KXFD 4PY7B 1YEDA 1OQOA 2FBOJ 1IMHC 1GZQB 1BOGB 4KK9D 4GKNA 4OZFB 4G43B 2PTVA 4QGYA 5C0BE 2HT4C 3EJYC 3C5JA 4LIQL 1OAYL 1P5VA 3LEXB 1RZFL 4QF1B 4OM1L 3U2SA 1I8LC 2OBGA 3OG4B 1CLOH 5MEPB 3MLRH 5JOEA 4HGWB 2VZSA 1OAKH 3HAEA 4OIIH 1KOAA 3MODL 4NGHL 1TZHA 2APTA 3K0WA 4K94H 1FSKC 5DEGB 1MHPL 2VITB 1YEFL 5C0GA 4NFCA 1QRNB 4Q6IC 4BSWB 2Z35B 4YNYA 3OB8A 5T1KB 1OPGL 4J3TA 3BH8A 3SDXA 4Z18A 1NLDL 5FHBH 1KEML 5GJTL 1KSRA 1LO4L 2BRQA 2AI0L 1IAIL 4NBYB 4GG6A 1WZMA 4GXUM 3PWUB 2DQFA 2NY5L 4WO4A 2H2PC 3QNYA 1U2HA 4KHTL 5I1EL 1KCUL 1YNTB 1S7SA 4EZMA 1E28A 4GFTB 4MJ5B 3W5NA 1AQDA 2BVOB 4L1HA 1RZKH 2VL5A 4FQ2L 3FCTA 4XNZB 3O6LL 3S3SA 3BSZH 1AE6H 2AJSL 4RRPG 4HKXA 1IJ9A 2DQHL 3V0AC 5CILH 1N2RA 3HUJA 3KR3H 2P42B 4Z7QF 1G0XA 1FFRA 3AMLA 5CSZA 3BKML 4APQD 1DE4A 4NUJB 2FJHB 3CX2A 3ECBB 3RWDA 4Z76B 3PQYA 3MUGA 2DTML 3HC4L 1YMMD 2R1XA 4YXLL 1UWEL 5E8EB 1I3GL 1PG7L 1G0YR 3DXAE 2CUMA 2E9WA 3K3QA 4MCZA 3FO2A 4D0DB 4DZ8B 3G08A 2E6PA 3FFCE 5DS8A 4I0PC 1UXWB 4NCC1 2B1AL 3LN5A 2F5BL 3D0LB 4HPYH 2XTLA 5ESVA 1GGYA 3V6BR 4G3YH 4G8GD 1F8TL 2NY3D 4N9GA 2HH0H 2BY2A 4O2FB 3O3BB 1YY9C 1YNKH 5EORL 5CBEA 5D72H 3TP4A 1NDMB 1CZ8L 3KPRA 3NIGE 2BY1A 5EU7C 1H3PL 4NN5C 1T6WA 4Q58C 5DURB 3GRWA 1Q9KA 4ERSH 1HHKB 4E41D 2XQYK 2MSPA 1QSFD 4P2CG 3ARGC 3MNVB 4G8GE 4HQQL 5GIRA 5B8CC 2A83B 4I5BB 4PJ5A 4X4XB 1EXUB 4QRPA 4FQIL 4OGAC 4X4MA 5FB8B 4U6YA 4CNIA 3CPLB 3OR6B 2GJZA 2ERJC 3C08H 4OLZH 4PGCB 1VFUA 1A9EA 2CD0A 4JFXB 3A67L 2DLHA 4NQED 1OP5K 2YD2A 4N5ED 1M6OB 1IAIM 3CU7A 3JVGC 2F8OA 4XVTL 5C0EA 5FYJD 3VJ6A 3N85H 4Y4KB 5TGBA 3I84A 4ELKB 4F37K 2JTDA 2P8MB 3UJTH 3O4OB 2NX5D 1FFNB 1DBAL 2YSSB 3AY4C 3C8HA 1VERA 4QOKA 4YPGB 1P7QA 5FM5O 3WFDH 2IFFL 3T3ME 3FN0L 1KJ3H 1Z3GH 4HUVB 4C4KT 1ZGLA 1WT5A 2IGFH 4PJIB 3DARA 1CVRA 4OGXH 4OQ1A 1LP9E 1EDQA 3ILPB 2OJEB 4NZTH 4NHCL 5E8DL 3PWVB 3V8CA 5IB5B 3T8XA 4CBPA 4ODUA 2CDGB 1UKQA 1FH5L 4OZHA 3IF1A 4S0TD 2B39A 1Z5LB 2VISA 3X3FL 1QLEH 1BD2A 1NFIA 5T1MA 3HE7A 3B2UD 3DV4A 4YQXH 1U8NB 4F9LA 1FO0B 3B4NA 2AK4B 4MVBD 4GAGL 3X3GL 3LQAC 5H8DA 1RIUH 3TPUB 3CFIC 3TBWB 4ESKA 2VNCA 1Q9LB 1ZWIB 1A9BA 2IWGA 4PJEE 4BSVA 3BGMA 1MLBA 5EH1A 4MMZC 4QY8A 3NPZB 1FAIH 5ILTH 4GT7A 3PWPB 4OGYH 3VXNA 3MV11 2CJUH 3QDGD 1P2CB 1WF5A 3FO0H 2O26U 1UXSB 5GZND 5C09E 5IB3B 3MUY1 5JXAL 2A9NH 3RUGE 3U0WL 1A6VH 3TO2A 4JM2B 5I1CH 1UEMA 5IR1B 2BOBA 3ULVE 4O2EB 4DOHB 3L5XH 4MNQE 3UYRH 2X42A 1WWAX 3GSRB 4LBEA 4RISL 1X5IA 5HYQB 4NCC2 3ARDA 4RRPA 4YBLB 4ZPVA 2CKBA 1ZXQA 4J8RA 2J8UB 4LPCA 5DA4A 4PJGE 4KJPD 3B5TA 2HN7A 1RUQL 2M26A 3V5HB 4WNQB 1MNUL 4LCWE 2EYRA 4XTRD 5D2LF 1RUKL 3OKEA 4RNRB 2BSTA 2CO7B 2IALB 1FLRL 3VFGL 3GMRB 5KN5A 1U8JB 4F57H 4GW1A 2KZ1B 5DVMA 4XB7A 4KK8C 3PF2A 4NQSA 5IWLA 3BT2L 2IANA 1PSKH 3UJIH 4FQHA 1S7UA 3S35H 1GZPA 5I1AA 3O8XD 3V0VA 1WK0A 2Q8AH 1I1AC 5FCUH 1JGEA 2YPKB 4Z7WB 2E7MA 2NLJA 1BX2A 3TWCL 1GYAA 4LNVA 3UAJC 4Z7NE 4L8SC 2UZYB 1GGCH 4NKOA 4NPYB 3IU3B 3BYYA 4JY4B 1SQ2N 5IK3A 1Z9LA 3MQIA 2YD5A 3LKPB 1OD7A 5HDQL 3P11H 2J2ZA 4GBXC 1I8MB 4EBQL 4OKVA 5E2JA 4JHZA 1IFHL 4PJAB 4NP4H 1CGSH 2F58H 4XMKH 1ZHBA 1RZGB 2P5EA 1XH3B 1NAMA 1U8QB 3PP4L 2LE9A 4NC1C 4U1JA 3BGFB 3WFCH 2DM4A 1MREH 1DBJL 4FQJH 1GCFA 4YDIH 3HG1E 1EAPB 1QVOB 1C5CH 5J0BA 1F5WA 4MAUH 1MSPA 4JDVA 4XWOD 5DTFB 4B0MM 3DMMB 3ZTNL 2JK5A 3L6FB 5K9OA 1WFTA 5J1SC 3ALXA 1A3LH 3UTTD 4WTXA 5ALBL 4EIZC 1U3HA 3QUYB 4I0CC 1FO0L 3L95B 3GMLA 1IGML 4CVZA 1Q0YL 2R2EA 5EU6B 4RQQA 5FKAA 2B2XH 4WUKH 4R8WL 4P5TA 3T2OA 3I02A 1Z0MA 2W9LA 4HAFA 2GT9B 4FQXA 3UTTE 3H0TA 5JW4R 1KYOJ 5SX5K 5EOCL 2DQIH 3TJHC 3PIQA 1RZ7H 3FQNA 1JYVA 1B4RA 2DL2A 3QFDB 2CKBH 1NDGA 5IIEA 3RPIB 3TYFB 4JY6A 1N64H 1I8IB 3NABL 1MFAL 5J6GB 4XMLH 5I9QC 4JR9H 3RTQA 3WNOA 5DA0B 2VXQL 3VGGA 4KFZC 4G9FD 1OGAE 1GAFH 4BH7A 1BFOA 1JPTL 1K8IB 5FYJU 3ULSB 5J11C 5FGBC 4BYHA 2VDKL 4Z7NF 4F2MB 4HMCA 2V7HB 4OFDA 1OB1B 4R90H 4L3EA 1CD0A 5CUSL 1X6NA 2DIBA 3EJZD 5C3LD 5D6CA 2NXZD 5KSBA 4YDVA 4TOYL 4R6UA 4JQIL 1F11B 1HQ4A 1KPVA 2EC8A 1AR2A 3DX8B 5B3JF 4YDJB 1AD0B 1A6UL 1JGLL 1MFEH 5E94A 4UQ2B 1WWCA 4M7ZB 4TUJA 5JQHC 4GXVH 3LPWA 1BIIB 2AERT 2CGRL 4BH8B 3OF6D 3P9LA 3LEYH 1SJEB 1NMAL 2IAMD 5DVLA 5GGVL 2E7BA 3RIFK 3U4EA 2AXHA 2FX9H 5D7IA 5IJKC 4IRSA 3UX9B 4LNRB 1M7DA 4H26A 5D2NB 3IDJA 5F3HA 4A2LA 1QSFA 1HXYA 1MI5D 1INDH 4F7EA 4XWGL 1B4JL 2R56L 4CMHC 1J8HD 3OJ2C 1PY4A 4WIQA 4NQEA 1YEHL 3RP1A 1HKFA 3LKQA 3FONA 1SMOA 3IVKB 5DFWH 4U1LB 4PGBA 5C0RH 1J8HE 4ZXBA 3KHQA 3P0VL 1ADQA 3GMOA 3KPQA 1AKJB 4FQCL 4PJBA 1F97A 4D9QD 5TQ2L 2YD7A 4LRNL 1KTDB 2VXTH 2MHAA 4OCYH 1AO7B 1IKFL 1AGDB 1I4FB 4QT5A 2BHYA 5F7WC 5I16A 4I18A 4PJFE 3BKCL 4LU5H 3WS3B 2DIJA 3L3JB 2R4RL 1IM9D 5K9KB 1XGQA 1ZEAH 4MCYB 3H7LA 1MCPL 5I8KL 5CBAB 1YC8A 3C8KA 3O3AB 4LVHC 4QXUH 3SPVA 1AC6A 3ARFD 2PXYB 5GSVA 1UADC 3U36B 1VA9A 1VGEH 3U6RB 4JQVC 4DN4L 4Z7VA 5I1DB 1G6RA 3HB3D 5IW6B 2R4SL 3MGTA 3KLDA 4XRCB 3V4PH 4U0QB 2NTFB 4OZ4A 1H9VA 1KN2H 1HHJA 5JHDE 3DETD 1DANU 2KUTA 2Q3ZA 3NACL 4PG2A 1LQSR 4HBCL 4KZEH 4A6YB 2UY7A 2VQUA 3QBTB 1J0JA 2JCCB 4XNYH 2BY0A 4QTHB 4NQCD 3RRQA 2OM5A 2CDFA 4U1HA 1S78C 3GKWL 5BS0A 4PRAA 2H6PA 5CEXB 1D5MA 4RGMB 4DCQB 5IB2A 3KYOA 4OLVH 1KPRA 3FOMA 4S1RL 4EI5C 5IP4A 2ZNWA 4PJHE 1DVFB 4DN3H 1BVZA 4HK3J 1FPTL 3T3PE 2IJ0C 1T20B 3GSVB 4N1HB 2AV1B 3ARED 4P4KD 1WBXA 2BJML 3HR5A 5ENWA 1A1OA 3VFUB 5KSUB 1ADQH 3MXVL 1S9VB 25C8H 4WWKB 2I07A 4F58H 3S7GA 1CE6A 1SHMA 4RGNB 5HGHB 2CK0H 4NKDA 4YHIB 4MJ6B 1FC1A 8CGTA 2YPVL 2X05A 5INCA 4NO5B 2NY6C 1BGXH 3VRIA 2VLRB 3EOTH 5D71H 5FM8A 4RMTA 4LAJH 3VWKD 5KW9H 2HJLB 5D1XB 1VACA 2EECA 3M8OH 4NQUA 4R4FL 4ZFZA 4R97B 4GRLC 3QEUB 4DK6A 4NHUB 4I3RL 5E2WH 4LP5A 5BV7B 1IGIH 1S7QB 1Z0NA 3TBVB 2AJ3B 3GUTB 2BVYA 2E27H 2AJXH 3MRBB 3QXTA 1ZTXH 3L7EB 1U8HA 5D96C 1P9MC 1LVEA 3GIZH 4L5FH 1G9NC 3ZE2F 4KK5D 3QXAA 3MR9B 4Q6IA 1KT2A 4RWYH 1QYGH 5I71B 1QRKA 1CD8A 5DUMH 3JWDL 3QULB 1KB5A 3OGOE 1DBBH 5I1JH 4I2XA 4XPAH 3TESA 3UC0L 4G42A 3W0WD 4HS8L 3ARXA 5D7LE 3QZWA 4Q0XL 4M00A 2A6IB 2R69H 1ZGLP 1I7UB 4TRPL 4QTIL 3SDCC 1CK0H 3BEVB 3QA3B 1M7IA 5E2VH 3MRDA 5FK9A 2CMRL 1FNAA 3KNBA 4RDQF 1NBYB 3LH2L 1K5NA 1KNOB 4Z78B 1NCAH 2XZAH 4M1CC 1U36A 1NCDH 2A9ML 1JRHH 3EYQD 3H3KA 4TSBH 4YHOL 4CVXA 2XWBB 2NNAB 4FTVD 1QUNA 4PJHF 1I7ZA 1TJIL 4J3VA 4G6KH 4H5SB 5DDHB 3VXMA 2DWDB 4KDTA 3LD8B 2ARJB 3KLHD 4JFFE 2VABB 2CLRA 3L7FB 1ZT1A 3DVGA 4N0CC 3AS3A 4HK0A 4NQDB 4OFPA 2CKNA 2OCFD 3C60D 5ERWB 5HHVH 3BP7A 1CXEA 3Q6FA 4KHXL 1X7QB 4F7PA 3OAYH 2A6DA 2BNRB 5ICZB 3QFJD 5LWYH 1RAMA 2WIIA 4PV8A 4A6YL 5ABDE 3V6FA 5L8KB 4QRQB 4JDTH 4M5ZH 2D31A 3FQUA 1R3KA 2ESVA 3QNXA 3VFWA 4NZDA 4U33A 4ZUVA 3D25A 4UBDC 4L8CA 4LF3A 4G9FA 1Q9WB 4PJXA 1F4HA 3W11D 3IXAB 3WSQL 3G9AB 5DD0L 4XPTH 1HSAB 3HR6A 4UB0L 4Y2DA 1T1XB 1LO2L 1NCCH 2FJGB 4IM8A 2CDEA 2FWOA 4PREB 3HS0A 4HEME 5C8JA 3JUYA 4LOUD 3CMGA 5I75B 3D9AH 3P4OA 5CZXC 3ARRA 3OXSB 2QLVB 3TZVC 1JZ2A 2R2BA 4RFOH 5I8CB 1G7HA 1IAKB 1T4KA 2AJVH 5FYKD 5C0CD 1KG0B 32C2B 4PJ7B 4H1LG 5GGQH 2VDQH 4ODBD 3U30C 3DSFL 4NQXA 5GRUL 3TT3L 3MV7D 3RVUC 3SQOL 4YUEL 3ARWA 4PUBL 3UP1A 3O6ML 1JK8B 2X4PB 2AAVA 4UU9B 3EFDL 2R1WA 4FXKB 4LKXA 2ITDA 4YXKL 2BSRB 5HHXH 1TJGH 5ISZE 1AJ7L 3FO1A 3RBSA 1MCOH 1MCJA 2BNQB 5MERB 1EFXB 3G9VA 1NMCB 5BV7L 2KQNA 1MUJA 3ZYIA 4NN7C 2XRAH 3QUKA 1EH9A 1A7RH 3O2DA 3CFKB 3LKNA 3UTSB 3SKMB 4U49A 2G9HB 3TNNA 1L0XA 3I2CL 4I0KA 1JGVH 1XGUA 2PKDA 1S9YB 4FABL 2QJDA 3WHE1 4MXWL 5D70L 3T0EC 4WTZG 2PUQT 4CU8A 2PCPA 3D2UD 1MEXL 4L9LA 4AZ8A 3WE6A 4JFHE 5SWSA 2I5YH 5D9SB 1KUMA 3L3DA 1FNEB 5FUZH 1KCKA 3MRRA 2HFFA 1A2YA 4PFEA 3MV01 1LE9A 3R06A 5HTSA 3SDXE 1U91A 1OW0A 1Y18A 3QR2A 3LV3A 4K7PY 5SX4I 4GG6E 1ZVSA 1Z6JT 4WW1A 5EBWA 4JN2A 1R3LA 2PYFB 3LHPL 4IIQA 3QO0A 3BP6B 5L8JB 4OCXL 4UUJB 1Q94A 1D5IL 1JE6A 3QIUA 5E8NA 5E00B 3ARFA 3AAZA 1PKQA 3S97C 4HV8B 1S3KH 5J1AB 3QAZC 1P7KA 3G6JF 3OKKA 5TDOB 5MEOB 3QIWB 4WFFD 1ERNA 3HUJE 4LSDA 1IC5H 5T5NF 2MQCA 5KSAD 4MA8H 3O4LB 1MF2H 4DUXA 1OF2A 3AXLB 3PQYE 2P5WD 2X4SA 4ZDHA 3SDAD 4PG9A 1KBGH 4LCYB 2XTJB 5A3IC 3T77A 2BMKA 4OZGA 5TE4H 2IPTL 1Q72H 3F7VA 4NO0D 5HGDB 1MH5B 2LFGA 4HJJL 2BVQB 4XXDA 2Q86A 1CFVL 3GSWA 3QUXD 4WI9A 4Y19B 1JNNH 4M43H 1ZLSH 2ZPKL 3V7MA 3V0WL 4GS7B 4JJ5B 2CK2A 4LRIC 4NQCA 1P53A 2P5WE 3LPFA 4N8PA 2NR6C 2UUDK 4U1NA 4W81A 3EGSA 5B3NA 3ZYZA 3O2DH 2VQTA 3ES6A 4TYUA 4U7KA 3Q0HA 1E4XH 1NC2D 5IBLC 3VXSB 1A7QH 2YA2A 4Y16C 3DGGB 1CL7L 3MRGB 3QQ9D 3RFZC 3MYZA 3MCLH 5L2JB 4OLYL 5E8PB 4JO1H 3KPPA 1J0ZA 3TJEL 3TF7C 4X4ME 2Y25A 2H8PA 1WBZB 2JIXA 4WDIA 3V4UL 3AREA 4P4KA 3UTQB 3RJQB 3WNNA 4DTGL 1JZ5A 5HYJA 2BOCA 1ORQA 4MWFB 5J13B 5L7XH 2X70A 5MEND 5IFAH 4S2SB 5EU4A 4LVNB 4R7DB 4GG6F 1A6TA 4Q74A 1GGBL 5DD6A 4X6EB 2XG4A 5SWZA 5E4IA 2XKNB 2OS7A 3NCBB 2QHRH 4R2GB 5IMMB 3TVMC 3LN4B 3BN3B 3LQAH 1QPXA 5L0QC 4IOSD 3X13A 5BRZA 1ZLWH 1FBIH 1FFOA 1MCWW 4CGTA 2DMBA 3ZDXE 3QIBD 1FNSH 3WO4C 4HWBH 3RWCB 4MYWB 1GC1L 4LDEB 3VA6A 2M1KA 2GCYB 5FO9A 4R0LB 3HUJF 3LKOB 1HILB 3BGFC 2GIYA 1BP3B 2W0FB 4O9HH 4RAUA 5E7FA 4LSVH 2WSKA 1QA9B 4MHHI 4P5MB 1BQSA 1NCTA 1FZMA 3MLZL 2P44B 2XZQL 1NCBL 1QSZA 5FDWA 1K4DB 5HHMD 5IHZB 1ETZA 3W0WA 1QG3A 4P5KB 1PZ5A 5C9JB 4JFZL 4IMKA 4Y1AA 4NUGL 5K59E 3ULUF 2XV6B 3EO0B 5DJZA 4WTZA 5I8OL 3H3PH 1S7WA 4QXWA 3EKCA 3BHBB 3IDMB 5HHME 1KGCD 1DQQB 3F7PC 4W4OC 5HHQA 2R1YB 3KPNB 5CAYB 4GMSL 4DEPB 2Q76B 2VLJB 3N06B 2Q8BH 4XCCH 5JNYB 2A1WL 4FTVA 4I3SL 5C0AD 2YS4A 3WV0A 1TQCB 3GSNL 4U05A 4KKLC 1FDLH 3EFFB 3GK8L 2VLKA 1CLYL 3D85B 3GMMA 3C9NA 1CFBA 5J12B 5HVWA 3PWNB 5FM5M 1GPOH 3RWFA 3V6OA 4L3AA 4PJ9B 1KGCE 2IQAA 2Y5TA 3G6DH 4BUGA 3TO4D 3MBEC 5DK0A 3T4AB 5H94B 1H0DA 1TQBB 1LK3H 2DBLL 3K4DA 3BN9D 5C0AE 4M62L 4PRHD 4FNLL 5IHUL 3RZCD 3DV6B 3GGWB 1IGTB 2IPKB 3MRPB 1J1OL 3QQ3A 5CZVH 5BJTB 2AQ3A 1ZA3A 1PYWB 3C6LC 3FQXB 1G7JB 4PJDB 5ITFA 4LCIL 3DNKA 2K1MA 1MFBH 4PRBA 1QBLL 1CICC 1C12A 3ARVA 5D1ZB 1WISA 4PRHE 5JXEA 4OZFG 3V4VL 5C0JB 4NQVB 1UM5H 4FQ1H 7FABH 1OSPL 3SDDB 1KF9B 4H1LH 4JLRA 1DQJA 1C16A 1YEIH 4AEHL 5CHNA 1U8MA 4H0HB 2VTFA 1BHGA 1WWBX 3MBXH 4PGDB 3V6ZA 3QHTC 5GRYA 2VLLA 2PO6D 4XP5H 5GJSL 5C07A 5ADPL 2IANE 4GRMB 1JNJA 1G7PA 1WSST 1HH6A 4HCRA 4KDVA 3HE6C 3TFKC 2ILLA 2J5LC 3WUWG 1FGVL 1ZV5A 1ZHNA 4G5ZL 4NM4L 1NQBA 4OZHF 1AP2B 5T3XH 3MACH 1T21B 4OCWH 1KFAH 5HPMB 4FFYH 3CDGB 1JPFA 1CE1L 4JREC 4TNWK 5E6IB 1IC4L 4JO2L 3EO9H 3RGVC 5LGJB 3STZB 5KTEL 3DVNA 5E2UH 1A6WH 4JFOA 5JR1H 5JW3L 4U1IA 4HF5L 2BY3A 2R2HA 4KMLB 1Y0LA 1F45A 2AJUL 5J9PA 1KENH 2BVEA 2EH7H 4Y4HB 1HZHL 2VL4A 4WV1A 4YGVB 1RURL 2EXYD 2XNAA 1FNLA 2P5EE 4L4TD 2BSED 4JG1H 1AXTL 4P2RA 3HN3A 5CIPB 1DLFH 1FV1A 2BK8A 1EJOL 2KH2B 3O9WB 4UTAL 4JM4H 1FN4B 2ICES 1NAKL 2OQJB 2P8LA 4IEFB 2VWEC 3WIFB 2AEWA 1FL6B 1K8DB 2AK4D 3LSOA 4IS6B 3IDNA 4ZQKB 4GW5B 1KTRL 3JWDC 4P46A 5FA4A 2MWCA 1SEQH 4LAQL 1TPXC 1OSZB 4O02H 1AR1D 2GTWB 1YDPB 4N8VB 1NEUA 3FJTA 4HKZB 3KPMB 3BJLA 4HWZA 4LQFL 4UT6H 5H2BA 3E6FB 2XWTA 4XCNA 4XP4L 4FQLL 3KJ6H 5E95B 1IAII 2GJ6B 3PWPD 3QDJB 5I66B 3BZFB 4P23B 4WCYL 2H1PL 5KS9B 2JB6B 2DJSA 2D9CA 5HHOB 3IDYC 5HHNB 2QQLH 3U0PA 2ADFL 5FGSA 4JM2D 2L4OA 4WUUD 1IAMA 5FUOH 4D0BA 1KLGB 4U7SA 2DS4A 2YOCA 3NCJH 5IW1B 3DRTA 5DJ8B 2B0SH 4X7TB 3ARUA 1JVKA 2DYPA 1S7RA 3MRJB 4LARL 1GRWA 1X9QA 2IG2L 4G6AC 4CKVX 1A3RL 1OTTC 5CMAA 4M61B 4WUUE 5MHSE 1NEZA 2E7HA 3OTTA 4X8XA 3FAWA 1DN0A 1W8OA 2QBWA 4C56A 2UWEF 5CJXC 2IADB 4EOWL 4K3EH 2AK1L 1KCLA 1E4WL 2BSSB 2FECL 4YHLH 1YPZA 5IOPB 1FORL 1CS6A 3UJJH 3KPSA 2EIZA 3WFBH 1IZKA 3GNML 4PLNC 3P77A 1R5IB 1ZLUK 3ARZA 4DAGL 1OTUD 2G5RA 4Y5XB 2GITA 3P73B 5LAXB 1RVFL 3L9RB 1F4YH 1HHGB 2DRUA 4Z7UA 4U1KB 1N6VA 4OM1H 4PB9H 3L3GA 3CLFH 5A2LH 5C6TH 3U0TB 5I18H 3ZT6A 1CF8L 3M17B 5D7IE 1NUFA 1BFSA 2G5BA 2XXCB 3UDWA 1EAJA 1M71B 2E8ZA 2V2WA 3MODH 3QQ4B 3H2WA 4NJAL 2X4NB 4PY7A 3RVTD 2HTKC 1TENA 4LCCB 4PP1C 1YEFH 2CRZA 5GSRA 1CBVL 1GZQA 1XF5B 2FHCA 4M6NL 1BOGA 5CEZL 3QCUH 4OZFA 4ZTPH 3KJ4B 2BC4B 3BE1L 4G43A 4N0RA 5HBBA 4J12A 1OPGH 4UNTA 4HIEB 5AZ2L 4ZOCA 2JJTC 4BK4A 1P9MA 3LEXA 4QF1A 1NLDH 5LKNA 1KEMH 1F4XL 3TCXA 3NTCH 2Y6SD 2AI0H 5MEPA 1RJYB 1D9KC 2DOCA 3U9UB 4HGWA 4KRMB 4XVUD 2DQUL 1YQ2A 1ZSDB 1QP1A 5I1EH 1KCUH 2OXGA 1CVSC 3K4ZA 3VFMA 4PJBE 3QEQE 1IGFL 4JKKA 4G6JL 1QRNA 4BSWA 4FQ2H 4J3UA 2Z35A 4C83A 2DI7A 2AJSH 4OT1H 5T1KA 3VGHA 1T7WA 5ACZB 3H8NA 3BPCB 3BP5B 2G75B 3BKMH 2VIRB 3PWUA 3ZE0F 2E7LC 5D93B 2VMFA 3HC4H 2FCBA 4HG4J 1S9KC 15C8L 1TTGA 5KSBF 4YXLH