5F96H

Crystal structure of broadly neutralizing vh1-46 germline-derived cd4-binding site-directed antibody ch235.12 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
225
structure length
220
Chain Sequence
b'QVRLAQYGGGVKRLGATMTLSCVASGYTFNDYYIHWVRQAPGQGFELLGYIDPANGRPDYAGALRERLSFYRDKSMETLYMDLRSLRYDDTAMYYCVRNVGTAGSLLHYDHWGSGSPVIVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 44
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f96H01
5CGTA 1S7XA 4BFBD 3OB0K 4X80L 5DGQA 3R1GL 1M71B 4DJMA 1QSEB 4XWOD 2GFBA 4M5ZL 1NGPH 5I1LA 3VXQB 4XPGL 4P2RE 4ZO9A 1JTOA 1RK1B 2ATPB 3OKMB 1BGXH 4X4YB 4J7RA 2FLBT 2VSCA 4YHOL 4YQXL 3G5ZB 3BE1H 3ZKMC 3PV6B 1CFQA 1QG3A 2APBA 3MBEB 1CDUA 5IB3B 4YDLB 3NZHH 5C0EB 4JFOB 4YAQB 3S36L 4PGDA 2FEEL 3IS1X 2MNUA 1UH4A 4RGOL 2IPUG 5EPMA 3WNOA 2NY3B 3HC4H 4U4BA 3VWKD 5DMGD 3FZUD 1GC1L 5DMIL 1I8IA 3KGRA 3MO1A 1QEWB 4UT9L 1ONQA 2WBJA 3O45A 4F37K 3CCHA 1XGPA 4KQ3L 5KSAB 1QHOA 4DZBA 1WLHA 3QO1A 2BMKA 1CG9B 1CFSA 3QG7L 1ZA3A 2ID5A 3CPLB 1T0NA 3PGCA 3I2CH 1EJOL 1DBBH 5EOQL 2QHLA 4BFIA 4LNRA 5L0QB 3LEXB 4LF3A 4PGBB 1DBAL 1LDPL 2B4CC 3D9AH 4EN3B 5DVKA 5KOMC 2FJGB 4N0FB 5FOBA 4WW2F 3G08B 3FHAA 2Y1VA 2X4PB 1NGPL 1KB9J 3W0WB 2UZIH 2IALB 1GHFH 2DOCA 5DYOB 2Y5TA 2AEQL 1IC5H 1ZANL 4JVUA 3HI1B 1IGFH 2VLKA 3RPKA 1RZFL 1D3CA 5DUML 5DSCB 1HWGB 4BQ6A 2D7OA 4WFEE 5HGHA 1S7VB 5EC2A 4Y5VB 5TDPA 3P73B 3G9VA 1RZJL 1S5HA 3RVTC 1EO5A 4JG1L 2B7DT 3S4SB 2VLME 2A9MH 2EEBA 4XWOC 1JI2A 3HS0A 3T0WA 1S7TB 4HGMA 4JPKH 4R7NA 2VIRB 4XCNA 4ZQKA 3BJ91 2Q7NA 3U7WH 3UDWC 2FBJH 4WHYG 5I9QC 3OJDB 1NEUA 1VDGA 1YY8B 2K7QA 2F8OA 3P0YH 5FK9A 5C0CE 1JWMB 2VL4A 3U30C 2DQHH 3LPGA 3VWKC 5DMGC 5DRWB 1H5BA 3FZUC 1UADC 4FQHA 1VPOH 1TZGH 1F6AA 2IADA 3C5ZD 2GJ6E 4JFDD 2CLZA 4OGZA 5J6HA 4M48H 2MJWA 1BOGA 3VXMA 1CE6B 4BUGA 1H3PH 2V2WA 5F3HA 5GS1C 1HSAB 5SX5K 1K8IA 1WUNT 1R5VB 1W72L 4MD0A 4HG4K 4KK6C 1MCOL 2NLJA 3SDYH 4PJHA 4N0UB 4XP5L 3I6KA 2QV2A 2IQAA 4L4VA 1A2YA 3O3EB 3RWCA 1QR1A 3QPQD 4P59H 4KK5D 5FHAL 2XY1A 4LFHG 4YNYA 4ODHH 3KPMB 3NN8B 4PJAF 2MQCA 3CMGA 3G5YA 4POYA 1IBGL 1DP0A 3SGJA 4I48B 2ICWI 3P0YL 1B0WA 1IGJA 5B21A 3KPSB 1D5BB 4PRNA 4F7TB 2UWEA 3EFFA 3S4SG 5B8CA 3PHOA 4LPUA 3MRIA 1JZ2A 4X5XB 2E6PA 5BW7A 4GSDL 3HRZB 3S34H 5L2KA 3DHMA 1D7FA 4O4YL 1CXEA 1KIQA 3IETB 3KR3H 4PYGA 3OL2A 5EU6B 1CE1H 1M4KA 3O41B 4WNQA 1F11B 4F8TA 1DQDH 3RX8A 5FO9A 3S5LA 1DVFA 2ARJQ 1Q38A 2DJ4A 2X70A 3G6JF 4L8SB 3VXOA 2R8SL 5D4QA 4PJ8D 2XA3A 3FFCB 3O6LL 1DN0B 4OCMC 1UM6L 2XZCH 5F9JB 1ORSB 4HUUB 3U4AA 3C5ZC 1FLTX 5H94B 1U93A 3HZVB 4OQTL 1FZKB 1JTTA 1YMHB 3QUYA 4HLJA 3KPOA 4J3XA 5HYSA 1EGJA 2X44D 1HNGA 3UBXB 3C8KB 1E4KA 2G5RA 4YR6B 5JPMA 1EHXA 2GJZB 5FYKD 3K4ZA 1AXSB 4NC2B 3MUJA 4J3WA 3FMGL 4PRIE 5IM7A 2F54D 5SWZD 4DUVA 3B8YA 3STZA 1X5GA 4KMQA 5GZOD 4KZEH 1BVLB 1N4XH 3HE6D 5FGCE 4P5TA 4EBQH 1GPOL 3TZVB 2YPKA 4XPBH 1JN6A 4HF5H 3GBNL 4ZUSB 5AUMA 3BP7A 3LQMA 4V1DB 4FQIL 4KK5C 4CADA 2VISA 3F7YB 5SWQB 3ARBA 2DF3A 2JB6A 1GCFA 4XCFH 4NCDA 2BNRA 1MVUA 1RUMH 3LKPB 4HS6A 4HIIA 1QBMH 4LEXH 5HXMA 4HUWA 4FQJH 5AD0A 3VI3E 4RRPG 4JVPA 2D9QB 4E41B 2DM3A 3CK0L 1B0GB 3LVEA 1FZJA 3DGGB 1OAKL 3P4NA 3MC0A 4YDKL 5EUKB 2PCPA 4NKDA 2ATKA 1RI8A 5E1HB 4XNXL 2X89A 2XT1B 2LVCA 2LU4A 1CBVL 3KHOA 1BF8A 3IS0X 3W5NA 5GGVY 5DHYA 4P2QA 1YNLH 5IFAH 1NLDL 4UNVA 1FAKT 1DTUA 1LO2H 3EYVA 1GGIL 1KT2A 2YUWA 4PJ8C 5DK0A 1FFOB 5EIQA 1F58H 2AXFB 5MP6L 3QNYB 4L4TD 1RZ7L 1AJ7L 5AG8A 2NZIA 5DQ9B 2W59A 1KCKA 3TBYB 3U0WH 4Z7WB 3UBXG 3ARSA 1OP9A 4M6NH 4X6CF 2V2TB 4JFDE 1J11A 2XWJA 3T0DA 2P8PA 2MCPL 1CLCA 4L4JA 3WXVL 2I5YL 5I8OL 3JSSA 1AQKL 3ZHDA 1I1RA 3JV0A 4C83B 2W0PA 2X5PA 1G84A 5GZOC 1RZGB 2NY7L 3HE6C 2NNAB 5EN2B 1BIIA 5L8JB 4H8WH 4ERSH 5DWUL 3WLBB 4O2CB 4HS8L 4TSBH 3KPPA 3WE6A 2XPGB 1L9MA 3K80A 4MJID 3ULVH 2XWBA 1XZ0B 1N2RB 1QP1A 1CD1B 5C0IB 5T3ZH 3RGHA 2B0SH 1UVQA 2BOCB 1IEBA 5EOCH 2BNUB 2OSLB 2Y4SA 1NDMA 2NCMA 4UQ2B 4Y19B 1EMTH 3AB0C 1LGVA 5KVDH 1JF1B 4WU5B 5DD6B 1J0KA 2VDML 3MLXL 3RGVA 3D87B 5KZCD 3BKCH 4UTBL 5LGJB 1ZOXA 3E8UL 5DC0A 4F3FB 4M61A 4XCCH 4UNUA 1FVCA 5E8DL 4HIHB 3V6FA 2N7AA 5ANME 1OWWA 2B4CL 3LDBC 3BQUB 5IG7A 1KENL 2D0GA 3T77A 3C9NA 2EDOA 2Q76A 4LLVB 4NM4L 4OZGB 3MTRA 5L2JB 4ZNCD 1IM3B 1HKLL 3QCUH 3WFHB 2YN3A 1ZWIB 1K4CB 1HQ4B 4PJDF 1Z9SA 2JCCE 4AYFA 3O9WB 3VWJC 4G8GA 5DJ8B 3ELAT 3GSVB 2P8LA 3QWOA 1WICA 3ARFD 2E6QA 1EXUB 3IT8D 3ZYIA 5D1XB 3VFOA 1QQDB 3L6FB 5I2IA 3V2AR 4Q9RH 3IKKA 4CDHA 4QRSB 1CGUA 4DVRL 4JN2A 2APVA 4FNLL 5FYKE 3P9LA 4L29B 3CDGA 4DUWA 4YGAB 4ONHB 5KVDL 3FQNA 5JORB 2F54E 4G9FA 3GRWL 5SWZE 6FABL 1ZLUK 4R2GB 4P2OA 5C0BD 4XC3L 4MD4B 5I73C 4ODWA 5D2NE 1KFAL 3DO7B 5DJXB 2N1KA 1AFVL 4PY7B 2VH5L 4B53A 2NX5D 3J8F7 5I1KH 2Z92B 1JHLH 4XNZC 1FH5L 4IIQA 3JTTB 4CVXB 4U1GC 1CFVH 1P7HL 3MJ6A 1I7TB 1OTSD 3EOBB 4HULB 1MJ7L 1IZJA 4OAWB 5CWSA 2X05A 2DRUA 3L95B 1X5IA 4JCMA 3NPSB 5D72L 5I16A 5IB5A 3D85B 1MPAH 4HWEL 4JGJA 4NNYA 4Y2DA 1MFAH 5HYEA 3GEWB 3N1FC 1SEBA 1WBXA 4O51B 3VFSB 1T21A 3RHWK 3BIKA 3DRTA 3MFFA 3MRDB 4E5XA 5CEZD 2I60H 4HX1B 4ZD3L 5I76A 1DQML 1IAKB 5DRXA 1A7RH 5ESVA 3D2UA 4NUJB 4HUXA 3UZEA 3W2DL 5A43C 3K8LA 4GG6B 4A2LA 5JHLL 1DQJB 5CLWA 1GGCL 5DQJB 3SBWC 3PP3H 5CHNB 2R0KL 3RNKA 3BZFA 4L4TE 2V2XB 5DJCA 3Q3GA 4AT6B 4LSPL 2D9CA 3IDNB 4UV4H 1CYGA 1F4XL 4PJ5A 3ZKND 2KQMA 1IGIH 4JFZL 5EU7C 4N0CC 4B0MM 1T83C 2DQUL 1L4IA 2IFFL 2IGFH 4JM4L 3BRDA 5EZLA 1YYML 1F42A 1YY9D 1X7QB 1M6OA 4X7EC 1FV1A 2J8UA 5GISL 3VFUA 1T1YB 4TNWF 2GK2A 1BZ7B 4OZHE 4KHTH 5IVOA 4NBXB 1VACB 1UXSB 2XG4A 3F7VB 3P9MB 2XZQL 3PHQA 2I60L 1IRAY 1MNUL 3S9DB 1NCAL 4MJIE 1R5WA 3TH3T 4HS3B 2FL5B 1ZS8B 12E8H 3H3PH 4P57B 3ZDZE 3NA9L 1OTSC 4YX2H 2UZYB 1M71A 5JMRA 2BHZA 3MCG1 5BV7B 4G7YL 1RK1A 3RIFK 3ZE2E 3OKMA 1EUTA 4X4YA 2OXGA 3KXFB 5KS9E 3G5ZA 1P7QD 3PV6A 2FHFA 3MBEA 1N64H 5IB3A 4RMSA 1JPGA 4JFOA 5C0EA 3BZEB 3UX9B 1WC7B 2QR0B 5CJ5A 5F7KC 4C58B 4OLUH 3LMJH 1QBBA 3LS4H 4IS6B 1FL3A 3ARZA 3N06B 3QNZB 1F4WL 3T1FB 3NACH 3ARED 5FYKH 4LCUB 4MCYB 3EYSH 1QEWA 4GRWB 2FX7H 1OD7A 4G6JL 2VLRB 2DQDL 3ZKNC 1IL1A 5KSAA 1D6EB 3GHEH 1G9NH 1CG9A 2XZAL 4Y4KD 1LEIB 1E4XI 3VGAB 3CPLA 4G7VL 3ET9F 1N3NB 4YXHL 3UP1A 3HFML 3LEXA 2QQLL 3KPNB 3I3EA 1TNMA 3MRJB 4PGBA 4XVSL 2VE6B 5IWLC 2WIIB 2FJGA 1PQZB 4N0FA 3G08A 3MLYL 1YY9C 2C3HA 2WM0A 3JTSB 2E9WA 4KK8C 3EBAA 3THML 2VN4A 2IALA 4JKWA 5D8JH 3HNVH 4M8VA 4U6HB 5DYOA 4HGKC 2Y9RT 2BY3A 1CDYA 5C3TA 1PG7H 1O7SA 1IGYB 2AK4B 3HG1E 3Q1SL 5FXCH 3FRPG 4U6VL 1JZ3A 1J05B 3DWTA 5HDOA 5EOTA 5DSCA 2NX5E 5E8EB 1QYGH 4YDIL 3RWEB 4Z7QE 1TZIB 4JQIL 4Y5VA 3I50H 3IFLH 5JW4Q 3GSOB 3P73A 1C5DA 1JWUB 3T2QA 3OAUH 3S4SA 4IMKC 4YFLF 1CT8A 3KYAA 3KYKH 5D2LE 3T0BA 1BZ9B 4D9LL 3RX7A 3EIFA 3OAYH 1WWCA 1PVHA 3OR7B 1MRCL 2QKIB 4AK1A 1EAPA 2FHBA 1A3QA 2APTA 3I02B 1TIUA 4JZOB 1C7SA 1FO0H 5IHLB 4PJBE 1SMOA 1XGYH 5BCAA 1KCSL 2W60B 5DD3L 3OJDA 1DBKH 5CEZE 4FXKB 1YY8A 4I8DA 1HK6A 3SQBA 5B38B 3MV9B 5DRWA 4PJXF 3L3HB 3AREC 4RFOH 1CFNB 5DK2B 1VSCA 3AY4A 1JGUH 2M1KA 1PW3A 3QRGL 1CE6A 2GT9B 4Y4KC 1FL5A 1OCWH 1A5FH 2IBZX 4NQXB 1T5XB 3HZMB 2P5WD 1BHGA 5LVEA 5BVJA 2ZKHH 3CVHH 5IVXE 43CAA 4N0UA 2IAMD 3SDCB 3NCYS 3GSNL 4TUKH 5L7XH 1NBYB 3DV6B 4OJFL 4QGTA 5EBLB 4PRPB 1PYWB 3VW3L 2HTKD 2CUMA 4OBSA 2Q3AA 1EFQA 3MSPA 3BIAX 2XTJB 3KPMA 1JL8A 2Z93A 1SM3H 3HE7D 3EJYD 5IESH 5IB2B 2X09A 1DBKL 1T7XA 4I48A 4X6DF 5C6TL 4G8IB 1WT5A 1VFAB 3I9GL 2BP3A 4IRSD 2DWDB 1D5BA 4RRPA 3U36B 5I1HL 4F7TA 4NSKB 1UCBL 2FB4H 5T1MB 3NH7H 3H7BB 4L3CB 4X4XB 5IHUH 5I30L 4X5XA 3GM8A 4LPVA 4R4ND 3O2VH 2MKLC 3AGVA 4AENB 3LKRB 2B5IC 4P46B 5AYUH 2ARJB 3O41A 4TPRH 1MAMH 4L8SA 5B38G 4HC1A 2AXGB 4H25A 3RU8L 5TE6L 1F2XK 3FFCA 2OTPA 1DN0A 3G6DL 3S37X 1KELL 5F9JA 1ORSA 5J11C 4NFBA 4HUUA 5H94A 1FZKA 5HD8C 1YMHA 1G0DA 4P3CL 3UBXA 1GIGL 1BX2A 3IDXH 5C08D 2VMFA 5I1IL 3RWHB 4OM1H 1AXSA 4JCLA 2NY2C 3VXRD 1VFOA 2HT2D 1V8HA 5HHVH 4FMFA 1V7MH 5MERB 4LSRL 4PLNC 4X4ZA 3V6BR 1PBYA 1TENA 1BVLA 1I75A 3HMXH 5I8KL 5TDOB 2IAMC 4Q58C 3LIZL 3TZVA 5CGMA 2X4SB 4XMKL 4ZFFA 1KCLA 1XR9A 3ILPB 1DANT 5SWQA 1EHAA 2HYMA 4FTVB 4YXKL 1SBBA 1H15B 3D69B 3UTQB 1JZ7A 1H3VA 4DOHE 1MREL 3HE7C 5D93B 3NPZB 3LKPA 1J12A 4WEMB 4LK4A 4TQEH 3VRIB 2PYFB 3LZFL 4QRRB 1U8IA 3K4AA 4PRHA 1E28B 5IV2B 1LEGA 2HH0H 4Y5YB 1J5OH 2L0DA 3H42L 4JANB 1KB5L 4R4NC 1YNTB 1U58A 5EUKA 1R5IA 1YEHH 5CEZH 1M7IA 3K1KC 1YQ2A 1MWAL 3I75B 3A6CL 3LN4A 1BF2A 4TYUA 5I8CB 3WO3B 5J6GB 4NZRL 4XBPB 2ZSVB 3OKKA 4GH7B 4KDVA 1HH6A 4KAQL 5D7SL 4N1EA 3HMWL 4XP9L 1G1YA 5JDSA 4A2MA 1FFOA 3CUPB 2AXFA 3ROOB 3QNYA 1U92B 4Z7UB 1QLFB 3MLRH 4MAUH 2DQEL 4TN9A 4ODSH 3TBYA 4APQD 3MYJB 2P24B 4Z7WA 5GRWA 5JR1H 4QOKA 2V2TA 3K8MA 2ICCA 4OLEA 1YEFH 2Z31D 2MPAL 4Y16D 3MLTB 3BRGC 2HT2C 3TA3B 1ZK9A 2HLAA 2F19H 3QFJD 1GOHA 5HYJD 5C1MB 2HVJA 1W2KT 3N50A 3V0WH 2HJKB 1P6AB 2C26A 4TSCH 2NNAA 2P5WE 1RFDH 5EN2A 2O5ZH 1MJ8L 2P8MB 2FD6L 1A1MA 1EBAA 3K74B 1EUUA 1NC4D 3WLBA 3BZ4B 4U3CA 3RTQA 1D9KB 2XPGA 3WLWD 5GS0D 2HWZL 1N2RA 1CD1A 5C0IA 1GYAA 1SY6L 1XF5A 4KY1H 4KTDL 2BNUA 2OSLA 2IBZY 2AGJL 1FL6B 4UQ2A 3WS6A 3VFMB 2BXYA 3H9YA 1JF1A 5DD6A 4HZLA 2CDEA 5E94A 2NXYD 3BH9A 3GMPB 3MMEA 1I1FB 2DD8L 5LGJA 4X7SH 2VLJD 1ADQL 2IANB 4F3FA 5JNYA 2F5AH 4HIHA 4RBPH 4R90H 2XYCA 2LTQC 4CN4A 1IGML 4F9LC 3M45A 1L6XA 3SKJH 1JGLL 4LLVA 4OZGA 4KXZI 4XC1L 5LBSH 5JOPD 3BAEH 1QFWM 4AL8H 4TUOB 5EIVA 2BSTB 2CKBB 5L2JA 3FB7B 1IM3A 3WFHA 3NBNA 4BZ1H 2DL9A 1QRNB 2BVEA 2QQNH 5CJ8A 1I9JH 1HQ4A 1K4CA 3BKML 4FQPA 4BQ9A 2OZ4A 4UT7L 3ZT7A 3GNMH 3L5JA 4R0LB 4R2GC 1RZIB 4X0KB 3FO0L 2R9HD 5DJ8A 3GSVA 4LLWB 4LSSH 5GIRA 3FB5B 1EXUA 4AEIH 5D1XA 1QQDA 5HYIA 3L7EB 2Z31C 1JNNL 4Y16C 3QUXD 4QHLA 3X14B 3FQXA 2RCSH 5C08E 3EGSB 4WVRA 4L29A 4YJZL 1KTKE 3VMPA 3RUGB 1A6WH 1JRHI 4NZTL 3VXRE 1N7MH 1DQQB 3MACL 3NGBC 5HHPA 3UJIL 1JV5A 4G6AC 1OT1A 5EUOB 5E2WL 5A3ID 2WBJD 4WW1A 1AO7B 4LGSB 2F58H 1DEEB 3NPSC 3DO7A 3WLWC 5GS0C 1KJ3L 3DXAB 3GFUA 4PY7A 5DJXA 3OWEA 1JFQH 3WN5C 2JJWA 1BREA 3LOWA 5JDJA 3I6LD 1RMFH 5FKAB 5J8OA 2Z92A 2APWA 1PY9A 1P7KB 4QXUL 4RX4A 3TIDB 4CVXA 3PXHA 1I7TA 2NXYC 1J86A 3EOBA 5HJ3B 4Q9CA 3QWQB 4OAWA 5LCVH 3B9EA 1F90L 1ZT4A 5JXED 3D85A 2EECA 1A7QL 4F9PC 1MSPA 2VLKD 3MRDA 1J1PL 5DQDH 2EE3A 2A6JB 4HX1A 5HHOB 2J8OA 1G9MH 4J6RH 3TV3L 1E4XL 2YN5A 3CC5B 5CGYD 4GG6A 1GVIA 1WFOA 1MCRA 3MRNB 3BGFC 4WWID 5ELIA 3A67L 2ZCHH 2VC2H 4QYOB 4UU9B 4ZS7H 5DQJA 3PGDB 5IROA 1BQLH 5BO1H 2F8XC 2R9HC 3CMOH 5HHXL 2V2XA 1U8QA 4Z95H 4AT6A 5LWYH 3KPRB 1KCRL 1P4BL 3MJ9A 2FCBA 1VCAA 1Q1JH 1HXYB 2Q20A 1EV2E 3QUXC 3BWAB 5D6DA 1UYWH 2WLYA 3IJHB 4M5YL 3MYZA 4OCWL 2OQJB 4G3YH 3CSGA 5E7FA 1OAXH 4EDWH 4FFYL 2A73B 3QFJE 3QJFA 4LVEA 5F89A 4NJAL 5J3HC 4HPYH 3BUTA 1BECA 1U6AL 3UTTB 4ZSOE 4RAHA 4PJ9A 1T1YA 2DJUA 1BZ7A 3U2SB 2DQJH 1VACA 1UXSA 3F7VA 3P9MA 4HHAB 1BJMA 1Z5LB 2XRAL 4UDTB 4ALAH 3FRPA 1RUPL 4HS3A 2FL5A 1A7OL 3FB8B 1CWVA 4LDEB 4P57A 2EH8H 1LE9B 2DBLL 4ZS7L 4OF5A 1WITA 3H9ZA 1OAYH 4KKNA 4L4VD 4NOBA 2ZG3A 1KN4L 4QTIH 4NKMB 2FR4B 5D71H 4QWWC 1CLYH 2WQ8A 4R7DB 1DQLH 4K71B 5JXEC 3QB7C 4HD9A 4LSUH 4FQXC 1NAMH 2W9EH 1WEJL 2E27H 1PZ5B 2VLJE 1N6UA 4HPOH 4ZFZB 3OX8B 1Z0NA 3KXFA 3LY6A 3RDTB 4LL9A 1TFHA 5C0DA 4V2CB 4WI7A 4F15B 1I3VA 3JUYA 3SDXE 2YEZB 5CGYC 1VENA 3TLRA 4LCCB 4BZYA 5I19L 3U7AA 1WC7A 3WNLA 2B1AH 3H0TA 1I7UB 4NN5C 5JOPE 2R2CA 3S35L 4IS6A 3O4OC 3QNZA 3QUKB 4MJ2A 1KEGH 1J8HB 1YUHB 4U1NB 5JO5B 1CLOH 1MIMH 4I0KA 4L3EB 3VJ6A 4EJ1C 5JIKA 3EZJB 3IKCB 1DVFD 2COQA 3UYRH 1LEIA 1G6VK 2EEAA 1BVKA 5HSFA 1Y18B 4MNGB 4PJCF 3GIZH 1N3NA 5TF1H 3F65A 1BAFH 3KPNA 3ZDXE 4K8RD 2VE6A 1UJ3B 2OJZH 5F7EL 4DN4H 5GRZA 2WIIA 2OTUA 3MRGB 3GO1H 3RBGA 4P5MB 3JTSA 3LPFA 1HILB 1IC4H 4I3RL 5FHBL 5IQ7L 4XP6L 4ZMAT 3O2DH 4PD4J 1T4KA 1HIMH 2OK0H 3O6MH 1U8HB 3OPZL 4OGXH 1X5LA 3MJGX 2AK4A 2P42B 1IQWH 4CW1A 1VEPA 4R8WH 1RZKH 1N8ZB 1JTPA 5E8EA 1S9KC 5IJKC 2YXFA 4P5TD 3I6LE 4R26H 1TZIA 4LLAA 2R4SH 5DEFA 3ZYZA 3GSOA 1JWUA 5AG9A 3OAYK 3CXHK 5F93C 3ARBD 4H0HB 4WW2B 4PGEA 3F58H 5EFIB 1YZZA 2BNRD 2QKIA 1XF2B 3IAQA 2G5BB 1U3YA 4JO1L 4XVJL 2PYEB 2JB5L 3CDCA 5E8PB 3GSXB 1LP9A 1TQBB 2OL3H 2VLKE 3QWRA 1MQ8A 3UJJL 1RIVL 1K2DA 3BZDA 4FXKA 5B38A 1OTUC 1ZHNB 5HY9B 4MZ3A 3MGOB 4EXKA 4G6KL 3TJEH 4Y8AA 3SKMB 5D9SB 3MLPA 3L3HA 1CFNA 4XMPH 5DK2A 1YN7B 4EDXB 4OLVH 1KJ2H 3DX9B 4K3HA 3HB3D 4MJ6B 1XIWA 1CR9H 1DVFC 2GT9A 3MV8B 2EE9A 4NQXA 1KLUB 1JHKH 1MF2H 1T5XA 2BXZA 3PWNB 3IYLW 5CCKH 2LVEA 3DSFH 1JPSH 3DURB 1NANI 2Q8BL 2VXQL 5C2BL 3VA6A 2A38A 2PO6D 5JIPA 3FQTB 2EYRB 3UYOD 5K9QG 5LGKA 5E2JA 5INCB 1NBYA 3DV6A 4IRJB 1Z3GH 1A7BA 5EBLA 1XF1A 4PRPA 4R3SB 1PYWA 2NY5H 3LQAC 4YBLB 3RWGB 4ONGL 5JW5B 1KV3A 1VFUA 3QEGH 2W07A 3IDIA 1J87A 2H8PA 3BGMB 5CEYB 4H88L 4IRZH 3KLSA 1C5BL 2PF6A 3QA3B 4DVBB 5IB2A 4P46C 2PR4L 1XR8B 2Z9TA 1VFAA 5ADOL 5JA9A 2A77L 3U36A 4NSKA 2AJSH 5T1MA 3H7BA 2QSCL 4L3CA 2DI8A 4X4XA 2VQUA 1RUQL 1S7RB 3MNVB 4L4VE 5F1SA 1QRKA 1T1ZB 1ZKAA 3NAAH 5AZ2H 1IC1A 5AEAA 3AUVA 3NFPB 5LQBH 1T20B 2HRLA 2YWYA 3LKRA 2WANA 4TULL 1OGAB 2ARJA 1J0YA 3GSQB 1D5MB 3H9HB 3QHFH 4PJAB 1DSFL 3BUYB 5H35B 2AXGA 2C1OB 3CFJA 1U8JB 3GI9L 1TTUA 5K9JL 1CFTB 1J1XH 2DQTH 5GS0L 2UWEE 1WZ1H 4KXZH 4BELD 2HMID 5D7LA 1Z3GL 1FORH 2GITA 2EXWD 2ZJSH 4OCSH 3C8DA 5GXBB 3QEGL 2VXUH 1BQHB 4EOWH 4OKDA 4BM7A 3JV6B 1OM3H 2KPNA 3QUML 3GMOB 5ICYB 1IMHC 4MAYD 4K9EH 1WZLA 2AJSL 4XRCB 1FG9C 3G6JB 4WWKD 2PO6C 3WUWB 5E5RB 3MBXL 5D1ZC 5TDOA 2HFGH 4DCQA 1I9EA 3IVKA 3VRJB 3ILQD 3K2UL 3B83A 2D4FA 1VFBB 2X4SA 1JRHH 4JHWL 4NWTL 4FHBD 3ARYA 2GCYB 2X41A 4ODTH 4R4BB 3IDUA 2YXMA 2WWMD 4FTVA 2DQCH 3IDMB 2VDKH 3UTQA 2CPCA 1P84J 5E2UH 2Z8SA 3WXWL 1MFBH 1U41A 2H1PL 1G7QB 4G9FD 1F4YL 3VRIA 2PYFA 4QRRA 2YR3A 1NEZB 4JRYA 3F6LA 2CO7B 1TJHH 1R3KB 4DTGL 5F9OL 4E0RB 2YBRA 1YNTA 1XCTB 3ALXA 3VXTB 3I75A 4LAQH 1K8DB 1MY7A 5TE4L 3BO8B 4YWGH 3UJTL 2WV3A 3CLEL 2ZSVA 5MI0B 5AWNH 1T6VN 2BNRE 4GBXC 1UB6B 3RI5F 3FT4B 4P23A 1IKFH 1MFEL 3CUPA 2ITCB 5E4EB 2ZWLT 1U92A 4Z7UA 2HMIC 1QLFA 4YPGB 4JO2H 2EXWC 4Y2DD 3MYJA 2MMXA 2RAMA 5MEOB 2VB5A 4NPYB 4JQVA 4DGIH 4RMTA 5E2UL 4UT6H 1M7XA 3E6HB 1Q94B 3D2UD 4P2QE 3OKYA 4MAYC 4Z7VA 3TA3A 4MMXC 4TUJA 3P0GB 2XTLA 4WWKC 2HJKA 2CH8A 5I6XC 3ARXA 3W9EA 3BH8B 2P8MA 3MROB 3NFSL 3ILQC 1T04B 1T7ZA 4K3JL 3NA4A 1HXMB 3BT2L 1JHTB 3KS0H 1D5XB 3TWCL 5GS2D 4MA7H 3BPNB 4PJ5D 2VO5A 1K9TA 4UILL 3JWDL 1OHQA 3BZ4A 1D9KA 2XN9D 2AJXL 3LS5H 4UTAL 4J8RB 1T7VA 1FPTL 3OR6B 1OY3B 2BZDA 2DWEA 2E3VA 4WI5A 4X6CB 1L7TH 4OIBA 1NEZG 1FL6A 4OZHF 1A6AB 1CFBA 4X7CC 4M1CD 3VFMA 3BEVB 5I1EH 5FDWB 4PV9B 3GMPA 1I1FA 1K3IA 2X4RB 4ODVL 2QHRH 2IANA 2GUOB 1ZLSH 5ERWB 1DZBA 3ZKXC 2NY6B 4LMQI 3ZDZF 1XF3B 5HVHC 3P11L 1UB5B 4L1DA 1INEH 3E2HB 2YD6A 4IIQC 5E2TL 4KK9D 1T7YA 4KC3B 3RL1A 4TNVF 4NT6A 3SE4C 5BZDA 3V4PH 3QQ4B 2NY1B 4U1IB 4WY7H 5DI8B 3OKLA 4OCYL 3DLQR 2BSTA 5HGDB 3FB7A 4YHLL 2CXKA 1N0LA 1VB9A 3MV7B 1CGTA 1QRNA 1FVDB 1C8PA 4TSAH 3N9GL 2ZCKL 3T65B 3WIFA 5IJVB 4Y2DC 3AM8A 4U6TA 3RNQB 1N5YL 3QIUD 2IG2L 4R0LA 4X0KA 1RZIA 4LLWA 5JQ6H 2KH2B 5B39A 3KNBB 3FB5A 1OW0A 3MBED 1UWEH 4K8RH 4EZMA 3T4YA 1HHGB 3L7EA 3LEYL 1A14L 3X14A 1FNSL 4YGVB 4S1RH 1WZMA 4RGNB 3EGSA 1EGJH 2ZPKH 4O9HL 2P4AB 3RUGA 1A6VL 3PWLB 4ELKA 2CIIB 1DQQA 3QCVL 1A21A 1JIBA 1JBJA 4PJDB 3SE8H 5C9KA 4LHUB 5BVPH 5KVGH 2O26U 3ZDYF 5CBEB 4LCIL 5F7WC 3C09B 2FJFB 1T80A 1OARL 5FKAA 5CMAA 1JPFA 1Q0YL 1NBZB 1F3DJ 5TQ0H 1P7KA 3RPIB 3T4AB 3TIDA 2GSGB 1HHIB 3HI5H 4G9FE 5A2FA 5C8JA 2G75B 1TETH 2YZ1A 5HJ3A 4OZIE 2QADD 1BD2A 3EO0B 3HR5B 3U4EB 4S1SH 1HHJB 4Z7QF 5DUBB 3K81A 2CGRL 4J4PA 1EHLH 1QR4A 4GRLD 5T1KB 5ILTL 2B20A 4EIZC 3WYRA 4KK9C 4HIJA 3O6KL 4K3DL 1QSFD 3P77A 4M4PA 3L5WB 4LAJH 3WKML 5HHOA 2A6JA 3VI4E 9CGTA 1K5NA 2CIKB 3U9PH 3E3QC 4Y4HB 2EO9A 2J88L 3K7UA 3U0PB 1EFXB 1F4HA 1PKQE 2FEDC 1OOAA 1G1CA 1S3KL 3LQAL 5DR5H 4NKIH 4ETYA 4UU9A 3QAZC 4KTEL 4M1GL 4PJBF 4JZNB 3QIUC 3PGDA 4K7PL 3Q5YA 1JP5A 5DJ0B 4QXWA 3MRMB 2FIKB 3KPRA 5E5UB 4H1LB 2JK5B 3RA7L 4G8FB 1MIEH 1RIUH 4W81A 3PDGA 1DDHB 4OCNC 4W4NA 3DX8B 3BWAA 1S78D 3LN5B 2OQJA 3JV4B 2YHGA 3PF2A 1Q9LB 5ITBH 1I8KB 3PIQB 1I8MB 2A73A 4HZAA 4JFYB 3BN9D 3DHJA 1CXIA 1N59B 4KDTC 5EO1A 3O4LB 4XXCC 3UTTA 5CKAA 1LHZA 5DHXB 5EWIH 4LHUG 1OAQH 5LJYH 2XXCB 4NFDA 3U2SA 5IVXF 3JV5A 1QNZH 4PJ5E 5HHMB 4HHAA 2Y06H 5IBUB 4BH8B 4UDTA 1IGCH 3NIFF 3QCTH 2O5YL 4WV1B 5IHBA 4K2UL 5JUEL 3LKNB 2XKSA 2ZUQB 4LGPB 4UIMB 2NQCA 2NXZD 4UBDD 5GGVH 5D96C 5SX4H 4LLUB 1KBGH 2BSRB 2QADC 1FCGA 1X5ZA 3WEXB 1UKQA 3CFCL 4NKMA 3EHBC 2FR4A 1RUAL 3LH2L 2ESVB 2J8UE 4R7DA 4JY5H 4GRLC 1A6UH 4MNQA 4GJTB 4H20H 1PZ5A 2CUIA 4ZFZA 3OX8A 3V9FA 4O02L 1NCTA 4FQ1H 1T2XA 3O2WL 1EX0A 4GO6B 5SWSB 1U8NB 1AE6L 3QHTC 4LCCA 2X1WL 4JFQB 3ZTNL 4UB0L 1YQVL 3BMVA 3E3QE 4DAGL 1I7UA 2NTFB 4L3AA 3QUKA 5IMKB 4WJ5B 3SEPA 3RZCB 3P4LA 1J8HA 1YUHA 4U1NA 4HH9B 4LMQE 5JO5A 3VFVB 1U8KB 3NZ8B 4U1SA 5E2VH 4XPHH 4JKLA 2VN7A 1A9BA 4H1LG 2EYTB 2VXSL 4LVOC 3RFZC 2CRMA 5DT1H 2W9LA 3T08A 3V5HB 3QIWC 4NZUL 4CAGA 1G6RA 4QLRA 2EE2A 3P0VH 1AD9A 1Y18A 4MNGA 4MXVE 2R23A 3FFCD 3CD4A 4BK5A 1M7DB 1MAJA 3T2NH 4ORZC 5F6IB 2W0FB 4DN3H 1NCBL 5ABDE 4ZUUB 3AY4C 3EJZC 4P5MA 1JGVH 4ZTOL 5DS8A 5DRZB 1HILA 4G5ZL 1L0YA 5IMLA 3SDDB 1IC7L 4NHCH 2MOVA 3LKOB 2YRLA 4YUEH 1YC7A 1U8HA 4C56B 3WIIH 2HTLD 5GRYA 5IBUG 3GZKA 4GXVH 1O5DT 4P4KA 4LEOB 4NZJA 4UIKH 1N8ZA 4B50A 3FQUB 1IQDA 5C86A 2M8XA 2OI9C 4YHZH 1CGWA 1RIHL 3TZVD 2V17L 2NXZC 3L3IB 4JG0H 1A7NH 1WWWX 5KSBF 4NKOB 1RK0B 3V4UL 1FVEA 2HKHL 3RAJL 5LGHH 4WW2A 4F33B 3B6SB 5EFIA 1IAIH 1AGEB 1CU4H 4QT5B 1XF2A 2GHWB 4MMZC 3IFNH 4P5KA 3C60C 2PYEA 4GAJL 5EZIH 3WDJA 4KPHL 4JQXC 4PRHD 4WFFD 4EIGB 3GSXA 3MREB 1QSFE 4ZOAA 5CJOL 4JFEA 5KANG 1ZHNA 4XNYL 2ZOKB 4WUKL 3QUZB 2H41A 3SKMA 2ORBL 1VADB 2VZTA 5CSBA 1BOYA 1R3HB 1WCBB 4EDXA 3G5XB 3ORJA 5GS3A 4MJ6A 4XVTL 5GRUH 1UZ6E 3MV8A 2F53B 3IU3B 4XCEB 2CKBL 3DOSA 1KLUA 1KJVA 4F7PB 1TZHA 4ZAKD 2BJMH 5C0FB 2GY7B 1A3LH 4OGAD 3DETC 2E5EA 2EYRA 4LDOB 3WFZA 2EIZA 3IU4H 3OHXB 4QOKD 4IRJA 2NY4D 3EKCA 4I18A 3ALWA 1T03H 4OSUH 2EDKA 4PJXB 1T66C 2NW3A 4R3SA 1FNAA 1GOGA 1MCPH 1YPZB 5E99H 5JW5A 2ADFL 1R3IH 4PBXA 5CEYA 4X7TB 3TBWB 3R8QA 3RWIB 3QA3A 3EOYG 4DVBA 3KDMB 1KCVH 1X5FA 1XR8A 1C1EL 4H0IA 4QXGH 2XQBL 3FOMB 1SYVA 2AJYL 3OV6A 4HIXH 4KV5E 1F8TH 4N0UE 4OLYH 1URLA 3FCTB 4KUZL 1K4DB 4NM8H 1F97A 1G7PB 1N5AB 3ZT5A 3RTQD 3MLWH 3ZTJG 3MNVA 4GG8B 1T1ZA 1AR2A 4ZOEA 4B7IA 3NFPA 1T20A 4QRPD 4Y4FB 1I85A 1KTDB 1CK0H 1OGAA 4U7KA 3GSQA 1ZTXH 2VLLB 3H9HA 4PJAA 5KVEL 4JPWL 3O0RL 1NCWH 3BUYA 3O3DB 5H35A 1II4E 1I1AB 1U8JA 2EDLA 1CFTA 1U8MB 3MXVH 4X6DB 1NGQL 2OR9H 1UXWB 1FZOA 2AW2A 4LSDA 1MEXH 4WHYH 3QQ3B 4ZTPH 5GHWH 1J88A 4N90D 1S9YB 3P30L 3ECBA 4GW4A 4OLXH 3JV6A 2HLFC 4KRMB 3X3GH 3U48A 3GMOA 5ICYA 4ZAKC 1LD9B 2RBLA 2D4DA 3WS3A 4XRCA 3LB6D 3FFCE 3RWFB 4WUUD 4HXAL 1TVHB 3GJFH 3VRJA 5E5MB 4N9GB 1NL0L 1VFBA 4GQ9L 5HVFB 1C5CL 2HVKB 5C07B 4NDMB 2ZP0T 5GGTL 1MCWW 3BP5B 2J6EA 4KMTL 4RZCB 4AQ1B 5EG6C 5CD5D 4MDIA 1HKFA 4L9LC 4PP1D 1N26A 4LQFH 1G7QA 2Q8AH 3PP4H 2BFVH 3KPQB 4HEME 3TVMA 1NEZA 1CICB 3WJJC 4YDVA 5AYQA 1CZ8L 1R3KA 5CEXB 4E0RA 5F96L 4QEGA 3QXAB 3RTQC 1XCTA 3GI8L 3VXTA 1NBVL 1L7IH 4OZFB 3ROLB 5IMMB 1T6WA 3QHZL 3N85L 1K8DA 2D31B 1WJ3A 4M6OL 1G7IB 1D5ZB 4OCRH 4JY4B 1UB6A 25C8L 3WS6C 2R1WB 3FT4A 1QBLH 3WSQL 3PWPB 3HNSL 4HDIB 4PRHE 4WFFE 3CIQA 4EXPX 3VD9A 4CU7A 4NC1C 1NKRA 1YEDB 4GAGH 4WO4D 4YHPA 5D6CB 3RJDA 5DMKA 5J06A 3QDGD 1BEYH 4PY8J 4ZFOB 3SDAA 1NFIB 1UKTA 4XNUL 1G9EA 1AI1H 4NPYA 5SV4A 4QF1A 5EB9A 4NZDA 3E6HA 1Q94A 5IFHL 2LE9A 3PP4L 4FQCL 4PB0H 4QRTB 3QEQA 4OLWH 3VFTA 2P5EB 4L8DB 5HDQH 4JO4L 4FFZL 3VXUB 3BMWA 1NLBL 3BH8A 3MROA 5F70A 1T04A 1QSZA 1HINL 4M9PA 4XP4H 1RULH 1ZHBA 1HXMA 3O81A 1W72B 5DEGB 5KJRL 4LRIA 1BPVA 4DUXA 5HYQB 1E4WH 4TRPL 5EORH 5FM4A 3BISA 1YECH 5I1JH 3GMMB 4QGYA 4RQQB 4QOKE 1IGTB 3V5KB 4CVZB 5CD5C 2VZSA 4PP1C 4XAKD 4X6CA 3OR6A 3QPXH 4O2EB 2EYSB 3CLFL 4NOFA 3V8OA 2P44B 4PJFE 5ALBL 1EHNA 4D3CL 3BEVA 1KIRB 2BY2A 2VZ1A 1UJTA 4FXGB 1AXTH 4PJ9D 4PV9A 3DVGB 4U3XA 5E6ID 1CDBA 3FN9A 1I4FB 2X4RA 4PS4H 4OZFG 3ARRA 3H6JA 4DQOL 2GUOA 1CDIA 5ERWA 2P43B 4KZDL 3DRQB 4JDTH 1XF3A 4MSWB 3TYGL 2X2YA 5JHDA 5ISZB 3BKJL 3K2MC 3H9SD 1QLRB 4HXBH 1I3UA 4CJ0A 1PG7W 3QQ4A 1JJUA 1QZ1A 1V5JA 2YPLB 4U1IA 4NNXB 3WIHL 4U33A 5DI8A 4DKEL 3V6OC 3V4VL 3PXJA 4K23L 3MV7A 2ZCLH 5DDHB 1FVDA 3QIBD 1IM9B 3QI9B 4U0RC 3T65A 5IB1B 4WO4C 3RNQA 4JHBA 3SDXF 3GUTB 4CU8A 4HC1H 4YBQD 2NZ9C 4J23A 3KNBA 1EO8H 4M62H 1GGBL 4N90E 4U1JA 2O61B 2EE6A 1HHGA 4P9MH 2ZG2A 4RGMB 4OD3L 2E8YA 3EOTH 3NCJH 4YGVA 1A64A 2D03H 4AMKH 1AR1D 3PGFL 4JFFB 1MUJB 3HHRB 4P2RB 3JWOC 5IROC 5FGSA 2EDHA 2V7HB 5CJQL 1T2QH 4Z0BH 1GGYA 3UXFA 4LVHC 4PJDA 2ADIA 5L9DL 4RWYL 3RX5A 3ZDXF 4LHUA 4XWGL 5D6DC 1NH6A 4IOIB 2YK1H 1LO4H 4O2FA 1GH7A 3B3IB 3WO4B 5FCUH 5ICXB 4I0PB 3HKFA 4JO3H 4O58H 2OCFD 1RD6A 3CXDH 2GSGA 2CD0A 5GJTH 4NO5B 1HHIA 3EO9L 2G75A 4PJ9C 1PKOA 2DQFB 2R69H 5E6IC 2PTTB 3DMMB 3HR5A 4LKCB 5BJTA 5DUBA 1TCMA 4M62L 2R4RH 5T1KA 4WEBH 5J13B 3W82A 2IJ0C 4GRMA 4X8XA 5CZVL 3VMNA 2A2QT 3MLZL 4CU6A 3L5WA 1LDSA 5ECJE 4AMKL 3VFRB 4GW5B 3MRRB 1EFXA 1YEIL 2B39A 2GKIA 4B41A 5I15L 3L1OL 1QO3A 3S36X 3QIBC 3TPKA 3CU1A 5BMFL 4NBYB 4JZNA 3V6OE 4Y89A 4LRNH 2Z4QB 5DJYB 1U2HA 4H1LA 3A6BH 5DUPH 4OFIA 2JK5A 4YHKL 2VR9A 4G8FA 3NABH 3QWRD 3DX8A 4MA8H 4F7EB 5C7XL 4WHTB 1AR1C 3D0LB 5TPWL 1LNUB 3QDMA 1F13A 1KCUH 1I8KA 3PIQA 3STLB 1OAUH 1G7MB 5DRNA 5ACZB 1NC2D 3TT3L 3AROA 4CRPA 4FZEH 5C0RH 1N59A 3U83A 4F58L 1BBDH 4LIQE 4N0YH 4L8CB 1RUKL 1LILA 1CLZL 3NMEA 3O4LA 1BMGA 1IT9H 1XIWD 2FX9H 4KJWC 2AJVH 2OJEB 3FN3A 1AH1A 2K7PA 1U42A 2R2BB 5JIHA 4PJIF 2XKNB 5C0CB 2DYPB 3NIDE 4IMLB 4OI9A 4Q6IB 2C3WA 3QDJD 1T5WA 3TN0A 3U0TB 4KQ4H 4WV1A 4XAKE 5IKCB 3LKNA 2GJ6B 4UIMA 2JTDA 4LLUA 3CX5K 4PRPD 4H26B 1U36A 3WEXA 2YD8A 4GMSH 3FKUS 2ESVA 3OZ9H 2IPTH 1XF4B 4F7MA 2C9AA 3PG2A 3BDYH 3ZLQC 1QHPA 1FDLL 8FABA 3ARWA 5I1AA 3MZGB 3R0MA 2HT3D 1U8NA 5F6HI 3AXLB 1B3JA 3SJVD 1CGVA 5DJ6A 3TO4D 1S7WB 3H9SE 4JFQA 2EKJA 1JWSB 4QTHB 5T5FH 1TDQA 3BVNB 5TFSL 5MHSD 1DLFL 4U1MA 4JR9L 1RQ5A 1INDH 4WJ5A 5CUSH 3V5DB 3ZL4H 5CFHA 1DFBH 3U46B 3ARQA 4HH9A 2XV6B 5GRJL 5IW6A 3VFVA 1U8KA 4WTWA 4Q0XL 4QHUA 5EU4B 2EYTA 2VXVL 4YZFE 1X5XA 4RFEA 3V5HA 4MCZB 3H2WA 1U3HC 2OZ4H 1HHHB 3FN0H 5JW4R 1FYHB 5TDNB 3M17A 5EOCJ 3MLUL 1X5HA 4YHNB 5D7LD 4ZUUA 1Q9KB 4HBCH 1BQUA 2YS4A 5FGBA 2JELL 1RJZA 1XIWC 1S7SB 4F57H 7FABL 4I3GA 3CU7A 2WK2A 4G6ML 3C2AL 1DQTA 2VDNH 1TJGL 1MRDL 2FZ3B 4GRWE 4JN1L 1QUNA 4NQCD 1ZT1A 3DX7B 1YEJH 3PDDA 3LKOA 1BIHA 4Q9BA 4C56A 1RU9H 3KVQA 3IXTA 3F5WB 5I9QB 4I13B 4LEOA 2E7LA 1JMXA 4HAFA 4EI6B 1OB1A 1HWHB 3FQUA 4PJCB 5SX5H 3U30B 4YLQT 1WK0A 3VWKB 3L3IA 1Z9MA 3MNZA 1D6VL 4NKOA 1G0YR 1DFBL 5CP7B 1UGNA 2UY6A 2K9UA 1AY1L 4DWHA 4F33A 5T33L 3O8XA 4HV8B 5IF0B 3VFGL 4XP1H 4QT5A 4GOSA 3D0VB 2R0LH 5GS1B 3NTCH 2NW2B 1P9MC 1YEEL 2HT3C 4HFWB 2AK4E 3EYUH 5FGCB 1UZ8B 2YSSB 5F97E 3DVIA 4JRYD 2XY2A 3TO4C 4I3SH 4OKVB 2FWOB 4HWBL 2GY5A 4HBCL 5EA0L 3LD8C 3QUZA 5ADPH 3DIFB 4PTUB 1VADA 4TNVK 5T1DL 1R3HA 1NCUA 2FX8H 1WCBA 3G5XA 4Y5XA 3TNNB 4YEEA 3DUHA 5EBWA 3QO0B 3BESR 5GGRY 4P9HH 3B9AA 1U8PB 4RISL 2F53A 4LIQH 3IU3A 4XCEA 4P23D 3S37H 2IQ9L 1A6PA 1LP9E 2Y36H 1HEZB 3HUJF 3HR6A 3MJ9H 4S2SB 5HHNA 1P5UA 5TH2B 2DI7A 3MLVL 3DROB 5T3XL 4ZNEA 4ISVB 4NQDD 3OHXA 4M9OA 1REIA 1A22B 4WI3A 3B9KC 1ZGLA 4PJXA 1I9RL 4YIQB 5GGSB 5E8NB 3WDIA 2AJUL 3OKOA 2JKXA 3C5JA 2H32B 4X7TA 3TBWA 4GS7C 3IRZA 2EICA 3LRHA 4ZO7A 3RWIA 4CVUA 1RJCA 1HYRC 4JAMB 1H3TA 1H3GA 1FE8L 2XQYG 4HCRA 1GRWA 3FOMA 1RURH 5K33A 4FP8L 4NN6C 1BFVH 3FCTA 1KPUB 1K4DA 3C5ZB 5FYJL 1FYTB 35C8L 1JYXA 5J89A 5DD5L 1ZSDB 3INUH 4FQLH 4M1DH 2GK0A 5EBMA 4NUGL 4GG8A 1MCHA 4PRPE 5GGRA 5F9AC 3RY6A 4HMDA 3DBXB 4XVUD 3TP4A 3UPAA 3JWOL 1KTDA 1ZV5A 1J1OL 3WFCL 5BV7H 1NDGB 3F6IA 5I74C 4DGYH 2DDQH 4BZ2L 3F7RA 3MA9L 1FLRL 1NMAH 1Y6NR 3BX7C 4D0BB 1XGUB 5F7UA 1EA9C 1I1AA 1U8MA 2BSSB 3EFDH 1MI5A 1UXWA 1WBZB 3SJVE 2YKLL 2CDGB 3VFNB 4I1NB 3ZE0F 4M43L 3QZWB 5IMOB 4PRAB 2EH7H 4JZJC 5MHSE 3X12B 4KROD 3TO2B 1KIUA 3MODL 1YNKH 2VDPH 4JPVH 4IDLA 1E6JL 1QFWL 2MKWA 1CS6A 2R29H 2KKQA 4ODUA 1B0RB 3BPCA 4LSQL 1LD9A 2VKWA 3A0OA 4GRWH 4UQ3B 4FXLA 5FOJA 2L7JA 3CSPA 2VYRE 2OS7A 3E6FB 5MEQB 3RWFA 1CICC 2F9BT 2X4NA 4JB9L 2ICWJ 2YC1A 5E5MA 5D7LE 4LPTA 1EEZB 2ICWB 2HVKA 5C07A 4NDMA 1Q0XL 1O7VA 5JW4N 4R97C 4GAFB 4EQ3A 4HW6A 4RZCA 4A6YL 1V3KA 5F7HA 2V5YA 4OF7A 2YPVL 1T22B 3SPVB 1A9EB 1I8LC 4XPTH 5CINL 2N7BA 1KB9K 1CCZA 3MOBL 1VGEH 3GHBL 4PJ8B 4UMGA 4WI9A 3VXNB 2UUDK 1FFNB 2JJTA 3FO9B 3MOAL 4PBVC 3D5OF 4J3OC 4N8PA 3M1BB 3VG0L 3QXAA 4UOW1 4KI5D 1I3GL 1HH9B 4OZFA 1PY4A 3GSWA 3ROLA 3SCMD 3EYFB 4OB5H 4D9RD 1R0AL 4YHMH 1RHFA 3AU1B 4XVUC 3DVNA 3QEHB 2X4OB 1CXHA 1G7IA 4OZIF 2F54B 1D5ZA 5SWZB 1GXEA 3CX5J 1UFUA 4JY4A 2R1WA 3L5XH 3AMKA 2OX5A 3HE6B 1OSPH 3PWPA 5HGAB 3PWUA 2XZZA 4MHHI 4JRYE 2UV3A 1BD2D 2ED9A 1A1NB 3B8SA 3QZWG 2DLEA 4ZFGL 3G9AB 3BWUC 4EQ2A 4M4RA 3GBML 4KROC 3GM0A 1CL7I 3QULA 4RIRB 4O5LH 2J4WH 5C0AA 5TQ2H 3CDFA 1ZLWK 15C8H 4QRTA 2BNQD 5F3BB 1OTTD 5INDB 2P5EA 4JFPB 1XAUA 1KC5L 3VCLB 3GKWL 3VXUA 5DFVC 4J3VA 1PSKH 1W72A 1OW0C 1TPXC 4JREC 4LDLB 2FH6A 2Z35B 5HYQA 2YA0A 1X3DA 3LDBB 3GMMA 4NQDE 4RQQA 1IGTA 2QJDA 5GQBA 3GSNB 3T8XB 4CVZA 3OXSB 3FO1A 4K3EL 2YZ8A 4R4FH 2X7LA 2A1WL 1FSKC 2EYSA 4Z7VE 1H3XA 5F8QC 2BVTA 3IFOB 4L4TB 1WWBX 4PJGF 3T0EA 1KIRA 4KTYA 5IGXH 4MA3B 4EUPG 4ZXBD 3VWJB 3GB7A 3GMRB 3OXRB 4KI5C 5FA3B 1I4FA 5D7JC 1ZLUH 3UO1L 3SE9L 1YEKL 2DMBA 4BYHA 3SCMC 1DBML 5L6YL 3DRQA 4JGUA 3MCKB 4MSWA 1QLRA 5D7IA 2CJUH 5E95B 1MHPH 2J8UF 4NNXA 5BZWB 2XICA 3AC0A 4Z0XB 1KLGB 5A16B 4OZHB 5DDHA 4CMMB 2Q86B 1C12B 2BRRH 2SEBB 4OD1L 5I73B 4MNQD 1PLGH 1JF5A 1JMZA 1HZHH 1UWGH 3X17A 4JHAL 2IANE 4MJIB 1NBQA 4PR5B 4XAWL 3VGGA 3MXWL 4LCWD 1UCTA 3T0XA 4WHCA 2EDRA 5D70L 2O61A 4OQTA 2EKSA 3EYOB 1INQB 4XNZB 4HWZB 2V7NB 4BQCA 1Q9OB 3Q0HA 4CN6A 4U1GB 1MQKL 3HC3H 4JFFA 5KVFH 3HNTL 5FA4B 1MUJA 4XZUB 4BH7B 1J8HD 4GMTH 1OQOA 3L7FA 1NCDH 2DQGL 3QQNA 4MXVF 4AIXA 4MJ4A 1F5WA 2XA8L 5EIIB 4UV7H 5FYLL 2ZUSA 4HSQA 3UC0H 4Y1AB 5CAYB 6CGTA 1BM3L 4AIOA 4IOIA 5J13C 1MFCL 4K7FB 2CJUL 5IIEB 3B3IA 5ICXA 3IJYB 5ALCL 2VDOH 4I0PA 3LEVH 3FT3B 2VABB 1JYWA 2B1HH 1QLEL 4ZXBC 2DQFA 4MXWL 1N0XH 2M26A 4NGHH 1A0QL 2JF1A 3IFPB 4LKCA 3ARFB 2APFA 2RQ8A 3PL6C 1Q9WB 4S10A 3TFKD 4KI5E 2V5TA 4AJ0A 3Q6FA 1KB5B 4P4KD 3CVIH 4D9RE 4AY0A 1MWAB 1FRGH 1KXVC 2RIKA 3VFRA 3MRRA 1AKJB 3HC3L 2DBJA 4QO1A 2WZPD 5EDXA 1JNLH 3ULVD 4FQ2L 1MRFH 1A4JB 5T3ZD 1KPVB 1TJIH 5LXGH 2R0WH 1HDMB 1HSBB 5C0BB 2I07A 4W4OA 2HRPH 1BD2E 4QRQB 1ZA6A 5A2JH 3ULUD 1QA9B 2Z4QA 1J7VR 2NX5B 3V52L 2D3VA 2CMRH 4FZ8H 1RVFH 5EO9A 4UINL 2PW2B 2VQTA 4JFED 4WHTA 4JEGB 4NNPL 4Q6IC 1LNUA 4MQXC 3STLA 1A3RL 2BNQE 4KVNH 1KLFA 1UZ6F 5CS7A 2DM4A 2LAGB 2OBGA 5GGQL 4DGVH 5GJSH 1DBJL 5DJ2B 4L8CA 4OLZL 5MENA 4K94H 1CGSH 4PJBB 4U1LB 1S9VB 2R2BA 1YA5A 1PZUB 4PRID 4WI4A 3ZYOA 3BSZL 1KTLB 1WCQA 1I9IL 3KYOB 4XMLH 2WQRA 3U0TA 5IKCA 1I1YA 2N4IA 3U6RB 1MCEA 3NIGE 5EU5B 5J12C 4H26A 2DQIH 4X6EB 5DJZA 2X1XR 4ETQB 3R8BB 3D48R 2C3VB 1B6DA 1BGXL 3TFKC 1KN2H 4KV5F 2CMRL 1RVFL 3L3DB 3DUSB 4H8WC 4HJJH 2BVQA 3BE1L 5IVXB 1DE4B 4KGJA 3NZHL 3EW3B 4LPCA 1S7WA 3L9RB 5GSVA 4DZ8B 3ULVC 1JWSA 4OV5B 4U2YA 5HHQA 3S3SA 3BVNA 1F6LL 2CK0H 3FQRB 3HC4L 1QFUH 4OQ1A 3V5DA 3S88H 3U46A 1MLCB 2Z8WC 3ULUC 1JNHB 3EAKA 4JDZB 4CL7A 5EU4A 1IAMA 2J3SA 4Z78B 4QY8A 4MNQE 1X5AA 4HT1H 4NC0B 5B4MD 5TE7H 2PTVA 1IFHH 1OSZA 4MCZA 4LCWE 4NKQB 1HHHA 1ERNA 3B2VH 3I2CL 1DBBL 5D5MA 1IAOB 5TDNA 1MCSA 1N6QH 3OAZK 2RFXA 2Y6SD 3D9AL 3D3VD 4ZFOL 4JM2D 1IKNA 1Q9KA 4NQSA 3ARGA 4I77H 1S7SA 1J8HE 2UZIL 5C0JA 4N8CH 1GHFL 3GRWA 2VDRH 2FZ3A 3BPOC 5J1SC 1P7QB 1IC5L 3F5WA 1IGFL 4YHIB 4MNGE 1KNOB 5FF6B 4EI6A 4OM0H 2W38A 4PFEA 4Q6YA 2JIXD 4PJCA 3R4DA 2E9BA 3VWKA 3ZE1E 4I18C 3AREB 3BFOA 3QR2A 2A9ML 4FQQA 5T1LB 4WENB 2VZOA 2AV1B 3BD3A 4JPKL 3UPRA 4HV8A 5DK3A 5IF0A 4JPIB 1JI1A 5GGSY 1ED3A 4Y4KB 3U7WL 3D0VA 5GS1A 4Z18A 1NUFA 2FBJL 1ES0B 3RKPA 2NW2A 5FUOH 2A6DB 3DV4B 4HFWA 3TVMD 1UZ8A 2YSSA 4LSTH 2OXHA 3RP1A 3RKDD 5MEPA 2MHAB 5KW9H 4PB9H 2FWOA 2DQHL 3MQIA 1T1XB 3L5IA 5FYJU 4PTUA 1P4IH 4XBEH 1VPOL 1TZGL 4BK4A 4Z5RB 3ULVE 5HPMA 5DD1H 4DOHB 2ZOLB 5T3ZE 5KSBB 1EH9A 2KZWA 4M48L 5I66B 2NYYD 4XNMB 2OP4H 1H3PL 3U82B 3QH3B 3VU2A 3ULUE 1U91B 5E56A 4UUJA 1CL7H 4F8QA 2X1PA 1N6VA 4ONFH 1JZ5A 3S6CA 1GGTA 2Y6SC 3ZMRA 4QNPE 4S2SA 5FGRA 3SDYL 3STBA 4JFEE 5TH2A 1KPRB 4LGRB 4JM2C 5AZEH 2FYYA 1XMWA 4X98B 4YHYC 4U6XB 4XXDB 4M8QB 4R6UA 3SDAD 1U8OB 4ISVA 3P4MB 3VD7A 4P59L 4LSVH 4YIQA 5EU3B 4ODHL 5E8NA 5FV1L 5C09A 2B5IB 4M7LH 2HT4D 3S8WA 3EDKA 3QEQD 4JE4B 2H32A 4P2YA 1R24B 1EZVY 5I1CH 4LPXA 4GUPA 4JAMA 5IW3A 3RVXD 3RL2A 4DKFH 2DI9A 2VRAA 5HYFA 4NJ9H 4G8EB 3MNWB 1U0QA 5J11B 2VXTH 3O6FD 3X3FH 3VD5A 5IT2H 1U8LB 1KPUA 3C5ZA 3REVA 1FYTA 4Y2OA 1ZSDA 3S34L 4ODXB 4PJFF 3QPQC 3SN6N 1ACYH 2UYLB 4L1HA 2EIDA 3KR3L 1JGDB 1CE1L 3DBXA 4MNHA 2UY7A 4WDIB 4F37F 1U2CA 2X1QA 1DQDL 2NY2B 2P5WB 3IJSB 1NDGA 1SEQH 4KMLB 3RKDC 3MCLH 4XPAH 3PNWB 4FN0A 1XGUA 1Q8MA 2PN5A 2IAMB 1LEKB 2BSSA 2XZCL 5IEHB 1E27B 1WBZA 2CDGA 3VFNA 2LAAA 3TBTB 3D6GA 1S8DB 3QZWA 2P45B 4PRAA 1EJ6A 4P0DA 1FN4B 1A7PH 3X12A 5JHDD 1FFPB 5DD0H 3TO2A 1MHEB 1NKOA 2AABH 3HE7B 5IW1A 1GGUA 2OR7A 1B0RA 1OGAE 1GJIA 1YYLH 1UM4H 4PJAE 2AERT 1MCFA 4LASH 3T0AA 4KZEL 1X6LA 1N4XL 1C7TA 5DVNA 1IILE 5MEQA 4LNVA 5D7KD 4EBQL 4HJ0D 1G6RH 4XPBL 1FNHA 2GAZB 4HF5L 3SDAC 3UAJD 1KUMA 3D3VE 1EEZA 1PAMA 3FT2B 3OBAA 1BBJB 5EO0A 2HT4C 1I3RB 4ORGB 4XCFL 1EEYB 3C6LA 1RUML 4RGND 1A9EA 1QBML 4LEXL 1IAIM 5CIPB 4WFHD 4FQJL 5FUZH 3LRSB 3RVXC 2BVPB 4PJ8A 5I18H 4S0TD 3VXNA 1G9NC 3HC0A 4OBRA 5FO7B 3SKNB 1FFNA 3O6FC 2MSPA 1X6NA 3M1BA 3IAGC 5FO8B 1G7LB 3C8HA 4HMEA 5D2NC 4EUPA 4Z7NE 2VSDA 1HH9A 4AG4H 1UH3A 3EYFA 3BW9B 1BLNB 5C08B 3AU1A 3QEHA 2X4OA 3VXRB 1YNLL 2G2RB 4FABH 5IFAL 1LO2L 5KAQF 1J0IA 3HE6A 3P40A 4JJ5B 1F58L 5HGAA 3ULUH 5JXAH 5EZOH 3TT1H 5E9DD 1A1NA 3E1F1 4PLOB 5ESQB 4L5FH 2DKMA 3U1SH 2ENYA 4LVNC 3U0WL 1NJ9B 1J9CT 1P2CB 2O93L 4M6NL 4S1DD 4WTXA 8CGTA 3BP6B 4QCIB 1D5IH 4MDJB 1KACB 4AM0B 3L5HA 4IBLT 4LLQA 2BHYA 2QTEA 4XPFH 3CJJA 3MJ8A 3FAXA 5DFTA 5F3BA 3E0GA 1M05B 5INDA 3TYFB 4JFPA 5DURD 5C92A 3BXNB 3VCLA 3TCXA 4HJ0C 3D18A 2AAVA 3UAJC 4H8WL 4ERSL 2ZUYA 2R0ZH 4TSBL 1HQRB 2FATH 2EDDA 3ULVL 2QEJA 4H0GA 3GSNA 2LTQB 3OXSA 5T3ZL 1XGRB 5BRZA 2B0SL 3ARDA 3QDMD 5EOCL 5ID1B 1TNNA 3QEQE 2E9JA 1EMTL 2AEPH 3SOBH 2IH1B 3V7AE 3J7HA 1EIBA 3IFOA 1E6OH 4L4TA 5BOPA 1FNGB 5H37G 3MZTA 4L5FL 3NIDF 3HN3A 2D0FA 3BKCL 2Q7YA 4IDJH 4MA3A 3VWJA 3QDAA 3GMRA 5FA3A 4NP4H 1UACH 2WW8A 2DLFH 4XCCL 4XGZB 3KAAA 3HG1D 3CFDB 2CK2A 3MCKA 2Z31B 3LHPH 4Y16B 4X99B 3ZHLA 1KJ2B 3TN0D 3QFJB 4X6CE 5HYJB 1ZEAH 5J57B 1MHHA 3HZYB 2R15A 3QCUL 4ZSOB 2VDLH 3NGBB 4Z0XA 2DTSA 4X4ME 5IK3B 1ZAGA 1B9ZA 3VG9B 4OZHA 2IPKB 1NC4B 1YDPB 4CMMA 2ESVD 2VJXA 3MRPB 3EYQD 2Z91B 4Q9QH 1L6ZA 4PR5A 1JGEB 1ROWA 2BVOB 2DL2A 3WN5B 2CLVA 5JHDE 4Q9RL 3EYOA 3UTSA 3CGTA 4HWZA 2V7NA 4MQ7B 1Q9OA 2BDNH 1F2QA 3DGCR 4OGYH 4YZFF 4AZ8A 5DO2D 2NXYB 2YMXH 1XH3A 4BH7A 3QUMB 2A83B 3MV7E 4NFCA 4DK3A 3ZT6A 1FGNH 3Q2CA 1VEOA 2IFGA 1L9NA 5D7KE 4NQEB 3ARFC 3PWVB 3SDXB 4JKPH 4Y1AA 1UQSB 1W8OA 5I1KL 4M7JH 1VGKB 4K7FA 5IIEA 1JHLL 5DMYA 1LVEA 4RGNE 2RHEA 2J6EH 3BGFB 1UA6H 1CFVL 4WFHE 4P3DB 5CP3A 43C9A 3SBWA 3RVUD 4NYLA 1H8NA 5DFWH 5F1KC 3IFPA 4PJDE 3GK8H 1MPAL 1MFAL 1Q9WA 4KFZC 2FGWH 2EDXA 1KB5A 1V7NH 5M95B 3QUXB 4JRXB 3K0WA 5EULV 3P2TA 3BPLC 3OJ2C 1UT9A 1MWAA 1T83A 4ZUWB 3HPJB 4ELMF 1AC0A 5EPMB 1A7RL 1AQDB 1AKJA 2BCKA 4CN1A 5F7DB 2BY0A 3ESVF 5IBTH 1I8IB 1MFDH 3MO1B 3MRCB 2F74B 1A4JA 4KVCH 1ONQB 3O45B 4LKXB 2WUCH 1HSBA 5C0BA 3O8XD 3S35X 3EYQC 3QO1B 2BMKB 2X10A 1QSEA 4QRQA 3B9DA 5E9DE 1T89C 3VXQA 1QA9A 4UV4L 4M00A 3DI3B 2ATPA 3SE3A 1ZVHA 2DTMH 1IGIL 2PW2A 4O00A 1F02I 4Q2ZB 1R3JB 2ZUWA 3QUZD 5DO2C 5F71A 4YAQA 2IGFL 2A0LD 4OCXH 1EVTC 4X5WB 5DLMH 2A9NH 5DJ2A 5LKNA 4AEHH 1LP9F 4FQXB 4U1LA 4KHTL 1S9VA 1NCCH 3A6OA 1G7JB 2DKUA 2VL5B 3ETBF 4RAVB 4KUCF 3B9VA 5EC2B 5KG9B 1KTLA 3KYOA 4K07A 4MLIA 5GRXG 1S5HB 3GBLA 12E8L 3BEWB 3H3PL 3QDME 3GSUB 4NN5B 1B4JH 1SY6A 3O4OB 4GKOA 1TQCC 4YX2L 3RVUC 4EN3A 4R7NB 2AJZB 3FTGB 3R06B 4ZQKB 3VXPB 1DUZB 1CVSC 1WTGT 4X6EA 4LOUD 2V9TA 1TTGA 3LAFA 2X4PA 5BS0B 4ETQA 2C3VA 1CVRA 3W0WA 1YEGH 3CSYB 4LCYB 2E7LC 4FOMA 5IVXA 2Y7QB 1N64L 4HH8A 1ADQA 3AFLA 4PJIB 5CILH 3HI1A 4LARH 5I1DB 5IWLA 3L9RA 4OLUL 1S7VA 2MQ0A 4OV5A 3LMJL 1MVFA 3LS4L 5DVOA 1JPST 1MJUH 2Z8RA 3NACL 5FYKL 5HI5D 4PG9B 1GZQB 1KOAA 1Q72H 1MLCA 3EYSL 1JNHA 2FX7L 3KS0J 2ESVE 4JDZA 1S7TA 3GHEL 5F1NB 3OGOE 2VIRA 1G9NL 2QBWA 3CZJA 1FIGH 2NLJB 1B2WH 2Y07H 3HPLB 4RFNB 1MI5D 4ACPA 2A0LC 1A2YB 1JWMA 3KLHD 1LO3H 4IMKA 4U7MA 2AK1H 3IAPA 2CUHA 3OQ3B 1YPZF 1CGXA 3MRFB 5D8JL 2FECI 3HNVL 3G5YB 4X83A 3S97C 4TVPH 1AHWC 1PG7L 1RV6X 1P7QA 1OGTB 1HSAA 4PRNB 3KJ6H 5DC4B 4YHIA 1CDCA 1QYGL 1KNOA 4PJ7F 2JLLA 3UPCA 5FF6A 4G43B 4JDVB 4RAUB 3RHWF 1R5VA 1FFRA 3I50L 2R1XB 3IFLL 1JZ6A 1SVZA 3OAUL 5T1LA 2D7TH 3KYKL 4LOUC 3W5MA 3M8OH 1KIQB 4FFVD 4Z9KB 1CF8H 3WFEH 2WBWB 4RA0C 3S3PA 2AV1A 4DW2H 3O3EA 5FIEA 4R9HA 4NRZB 5FO9B 2H2SD 3S5LB 1DVFB 4JPIA 2X70B 3CX2A 3NN8A 1FO0L 5IFJB 2DMKA 1XGYL 1T1WB 2A6DA 3QT2A 3RVWD 2MHAA 2BHUA 3N1MC 4RMWA 4X8JB 1SBSH 1U93B 3KPSA 4LP4A 4PGCB 4E42B 2W9DH 3SGKC 2Y25A 5HI5C 4RFOL 4Z5RA 3LSOB 3L3JB 2ZOLA 5KSBA 3RY6C 1JGUL 3BOVA 4QHKI 3HRZA 5I66A 5IM7B 1KEMH 3MGAA 5BXFB 4NWUH 1A6ZB 1CQKA 1OCWL 1A5FL 1YJDH 2WUBH 3IETA 3QH3A 1JUFB 5EU6A 1T7WA 1F11A 3IRPX 2ERJC 2F5BH 2ZKHL 3CVHL 2L4OA 4WU7B 4H1LH 3KLHC 5I1GH 3QRFM 2FO1A 1G9MC 4U6XA 4TUKL 5C6WH 5L7XL 1TVBB 4M8QA 2WINB 2FIRT 1DCLA 3P4MA 1NUDA 3HZVA 1U3ZA 2BNRB 5C0AD 3L3GB 4OIIH 3S7GA 1I7RB 5EU3A 4NHUB 4PBWD 2O5XH 3C8KA 5AD0B 1SM3L 3QISA 4YR6A 2F53E 5GZND 2GJZA 5IESL 1B6UA 3CAFA 1FAIH 3RIFF 2P5ED 4Z8FH 1ZLVH 3TIEB 2P46B 1FZJB 1WAAA 4BA8A 3P4NB 4S1QH 3AS2A 2PCPB 2FB4L 3NH7L 1UM5H 4G8EA 4HQQH 1BJ1J 3HUJB 4W68A 3MRLB 5JMOC 3TM6A 5IHUL 5HI4D 3F7QA 4FFVC 4ZNEE 3O2VL 4Z7VF 5HDLA 4ZUSA 4ODXA 2A74B 4M6MH 4PJXE 4V1DA 2HTKC 2UYLA 3F7YA 1JGDA 2NY0D 1DJSA 5AYUL 1KT2B 4TPRL 3BIBX 5DK0B 1HCVA 3EJYC 1MAML 4Y0GA 3RVWC 3IJSA 3UYPA 1JCKA 4Q74A 2AI0H 1L0QA 2M2DA 2NTSP 3T0ED 2X9XA 2PO6B 4IRSC 4ZYKB 5D1ZB 4M7KH 2IAMA 1LEKA 1CTOA 4E41A 5IEHA 1E27A 1B0GA 4ZDHB 3DGGA 1NMCC 3FONB 3TBTA 3EOAB 4U7SA 2XWJB 3D1MC 3Q6GH 3DNKA 1FN4A 2OMBA 1FFPA 4UAOC 1MHEA 3IDXL 1HYSD 4OM1L 3VRLE 3NCMA 1JPTH 2R56H 3CZFB 4KRPD 5HHVL 1V7ML 4PJEF 3PQYD 1FIEA 5L88H 4YPJA 3HMXL 4XX1E 2QQKH 1MI5E 1WIUA 3KPPB 2GAZA 1F3JB 2ZUUA 4NO3B 2QQQA 3FT2A 5DQ9A 4N1CA 1BBJA 1IEBB 3MOQA 4WFGD 4LU5H 4XNQB 1I3RA 2LFGA 3D39D 1EEYA 1LK3H 1NDMB 2VDQH 5GZNC 2C1PB 4GBXB 5CSGA 2BOBB 4C59B 1K6QH 4JFFD 5KTEH 4TQEL 5CIPA 1KYOJ 2HH0L 4PD4K 4C83A 5FO7A 1J5OL 1WQVT 3SKNA 5HGGS 1RZGA 2YUXA 5HI4C 5I71C 5FO8A 1FVCB 1G7LA 2EDTA 1YEHL 5CEZL 4EI5D 3C08H 5IG7B 4O2CA 3W9DB 3BW9A 1BLNA 3C9NB 1FFQA 2NY0C 2FO4B 1XZ0A 4MAYB 2XXMB 3VXRA 3T0VA 3G04B 2B2XH 2R2HB 4RSVA 2BOCA 3DVFA 3ZTJH 2CXGA 1NFDE 4WWKB 3T0EC 1IZKA 5I6XB 5D1QD 4KI5F 4JJ5A 4Y19A 3OMZA 1GAFH 4OTXH 1NMBH 1RAMA 1LO0H 2P8LB 3QWOB 4WU5A 5DJAB 3MLRL 4MAUL 1RZKC 4UZGA 4ODSL 1GL4B 2PXYD 1P2CA 5DF0A 5JR1L 4NN7C 2W0LA 4QCIA 4YXLH 1HYSC 1WSST 1MH5B 1DR9A 1YEFL 3BQUA 5KTEL 2G60H 4PUBH 3SQOH 2F19L 4KRPC 1QPPA 1XFPA 4OZIB 4WCYH 3V0WL 3BXNA 4HFUH 4TSCL 2C4FU 1RFDL 4N8VB 2O5ZL 1ITCA 4ODWB 3QQ9D 1ZWIA 4UDUB 2JE8A 3UZQA 3O9WA 5JA8B 3ZKXB 1IJ9A 4APQC 5JQHC 5HVHB 3U4BH 1UENA 1PKQB 4IIQB 4XB8A 5C0AE 3HI6H 2GTZB 4F9LA 1XGRA 3L6FA 4KY1L 5JW3H 5ID1A 4QRSA 3KHQA 1DL7H 3PUCA 2P5EE 2IH1A 1NMBL 4ONHA 5E08H 3ZHKA 5JORA 2FDBP 1FNGA 4L8BB 1EO7A 2ICEB 1MCLA 3FJTA 3VXUE 5GSRB 4Y2DB 5MEND 4EI5C 1SEBB 3VG9C 3WFBH 1WBXB 4X7SL 1LK2B 4OT1H 3RJQB 3MFFB 4AQOA 2JJSC 2F5AL 4HCRH 4MD4A 3ZKMD 1V3MA 4OFDA 3MLSH 4XGZA 4R90L 4RNRB 1NSNH 4D2NA 3Q5OA 2Z31A 3D2UB 4X99A 3VGEA 3ULSB 4KHXH 1AXIB 2DAVA 5HYJA 1S5IH 3SKJL 1ZXQA 5LBSL 2NY5C 3BAEL 4OZ4B 4AL8L 5D1QC 3JTTA 4X80H 3BZFB 3HZYA 3R1GH 4XBGB 4BZ1L 2QQNL 1I9JL 3VXSB 3T0EE 2IPKA 4M5ZH 3JZ7A 1NC4A 1YDPA 3KG5A 4XPGH 3MRPA 2MCG1 4PJGB 3GNML 2X40A 2PXYC 2Z91A 3L95A 2XN9B 4YHOH 4LSSL 4YQXH 4K7PX 5B3JE 4AEIL 1H3UA 3VFPB 2MFNA 1JGEA 4OFVA 3WN5A 1SMAA 1NQBA 4O51A 4CKVX 3VFSA 2YD3A 2RCSL 3S36H 5D7IE 4MQ7A 4BFGA 3KJ4C 1IAKA 4RGOH 1FC2D 4NUJA 1A6WL 4N8VG 4KRNA 1M6OB 1N7ML 2LABA 2J8UB 1GC1H 5DMIH 3QQ9C 3QUMA 3PQYE 1DQJA 4UT9H 5CHNA 2P1YA 2F58L 3PHQB 4KQ3H 2D0HA 4NQEA 4F9PA 3PWVA 3QG7H 3SDXA 3IDNA 1JFQL 1UQSA 1EJOH 1VGKA 5EOQH 4WFGE 1RMFL 1Z6JT 2C7UB 1P53A 3D39E 1CXLA 4YDJB 1DBAH 1LDPH 3RVTD 4JFFE 1FC1A 3QAZB 3ARGD 3V6ZB 4P3DA 5I75C 1P84K 3QIUB 5A3IC 4UI2A 2GYSA 4K9EC 4Z7OE 5LCVL 2WBJC 3C5SB 1X7QA 3MGTB 2E9IA 4IJ3C 4GKZB 2AEQH 4M3KB 3VXMD 2WMPA 4D0CB 1CDGA 3WHE1 1ZANH 1JPGB 3ZE1F 3MRKB 3QUXA 4JRXA 1RZFH 5DQDL 5DUMH 5T5NF 3PHSA 4ZS6D 1G9ML 4J6RL 3IF1B 4ZUWA 1WZKA 3HPJA 1FL3B 1TTFA 4OZFH 1AQDA 3PJSB 1RZJH 5F7DA 4JG1H 1ZS8A 3MRCA 2ZCHL 3NCYP 2HP4A 2F74A 2VC2L 4HIEB 4LKXA 1FNFA 4BKLB 1IL1B 1BQLL 5BO1L 3CMOL 1Z0MA 4Z95L 5LWYL 2C3XA 3GJFB 1MCNA 1OPGH 2FECL 3ES6B 5CZXD 1Q1JL 2HJFB 2LV4A 3WBDA 3ULVF 1UYWL 3DJ9A 1XGTB 4KK6D 2E7HA 4G3YL 1OAXL 4EDWL 4Q2ZA 3BZEA 1R3JA 5F9DC 4YC2C 2QR0A 5HBBA 5D96B 2CR3A 2RGSA 4OCLC 2QADB 4HPYL 3ULUF 4RA3A 5FYKU 2ZSWB 4X5WA 2HN7B 2AV7B 5L2KD 3T1FA 5JXEA 4LLDB 4GRLB 3WNMA 4LCUA 4MCYA 4FQXA 4QNPF 1J18A 2N56A 2DQJL 5EOTB 1QSFB 2VLRA 1G7JA 2VL5A 4RAVA 1D6EA 1GOFA 5KG9A 3TBVB 1W72H 4G9DB 5LG1A 4ALAL 2AXJA 1MCOH 1C5DB 5C2UB 4XP5H 1V3JA 4QHNB 3BEWA 1IKNC 2QSVA 2X4TB 1CT8B 2EH8L 3WMSA 1H5BC 3GSUA 3MRJA 3ARGC 4URTB 1OAYL 1JNJA 3BN3B 1PQZA 3QUYD 2AJZA 1EAPB 3FTGA 3K46A 3R06A 1DUZA 4JVWA 4QTIL 5FHAH 3VXPA 5D71L 5C09D 1CLYL 5BS0A 1DQLL 1OPGL 4LVOB 4LSUL 5MENE 1WV7T 1NAML 2W9EL 2E27L 4U6HA 3CSYA 4LCYA 4HPOL 1IBGH 3QIWB 4ZS6C 1IGYA 2CKNA 1ZHKB 2Y7QA 4PJIA 1J05A 3GKZA 4PG2A 3RWEA 5I1DA 1PX4A 2B1AL 4RFNC 1PFCA 1FYTD 5E03A 2V5MA 4GSDH 5LAXB 1KEGL 4KKBD 4O4YH 1CLOL 4PG9A 1GZQA 1FL5B 1MIML 1BZ9A 2KL6A 1X44A 3VI3F 2J5LB 5CZXC 3RWDB 3OR7A 5F1NA 2FGZA 2C4XA 3UYRL 5BVJB 3SGJC 3I02A 2YD7A 4C54A 2R8SH 4JZOA 3GIZL 1YC8A 43CAB 3HPLA 5IJKA 3O6LH 5TF1L 2W60A 4TTDD 1UM6H 2OI9B 1BAFL 5B8CC 2NXZB 4X9BA 2OJZL 4DN4L 4M7ZC 5J1AB 4OQTH 4LHJB 5BW7C 3JBG7 3GO1L 3MV9A 4PYHA 3ISWA 2DB8A 1IC4L 2X89D 4LPWA 2Z93B 3MRFA 2BY1A 1IVLA 3O2DL 1HIML 5IR1B 2OK0L 3O6ML 3FMGH 3C60B 4P2QD 4OGXL 1YN6B 1GSMA 2EDWA 1IQWL 4K7PY 1OGTA 4R8WL 4JM2F 1RZKL 3CDYA 4HLZG 3HZMA 4JLRB 5D5ME 4G43A 4JDVA 4RAUA 4R26L 4IOFD 1GPOH 2R4SL 4K8RC 2R1XA 4M93C 3KLDA 2EZ0D 3VMOA 1PEWA 3GBNH 2CRZA 3QUYC 3JVGA 4FQIH 3SDCA 3DARA 3F58L 1RHHB 1E4KC 4NRZA 3C6LD 3VE0B 5JOFB 4PLJD 3TPUB 3VXME 4H25B 5IFJA 1T1WA 4M03A 4Z7NF 2OL3L 4X5LA 3CK0H 4NQVB 5SX4I 4G8IA 3WHE0 1B4RA 1OAKH 4KH2A 4P5TC 4X8JA 3HRPA 4PJCE 4E42A 4PGCA 2DWDA 3TJEL 4YDKH 4PJHE 4KKBC 2KZ1B 4XNXH 4XMPL 1OLZA 3LSOA 1VA9A 1BX2B 3ARBC 3L3JA 4OLVL 1KJ2L 2X4UB 1CBVH 4BFEA 2H9GB 4YK4C 2K1MA 3W81A 1CR9L 4I4WB 5ESAB 5BXFA 4HJGB 1A6ZA 1NLDH 4JKKA 1JUFA 4AENA 1JHKL 1MF2L 4P46A 5CCKL 1GGIH 3DSFL 4TTDC 5MP6H 1JPSL 3EDDA 1RZ7H 1AJ7H 4WU7A 5IEKB 3RGVD 4ZFFB 1XR9B 4W6WB 4PRDB 3MV11 1TVBA 1OAZH 1BJ8A 2WINA 4J2XA 2NY5L 3L3GA 1I7RA 5L2KE 2MCPH 3HB3C 4NHUA 3WXVH 1KG0B 2I5YH 1ZLVK 5I8OH 4IRZL 1AQKH 1U8IB 4PRHB 2JCCF 4LLYB 4B5EA 1LEGB 3RWHA 3TIEA 3T1WA 5KOVC 3BRFA 2NY7H 2WWKO 4IOFC 1U58B 1R5IB 5MERA 1M7IB 4X6BB 2EZ0C 5DWUH 3HUJA 3MRLA 4HS8H 4OF3A 4CJ1A 5E4IA 4G8GD 3LN4B 1OVZA 5FUCC 3FFDB 3ARUA 3OKKB 3NAAL 2A74A 3ILPA 5AZ2L 5LQBL 3C6LC 5BRZD 1HH6B 3OG6B 3ARDD 2ZZUT 4PLJC 5C09E 4OV6F 5JDSB 1NGZB 5F9WC 4F80A 3D69A 1H15A 4ZAKB 2KQNA 3QHFL 4I5BB 3LKSB 2V9QA 4TNWK 2VDMH 3MLXH 3UTZB 2PO6A 1J1XL 2DQTL 4ZYKA 1E28A 5D1ZA 3VWJD 5IV2A 4Y5YA 1WZ1L 4P2OD 4UTBH 3IDYC 1OAZL 4ZDHA 4QOKB 3E8UH 1FORL 2NY4B 4JANA 3FONA 3EOAA 1IAII 2PKDA 1FYTE 3CFEB 2ZJSL 4OCSL 5E8DH 2B4CH 1MCQA 5GGUB 5ITFB 1W8NA 2VXUL 3CFKB 4EOWL 1KENH 2HLAB 4PJFB 4L9LB 1OM3L 2HVJB 3UROR 5I8CA 5J6GA 4NM4H 4XBPA 2RB8A 2BSED 5FEBA 4K9EL 1HKLH 3MPCA 1S9XB 1A1MB 3CZFA 4P2CG 3VGBA 1YMMB 3RGVC 2HFGL 3ROOA 5IUSA 3RTQB 1F3JA 2X9YA 4MB3A 1JRHL 4NO3A 3WJLA 2EDQA 3ESUF 1XF5B 1LE5B 3OB8A 1FJ1B 2P24A 4ODTL 4QRPB 1BQHG 2IH3B 2DQCL 5JIIA 2NMSA 4U05A 2VDKL 4XNQA 3UTSD 1OL0A 4DVRH 4FNLH 2C1PA 4GBXA 3ME0A 2BOBA 1MFBL 4POUB 1QBAA 2CDEB 3MLTA 3GRWH 4HZLB 5E0QA 5E94B 3V8CA 3BH9B 4P99A 3FL7A 4NCC1 6FABH 5CD3B 3MMEB 5IOPB 3MUGB 1TJHL 3WUWG 4J1UB 5JNYB 4CMHC 2CRIA 3PDOB 4XC3H 1FCCA 1KFAH 2BRQA 1AFVH 4LAQL 2VH5H 4Y1AD 3ARDC 3W9DA 5FUCE 4YWGL 2WWMC 2FO4A 4FMKA 5AWNL 2PW1B 1FH5H 4MAYA 3G04A 2R2HA 2DM7A 1FGVH 4WWKA 4AEFA 1IKFL 1UG9A 1NPUA 4WUUB 1MJ7H 4P2OC 4DEPC 2X42A 4FFWD 5D72H 5DJAA 5GIRB 4JO2L 3DTXB 1MHCB 1QSVA 4HWEH 4QHLB 3FQXB 4DGIL 4N0CD 4ZD3H 3HLAB 1MH5A 4UT6L 1DQMH 3W2DH 1AKJD 4DKAA 2G9HB 5HHPB 4XB7A 1JV5B 4OZIA 5JHLH 1GGCH 4WW1B 4TUOA 2R0KH 3QFDB 3ZE2F 1S7UB 2CKBA 4N8VA 3QG6B 4MA1B 1QSED 5KS9F 1EEUA 1TITA 4UDUA 4LSPH 4MA7L 4HG4J 3ZSSA 1F4XH 3FO2B 2Q3ZA 3LS5L 3HCVB 4JFZH 1PKQA 4EVNB 2GTZA 3PV7A 2DQUH 3SE4A 1L7TL 2IFFH 1FGVL 4JM4H 5HPOA 2VQ1B 1PD6A 5I8EB 1YYMH 3SO3C 2NY3D