5F9AC

Blood group antigen binding adhesin baba of helicobacter pylori strain p436 in complex with blood group h lewis b hexasaccharide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
molecule tags Cell adhesion
source organism Helicobacter pylori
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f9aC00
3OG6B 3ARFC 3TN0D 2FZ3A 4OCSH 4MJ6B 2CO6B 3V4VH 5B8CC 1EHAA 2EXYC 3CSYB 2RIKA 4MGXA 4JQIL 2H26A 1ZWIB 4GBXB 2CK0H 4YK4C 3MLPA 4LARL 4WFFE 4G80B 5E99L 4P23A 4BZYA 2HLFD 4F7MA 1ZLSL 5IB2B 4Q9CA 1AD0A 2WANA 5J1SC 4XHQA 5CLTA 5ITFA 1GAFL 1N3NA 4MAUH 3PP4H 3QULA 4QXTA 3TBWA 5JXAH 5FKPB 5C07D 1MRCL 2Z93B 2J4WL 5SWSB 5C2BH 3O9WA 3FO2B 3DOSA 1WBYA 5BCAA 1NGWB 1M71B 2MQ3A 3G08B 4HKZB 1QP1A 4NT6A 1H15B 1L7IL 1KJMB 1NDMA 5T33L 4TVPL 4UB0H 1PD6A 5KSAA 4O9HL 3TBTB 1AGCA 5IWLA 4JQVC 4WHYG 2HJLA 2F58H 4QRRB 3RNQA 1ZA6B 4LSPL 4RFNC 2EYRB 3MGAA 3GO1H 3UTTD 5CEYA 1MOEA 3WS6A 3RY6A 1MUJB 1SM3H 3RTQB 2NXZD 1T5XA 2H1PL 3DI3B 5C08E 1FNGA 3TBTA 5HYQB 3PXHA 4RBPH 1EEQA 3RVTD 1HHHA 3KPQB 4Z0BL 5HHOD 2G5RA 1WIOA 2EYRA 4PLJD 4YX2L 1S78D 1MHHA 5FKAA 3PWUA 4LCUB 4IDJL 2P49B 5GZNC 3OR7B 1YY8B 4B7IA 1EH9A 4C4KO 4RZCA 3STZB 1NMAL 1ZHNB 3V7AG 2F5AL 4XVTL 4D8PA 4HUNB 1FYHB 4TRPH 3GGWA 5C0CB 2WIIB 4JY5H 4RGMC 4TNWK 1RJCA 5JDSA 5DJXB 5KS9B 5DGRA 3VXSA 3MV9D 4TSAH 1QACA 2X41A 3FFDA 1FYTA 3AS2A 5B39A 5I15L 5GJSL 4E41A 4YPGA 3UZVB 5KVFL 4PJFE 4F9PA 1HDMB 2OZ4A 3MGOA 1J0YA 1J1XH 4OLUL 2JJTA 3TF7C 2K9UA 1JPSL 4MNQA 1S9VA 4ODVH 2A73A 3T08A 3O6ML 2QADB 1JHKL 2PTTB 4LLQB 1IKFL 4JRYA 4L3EE 2X1XR 3LV3B 2BXZA 3QUXC 3SE4A 2JCCF 2E7LA 4ELKA 1KPVB 2IEPA 1YYML 4EUPH 1T03H 4MAYC 1MIML 2HTLD 1MCLA 4PJIE 3VWKC 3UBXB 2O5XH 3MOBH 4FXKA 5GS3A 5I8OL 4NN7B 1JRHL 1ND0B 4MA1B 4NN7C 4BQ8A 5A1AA 2VQUA 1H8SA 1UM4L 4HWNA 5DMGC 4N9GB 3BUYB 4O2FA 1GOFA 4C56D 3BOVA 4I3RL 4QOKB 4PJDF 1U3HC 4XAKE 4JJ5B 2HFTA 5ADOL 5L88H 5SWZB 1BQHA 3EO1A 1KTDA 5IB5B 4EVNB 3T0DA 5E8OB 5T1MB 5EULV 1T7WA 2NXYC 1IJ9A 3MCLL 2A0LC 4ZUVA 1T2JA 4YR6B 3JV5A 1BD2A 3U46A 4HWBH 1KFAH 1KEGH 5E5MA 3VGEA 2L7JA 1YMME 2BVUA 1JPFA 5E95B 2VXTH 5DR5H 3PHQB 4K3DL 4PBWD 5JHLH 5IFHH 3EOBA 2YD3A 3OX8B 3H42L 5TGBA 1MHHB 3UJTH 1DQDL 1PKQE 4RGND 2I9TB 1XIWC 3O4LE 3WIFA 5F1KC 2BRQA 5DLMH 3DGGB 4RFOL 5B4MD 4IBLT 5HYJA 1FYTD 3T0AA 1ACYL 4XNXH 2PW1B 3VXSD 5CD5C 5CEZE 1CVRA 1JP5A 5CZVH 3SGJA 1FVCB 5L0QC 4E42A 1LGVA 4TNVK 4AT6A 1T1WA 2P8PA 3NAAL 3IGAA 5HPOA 2HRLA 3DSNA 1DFBH 2PW1A 1BGXL 2X05A 1DBML 2H9GA 5IQ7L 1P7QB 1JZ6A 1ZGLA 4I9WE 5HHPB 5D5MF 2UY6A 1VESA 2APVA 4NO3A 3MV8D 2FYYB 2ZOKA 2DWDA 3VWJD 4I18B 3L5WB 1P4LB 4H1LG 2ICWB 3JVGC 4NO0B 5A2IH 3OX8A 1DBJL 3O2VL 3NCEB 1HHIB 2HTKD 5EU6B 1JZ4A 4M6AA 1AP2B 1QLRB 3D0VB 1LP9E 1CXHA 2BNRB 5FYLE 4LRIC 5DZOA 5D2LE 2NW3A 3DVGB 5BXFB 2C4FT 3BWUC 3MRFA 3E8UH 3H9HB 2XWTA 2GJ6A 4OGAC 2HG5A 2ZUUA 1J1PH 1BZ7A 1J87A 1XR9B 2GHWB 2XXMB 3KJ6H 4ZOBA 4HAFA 5SX4H 3W81A 4JEGB 4MVBC 1IARB 2R1WB 4JN1L 5D7IA 1GZPA 3IETB 3QEHB 1DEDA 4LHUG 5DFWH 2Z4QB 5C8JA 1G7IB 4TN9A 4OCMC 4JY6B 5HPMA 1F00I 1YN6B 4LLUA 5DT1H 4FQXD 4EIGB 2RFXB 3BGAA 5TH2B 1GZPB 3IETA 4YWGH 4LSTL 3T4YA 3VI4F 3VRJB 1D6EA 1T83C 1M6OB 1RU9L 4RWHA 1WIPA 2B4CC 32C2A 2DM4A 5FCUH 3V52H 1LK2B 3EZ8A 4N90D 2BXYA 1RIHH 1X6NA 4NRZB 5I30H 4M6MH 4KK8D 4UT7H 3RTQD 1LE9A 5J11B 1RZ8A 4MAYB 4AEHL 4F7TA 5LQBL 4R4NC 1B2WL 2PTVA 1JGUL 5F21B 1WK0A 5LCVL 2IFFL 3AFLA 4M3KB 1C1EL 2QQLH 1M6OA 4MA3B 3GDBA 4MZ2A 4O02H 4U6HB 4JFQA 4NZUL 3SHSA 4AIOA 5B3NA 4MA1C 4J3WA 3S5LA 5I1HL 4ZO6A 2OMBA 4FG6D 4LPCA 1D5BB 1K4DB 4ZPTA 1MCDA 2NTSP 1CE6A 5D1ZB 4P2YA 4PREB 5HHXL 4ERSL 3ULSA 4YHYB 3ESVF 1KTLB 4XVUD 4XCFH 3SDAD 5MEPA 3OL2A 4BJLA 5LGJA 3WUWB 3MXVL 3GM8A 4CVXA 1INEH 4QYOA 2JJWA 5E70A 2Q1EA 3VJ6A 3TJEL 1FRGH 4Y4FA 3MRNB 3ULVH 1CFSA 1E4KA 4OLWH 2R1XA 1A6ZA 4HIHB 4TPRH 3ZTNH 5TGBB 3WIIH 3RIFF 1G7PA 2ZKHH 3BP6A 2CMRL 3HE7A 2HT3D 4UILL 4JZNA 4Y5VA 2BVOA 2FNBA 1DUYB 1U8NB 2BNRA 4PTTA 1RQ5A 4F9LA 5C9KA 4XWOD 3U7YH 4NZTH 4QHLB 1NEZB 2EH7H 2PO6A 3TBVA 1OAQL 2VXVL 1JGDB 4HPOH 2D7TL 4GBXD 5D7SH 5DMJB 2EH8L 1ES0B 2VAJA 1JL8A 3QDGE 2R8SL 1HHKB 1MCPH 4RDQG 1WZKA 1U8JB 3H3PH 4OM1L 5KSUB 3O0RL 4HBQA 3MOAL 4HLZG 1P7HL 5BZWA 1LEGB 1YNTB 3RAJH 4DGYL 3QEUA 3TH4T 4ONOA 3F62A 5DI8A 4O58L 3FB7A 2GCYB 2AK4E 1QG3A 3FAWA 4ERSH 3V4PL 3A67L 4WIQA 4L4TE 4LAQH 5GGQL 3S3PA 1GIGH 3F7YB 4I0CC 5I30L 1MVUA 4RCAA 4S2SB 4ZYKB 3NACH 4YDJA 1IEAB 4NQXA 2FB4H 4QOKE 4KKBD 2ADGB 3VFMA 4OGYH 2IH1B 2R39A 4U1GC 4I0PD 3G5YB 5DUPH 1J05B 1MLCA 3O3UN 1VFMA 3WIHH 3ARDC 4JB9H 4Q9RH 1FVDB 2VOTA 3HUJE 4XT1C 2JTDA 4LVOC 1A9BA 2BCKA 3FMGH 1WWAX 2XN9D 4M48L 5T3XE 3TO4B 1HHIA 2ZG2A 3KJ4C 4ZS6C 3X3FH 5I1JL 2W59A 1DBKL 4HAGA 5ISZB 4EXPX 5LQBH 3RWEB 2GQHA 4CU6A 4O5LL 1INDH 1KIPB 4KVNL 4AK1A 1EHNA 1ZHBB 1NGZA 2CLRA 4BQ9A 4Q9QH 3K1DA 3GBML 3ECBA 4LIQE 1XGYH 3DRQA 5AAMA 1TIUA 1BZ9B 4M7KH 2A38A 1MCIA 5DJYB 5FM5M 4RAVB 4PJ5E 5I1DA 2DQJH 2O5YL 3DUSA 1DBJH 3LN9A 1KCSL 3T65B 1FNHA 4ZUSA 3AS0A 4YWGL 3D2UB 4MSWB 4TUOA 3S35L 4MS8D 2PKDA 1G7QB 2Y7QA 2I25N 3ARFB 1P2CA 1IGFH 4K2UL 1CFQA 1MJJB 4LF3B 5GGVL 1OGAE 1BAFH 2NY6C 5BZDA 1M7IB 2GK0A 5JMRA 3RZCD 3GJEA 1GZQA 2CKBH 2OR9L 1QA9B 1EEYB 3WNNA 2CO7B 2I24N 1A47A 5EIIB 2L7UA 4JRXD 3MJ6A 1OTSD 4G7YL 2VDKH 2IPUK 4OLVL 4ELMF 5AG9A 3CZFA 4KJQD 1UACH 1I7ZA 3LSOA 3S6CA 4RMTA 4OLZH 5C71A 3VD7A 3QXAA 4PJ5A 2VLKD 3I50H 3LQAC 1F6AB 1DUZA 1CE1L 5HYIA 2ESVA 5GS2D 3X17A 1FNEA 5GGVH 4OLYL 1H5BC 1T0MA 4QWWD 4GS7B 2Y06H 5MHSE 1Q9OA 1QRNE 2XG4A 2ITDA 2RCSH 3ALXA 4P23B 4ZNEE 4G6FD 2A6DB 3IFPA 3U4BH 2ICEB 1FVCA 3MCLH 5F9JA 1OAZL 2N56A 2A6KB 2XOTA 2IPUG 1V3LA 2ZSWB 4NZRH 1NBZA 5F8QC 3B9EA 3GBMH 1WAAA 1RJYB 4P2OC 2AXGB 3UTSD 4I4WB 5EZIH 5H94B 2XRAH 1UM4H 3NH7H 2EO9A 4ZNEA 2UY7A 3IF1A 3BZFA 3EYSL 2I60H 5IB1B 3MNZB 4KHXH 4J3TA 5DQ9A 2AERT 5HVFB 3ULVF 4ZUTA 5ADPL 2GITB 3VDAA 4HUUA 2NY6D 5DJXA 1MFAH 4NKMB 2YMXL 4X6DF 3X3GL 2QEJA 1WWCA 5FM8A 2BSRA 2VN4A 4QTHB 2O5XL 3MGTA 2VLME 4MDJB 1HSAB 4ZD3L 2W92A 5HHQA 3U30C 4LEXH 4F57H 1DQML 3W5NA 4ZTOL 5FYJU 1SY6H 3SJVA 1TTGA 2IBGA 3WSQL 4BZ2L 4D0CA 1FORL 1N6QH 2NLJA 3G5VB 4DGIH 3O81A 1A64A 2X7LB 5LGHL 1M4KA 1MSPA 5HDBE 3GMOB 5B3JE 5FGCB 4GBXA 4NKOB 3GM0A 5D70L 1BFOB 4ELMA 5FXCH 1I1YB 2FZ3B 4FFYH 2BNQA 1KSRA 3E6HA 1N59A 4DGYH 5BRZA 2XICA 1NAMA 3MTRA 1HEZB 2XN9B 5IKCB 1OD7A 3WHE0 4IDJH 4JFZL 4L5FL 1RUQL 2DQIL 5CUSH 3CVIL 3ARDD 1KPRB 4CGTA 1ZT1A 4HPOL 5D7SL 4PGEA 3HC0A 1TZHB 1M71A 3QEQB 4YDKL 4Y8AA 3ZDYF 1XGTA 4LLWB 2G75B 5D1ZC 5FYJH 3CFBB 3BDXA 5T1LB 4Z77B 1ZHBA 1CDJA 1FFRA 4AL8L 3TJHC 4NUJB 3I2CL 4G9FD 3HAEG 1T20B 4S11A 4XX1G 1LO0H 5T1KB 1JYXA 3VRLF 1YNKL 3VRLE 5FYLL 2DMKA 1XGTB 3OKKB 2DLIA 5BW7A 5D4QA 2CDGA 3C5ZC 1U8IA 4JPWL 4U31A 1A8JH 3O45A 5BRZB 4HC1A 3VA2C 3ISWA 1TQBB 1ZSDA 4ZTPH 1HQRB 3KWWA 4I18A 4NFBA 4GQ9H 5CFHA 5IVXF 3U7WL 1BIHA 4NHUA 4D0BA 3MV01 4PJAF 1P4BL 1B3JA 5CP7A 1T5XB 4YAQA 2Q7YB 1KCLA 3CAFA 2W9LA 4G6AD 1Q0XH 4NKMA 4ORZC 5MERB 5E1AB 3HNTL 5E2WH 1I9RH 5LJYH 2NY3B 3GMLB 1JHLL 3PWPB 4LLVA 1H3VA 3AB0C 2YC1A 1RZJH 3DHJA 5I1GL 3FB6B 4GG6F 3UTTA 4P0DA 3C09C 3L3KA 4BA8A 1RUKL 2A6KA 1DLFH 2DI8A 2LV4A 3QT2A 2I5YH 3L1OH 5DEGA 4UBDC 3GMLA 1A7PL 1T1ZB 3PGCA 3O6LL 2R1YB 1SVZA 4PJ8C 3V52L 3VXME 4JJHA 4PJ8B 4HUMB 1NC2A 3QDMD 2P45B 3HZKA 1T3FB 4G9FB 2KZWA 1N4XL 1KJ2B 5FV2A 4P2QB 4NHUB 4D0BB 2J8HA 4UUJB 5TDOA 2YD4A 1ULVA 4LKXA 5FDYA 3WFDL 2A6DA 3IFPB 3MUHL 2PO6C 2DLFL 1QSED 3ARRA 3FQRB 3C60A 5GRZA 4HIXL 5J1TC 3MLXL 1HHHB 3KPQA 5GGTA 1FGNL 1KJ2A 3WL9A 3HZMB 3LKPA 3OAZH 3W2DL 4UIMA 3CDFA 3NCBB 4TNWF 1QD0A 1PBYA 5CILH 4ZFOB 3BZEB 2Z91B 1GGBL 6FABL 3GZKA 3BT2L 4UV4L 3DUHA 2YKLL 3LKQA 1J86A 1CIUA 2FX7H 4ALAH 3CU7A 1TPXC 2V7HB 3SGJC 3QRGH 3FOMA 2NX5D 4S1QH 3HNVL 4LDLB 4DGIL 8CGTA 1FL3A 1FV1A 2ED7A 1P7KA 4L8DA 4NQUA 4YC2C 3ZDXE 4Z7VA 1D6VH 4YLQT 1EEUA 1ZGLP 4L1DA 4HJJH 2DTMH 1UYWH 4G9FA 4OQTH 2VDPL 4MQTB 1JN6A 1CDYA 5IB3A 2XNAA 1NAMH 3MYJB 4JRYB 2Z93A 5B8CA 3GJFA 4PD4K 5EOTB 1EFQA 3E6HB 1R5VA 5CBEB 3VD4A 5F96H 1AJ7L 3O11B 2JB5H 4UQ3B 5GS1A 1YDPA 2IALA 4NUGL 5IFAL 2IMMA 4NC1E 5IW6A 5IIEB 1T1XA 4EI6B 4HEME 1HH6A 5EUOF 2R69H 4BSWA 4OZ4A 4LFHD 2QLVB 3EOYG 3CFEA 1UVQB 3ARFA 4PJAE 2CLZB 5HDQL 32C2B 1E27B 5GGSB 4LBEA 1CR9H 3CFCL 4EI5A 4XPAL 4J12A 2IAMC 2X42A 1CXKA 4Y4HC 2ADFL 2F8XC 5C0IB 1IT9L 4JGMA 1NGXA 2P5EA 4HWBL 4J3VA 1JNHA 1G1CA 2R0KH 2KDGA 2DQDH 5AWNH 3O3BA 5DWUH 2FJFA 1X4ZA 1UVQA 3MRMA 3SPVA 1A14L 4D9QE 1QSFA 1FH5H 5ADOH 2X9XA 2EICA 4XP6L 4ZQKA 4ZSOA 4CVWA 3VFMB 2WZPD 5CD5D 1AJ7H 4QRPB 4X0KA 1IGYB 3QXUA 2FEEI 3UZQA 4P5TB 5KW9H 1XIWD 4F2MA 5F9JB 3H7LA 5I8EB 2Y4SA 4KKLD 4ONHA 5IT2H 1A1MB 4OZFG 1JPTH 4ZSOE 1ONQB 4XNYH 4XPGL 5TE4H 1P7QA 4K2UH 3PUCA 4JZNB 4GMTH 1GL4B 5JW4M 4ISVA 5C3LD 3M45A 2YKLH 2A0LD 3VFRB 3UROR 3ULVC 4LLVB 5D7JA 1U93B 1XFPA 3AAZB 3OMZA 4S0SD 5SWZD 3SDAB 1HYSD 2JLLA 1DQJA 2FDBP 5BO1L 3TIDA 5JLZB 1UJ3A 1QLEH 1BZ7B 5IVXA 1A0QL 1ERNA 1OQXA 2V9QA 3R1GH 4HJGA 4KMLB 5IB4A 4F7CB 3VWKD 5B38B 4MAYD 2P8MA 1JGEA 4ORGA 1TNNA 1IRAY 1UB6A 4KMQA 4TSBL 2QSTA 4KQ3H 4JM4H 3QUXD 3V6OA 2VMFA 3HNSL 4WV1A 5FF6B 4DTGH 1UWXK 4NP4L 4FFZH 4L8CA 4YC2B 4P9HL 1JGLH 4PJDB 5JOPE 2ZPKL 2ATPA 5I76B 5E8EA 5J6GB 1VFOA 1U42A 3F12A 4P2QE 3MODL 1N64L 2J88L 1YPZB 3P4LA 4NNPL 4HUWA 1G9NH 3GUTA 1MAKA 1MFBL 3NPSB 4X5WB 2H45A 3REWB 3IKKA 4U1IB 1TETH 4X4YA 2HKHL 4P9ML 4UDUA 3IAPA 5FYKE 3WHXA 3JZ7A 5FO8B 4E0RA 2Y1VA 1WWBX 2VH5H 4KWUA 3HI5L 4YDLC 4TQEH 5HYJD 4P23D 3HR5A 3SOBH 4KI1A 1O0VA 4HFWB 2X89D 1QA9A 1W72L 4KK9C 4N0UE 1U8PA 3FQTB 5C0NC 1U3HA 4U33A 5C2BL 4FXGB 2HVKB 4R9HA 1XCQA 5D1ZA 4K7FB 4W81A 5D6DA 3TT1H 5GGSY 1CD0A 5I8EA 1GGIL 1PLGH 2VR9A 5IOPB 3QZWA 3NACL 4UBDD 4M03A 2FBJL 4GAYB 1KCRH 2HRPH 3OKKA 1KIRA 2BY0A 3RVTC 3S37H 4C54A 4WHTB 4Z7OE 3ZT5A 1KT2A 3PL6D 4LAJH 4LAQL 3D9AH 2EH7L 1I4FA 5AYUH 3PWPD 3MJ9H 3MLUL 4O58H 4L8SA 3TA3B 5J4MA 1I7UA 3GSWA 4G6AC 1QSFB 4PJGB 3JWNC 3QPXL 2CDEA 4KU1A 5JPNB 3BKCL 3LMJL 5F6HI 3OKDA 3WV0A 4JY6A 4NIKB 1C16B 2X4RB 2EH8H 3SDYH 4P57A 2ZUQC 3BDBA 5HI3C 3O8XA 4BFBD 3D3VD 2I07A 2CUIA 4G7VL 3VFSA 5K9KA 3BJ91 4HJGB 5IB4B 3C5ZD 3QQ4A 1S7UA 3SOBL 1QFOA 2R2BB 4Q6IA 3WIIL 1EUTA 3NIGE 4QNPE 3WNKA 3PP3K 4O02L 3D0VA 5DDHB 1T7ZA 4BZ2H 4P9MH 1CU4L 4N68A 1S7UB 3TT1L 5D1ZD 3LKNB 4QKXB 2XWTB 3WNMA 1MQKL 4BZ1L 3VG9C 5I17B 3KYAA 3KYKL 2X4QA 1MVUB 4S2SA 3RGVA 5HHQB 4LL9A 4P9HC 4R7DA 4NO3B 1QLRA 2HFFA 3BRDA 2NY4B 4U0QB 2XKUA 4Z7UF 3RDTA 3JBG7 2ICES 3C6SA 3MV7A 2X70B 2DQFA 2OXHA 3S36H 2APFA 4UAOC 3JWDH 2AVGA 5DI8B 5LCVH 1FFNA 4IOSD 4JQXA 5ICYB 1HE7A 3T4AA 5IV2A 2P5WB 4HUXA 4L3CB 5EUKA 1A2YB 4M6ML 4PJXE 3SDCA 4H25B 4NQCD 1WISA 4Y4HA 5GSVA 5FHAL 4NZRL 5BVPL 1ITBB 4OTXH 1CFNA 1CFSB 4H88H 3IDNB 1MI5D 2XPGB 4HG4K 1DQQB 2UVFA 1RZGB 3CSYA 5EOCL 4HF5L 4Y4KC 1G7PB 1LK2A 5C08D 3LIZL 3IDYC 4L4VB 3KWWB 3QIBB 1VPOH 2ERJB 2AEWA 2UWEA 2EYTA 3FFCD 4FHBD 2X1PA 1ES0A 3O6KL 2GTWA 4OGXH 3K8LA 4BK4A 5DTFB 3ROLA 3RY4A 5IT2L 4U49A 3ZE1F 1KCVH 3KJ6L 1T1YA 3QP3A 4NQVA 3QISA 1VFAB 1DBMH 4FABH 3MV7E 3KS0J 1YPZA 4KRPC 2OCFD 3WO3B 3TCLA 5GGRB 1ZMYA 4Y4HB 5GSVB 4P2OD 1PZ5A 3UP1A 3BD5A 4MNGE 5EPMB 4M8QA 2CKBL 3N85L 3NFNA 3T0BA 3WO4C 4OZIF 3GHEL 2B5IB 2AJXH 4QYOB 3X14A 1JPTL 5DD6A 4M02A 4ODTH 2KZ1B 3VWKB 3QNXA 4G6FB 4P3DB 3VFOB 1RIUH 2BVQB 3O3DA 4PFEA 2DL2A 2NY7L 3EJZC 1RVFL 1AQKL 1ADQA 5K93A 3I75A 1P5VA 4K3EL 4FXGA 4PRPD 5C0RL 2J8UA 5KVDH 3U9UB 2Y36H 2HFFB 4YGAB 1NC4A 3FQNB 4MJIA 4XHJD 5DZLA 5CMAB 1IGCL 4JVWA 1U8IB 4OF8A 4JREB 4NQTA 1P1ZA 3C09B 3MO1B 3U0TA 2DTSA 4WU7A 3RWDA 1AR2A 1Q1JH 1ROWA 3BEWA 2R69L 4PRAB 1NDGB 2C1OB 5K9JH 2JIXA 2W91A 5SWSD 1I8IA 2HH0H 1SEQH 4XP1H 5EOQH 5I0ZA 4MD0A 4S1DC 3RZCC 3AC0A 1KXTB 3UTQA 4LCYA 5JIHA 3OSKA 1N7MH 3MJ7B 4QRRA 3LN5B 2VABB 4KV5E 3RDTC 3IVKB 4ZUWB 4UIKH 2V9RA 4MS8C 4IJ3B 2BSTA 3D69B 3N1FC 3QBTB 1FSKB 3T0ED 3O4OC 4JQXC 3OF6A 2ZUTA 1IEHA 3MRQA 3QUMA 5I16B 3VMPA 5LKNA 3IAQA 4XBEH 2YR3A 1U8HA 4WFED 4GRLC 4MD0B 4HGWA 4BUGA 3CVHL 4OF5A 1IEAA 3O6MH 3OPZH 2P46B 4XNUH 5J3HC 2FEDD 4PRAA 5F88B 4F33B 5DUMH 3CU1A 1JTPA 3I6GB 1DLHA 2WUBL 4IMKC 1NAKL 5CWSB 3G5VA 4BELD 1N5AB 2V17H 4FXKB 4M6NL 2A9MH 3MRHB 5ICZA 5C86A 1F3DJ 3PV6A 4ZS6D 5F88A 4K8RD 4UIMB 3LMJH 1WZMA 4J4PD 4QXTB 2DF3A 3IFNH 3TT3L 3F8UB 1PKQA 3VXMB 3UCRA 3FO2A 4NSKA 1EGJH 1G7LB 3MRQB 4X80L 1MIEL 5GHWH 3EFFB 5BS0D 4KUZL 3TH3T 4N8PA 1PX4A 4G43A 3H3BC 5CP7B 5DHVH 1MF2H 3OXRB 4KKBC 1BOYA 4UINL 1HKFA 1ZWIA 5JQ6H 1FO0A 4RISH 1PG7H 1GZQB 4HS3A 1I8LA 2OX5A 3FO1B 1V05A 1A1NB 2R0LL 3GJFB 5EOTA 3H7BA 4LF3A 3FCTB 2WLYA 3VFGL 1T89C 3GO1L 1X5KA 4Y4KB 3LS5L 4OI9A 4XCFL 3BVNB 3K3QA 4Y16C 4XPTH 3CFBA 2P1YA 1Y6NR 1BVLB 3K81A 4K8RH 2YBRB 4JZOB 5JOEA 5SWQB 2IPKA 3V79C 1P4BH 4LPXA 4D9RD 4Z7NE 5DXWA 1DLFL 1LP9A 4KRMB 2MFNA 1IEBA 2E7HA 5TE6H 2LU4A 1DBAH 1PJ9A 3LD8C 3HC3H 2HT3C 2M26A 3RUGF 4DEPC 4JRXA 1GC1L 3QHFH 1YNKH 4X99A 4IMLB 1A3RH 2LVCA 4DTGL 4F9PC 5DEFB 4NKDA 3MV8A 4K3HA 1C08B 1YECL 2ZUYA 1P9MA 5DJ0B 1F90H 1HZHH 4P2QD 5CIPB 1KUMA 2AK1H 4U6YB 5E24E 5DQJA 5JMOC 1UXWB 3FB5A 4X4ZA 3C2SA 4TYUA 3MRCA 1TQBC 2P8MB 3W0WE 3Q2CA 4R97C 1IGIL 4XVUC 1EGJA 3BE1H 1ZLWK 2X9WA 4FG6C 1ODAA 5L2KB 4N0RA 1LO0L 1WVZA 4P99A 1ZHNA 3FQUB 4Z18A 5FGCE 3FO9A 1Y0LA 1I7RA 5DMIH 3N1GC 3TGXA 5I17A 2HFEA 4F37K 3SY0A 2X4QB 4X7DC 3SO3C 1KN2L 2YXMA 3BD4A 4PJBB 5C0FA 3DX6B 4XNQB 1BJMA 1IL1B 1PW3A 5KS9A 4EN3C 3D18A 4TULH 4UTBH 1BVKB 1WJ3A 5FDWB 2HT2D 5CJOL 5C08A 1PZUB 4XTRC 3CH1B 5KSBB 4D9LH 3IDXH 4EI6A 3BSZH 1IC7L 1YZZA 3OKNB 3IVKA 4N0YL 4JAMA 5L9DL 4JPIA 1CZ8L 2P48B 4UQ3A 4YHKH 3QA3B 3PNWB 4OQTA 3BIAX 4K94H 1A02N 4FQXC 2QHLA 2GIYA 4TTDD 4NT6B 4WTXA 4ZFGL 4JHAL 1E4JA 2GY7B 4EBQL 1A7RH 1S9KC 4PIRF 4MVBD 4PP2B 3WS3A 1CDCA 5AAWA 3RPIB 1IL1A 4XNXL 4XP4H 4KJPC 1UC6A 1Z2KA 5IEKA 4PRIE 2NR6D 4K9EH 4KI5C 4ZUUA 1E6JL 3JWOC 6CGTA 1LILA 2MCPH 4X8JA 3QIWC 1DJSA 4ELKB 1WFNA 4LSQH 4ZQKB 3GMMB 4X6DE 2HTKC 5J57B 1JZ5A 3QZWB 4MWFA 2AGJH 3WXVL 1S5IL 4IM8A 2P4AB 1XF3A 1YEDB 1LO5A 1FNAA 3KHOA 4XC3H 3C8KB 1B88A 1BLNA 1JPFB 1GGTA 2MQCA 4QNPF 4JQVA 1EDQA 1UXWA 3F58H 2Y06L 4YNYA 2J6EA 4TTGA 1J12A 4Y2DC 4ZUVB 1BFVL 2KPNA 1Z0NA 1WTLA 5EZIL 3HLAA 4MQSB 1E4XI 2FCBA 4XCCH 1KTDB 5DURD 1JI1A 5T1KA 3H9SD 4HH9A 1A3LL 2P43B 4R96A 3P30L 4NQSA 4ZUUB 2CRMA 3VXTA 1RZ7H 5B4MC 1KELL 4PJBF 3FCTA 5GRUH 3OKLB 4JFPA 1IQDA 5EIVA 5D1QC 1BD2E 4N0YH 2XA8H 3CX5K 5IJVB 1IC7H 3RWHB 3BPNC 2AXFB 2UVEA 1BFTA 1NC4B 3FQNA 4MJIB 5IGXH 1YA5A 4N5UA 1KT2B 4LLUB 2Z92B 4G9DA 1R5IA 3OJ2C 1UM6L 3K74B 1P4IH 5HYQA 3BH8A 3V5HA 5B3JF 4Q0XL 4IMKA 5MERA 1AGBB 2F74B 4L8BB 3FRUA 3TESA 2WMPA 3BT2H 4UV4H 3KPOA 4PJ9A 3HKFA 4NZDA 4JAMB 3QXVA 3JSSA 2ZUSA 4K3JL 3WFHA 3B2UD 4DGVL 3KXFE 1I3UA 1NFDB 3ROOB 3U79A 5L7XL 3ELAT 1OOAA 1U3HD 2F53A 5BXFA 3B5HA 4L3EB 2OP4H 1B4JH 5DMGD 3TA3D 4Q9QL 3HZMA 1IAOA 4JFYB 4PJEF 4L3ED 2GT9A 2IQAA 2DQCH 3OJVC 3WFDH 1RIUL 1UH3A 1VPOL 4Z9KB 4ISVB 5HHME 1OSZA 1NMAH 4U1IA 3QJHB 3VFRA 4CMHB 1CLYH 2DAVA 5E94A 3OQ3B 3P77A 3FHAA 1XCTA 2WINB 4KPHH 1LK3H 5DMKA 1A4KB 3FQRA 4NJ9L 3BP4A 3L9RB 2EYSA 5CBAA 1DQLH 5E5UB 4KH2A 3P0YH 1U6AL 2VNCA 4XB8A 5DD5L 5AZEH 4LKCB 2YOCA 1I7TA 1FDLL 4LHUA 1SJHB 2F15A 2G9HB 4R7DB 1FL3B 4Z7VB 4XPHL 3NA9H 2OXGA 3O6FD 3UTZB 2XWBA 5C09A 3BYYA 3RI5K 4X7EC 2XWJA 43CAA 3C6LB 3QWRD 5HHNB 2ADIB 5FYJE 3BE1L 4OGZA 5BV7H 3IU3A 1L9MA 3OB0H 5INDA 4XRCA 1D3CA 1XGUB 4P5MA 1TZHA 3PL6B 1JZ8A 5E2JA 3SCMA 5T3ZD 3CK0H 2AQ2A 3QH3B 5EU4A 1PFCA 4KY1L 4HKJB 1T5WA 4ZO8A 4RGNE 3Q6FA 2VLRA 3GRWH 4KJYB 3QDGB 4KXZI 1EVTC 1QR1A 3ULSB 3NCMA 4MA7H 3GRWA 3QHFL 4L8SB 5D2NE 5BZWB 1BPVA 3GNML 4NHCL 1NFKA 1VKXA 1DUZB 5FGBC 4PTUB 1LEKB 3UJJH 4AIXA 1XT5A 3ZTJH 3DO7A 4PGCA 1E27A 5E99H 1OARL 1I85A 3MFFB 3U7YL 1KB5H 3UPRB 5EU5A 1HH6B 1T04B 4BSWB 5D6CA 1F97A 1BEYH 5D93B 2J12B 4JY4A 2OQJA 1ZLUK 3DX8B 2DS4A 3EJJX 2M8XA 4RSVA 3MRLB 4YDLB 3WLWD 3VXUD 4EQ3A 4WI6A 4JE4B 3IDMB 5F1NB 1N5YH 1NMBH 3BUTA 4KKNA 1VGKA 4DZ8B 4F15C 2IBBA 3MCKA 3UDWC 2CH8A 4POYA 1ZS8A 1FLRL 3GI9L 3HE7D 4LVEA 4JGJA 3HUJA 3KPNA 4KTDL 4UINH 3PWJA 3S34H 3FOLA 2DQHH 1UH2A 1UGNA 4FRWA 4WW1B 1Z9LA 1G6RH 5T1MA 4LOUD 2VIRA 1ZHKB 1XH3B 1YQ2A 4KTEL 3JTTB 3S97C 5DD3H 3D3VB 5ACZA 1ZANH 1ZV5A 3B4NA 4LEXL 1DLHB 5CWSA 3RZCB 3IFNL 1OP5K 1H3PL 4K3GA 2DQTL 2HP4A 2IANA 4J3SA 3U6RB 4UIKL 5HHXH 4WWKC 1ZHKA 3TN0C 3ARFD 4QHUB 5C6TH 1A6TA 2WBJD 1R3HB 4JDTL 3BPNB 3C5SA 3KHQA 4ETYA 2PXYB 2VLMD 1NUGA 4PB0L 3WD5H 3DJ9A 4ZAKD 3W9EA 5CEZH 3EO9L 4DW2L 5KOMC 1T7YA 3D9AL 1X5AA 3HRZA 3ALPA 5EZOH 2Q76B 4MNQD 2A9NL 1L7TH 4ZFZA 1MNUL 2FL5A 1PGRB 4AMKL 5IVXB 35C8H 1PLGL 3QDGA 4LK4A 4LEOB 3RDTB 2Y36L 5FECA 1V7NL 2LAAA 3MV11 2SEBA 1JRHI 1MCOH 1BJ1J 2DMBA 3H9SB 1I8MA 3ZDXF 4G5ZL 1UCBH 1ZA3A 2JK5B 2F9BT 1AE6L 1U8HB 4U1GB 1FSKC 1MHPL 2H3NA 4WJ5A 2EIBA 3KG5A 4PRPA 4NC0B 2CKNA 1RK1B 4JFFE 3QQ9D 5JR1L 4ODSH 4U0RC 5C7XH 1TETL 4IIQB 3RKDC 1Q38A 2NY2C 1U8JA 1N6VA 4JKPL 1AXTL 1Q1JL 5I1DB 4JFHE 1NANI 4KAQL 1QFWI 2DBJA 1IAIH 4HV8B 4DWHA 3VWKA 3PE9A 4M8VA 2D7OA 3HS0A 2AW2A 2IH3A 4QF1A 3G9VA 4WWKA 1J1OH 2FJHB 3L3OA 5TE4L 4UT6H 4PTUA 1Z3GH 1JMXA 4K3EH 4XNYL 3C6LC 3LZFH 4RBPK 4PLKD 5GGRA 3VD3A 1EV2E 2AJSL 3MRNA 5TQ2H 3JXAA 1MREL 1RFDL 5DJAB 5TPWH 4OZGF 4JFEE 2BC4A 3AU1A 4QGTA 1G6VK 5KOVC 2ZCKH 3FB6A 3BD3A 1L0XA 3GHEH 3HG1B 3ARPA 1CLOL 2PYEB 2AEIT 7FABH 5BVPH 1IMHC 4L4TD 3P4NA 3WBDA 5DJAA 4KK6C 3HR6A 3SDDA 4O2EA 4RAHA 3KLHC 1L0QA 3CX5J 2Z35B 4CMMA 3P9MB 5JW5B 5CSZA 1OAUH 3ZL4H 2WUCH 4I0PA 3FB5B 1MREH 1RFDH 3WUZA 1MFNA 2XT1B 4AENA 1BWWA 3NOIA 3QUYD 5HHOB 3NFNB 1N26A 2GFBB 4YHZH 2HN7B 3P4MB 3RWIB 4F58L 2XQBH 4XI5D 1ZT7A 2PNDA 1FFQA 1MHPH 1EEZA 2VXTL 4AENB 3X13B 4JB9L 1PYWA 1BJ8A 1PY4A 4HULB 4L4JA 3GI8L 3L5XL 1ZT4A 3MRBA 3MFGB 1HH9B 4QRSA 4WHYH 1U95B 1PY9A 5GJTL 4NUGH 1MHCA 2IH1A 1MQ8A 3PWJB 5IVZB 5CJXC 4PR5B 4NQXB 2XKSA 1ZHLA 3BZFB 4XGZB 4NRXA 5E8NA 3ARVA 2KH2B 3VGHA 3LKSA 4MQXC 1XF1A 1GPOL 1W72B 3QDJA 1IZJA 1DBBL 1NAML 4FNLL 4NM8H 5HJ3B 2VDPH 2FL5B 4Z0XB 2UZIH 1C5DB 2Z0BA 4K55A 1YYMH 4APQB 4NQEE 1I1RA 3LKPB 5FOJA 3RJQB 4JG1L 5IV2B 4L9LB 4LKCA 4LPWA 3OXRA 5C6WH 5HVHC 1IKNA 4K9EL 2AV7A 3OB8A 5KTEH 4G8GB 1II4E 1ZANL 1I75A 1JPSH 4RDQF 4KTEH 1CGWA 4YNYB 1Q9OB 3KPTA 2EEAA 3L3JA 4L8DB 1BQSA 5GS0C 1OWWA 4DZBB 4KTDH 2F54E 1MPAL 3ULUE 1QVOA 4JFDA 1FLRH 4OD2A 4K23L 4QHNA 5ALCL 2AV1A 1JK8B 1FO0L 2CSPA 3DNKA 4WCYL 1Z9SA 2AXJA 2E9BA 3W11C 3ARTA 5ERWA 4PG9A 1DTUA 5LGKA 3IF1B 1Q9KA 3TPUA 2BMKB 2C7UA 1F4WH 2X9YA 3CIQA 4G80A 4LIQH 1KLGA 4HS6B 3TVMD 4XXDB 1JWUA 1YMHA 3NABH 3SBWC 3CD4A 2VDRL 5E9DA 3RWJB 1AQDB 1XR8A 1G9EA 3WLBB 3RVVD 1YY9D 4G6MH 3ZYZA 2Q87A 1JE6A 5IK3A 1DP0A 3BPCA 5F7EL 3U46B 3UTSE 4DVRH 4KGJA 3OBAA 5IQ9A 1MCQA 1N8ZB 2ICWI 1HYRC 4JRYE 4GG8B 5GRWA 1ZVHA 4YDVB 1HKLL 3VXSB 3U4EA 1X5GA 1VEMA 3T8XA 5EORL 4F15B 5M94B 5JOPD 4GAJH 2C4XA 2ESVB 3W11D 3O41A 4JG0H 5FGBA 1NGPL 1TQCB 3AREC 3B2VH 3I02A 1RZFH 1OARH 1F4XH 4KMTH 2L0DA 4TUJA 4JM2D 5JIIA 4OFPA 3RWFA 2I5YL 3L1OL 1GAFH 3STLA 4BFIA 1K8DB 3MLTA 4PRID 4U1JB 1CICA 4U1MB 3NVQA 4FQIH 3LEVH 1N64H 2J88H 2OTUA 2A1WH 2VLJE 3RI5F 5E2WL 4W6XB 2ZPKH 4X6BB 1U6AH 5DD5H 5J6HA 5MHSD 4NKIH 3NTCL 3E8UL 3D85A 4G8IA 4XVJH 4M7LH 3HN3A 3AB0B 1NSNH 1QOKA 2YN3A 4JFZH 5I75B 3FO9B 2VLJA 1BIIA 3O3EA 5SX4I 2W65B 1JJUA 1JWMB 3RIAK 3P2TA 5ICYA 1H15A 5E8OA 3NFSH 4YBHA 4DCQA 1A6VL 2O5ZL 5T3ZL 1JK8A 5LWYL 3SKUD 3QAZB 3CGTA 4G8EB 2LTQC 5IESH 5EBMA 3P0YL 1JV5A 1S9YA 3I85A 5IKCA 1D7FA 4OD1H 1X5IA 1GGUA 2A77L 5AUMA 1L0YA 4KUZH 5ACMA 1YEFL 4D3CH 4YDKH 4GRWF 1NBYB 1PKQB 3VXMA 3FT4B 5EBGA 1S9YB 3DSFH 5D2LF 2Q6WB 3MNZA 1HOCA 1B0WA 2WBJA 5JOFB 3OAYH 5AWNL 4LSRH 4OIAA 1VACB 4GUPB 3WFCH 2AXHA 2HFGH 3MLSL 2JCCB 1MEXL 3S8WA 4I2XE 4PRHA 4XAWH 3DURB 2W0FA 3ZT7A 5ESQA 1GGCH 4XI5C 2Y72A 3B6SB 1X5JA 4LNRB 3DLQR 3EO0A 5F89B 5KVGL 5CIPH 5DR5L 5KSVB 3QUYC 3MREB 5ADPH 3M07A 2G9HA 4KK5C 4LQ1A 3VGFA 5SWZE 2BHYA 2DQEL 2LU7A 2YPKA 4X6CB 3J7HA 1P6AB 3LDBC 3HZKB 3GSRB 2XFXB 1QBLL 4FN0A 4KK6D 3GBNH 2QSQA 4PJGA 3CXHJ 1OM3H 1IQDB 1UKTA 1RZKC 2R56H 2FX9H 2V2WA 4P59L 3CLFL 5BMFH 3OKMB 4QRQB 3S96B 3UYPA 4GQPH 4GW5A 3R8BB 2R0KL 5DJZB 4YR6A 1B6UA 1IC5H 2DQEH 3VXMD 4HS8L 3U4BL 5HGBA 3FRPA 5EC2B 3VFWB 2ADFH 4E42B 2W0FB 4YHNB 1DQTA 4FQQB 3BPLC 4PY7A 5F9WC 5FK9B 5AEAA 1UYWL 2ZSWA 4OZHE 4WFFD 4DN4H 3P40A 1M7DA 5I19H 1U3YA 4Z7WE 1BVKA 4XZUB 2HFGL 3MLZL 5EH1A 3DETD 4FQ1L 1DN0B 4YIQA 4RZCB 2VYRE 1G1YA 3BH9B 3D25B 4LCWA 4XC1L 1NJ9B 1V7ML 4NQEA 1OW0C 4HPYH 4LASL 3QXWA 5IW1B 4KFZC 3ARGD 2H6PB 2CIIB 2Q20A 2GJZA 3RKDD 2NY0B 2QQQA 2VLRD 3GK8H 5MENA 2VABA 1ZKAA 5EWIH 5IHUL 3ZLQC 5SWSA 1AIFB 5J6GA 1FJ1A 2VL5B 3SDDC 1XR9A 3ARZA 3MUY1 4S0TD 1NCCL 4DAGL 1TFHA 4OQTL 2IAMB 4PRIA 3T77B 2V2XA 2VLLB 1WBXB 3MRFB 1WQVT 3OKYA 4L3CA 5EUKB 1CQYA 2PR4H 3BRFA 4MD4B 2PXYC 2CIIA 4WTZA 4HC1L 1C12B 3K2UL 5BVJB 4WU5A 3BH9A 3D25A 4LCWB 3KPRD 4XVSH 4QRRE 4OSUL 4P2CG 3FB8A 4JFED 1RZJC 2E6QA 2OR9H 3VI3E 1MJ7L 1XIWB 3QJHA 4G3YH 5C7XL 4X5LA 1C5BL 4G8GD 3A6OA 1RAMA 5FKAB 2EE3A 2MKLC 1NLBL 3HTLX 1QSEE 1VFBB 4I5BA 2ZCHL 2RR3A 2ZOLA 4P4KA 3REWA 3U2SB 3PWLB 1NMCB 4WW2C 4KROD 4RRPG 4JG0L 5E8EB 2AJZA 2QQKL 3BKMH 2C3VA 1X7QB 3OJDB 5DRNA 3FFCE 5EC1B 2WIIA 1MRCH 4NDMB 4Q2ZA 4PRHB 1M7XA 3O2DA 3QR2A 3WUWG 2W9DH 4S1SH 4JFEA 3RVUC 1FYTE 1QFWM 3HPJB 1N0LA 3I2CH 3K4AA 4PJCB 2HMID 4R0LC 5CGYC 5GGRY 5HDBF 3BRGC 1NGWA 3VXOB 2IWGA 1YYLH 3EFDL 3HI6L 2AJZB 3U83A 5C9JB 1QLFB 4H5SA 3AMKA 3NIGF 3VXUB 5DC4B 2BP3A 3WLWC 1QPPA 4JM2F 3O0RH 4L29B 3SGDI 4GKSB 1SVCP 3IGAB 1A4JB 3EO0B 5F89A 1GC1H 4BUHA 4Y8DC 4WRLA 1TPXB 4O51B 5T5NF 5KJRH 1VERA 1P1ZB 3LAFA 2X4UB 1YJDH 1U9KA 5DUBA 5BW7C 1KTKE 1DBAL 1J9CT 1J11A 2CUMA 1CQKA 1CBVH 1CIDA 5DRWB 1MI5E 1FN4B 1CGYA 1F6AA 1ONQA 3PGFL 4Y5YA 4FQHA 5D1XD 1MRDL 2FSEA 3A67H 5TE7H 4P3DA 3VFOA 3SKNB 1H0DA 1SY6L 3KR3L 3W5MA 3OAYK 1HINH 3VG0L 3MRCB 4U6HA 1JWSA 3FFCB 3I02B 1PYWB 5EZLA 4KROC 1FPTL 2I9LB 1INEL 3BQUA 4GSDH 1RJZA 5DJDB 1CXIA 2NY1D 3LKRB 4HIJB 3RWGA 4J3UA 3V7AE 3RWFB 4K94C 4MDIB 1F4HA 1PG7L 3WDIA 3DRQB 3T09A 1QYGL 5CP3H 4R3SB 5F7YC 5KG9B 2P7TB 4JKLA 2FSEB 3MACH 3O6FC 5IR1B 4HQQL 4YK4B 5GHWL 4KHXL 3RY6C 2IBZY 2I60L 4N90E 4IS6B 2Z31A 2XA3A 3MNVB 4OF3A 3EYSH 3D3VA 4HFWA 1G7IA 3UX9B 4Z7VF 4IOIB 1PSKH 3S7GA 3L7EB 3QUYA 4NJAH 4Z7QF 3VMNA 3RL1A 3T3PF 3B5TA 2PXYD 2XZZA 4M7ZB 2A9ML 3GB7A 1BREA 3QCTL 43C9B 4B41A 5JXEA 1CG9B 4ZD3H 1KB5B 1JF5A 4PRPB 1J05A 4JFOB 2WUBH 1EIBA 5DK2A 3WFBL 3SDDD 1T2QH 12E8L 5D72H 3LN4B 4WUUD 4WWKB 1UEYA 3GKWL 3SDCB 4PJEE 5GIRB 2BRRL 1SJHA 1LE5B 4DFIA 3G6JB 3QDMA 1FGVL 3QO0B 5DHVA 1BOGA 1V3MA 9CGTA 3B2UC 4FZEL 1BM3L 1G9NL 5SWSE 5D9SA 1J1PL 2NZIA 5ITBL 1N8ZA 3WS6C 1Z5LB 5F1IB 2JK5A 4APQC 2F54D 5JQHC 1KF9B 3GMNA 5GS1C 4DKEL 4Y89A 3NZ8B 5JLZA 1W0VA 4AH2B 3JV4A 4Y5XC 3EDKA 5IP4A 5CJXA 3MREA 5JPMB 4LLMA 1T66C 4LVHB 2I9TA 1EHLL 1BWMA 1AO7E 4PG2A 2VWEC 3QXDA 2DD8H 4UV7H 3BMVA 3RNKB 2IH3B 1CD1B 1TLKA 4QF1B 4WI7A 3ZL4L 2VKWA 4NRYA 3SPVB 4I3SH 4CN1A 3G6JF 5IHUH 1KJ2H 4FFWC 4OV5A 4Y4FC 2MHAA 4MJIE 1ZEAL 4DGVH 4Y2DD 1R3HA 1C16A 3WKML 1IGJA 4P2RB 1ZVYA 3O8XC 1T0MB 1ZT4B 3MRBB 4PJ7E 5FGRA 2EEBA 1BM3H 4X4YB 1RURL 3STBA 1TJHL 5J06A 4QT5B 2IBZX 4RAVA 5GSRA 4F8QA 4XPGH 1MJUH 3OV6A 4WFHE 2DLTA 2ED9A 1NANH 3QIWD 3Q48A 1HI6B 2XQYK 2KBGA 4J6RL 4AG4L 3QG6B 3F7VA 3SQOL 2YC1B 4Q74A 4AJ0A 4KJPD 4I0PB 4MNGB 1O7SA 2QHRL 4HH8A 3PWPE 1FFOA 5EUOE 5IOPA 1NAMB 1K8IA 3VFVA 2EDQA 5BS0A 3SDDB 2E9WA 2XYCA 5BJTA 1GC1C 3IFOB 1NCBL 3TO4A 1MNUH 4FQHB 4XMPH 5D2NB 1ACYH 5C2UB 2EE2A 4U1KA 1WFTA 3LIZH 2DQGL 4J4PA 3T4YB 3WCYA 3WE6B 1DBKH 2OTWA 1SYVB 3C08L 1G9ML 4Y2DB 1F2XK 3RWIA 3TFKD 1A7QH 3KXFA 4PJIF 2DIBA 4OZFA 2AGJL 3WXVH 2MJWA 1J8HA 1FZJA 5GRYA 3RAJL 5J1AB 4NUJA 2HT2C 1WFUA 5I8KL 3QG6A 3WKNA 2DI9A 3GMNB 3H3PL 2FO4A 3WFCL 1I8KA 2YEZA 4EN3D 4J3OC 4R2GB 4BFGA 3VXQA 4BZ1H 5ISZA 3M8OL 1OAQH 2VXVH 5H8DA 3SE3A 3BO8A 3G9AB 3LKOA 2NY3C 3QUMB 3TN0B 2XFXA 5IHBA 3V6FA 5H2BB 3ULVE 1K4CB 2G60H 5TE7L 5J9PB 4LMQI 1DN2A 2YPLE 1U2CA 1YN6A 2P42B 3C8DA 5C0JA 5FIEA 4ODXB 5L2JA 5GJSH 3P9LB 1UWEL 4HK0B 5C92A 1JZ2A 3C8HA 4UT9L 2X09A 2VRAA 5INDB 1AQDA 1OTUC 4HIIA 2E6JA 2MHAB 3OKNA 2XN9E 1JN6B 4U6VH 2LQRA 3MRGB 3OJDA 1Z0MA 4QCIA 5HHVL 4EUPB 3I9GL 3FJTA 1RK1A 2Y5TA 3CLEH 1KACB 2IG2H 3PV6B 3V6OC 4M1GH 3QO1A 2OJEA 5CD3A 2EDBA 2WLZA 1OT2A 4S1QL 1URLA 3S34L 5GS1B 5JPMA 5ISZD 3GIVB 2P5EE 5JA8B 2EIZB 4XWGL 4M7LL 1YYLL 1E6OH 1ZLVK 4P2RE 3RUGB 5HYSB 3RVVC 3ZKXC 1FNSH 1XGRA 4FQ2L 4YXKH 1KCRL 2HRPL 2HT4C 3S37L 2EIZA 2NZ9D 4JRXE 3CDGA 3MRJA 4PREA 5I73B 1GGIH 3VE0B 2W07A 2C5DC 3ORJA 4UB0L 1F4XL 4KMTL 3BHBA 4OZIA 1IGJB 2WIMA 4P2RA 3RTQA 1HXMA 5D1XB 2VZ1A 1W72H 2IAMA 5AYUL 3LRSB 1KCKA 3QO1B 3HAEB 4FZ8H 1QSFE 4CN4A 2NY5L 3QDJB 1W72A 1RJYA 3G5XA 5KSAB 4L8SC 1SJVA 3OZ9L 5DRZB 2QQLL 2DN7A 2MOVA 5J56B 2YD9A 1INQA 1S3KL 5JUEL 4MMXC 4S1SL 5DYOB 3NA9L 4WFEE 5I1GH 4MJ2A 4I1NB 3SGEH 1DE4A 2VZ3A 4UT7L 1NQBA 4F80A 1E28A 4FP8L 5IJVA 1UWGH 1MCWM 4QRSB 4MXQD 3SE3C 1NC2D 3EOAA 3K2UH 4J4PC 5E94B 3LD8B 4K8RC 4JPKL 4M5YL 4XZUA 2P7TA 3T1FA 3QI9C 3S35X 1K2DA 5A2LH 5IW6B 4NO0D 5KN5B 2EDHA 1TCRA 4X7CC 1FCCA 5KANG 1FO0H 3VD9A 2MPAH 4ZODA 1FDLH 1VENA 2FEDC 3T1FB 1Q94B 5CEXA 2O26U 5FYKL 3R0MA 4F3FA 1DFBL 1UQSA 1L6XA 4NP4H 4WUUB 4W68A 3GMQB 5BJTB 3GIZH 4M5ZL 1MWAL 1D5IL 3QDJE 4LLQA 2DKMA 2XNAB 4KPHL 5D5MB 5FO7A 1W2KT 2XTJE 4PV9B 3T0EC 4XXDA 2Y07L 1ZT1B 1H3WM 1GJIA 5D96C 1YUHA 2VL4A 2CK0L 2FJFB 4ZFOL 4XC1H 3D2UA 1TITA 3EJYD 1IC1A 4UOW0 5I9QB 4LHJB 4Z7UB 3RDTD 2QKIB 4HWZA 5ANMA 1RY7B 4U05A 3PJSA 3QQNA 4KDTA 3H0TA 3E3QE 4HBCH 4PRBB 4DN4L 4H8WC 3IJHB 4NQDA 1I9JH 1OLLA 4S1DD 1P53A 4OD2B 4LPVA 4R97B 2P8LB 3OAUL 5TDPA 2CLZA 1LDSA 4HUWB 3GUTB 1QBMH 1NCWL 4OZIB 4XMKL 3V7MA 1NCUA 1VCAA 4LRNL 4LASH 4HV8A 1U3ZA 3BWAB 3DXAE 4ZO7A 3WXWL 3U0WH 3LRSA 3BKYH 4XHJC 1TJGH 3EDFA 5F7DB 4YEFA 2J6EH 1OB1A 5H37G 4M4RA 1ZLVH 4PJ7A 1I3GL 1A9EB 3PGDB 1AKJA 1VA9A 3MROA 2XA8L 3ET9F 1CGXA 2YK1H 3GSVB 5GRUL 5DURB 3P0VH 5E56A 1YEGH 2EE9A 4NDMA 1XGRB 4Q2ZB 3UJTL 1UZ6E 5KS9E 4C56A 5JNYA 4I18C 5KVEH 5MENB 2HVJA 4WENB 3V5DA 2Z31D 2OSLA 1MLBA 1KFAL 3D1MC 4KTYA 2CR3A 2DYPA 3MO1A 2IGFL 3C2AL 3WIFB 4WU7B 3RWDB 5HGHA 3QWOA 4KRPD 3V5KA 1I3GH 5DS8B 1YQVL 2C3HA 3QIUB 2LVEA 3QYCA 3FT3A 5I1AA 1IAKB 1S8DA 1ZVSA 1IGCH 4Z95H 4OUUA 5CEXB 5ITFB 1MCSA 4XCEA 3TO4C 1YNLH 3D39A 2EC9T 5ID1B 2NMSA 2EYSB 1A7NH 3O2DH 1GCFA 5KG9A 3BGFC 2AJYL 3FL7A 2CDGB 4NKDB 4LKXB 2YUXA 4D9RE 1CZ8H 2H32H 2BSTB 4M1DH 1HHGB 4Y4KD 1A6VH 4HCRA 3VU2A 3U36B 4R26H 2KL6A 2QR0B 3LQZB 1CDIA 3D18B 3I50L 4IHOB 4YHOL 4EBQH 2IFGA 1HSBA 1LO4H 1JNHB 3ZKNC 1TZIB 4JHAH 3BXNA 4OLZL 3IDUA 3H0TB 4UTBL 4RGNB 4RMQA 4HIEB 1K3IA 4G8FB 5TH2A 3ARYA 3WXWH 4C57C 2F74A 4Z0BH 3U2SA 3NTCH 4GMSH 25C8H 1EX0A 4ZUTB 5HBBA 3T3MF 2GJZB 1E28B 1UT9A 1ADQH 4GW4B 2NY0C 4HIXH 5FUCE 3GMQA 3C60D 1E4WL 3KPMA 4WWKD 4QRPD 1GSMA 5I1EH 4GS7C 1AE6H 5DQJB 2CJUL 3VCLA 4GRLA 4IRZH 4BK5A 1RZFL 4F7TB 3U36A 4W6YB 3IXTB 1UCBL 5FUCC 1OGAB 1NGPH 3JUYA 2VISB 4QHKJ 4QHMB 1I7TB 2X2YA 5EU6A 1OT1A 1JHTB 1JCKA 4LOUC 4UDTB 3RX5A 4F8TA 5ILTH 5FHAH 2YRLA 5EFIA 3FT2B 3ZO0A 3PDOB 4Y19A 2ZG1A 3G6AA 4POZC 4FP8H 3OZ9H 1U8QA 2VITA 1L7TL 2ZJSH 4HDIB 1X4XA 3QUML 3DRTA 4NC2B 3F12B 3HE7C 2H2SC 1KPUB 4NN5C 4C59B 1SM3L 4U7MA 1U2HA 2E8YA 5ELIA 3ES6A 4OUOA 3WS3B 4U1SB 3TZVA 2NW2B 3A6BH 3TO2A 5IHZB 4GKOA 4BSVB 2BZDA 4X4MA 4Z7WB 5LXGL 3PXJA 3QQ3B 3X3FL 5I1JH 3QUZA 4X98A 5I8CA 1FV1B 3ROLB 2X6MA 4XRCB 4XPTL 2VZSA 15C8L 5HTSA 2CDFA 3RVXD 3DGGA 4GQ9L 4BH7B 3SKJL 4MWFB 3KLAB 4ZTPL 4UAOB 2H2PD 3TBYB 4RMUA 3OGOE 4KKAC 5E6ZA 4FQ2H 4YXKL 1P84K 3KVQA 4GAJL 4CBPA 1EAPA 2IADA 3UAJD 5DD3L 4JDZA 5JXAL 3SDXA 1BZQK 3JV6B 2ZZUT 5K9OA 3PL6C 4Q6IC 4NBXB 4HZLA 4LSSH 5DJ2B 1DSFL 3HPJA 3VE0A 1NKRA 4MJ6A 3BZ4A 3S4SA 2XZQH 1BD2B 3KGRA 4HJ0D 5DGQA 4PP2A 2PXYA 3O8XB 1YEEL 2DBLH 3FB7B 1WBYB 4CJ0A 5C0ND 2DWDB 2N1KA 4QRQA 5ABDE 3SGEI 4QHLA 3ZE2E 1LEGA 1YNTA 3NFPA 4WUUE 4JFQB 5DA4A 2DL9A 1AHWB 4QO1A 5HHVH 3FT3B 3U7AA 4KK9D 4PS4L 4EI5D 1NMBL 5JPNA 5MEQA 4PG2C 1OL0A 5FYLH 3UXFA 1G0YR 4XPFH 4P4RB 4I2XB 4RGMB 5E1AA 2BSSB 3DBXB 4HX1A 3CLEL 1XZ0B 2V17L 4YFEA 2D7TH 1Y0LB 3T3ME 3VJ6B 1OD9A 4JFOA 2BNQD 1OF2A 4XMLH 5DA0B 4OBSA 4NWTL 2DM3A 3MRKB 2R2CA 5GGVY 2EC8A 3G5YA 5C3TA 5ICXA 1J0KA 1UENA 1S7QA 5IMOA 2B0SL 4MJ4A 2UUDH 4FTVA 4JCLA 1SYSA 5BRZE 4CJ1A 3RFZC 4PJHE 1NAKH 1GPOH 1RZ8B 2C3XA 2J5LC 4UU9B 4U6VL 2P47B 5DUML 3RWHA 4F7EA 4JHWH 2NX5A 4YFDB 3SE4C 4YHML 3OPZL 4JLRB 1WZ1L 3TA3C 3BUYA 5D2NC 4NZUH 2OL3A 4JHZA 1HYSC 3BISA 5GJTH 3DWTA 3O6FB 4MXWL 1T1XB 3DX7A 3WE6A 5EN2B 5C1MB 3ULVD 1F5WA 3N0PB 3CFDB 5IMLA 4KRNA 4Z7UA 2O61B 1T0NA 1KIQB 3Q6FB 1QSEA 5C6PB 2BJML 4S10A 4FFZL 3U82B 4HXBH 2BVTA 2ATKB 5DD0H 2YMXH 3HNSH 3PL6A 1MFAL 2DDQH 4ONFH 1K3ZA 2EYTB 1CFQB 1MJJA 3N50A 5E4EB 1XF3B 1YEJH 1JWUB 3MYJA 4KKLC 4LMQE 4MZ3A 5F7MC 4F7CA 5HYJE 5L6YL 3ARXA 4MSWA 5TPWL 1IFHL 2B1HH 3WJLC 1A0QH 3R1GL 5HGAA 3CPLB 2FH6A 2NXYB 3P11H 2VDNH 2EZ0C 2X44D 5FA4A 3MR9A 1AGEA 2GKIA 1G84A 3O4OB 4TSCL 2Q86B 3BP7A 4AM0A 3T2PA 2VN7A 3UPRA 3LHPL 4PRHE 2AV1B 2G2RB 3ZSSA 1YEKL 4QLRA 4OD3H 4W4OC 3V0AC 3OXSB 2EDEA 1HXYA 3GSVA 2ARJB 5KSBF 4K71B 4WW2F 2E27L 4EUPA 2NY7H 3D69A 2A74B 1AXTH 4POUB 3ARSA 2V2TB 3QAZC 3OGCB 5T3ZE 2DWEA 4GMTL 5F7KC 1SBSH 4PB9L 4Y4HD 4LSVL 2G2RA 4FQXA 5AG8A 4CDHA 1W8NA 4J1UA 2IAMD 3BZ4B 4OGXL 1CCZA 4TUJB 4X6EB 1HHKA 3IS1X 3VDBA 1WFOA 1A6WL 1KTRL 4EVNA 2B8OT 5FA3B 1O5DT 1VGEL 1UA6H 4PJ7F 2APXA 3ZKXB 3OXSA 2XTJB 1KELH 2Q3ZA 5CGTA 4ZG1A 3WFHB 3LPGA 4P46B 3LY6A 3VFSB 5K9KB 1JUFB 1S7RA 4HKXB 1OHQA 3ARGB 4HD9A 4XP6H 1XGYL 4I8DA 3TIDB 4Q6IB 3PDDA 1Z9OA 5IHLB 1FZOA 1JZ3A 3DHMA 4TTDC 5LAXB 3NIFE 1QO3B 3MX0A 2W60A 3ILQD 4LU5L 1CDBA 1YUHB 2C9AA 4FZEH 4A2LA 5E2UL 1XGPA 4PJAB 1QRNB 5IFJA 3S35H 1LO2L 4NM4H 4Y16A 5DJ8B 5I16A 4DW2H 3HFML 3WYRA 3C6SB 1S5HA 2E9IA 3V9FA 3PABA 4XBPA 4HK3N 3P77B 3H42H 1K5NA 3AUVA 2CLRB 3S4SG 12E8H 3QHZH 4JKWA 3IDYB 2Q8AH 5BS0B 3WFEL 1QFUL 3C5ZA 4R3SA 4LSUH 4NRZA 4KGLA 1F8TL 1OW0A 1GH7A 4JFFD 4X6BA 5CCKL 3P3YA 3G04A 2VQ1A 4EOWH 1EJOH 2FD6H 3IKCB 1CGUA 1U8MA 4UMGA 5HGAB 5FHBL 2V5RA 3MRGA 2A9NH 1K5NB 1J8KA 5DTFA 4WW1A 3HR5B 3DV6A 4AIZB 4PJAA 4NRXB 5DJ8A 3QUXB 1EFXA 4JCMA 2VLKB 1KNOB 4JFDD 4LNVA 5DHYA 4LCIL 1FPTH 3U9PH 3UTOA 3QRFM 3BO8B 4OGYL 4ZOAA 4Z7QE 5E08L 2DYPD 5EPMA 1S9WB 4PJ8D 4PV8B 2UWEB 1TJIL 2K3TA 3IXAA 3VGDA 1A1NA 1KEML 3RUGE 1MRDH 3WN5A 2WQ8A 2OL3B 4GRMA 5DD6B 4EJ1C 3V4UH 2V7NA 1RHHA 4N8CL 3WDJA 1T21B 4N9OB 4OT1L 1K9TA 3KS0H 1HN1A 1OAXL 4NPYB 5ANME 5CSGA 1UXSB 4N5ED 4HKBB 5A43C 4IRJA 3ZT6A 3D39B 5ID1A 5I2IB 1W0WB 4ZXBD 4Y16D 4DQOH 3EBAA 3ZE1E 2BOCB 2ARJA 5FYKU 4Z6AT 2EIEA 3IRZA 4HUVA 2V7NB 4I9WD 4MLSA 4OLXH 3QUKA 1ORQB 4IRSC 3K4ZA 2VJXA 1HINL 3VG0H 3QWOB 2B39A 2DRUA 1KB5L 2JIXD 2R1XB 4HIHA 3RUGA 5HYSA 1FBIH 4YH6A 5T3XH 2HN7A 3L3KB 4HUVB 4QRPE 3U9UA 1UKSA 3IJSA 5F44A 1T4KB 3OKEA 1BVZA 3NCJL 3HAEA 4ZS7H 2B4CL 3GSOA 4O2CA 1BECA 3DVNB 5GSRB 3IAGC 2AXGA 5CSZB 3U30B 3J8F7 1ZLUH 1FQ9C 3QUMH 2YRPA 2ZG3A 3GNMH 4NPYA 1WCBA 1HH9A 3L5JA 3U48A 4JFFB 4NWUH 3KPSE 5CKGA 1W0WA 4NJ9H 1K8DA 3MLTB 4U2ZA 1A1OA 4ZUWA 4P49A 3P73B 3ZYOA 3Q0HA 3HI5H 3FO0L 3BP6B 2I07B 2AEPL 2IFFH 1ZE3C 4LCYB 3GSQB 4W70A 5D7LB 3MJ7A 4YBLC 1EAJA 3G5ZB 4H1LH 1N0XH 3L6FA 1D9KA 4DVBA 3AY4C 2HAZA 2Q3AA 4P2OA 5FDWA 5J3HD 1BIIB 3O3EB 1EVUA 5JW4N 4PR5A 1RIHL 3E6FA 1TQCC 2OP4L 4M7JH 3OTTA 1IEBB 3SE8L 2B2XH 4OI8A 1S9WA 1LDPL 1R3IH 4JFYA 3K8MA 2FO4B 5ANMB 3P0GB 1I7RB 1SYSB 4HMCA 1OP5H 2AQ1A 2CIKA 1U8OB 3H2WA 4FQCH 3S37X 5GISL 1WEJL 2Y6SC 5CBEA 3RP1A 2XN9A 3UDWA 2BNUA 5IBLC 1UB5A 4PYGA 2EIDA 4KJWC 4HK0A 1UQSB 2YPLA 1B0RB 3QDMB 3HC4L 4HS3B 3THMH 3C5ZB 3QFJA 3TVMA 2OZ4H 2ICWJ 5D7IF 3B83A 1MJ8L 4HKZA 3G08A 3R0NA 3BPOB 4LHQB 5F6IB 3DGCR 1H5BB 3O11A 3LEYL 1FIEA 3ULUH 4DK3A 1NCDH 4LGPB 4A6YB 5MP6H 4ZTOH 5A16A 2V5SA 4CW1B 1AO7B 4I77H 1LP9B 2QSCH 4TOYL 4Z8FH 3EJZD 3SEPA 4V2BA 1FG9C 2VLRB 4EXKA 3G6DL 1N5AA 5IQ9B 1BGXH 1KPRA 3DTXB 5INCB 4LBEB 3P30H 3HG1A 3X3GH 1KCUL 1M1SA 1QFHA 2AABL 1FFPB 5DJ2A 1Q9KB 5ESAB 3TPUB 3KPRE 5E6IB 4Z95L 4KVCL 2VC2L 3RY5A 2LTQB 2FLBT 2O93L 5E8PA 1R3LA 3GBNL 4I4WA 3GSQA 5D1XA 5C0AD 1VFUA 1UJ3C 4G8GE 3CLFH 2BSED 4JPVH 4HFUL 5IG7B 2F5BH 1S7VB 3CC5A 4LSDA 1MCWW 3TBSB 3NIFF 5F1SA 4YHPA 1EO5A 3QUZB 1FL6B 1C7TA 2G5BB 1A5FH 2Z92A 4G9DB 1G9MC 4WO4B 4DUWA 4P4RA 4ELME 4NN6B 5JHLL 4AEIH 4RFNB 5KZCD 3HG1D 5DD1H 1T2XA 5GRVL 3UTPE 2BHZA 1NBVL 3EDDA 2Y23A 3OKLA 4JFPB 1VADA 4L4VE 4YFLI 1OP3H 3QIUA 1T7XA 3AGVA 1RSFA 5FV1L 4OLYH 3CFKA 4HXAH 2BY3A 3DX9B 3PWPA 1D5ZB 1QKZH 3EYOA 1CWVA 3HNVH 4M93C 5DDHA 4E9LA 1Z6JT 2W65A 3VFTA 3DSFL 5E9DE 1WEJH 1I9IH 4XGZA 5E8NB 1NCWH 2JE8A 5T5NG 5KSBE 2XY2A 3AAZA 1H8OA 3ROOA 4MLIA 4WGVB 5H35A 3OAUH 4ZFGH 1GRWA 1AHWC 5DK2B 4X4XA 4Z5RA 1T03L 2ID5A 2Z8RA 4Y1AA 4M7JL 2IMNA 1T7VA 3L95A 4KQ4H 4P3WA 5KANI 4CL7A 1OWRM 1YEHL 4OIIL 3UJIH 1YPZE 1Q94A 1LP9F 5T3ZH 4ALAL 2V2XB 5CBAB 3F7PC 4I0PC 5EN2A 5IEKB 3IDXL 1IE5A 1TCRB 3FFDB 5D9SB 4OZ4B 5L2KE 3EKCA 1NCTA 1KPUA 1TZIA 5B21A 5BOZG 1NH6A 2KKQA 1E4KC 5FF6A 1A6AA 2XWBB 5C09B 1WC7A 4NWUL 5D1QB 4M9PA 4ZNCD 2IQ9L 3MLWH 2VDMH 3AXLA 5BOPA 1KN2H 2VLKA 1EJ6A 1R5WA 5LWYH 3PJSB 2AAVA 4NOFA 5CJQL 4LQFL 4DZ8A 1XCQB 2B2XL 5HI3D 2AEPH 3JWDL 2VLKE 1OSPL 1FN4A 1MI5A 5IEHA 4X6CE 1OP9A 3LV3A 4JPKH 4M5YH 1ZVSB 1FBIL 1NGXB 2P5EB 3C8KA 3EIFA 5E9DB 4LHUD 2NY4D 2XY1A 4CVUA 4ETQB 4BH8A 1S9VB 4GBXC 1CDUA 2FGWH 2WSKA 4GXUN 3EAKA 2PYEE 4DVRL 5F7EH 5MEQB 1K6QL 3LOWA 3NBNA 5C0EA 4L29A 2YHGA 3ARGA 2AXFA 1MAMH 4Z76B 2ATPB 5I76A 1QLFA 5JW3L 3DX9A 2ILLA 4IHOA 3H9YA 4FZ8L 3HC3L 5F7LB 3O9WB 3TZVB 3B2VL 3QUKB 3UTZA 3PGDA 3LS5H 2ORBH 1HOCB 2WBJB 3Q5YA 4MB4A 4JRWA 5JOFA 2CGRL 1JNLH 3SDAC 1OGAD 3VG9B 5E5MB 1U91A 1CGTA 2HJKB 3L3IA 4P23C 1JUFA 3ZMRA 2FH8A 2XIDA 4PJ9D 4RISL 4Y5XA 1BBJB 5E08H 4K07A 3TBYA 2BDNH 3OWEA 4YPJA 3QPXH 1M7DB 1MCFA 2HKFH 3L3GB 3BZEA 2NY2B 1WITA 3D6GA 3QNYB 1WIUA 1IBGL 1X5HA 4KK8C 4LPTA 3RTQC 1A6ZB 1F58L 3LKQB 3V4UL 3MCG1 4J1UB 1KG0B 1OAYL 5KTEL 3CVIH 3NZHL 1IAOB 5CINL 1L9NA 5CZXD 1U91B 5EO9A 3REVB 2VLJB 1DDHB 3SGDH 4RA0C 5FHBH 2AKRA 2YWYA 3ULVL 3MRRA 2Z31B 4X9HA 1QRND 1EJOL 2FD6L 3ZZ1A 2GW5A 3WMSA 2EC9U 2R0WL 1MHEB 2CUHA 4M6OH 1DBBH 4EQ2A 3DVFA 5IJKC 1FFOB 3DPBA 2E9JA 4OZGA 1WV7T 2VDOH 3DIFB 4GG6B 5J9PA 1UZ8A 5IROC 2Y5EA 1KIQA 1G9MH 1FAIL 5J12C 2HH0L 2VLRE 3HMXA 2G60L 5EOQL 3VW3L 4WDIB 3FN3A 4V1DE 3LCYA 3QDME 3VI4E 2YS4A 5E2UH 4MB3A 1OGAA 5SX5K 4WUKL 2AJUH 4YDIL 1T21A 1A3QA 1F11B 3NH7L 3DMMD 3AREA 1KB5A 2X5PA 3EGSB 4YUEL 4D0DA 1QSZA 1X5FA 3NCYS 5C0AB 2BNRD 1KBGH 1PQZB 2MSPA 2NX5B 5EB9A 3IJHA 2JELH 4OCXL 4OIBA 3VRJA 3S88L 4H20L 2HWZL 3GMPB 2GJ6E 1OAZH 1RUPH 1A7QL 1LD9A 3CFDA 5IMLB 1OP3K 2RFXA 3SQOH 5EO0B 2RAMA 4YE4H 4L3AA 2R2EB 1UA6L 3P4OB 4FOMA 3SCMC 5LBSH 1R3JA 2A6IA 2FATH 2R0ZH 3KYOB 1QLEL 3IDGB 5D96B 5EU6E 4PP1D 1YC8A 5IIEA 1I4FB 3FZUC 5F7FA 3AXLB 3V6BR 4R96B 2ZCLL 2APBA 3FN0L 2VDQL 3GSUB 4WHTA 4QY8B 4JREC 4MAYA 5GRVK 5E6IC 1AGDA 1KOAA 4WEBL 4HGKC 1VGEH 3DYMA 4M7ZC 4OAWB 3GJFH 4PJHB 3P4NB 1A6WH 1CLOH 2BVPA 2A6JB 5F8RC 1B4RA 4X9GA 1BAFL 3G6JE 1C5CH 4PRDB 1HHJB 5T1DH 1BLNB 1IGFL 2W60B 3NGBB 2AKRB 2AJSH 3F7QA 2JJTC 3V5KB 2H3NB 1F6FB 1HXYB 4NQEB 3DVNA 2NXYD 3V6OE 2X4UA 1AD9B 3RBGA 1U58A 1YJDC 4IMLA 3NAAH 4DJMA 2XKNB 1DUYA 1YMMA 2C3WA 4OZHA 3A6CH 4NO5B 5HVWA 2PYFB 1KN4L 2Z4QA 5C8JB 4L3EA 4JFDE 4N0UA 2BOCA 2YD1A 4FABL 1A14H 4P46A 3VXOA 2BOBA 4K7PX 3TH2T 1Q0YL 2GK2A 1XF2B 4ONHB 3QFDA 3BJLA 5L6YH 5K33A 1J18A 3BDYH 2O5YH 4HUXB 4JO1H 2X4RA 3W9DB 3VD5A 1XCTB 4AQOA 4KDWA 2YUWA 5SV3A 2P5WE 5DRXA 2PCPB 1LEIA 4QRPA 4WEBH 3VXPB 4CADB 3N06B 3ZYIA 4R90H 2DQFB 2VO5A 1DEEA 1YEJL 3DROA 2R2HA 3O4LA 4KHTL 3ULUF 3HCVB 1ZOXA 2BHUA 3W39A 4PJBA 1I3VA 4YDJB 1R0AH 4IIQC 2EDXA 5GZOC 5C70A 1Y18A 5HHOE 2WAHA 1NKOA 3B43A 5CEZL 4ODSL 35C8L 2JB6A 1RZKL 3KJ4B 3GKWH 4C56E 3JVGA 4OZFB 3RL2A 5CS7A 3QB7C 5EZOL 2GK0B 4N0CD 4PJGF 1H0DB 3FKUS 1BX2B 2PO6D 3FQWB 4P5KB 1FZMA 4GOSA 4FTVB 3EYQC 2UYLB 1T89A 4M61A 4PB0H 4M6OL 5EO1B 1NFDE 4XPBL 5C0BA 5C0AA 1MH5B 3DTXA 5INCA 5BZDB 1X5YA 5GZND 4HIIB 2FX8H 5DJCA 3MLVL 3SE9H 2Z9TA 4LRIA 4L9LA 1CI5A 4ODXA 4PJXF 5CINH 3RL2B 1GIGL 5AD0B 3KYKH 5L2JB 4Y2OA 4GG6E 3T0XA 3UTPD 4ODHL 1Q9LB 4A6YL 4L4VD 3V4PH 3ZE2F 3MLUH 1HI6A 4NWTH 4JKKA 3SJVD 1GGBH 1WT5C 6FABH 1S9XB 2G75A 1YEEH 5C9JA 3FQXB 2HKFL 5GS0L 1AR1D 2WP3O 5F3HB 4JFHD 5D5ME 5D2LB 4WO4D 4MCYA 1F58H 4NFCA 4DKDC 1FFPA 2YD7A 4XPFL 1QBBA 3KPSA 1CK0H 4M3JA 3EW3B 4YHYC 5AD0A 1G7JA 4GSDL 2PUQT 3QIBA 4GW1A 4MA3A 4X9IA 4K7PY 1QQDB 5ID0B 1IQWH 4PS4H 2APWA 2CXKA 4NHCH 3PHSA 2VH5L 2VUYA 4XXCC 1BEYL 3TJHD 3JTSA 4MJ5A 4ZYKA 2QADD 2ORBL 2HLFC 2ADJA 1B6DA 3MBXH 4X6DB 5F6HJ 1RZJL 1MFBH 3QIWA 5KJRL 4QXGL 3VH8B 3EZJB 1JYVA 3MLYH 4DN3L 5FA3A 2EXYD 4PRNA 3NZ8A 5FUZL 4BQCA 3FTGB 3HA0A 1CN4A 3DBXA 5H2BA 5FCUL 5C0CD 5I1HH 4XPBH 1OSPH 1KJ3H 3K80A 3O4LD 2BVYA 1Y6KR 1C1EH 1ORQA 5HGHB 1G7HB 5MI0B 4WHCA 1KJVA 1T4KA 4M1CD 2PO6B 3FTGA 4B5EA 4M93B 1KYOK 4WO4C 1XF5A 1XMWA 4ZOEA 1MAML 3FAXA 2IQ9H 1HNGA 1B0RA 4LEOA 4AL8H 3T0EE 1K6QH 1I1AA 3IXAB 2JKXA 3OB0K 5FYJL 1DANT 3ARBD 1G0XA 3RZCA 1ZK9A 2X40A 8FABA 1RIVH 3CSGA 4EKXA 3U4AA 3B3IB 5T5FH 5KZCB 4KV5F 3EOAB 4JQIH 4P3CL 3MLRL 4U1HA 5ESVB 5FUOL 5FYKD 1AGFA 3BIKB 1RUQH 4V1DA 2DQCL 1EZVX 2F54A 2D4DA 3KYMB 3CSBA 2D7NA 1NUDA 1UADC 1BHGA 1BMGA 1CLYL 4R26L 3KDMB 1MFCL 3VXRD 2XZAH 5I2IA 5IBTL 1NFDF 2H8PB 1QZ1A 3BEVB 4E41E 5I1EL 1TCMA 4PV9A 2EDTA 4XCYB 4G8EA 4K3JH 4XP5L 3VXQB 4JN2B 4N0CC 3MLWL 3G04B 3QZWG 1DQLL 2XZCH 3LB6D 4PGBB 2FR4B 5C0DA 4WUUA 3O2WL 3W82A 3QIBC 3V0VB 3CXDH 3HMXH 5LGHH 2CPCA 1CDGA 2H8PA 3BEVA 5DVMA 1QKZL 1GOGA 1FORH 5IROA 2YA1A 2YPLB 2AJVH 2BNQE 4XXCA 5DF0A 2YXFA 2FR4A 1XR8B 3BMWA 3TNMA 3I3BA 4M1DL 4D9QD 1NJ9A 2ZNWA 3L5HA 4Z7UE 2WWMC 4XCYA 5GRJL 1NBVH 1U3HB 2OJZH 4O2CB 2KUTA 3S5LB 1QNZH 4JZOA 5SWQA 4QWWC 2DMCA 5I0DA 2PYEA 3KDMA 1HQRA 3BVNA 1QR4A 5TQ0H 2APTA 1B90A 3IDNA 2AJ3A 5TDNA 5TFSH 2AK4B 4KJQC 3B9KD 3V6ZB 1R5WB 2W9EH 1WGOA 2IPKB 3IJYA 4MXVE 4WY7H 3O2DL 1OTSC 4H1LB 2EO1A 4ODWA 1AO7A 3K8KA 5D7JC 1Z9MA 5C07E 3IT8D 5IFAH 2FX9L 4I3GA 4TUKH 4X83A 1V5JA 3V5DB 1IM3A 4Z7WF 3L3JB 1MUJA 2CDEB 3ZE0E 5F3HA 3O9WC 5GGTH 1OTTD 3TWCH 5JNYB 1SMAA 2R0ZL 5MEOB 5KVEL 2EKSA 1S7XB 1J0ZA 1SJXA 4YDVA 5TF1H 3HZYA 4HLZH 3MBEA 4M9OA 5DJZA 1NCAH 1IGTB 4C58B 2X4SB 4JFXA 3G6DH 3LEXA 4GRWH 3F5WB 4YXLL 8FABB 1IM9A 4JFFA 3D0LA 3S98A 3UTTE 1BQLH 4KI5F 3UYRL 3S4SB 1QNZL 3RA7L 1MEXH 2OJZL 4HSQA 1YMHB 3TZVC 4XBGA 1JHKH 3LS4L 4OUUB 5E1HB 5MEOA 4X6CA 5E4EC 1HDMA 2HJLB 2AJUL 3DECA 3F58L 5BV7C 1ZHLB 5MP6L 1J1XL 1KJMA 4FTVE 3FZUD 3KPPA 1U93A 2JB5L 5CJ5A 5TFSL 4PP1C 3KXFB 5E6YA 4OD1L 5C0FB 5I15H 3CDGB 4F7PA 2AABH 1MJ8H 1QFPA 3QCVL 2Y9RT 3SCMD 4HBCL 4RQQA 1D9KC 4GJTB 1D9KB 2V5YA 4DVBB 5GRJH 4PJ5D 1IKFH 3D3VE 2JJVA 2DLHA 1JIBA 1WAAE 3D2UD 3TO2B 1OSZB 1RULH 4I77L 5A2KH 4XP4L 4NO0A 1A1MA 1BJ1H 5HD8C 5GRXG 5MI0C 3B9KA 5KSAD 5KVFH 5K59E 2A77H 2ITCB 1BQHB 1JV5B 4TULL 1NGYA 1XGUA 1ORSB 4P5MB 4Q58C 1VB9A 3RIFK 3T04D 5F9WB 1T20A 4FQCL 4LNRA 4ZFFA 4PUBH 4YHKL 2A1WL 1I85C 1B0GB 3EO1B 1VEOA 3GIZL 3QFJD 3N1MC 4K7FA 4NZJA 5F7WC 1I9RL 1S3KH 5JUEH 1Q0XL 2FHBA 2JCCE 2Q6WA 4JLRA 3GSNH 1CGVA 1ED3A 4GAYA 4JGUA 4EDWL 4I48A 4YGVA 2MPAL 2ERJC 1P7KB 1HQ4A 1NSNL 2X1OA 4Y19E 3BPLB 2DICA 1I1CA 1R24A 3TA3A 4HDIA 1S9XA 4XWOC 1QRKA 3VXTB 2PETA 4HWEL 3UC0L 1UFUA 3VXRA 1NGYB 5FEBA 3CVHB 5EU6D 1H3GA 2MNUA 1UXSA 1ND0A 3K0WA 5D7LE 5EIQA 2FB4L 3VGAB 2DJSA 3V0VA 3JWOH 2ZUQB 4OZGE 1A6UL 1MFEH 4LLYB 3VFPB 4X6EA 1YDPB 4OJFL 4TVSa 2H26B 3NCJH 1HNFA 1OF2B 3CVHA 3OKMA 5EA0L 3SDCD 1JNNL 4UNTA 3EFFA 4OLXL 4XCNB 5FOBB 3DXAA 3VFGH 4PJ9C 5DUBB 1UZ6F 3GGWB 5KS9F 3M1BB 2E7BA 3PIQA 5DYOA 3SDCC 2I26N 2AEQH 2OSLB 4R4ND 2G5BA 5EO9B 3AS3A 4NGHL 4EN3B 5IF0A 1CK0L 2CRYA 4G6ML 2NCMA 1IKNC 2LAGB 3IU4L 3F7RA 4I13B 4EUPG 5F93C 3I6LD 5D70H 3QJFA 5JQ6L 1MPAH 3CX2A 5D7JB 3OJMB 2GJ6B 3SKMA 3P9WB 1S7WA 3L3GA 2PTUA 1AGCB 1MIEH 1A9EA 1DQJB 4X80H 3VFTB 3TPKA 1BBJA 1DQMH 1F2QA 4M6NH 1OAKL 4KUCD 5EC2A 1D5ZA 2J8UF 3UJIL 4L5FH 2NY4C 2KQMA 5HVHB 3CCHA 5K9QG 4U1SA 4WNQB 2K7QA 5HHMD 2YPVH 4ZMAT 5JXED 4Z7WA 1J0JA 4RQQB 3EYUL 1S7WB 4OCRH 5SV4A 1YY8A 2YA2A 3HE6A 2DQGH 3DO3A 4N8CH 1W8OA 3CJJA 4OGAD 4XX1E 1QHPA 3DI2B 2VISA 3MUJA 1F8TH 2A6IB 3FOLB 5DK0B 3MR9B 5GIRA 3REVA 7CGTA 3SDAA 1NLDL 4NOBA 1RZIA 3LKNA 1JWSB 4OM0H 3U9PL 43CAB 2C4FU 2GTZB 2E5EA 2EDFA 3EOBB 3E2HC 3GI8H 4EDXB 5SX5H 1CTOA 3VWJC 2EDJA 3VWJB 2HVKA 3LRGA 1BOGB 3FN9A 1PQZA 2Q8AL 4WNQA 3O3BB 2ATKA 4QRRD 3AM8A 2OR8A 2W0KA 2UWEF 1A5FL 4UDTA 3BDYL 1FNLA 3CSPA 5C0CE 4RFEB 3ES6B 4XBEL 1AGDB 3HAEH 3ARBB 3TC9A 5IB5A 5K9JL 4GAGL 2CRIA 2NPLX 4CW1A 2ADJB 3AS1A 1IAMA 4HLJA 5EU5B 1A4JA 1CTNA 1G9NC 4LU5H 3WHXB 4ONGL 1F42A 2FJHA 3EGSA 4D0DB 4MB5A 4DFHA 5T1LA 4Z77A 3EYFA 3TCLB 3L7EA 1KC5H 3K7UA 3TZVD 3ARUA 4Z78B 4RGNC 2VDLH 2QQNH 1EK3A 4PJDA 1R3JB 2FIKB 2YBRA 3U1SL 2AJXL 4O4YH 4X98B 2RCSL 5JW4Q 2XTLA 5EO0A 3WLBA 2PN5A 3LRHA 3CFEB 2VR5A 3LZFL 1CD9B 3INUL 3L7FA 1VGKB 1Z3GL 4YXHH 4PJDE 2FBOJ 5F6IC 3QXTA 5JZ7C 3FT2A 5KVMC 3T2QA 4YHIB 3S96A 4W4NA 5CZVL 2YWZA 5EZLB 3WKMH 2WWKO 3TYGL