5F9AC

Blood group antigen binding adhesin baba of helicobacter pylori strain p436 in complex with blood group h lewis b hexasaccharide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Cell adhesion
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f9aC00
4LCWE 4Y1AA 4RAUB 2B2XH 2V2TA 5I1GL 2Z92B 1FFPA 4ZUWB 2JELL 3DSNA 4MA1C 3L1OH 2DOCA 4L4TB 4ZFZB 2VO5A 4ZS6D 1XGQA 2EYTB 1I7RB 3V0VB 4W68A 3RNQA 2XRAL 4QGTA 2E7CA 3CVHB 5TFSL 5B3NA 5GRWA 5FF6A 1RZGA 4PRDA 1Q9KA 3HPJB 4PJIB 5I19L 2Y5TB 3TH4T 4GO6B 4EXKA 4WO4C 1EK3A 5GRVL 4PJBB 1G7QA 4AYFA 2IBZX 5INCA 3S34L 1I4FA 5D70H 3BISA 1FGNH 1EO8H 4IRSC 1ZSDA 3PWUA 2R0WH 5EZJB 3DV4B 4X6BA 3MSPA 4PY7A 3RBGA 1FGVH 2HKFH 2VTFA 4IMKC 3QXDB 5C09E 1ZLVK 4MCZB 2B4CL 2P5WB 3GBNL 3IJHA 4ENEC 3LKQA 3TNMB 5L2JB 5T1MA 1N0XL 4PJBF 3HMXH 1QBAA 1ED3B 1CIUA 1BZ7B 2ATKB 4ELMF 1NC2D 3AU1A 5AUMB 3VCLA 3S4SA 3D18A 4X6EA 3SGEI 5EU4A 1T0MA 2P1YA 1G9MH 1I3VA 4I9WE 5GGVL 3LKQB 1CGYA 1RIVH 2YXFA 3C2AH 2UVEA 5ENWA 3A6CH 3Q3GB 1IAMA 4JANB 2G2RA 1YQVL 3HAEB 4HWBA 3BQUD 4M1DL 3UTTA 2VXUL 4G7YH 4R7DB 4NO5A 3IFOA 1OT2A 2IADA 3SEPA 1GSMA 2EDYA 1OP3K 3U36B 4RX4D 4AIZB 3RL2A 4KQ3H 3B8SA 1ZHKB 1M7IA 3O6KH 1WK0A 4UNUA 1Q9KB 4R26H 4JDVB 4OTXH 3JV4B 4PJ9D 4XNMA 1CE1H 5C3TA 1ZHNA 5DI8A 1G9NL 2JELH 3ULVF 4WO4B 4PD4K 3UO1L 5F3BB 4FFZH 4RRPG 4ZFZA 1U92B 1E4KA 1A8JH 4N68A 3QYCA 5IW1B 4FABH 1F8TH 5L2KE 4U6XA 5D96C 1BOYA 2A9ML 1YQ2A 2W91A 2F54E 3GI8H 3LN5A 4KVCL 3VG9B 1T6WA 1NMBL 4Y1AB 4HK0B 1G9EA 3T8XA 4G8EB 4NQCD 4JZNB 3RWDA 3MO1B 5DD1H 4TVPH 1Q9WA 1P4BL 1NAKL 4DQOH 2IEPA 1JF1B 4C56E 1EAPA 4GXVL 4P3CL 4RDQG 4I0PB 5DUPL 2ICWI 3QDHA 1SJHA 3ULVC 3WFHA 4KTEL 1WC7B 1E0OB 1NGPH 3IF1A 4F58H 1IAIH 2WWKT 3C08L 2IQ9L 2YUWA 3CXHK 4ZXBA 5TQ0H 5EZOL 4Y5VA 5DVNA 1A3RL 4LQFH 4PUBH 4U6YB 1C12A 4ZTPH 3P4MA 5FYKL 2P7TB 4PRHA 4PJHB 5AG8A 4HDIB 3V6FA 4C83A 4P3WA 1H3PL 2MKLC 1MCRA 1FVEA 2EDNA 4R6UA 5C0BE 4XVJH 1MY5A 2A77H 5GGVH 1EJ6A 1G7LA 4LCCC 2AXHA 2P45B 3KPNA 2A9NH 1M7DA 1WEJL 5CBEB 1RHFA 5A2JH 3Q0HA 3TBWA 5IJKA 1C5BH 3ULVL 4Q9BA 3OHXA 5JDJA 1QTYT 5DD6B 3TV3L 4KKNA 5E8EA 5BV7C 1BQUA 2HT2D 1FL6A 2EKJA 3QUXC 5C92A 1LDPH 4WTZG 1X5GA 1I9RL 3BRDA 1S8DA 4AENA 3DIFB 4TTDC 4OTXL 4AEFA 3VXSB 1RY7B 4HS6A 4MNGA 4IIQC 5KSBA 2YPVL 2KL6A 3ZT7A 4DZ8B 4L8DB 3QJHB 3O4OC 1IAKB 1EV2E 5D9SB 1CK0H 1WJ3A 3BZ4B 3ZKSD 1A6TB 5L6YH 1JRHH 1OAYH 3QT2A 2AJZA 1X5XA 5C0RH 3QIUB 1T80A 5AD0B 3ARVA 4BQ6A 4N9GA 1E6JH 1MHEB 4UQ3A 4MB3A 3RY4A 4DQOL 4L8SA 3L7EA 5JPNB 3QEQD 5F3HB 5GRJL 1JV5A 4YXHL 4MCYB 1JGUL 4HXBH 2AEQH 4NRYA 1KTDB 1XZ0B 1CG9B 3TFKC 4GOSA 3IDNA 3W9EA 1OAUH 3ZZ1A 5HHME 4XP6L 4QXTB 5E2VL 1J86A 1IAOA 4E41E 1BOGB 5JR1H 1EZVY 1X7QB 4XVUD 4ZO7A 3MRPA 5F9AC 1AQKH 1J0KA 4JO1H 2J3SA 1SYVA 2IG2H 1UXWA 1J5OL 1AXSA 3HC0B 4JFXB 2NTFA 3RKDD 2FIRT 2CUIA 4A6YH 2Z8RA 1NCDH 4WI3A 1PG7H 1U58A 1F6LL 4JG0H 3VRJB 1QA9A 4KI5F 5IFJA 3HZMB 1Q9OA 3THML 1YEJH 1IEAB 2OR9L 1QVOB 3HG1E 1UKSA 4U6TA 1C1EH 4ORGA 2XRAH 1UJ3B 5EC1B 5DSCA 2VISB 1CVRA 1RJZA 4X80H 1OHQA 4XNZB 7FABL 1AO7D 3BPNB 3QCTH 5SWSE 4OBRA 1MHEA 1F2QA 4DVRL 4GKZB 1XAUA 3QNZA 1Q9LA 4YQXL 4M8QA 3LHPL 3V7AG 3QPXH 4HAFA 5F7YC 5D9SA 2WIIB 1BFOB 3LRHA 1SMOA 3BKYH 4WHTA 4HH9B 1X4ZA 1DE4B 3LS5H 3G5XA 4G8IA 5CILH 4I1NB 1LK3L 1RJYA 4HKXB 3RL1A 5CZKA 5JDSB 1NGWA 3JTSB 2FSEB 2R1YA 4NN7B 5FGBA 2VITB 3C2SA 5A2FA 4PRPD 5DDHB 2E9JA 1HH9B 4P99A 2W9LA 3NCCB 3PF2A 4JO2H 3CU1A 4OLUL 1NAMH 1D9KA 1WWCA 4JGMA 4W4NA 2HN7A 1MFDH 4N1CA 3L9RA 3BIKA 1MHCA 3MRRB 4I13B 1RK0A 1OTTC 2PR4L 4X7CC 3RUGF 1SY6L 4JB9L 4M7LL 5F7EL 3TV3H 5C2BH 4A6YL 2QSCL 4ZFOA 5IEKA 2ZG3A 4YDIH 4D0CA 2WQ8A 4TSAL 4APQA 2QBWA 3L7FB 1L0QA 3ARTA 4XHJC 4FXKB 2YRLA 4NWUL 3GRWL 2K7QA 2JLLA 1NMCB 3DPBA 1L4IA 1CQYA 1YEDB 2OI9B 3ULVD 5KVEH 1ACYH 3QCUH 3MRMA 5D7IF 4ZUUA 3RJDA 4DOHB 1BD2E 1YEHH 2CKNA 1FFQA 3ESUF 1FRGL 4NRYB 3MRBA 1IM9D 2UWEF 4YLQT 1RZJL 3MFFB 3NCFB 4D0BA 1BWWA 1U3HC 3GSRB 1QUNA 1NCBL 1CICC 4WHYH 5D7SH 3MJ8B 4G6JH 1JWSB 2VLJB 1JZ6A 1DQDL 1S7TB 3HLAB 1X5HA 1RZFH 2XZCH 1YNLH 1AGBB 1K4CA 4H0GA 4OJFL 2VDQH 5KOMC 5JO5A 2Y6SC 3V4UL 1HCFX 3B9EA 3RGVC 4HS6B 3VA6A 4G8IB 5HD8C 4LCCA 3RGVA 1UFUA 3B9KA 4ZAKB 1P6AB 4UNVA 3P9LA 3U6RA 4OZHE 4PYHA 2WIIA 4IOIA 2BP3A 4H5SB 1INQB 1MI5D 4V1DE 1CVSC 3JZ7A 2IH3B 1MI5E 5I1AA 2BNRA 4CMMB 1WEJH 5EWIL 1OP5K 5CLTA 2P5EB 2FEEI 4WY7H 2YOCA 2DYPD 3V6OC 1U36A 3V4VL 2VXTH 2FEDC 2PXYB 1UH4A 2AXFA 1MJUL 3VH8B 4NNPL 3GSOA 1JNJA 1GGCL 4LVHC 1E4JA 3OKDB 5LGJB 4PB0H 1A9EB 4APQD 4LSRH 5K59F 1OLLA 4GRWF 3RWJB 4KXZI 4PJHA 3OR6A 3U7WH 1ORQB 5FO9B 5FCSH 1B4JH 2A73A 4KDTC 1A1OB 4N5UA 1DANU 5FDWB 1U8HB 1CICB 4WW2C 3LN4B 5DJXB 3QIWB 2RQ8A 1WC7A 1E4XL 4GUPA 2O5XL 4JG1H 3RNKB 1EAPB 1F6FB 4FTVD 4I77L 5E99H 1FNSL 1OGAA 5T3ZL 3V5HB 2J8UB 5E08L 1R5VA 5IW6A 3G5YB 1A6UL 3MACH 3KYNB 4Q58C 5DS8B 4UOW0 4OI9A 3LKOA 1CLZH 4KV5E 2VLRD 1JGUH 4HXBL 4QXTA 1S78D 2BK8A 4H0IA 2UZXB 4HHAB 1FG2B 5C0AD 3G6AB 1D9KC 2F5BH 1ZE3C 1LILA 3D9AH 2AKRB 1MCEA 5J6GB 4M3JA 4P2RE 1TXKA 3WFEH 3NABH 3CUPA 1I8KA 4FFWC 1CR9H 1ADQH 5LCVH 3ZE2F 3EOBA 4NBZB 1U8IB 3UJTL 5J06A 3GMOA 4BZYA 1HXMA 1HHHB 2DQHL 3OAYH 3HE6B 1S7UB 1KNOA 1R5WB 3E1F1 4P2RB 5GRZA 3UTQA 1DLHB 2R4RH 1SYSB 1QSEE 3HZKA 2WUBH 4TUOB 5T3ZE 3GSNL 3EYQC 2AJYL 1QFUL 5T3ZD 1AKJD 1B0RA 1NDGB 3C5SA 1VFBA 5SV4A 5LGHH 4GAYB 2R0ZL 4XCEB 5I73B 4NWUH 3S96A 5I1DA 5CJQL 1FYTE 1A9BA 3UO1H 4OIBA 3T04D 3RPIA 1U0QA 5EDXA 2H9GA 2X70B 1KBGH 5HYJA 5JW4R 1F8TL 2APWA 4PJDA 5E9DB 2V2XA 3W39B 3MLVL 4KFZC 4NBYB 5JIIA 3C2AL 5KSAD 1FL6B 2FHFA 2W59A 2P44B 1WBZA 4X6DF 3O8XD 5DR5H 1PX4A 2H2SD 2LTQC 5ESQA 3HRPA 1H3WM 3WXVH 4X9IA 3B2VH 3BPNC 4XXCA 4G6JL 1BZQK 2QL1A 5MENE 1K6QH 4N0CC 4U1SA 3BDYL 4QNPE 4V1DA 1MWAA 1I4FB 5JZ7D 3HZYB 4QRUB 1G9NH 4DGYH 1UVQB 5J8OA 1DEDA 4NO3A 4FFZL 5DJ0A 3QUMB 4YE4H 1P2CB 3MCKB 4EQ3A 4OGYL 3WN5C 2HJFB 4F7TB 4K9EC 5D7JB 3JWDC 1JMZA 4R0LA 5CJBA 2P5EE 2Y5EA 4X7SL 1JF1A 2APXA 4NC1C 4OD3L 5DHVH 2A38A 5KANG 4EKXA 3MLZL 4KK9C 2MQCA 4WY7L 4M7JH 5L7XL 5IVXE 3U46A 1CGSL 4KPHH 4LLMB 1HQRB 4S1DC 5FCUL 4TSAH 1FN4A 4FQXA 4M9OA 4KU1A 4XAWH 4ODBD 1BPVA 3KPMA 4BK5A 5HYSB 2B8OT 5IMOA 4JAMA 4L5FL 1NGQH 4ZNEE 1KB5L 2Q8BL 3QPQD 4YDLB 2E7BA 1NMAL 2FYYB 4XPBH 5C0BD 2CDGA 3K3QA 3CFEA 5IW6B 4NCC1 1S9YA 5I66B 3QEHB 4UV7H 3EJZC 5A16B 4PJGF 3LZFH 1MCFA 4UIMA 1JF6A 3C6SA 1RJCA 4HX1A 4Y8DC 5E24E 4ODUA 2PTVA 4LSUL 4ZTOL 2CD0A 4MNHB 2LAAA 3QUXA 3E6HB 1XCQA 4R7DA 2PCPA 4JQIL 5EUOA 4OCRH 5BZDA 2OP4L 2ZSVB 3I02A 5E08H 2GI7A 4EDXA 1PYWB 2Z35B 3CX2A 4GMTH 3B9VA 3EFDL 4JY6B 4LIQH 4TUJA 4KJWC 3GJFB 4EIGB 5IHZB 3IETA 3AS3A 3MRIA 3ILPA 4YHPB 3DETD 5C9JA 4XPAL 1UENA 4AT6B 2X9XA 3Q2CA 4FTVE 5GISH 43C9B 5HDQL 1ZVSA 2WWMD 3MRHA 3VGBA 1T5WA 1LGVA 2V17L 1P7QA 3I9GL 3KXFA 1HHGA 4PP2B 4KMTL 4QHNA 1Z0MA 3R4DA 4M7LT 1N64L 1S7RB 3RIFF 2P5EA 1TVDA 2IG2L 3VGAB 3LY6A 1T04B 3MV9D 2DKSA 2JKXA 2A6DB 4O2FA 3QZWG 1E6OH 4HSQA 5GGRA 3BKMH 4D2NA 2DQTH 5D72L 4MD0B 2NW2A 4FN0A 5FECA 3G6DH 4OD3H 4FTVA 5E2JA 5C0AA 4CKVX 4V2CB 1SEBB 3ARFA 1AJ7L 3IDXH 1G0YR 2HLAA 4D9RE 5KW9H 3CFBA 2DTMH 4YXKL 3PL6D 5FKAB 4ELMB 1FLRH 3O3DA 4PREB 5DD5H 4JRYE 4XBEH 4X8XA 2YD2A 1FO0A 1Y0LB 1FL5B 4Y4FA 5GGQH 4U1MA 5HJ3B 1D9KD 1H3PH 4F9PC 4K3GA 2IPUK 2PO6D 3V7MA 1P7KA 2AK4E 1LO3H 1UH3A 5JPMB 4UTAH 3L3DA 3OR7B 5CWSB 5CS7A 4JY4B 4YGVB 1NUDA 3T0BA 1LK2B 2XN9A 4UV4H 4EI5D 2OTWB 2BSTA 3C09C 3Q5OA 4P23D 1KPUA 2CR3A 5FM5O 4YFEA 1EX0A 5D8JL 3U4BH 4YHOL 5CD5D 2B1AL 3MRDA 1N5YH 4GKSB 1MREH 4HJ0C 4CGTA 1XGTA 4PB9L 1V7NL 3MCLH 1FHGA 5C6TL 3QJFA 3MLVH 2AJSL 2N7BA 4S1DD 1KGCD 5JUEL 1EEZB 1PG7X 3L7FA 4F57H 3QO0B 4YHNA 4AK1A 1KYOJ 3QCTL 4JJ5B 2BNRD 4QHUA 4LF3A 2CKBL 5D7IA 3QQ4A 1YEIH 4KMQA 5EG6C 1CK0L 5FYLH 4R7NA 2R0WL 1BJMA 3LRSB 3L9RB 4KY1H 3SE4A 5KTEH 1FBIL 5B22A 3T1FB 1RMFH 2A6IA 5EO0B 2OL3L 1CF8L 3VFSB 5L7XH 3CFJA 2H2SC 5FYJL 2Z9TA 4XP5H 4ETQB 3PHOB 2F58L 3P11L 4TTDD 4MB5A 4NUGH 1U8OB 12E8H 2D9QB 4GBXD 4PJDB 5E9DA 2BERA 5DFWH 1KCLA 2R0ZH 3WUWA 3AMLA 2NY5H 1N5AB 1OGAE 2HKHL 1KIQB 2OLDA 3EKCA 4Y4KC 3OKNB 5F7FA 3FT2A 3LKRB 1AGEB 4OLUH 4OD1L 3MUY1 1A7QH 2X10A 2VIRA 1T7ZA 1Q9LB 4U2ZA 3HMWH 3D85D 4QRPA 3IJYB 3ZHDA 2BHZA 5JOPE 4LAJH 4J2XA 2ZNXA 3T0WA 2EH8L 4L8CB 3EOBB 2ZKHL 2FGWH 5EOCJ 4OUUA 4FNLL 2BY2A 2D03L 4X4ZA 1MNUH 4L29A 1G1CA 4OAWB 4KMLB 4E9LA 1KT2B 3BI9X 3KS0J 5D8JH 3NBNA 1DBAH 4P9ML 3KGRA 4KXZH 4G9FB 4P5MA 3RP1A 4DGIH 3GSXB 3LIZH 3BWAB 1J0IA 3QCUL 4Y2DD 1R5VB 2Q3AA 1NMBH 2X4NA 1CS6A 1T5XA 1I1AA 5DEFA 1RIHL 3MUZ1 1OVZA 5BS0E 2A0LD 5B39B 3NIGE 4EUPA 1P4BH 4U1JB 2NY1C 3BIAX 4HKJA 2KZ1B 1SM3H 5ELIA 5TGBB 5ALCL 5DLMH 4XXDB 2MHAB 4LPYA 4HFWA 5DFTA 4KI1A 4OZGF 2YD9A 5MI0C 3MUHL 4LPCA 1OSZA 2OL3H 4CVZA 4NQXA 1OW0A 3OXSB 3F62A 4J4PC 5KVDL 2GJ6B 6CGTA 2HJKB 1FLRL 1EFXA 4IJ3B 2F58H 1QEWA 3RVTD 3BP5B 3FONB 3DMMB 4JO1L 4QRQB 3NIDF 5LGJA 1A1NB 4HWBH 3MOAH 1NQBA 1QSFA 3L7EB 4B7IA 4FFWD 5J9PB 2Y6SD 2ARJB 2ID5A 2A77L 5E1HB 3IGAB 1T2JA 1BD2A 2IH1B 2H32B 2HYMA 4C56B 1X5FA 1ES0A 1A6VH 1I7UB 3E8UH 4QRRE 3AB0C 2XIDA 3X3GL 1FZMB 3U7AA 3VXPA 4H5SA 2VIRB 3GSWB 3ROLB 1I75A 4GS7B 1X5AA 2X1WL 3ARGA 1D5BB 2VAAB 3VXSE 4QRSA 3OKNA 3TC9A 5SWZB 4DUWA 3D3VD 2PW2B 1A3LL 3EO1A 3P30H 1C08B 3R0MA 4Z7WB 3KNBB 3O9WD 1QSVA 4XBPB 2CRMA 1YEIL 3L3GA 4ZPTB 2CPCA 2P48B 4NOBA 3VDBA 3F12B 2Y07H 1DSFH 3C8KA 4PLJC 3VMNA 3QEUA 5DQ9A 4XRCB 4X4ME 1VPOL 3N1QC 1AHWB 4HCRA 1NL0L 2AJ3B 4RNRA 5K9OA 3LOWA 3HC3H 3BP5A 3DJ9A 1A7OH 3NPSB 3TZVB 4LF3B 2L0DA 5F88A 2PKDA 2QSVA 3QUZA 1A6AA 1MFBL 1NC4D 4Y5VB 3O41B 2HFEB 2IPTL 1C16B 2VDPL 3KXFE 1J1XH 1C16A 1ETZB 1I9JL 1YQVH 2BOCB 2JCCF 3B6SB 4FXKA 5GSRA 2FATH 2N56A 3VJ6B 4NT6A 2VQTA 5F88B 3B43A 4LQ1A 2BVUA 3BEWA 4Z76A 2V6HA 4JGUA 1P4LA 5IKCB 1LO2H 2R4SH 1FSKC 1NUGA 4X7FC 5A2KH 4R96B 4RFNB 3BIKB 3GSXA 4CW1A 1G7PA 4EOWL 3BP6A 1F6AB 2EDKA 3RAJL 1BAFL 4YHOH 1IM3A 2EYRA 1WITA 4XBGB 3L3GB 3OX8B 5LGHL 5B38B 5ABDE 9CGTA 1RZ7L 2YUXA 5C0NC 1HKLL 4PREA 4QYOB 1R0AH 3TIDA 1TCRB 4PJXB 1UM4H 5GS1B 4X7EC 1V7MH 3GZKA 4QRSB 1BQLL 1A14H 3QNYB 3BAEH 3QHZH 1B90A 3S37L 2ITDB 5FXCH 2ADFH 4MHHG 4YHZH 4YWGH 5DJAA 2ZOKB 4RMTA 2R2BA 3UTPE 3WIHL 2VN4A 2PN5A 4JM2B 3PL6A 1U8NA 4YUEL 3HZVA 3KPRB 3MBXL 5DLML 5MERA 2MQ3A 3QDJA 1BZ9A 2D7TL 2PTUA 4XPFL 1UKQA 3K80A 5C8JA 1WBXA 4HCRH 3QDMD 5ACZB 1RHHB 5JMOC 4KROD 3VXNB 3UMTA 1WV7T 3QR2A 1IGTB 2VZ1A 3LCYA 3QXVA 5DQJB 1BX2A 1F90L 4LCUA 3O9WB 3GUTB 4GAGL 4N0RA 5HGHA 4WEBL 2EEBA 5GGSY 4TNVF 4WDIB 1CQKA 1GXEA 5DC9B 1PLGL 3GRWA 4MS8D 1K2DB 3PJSB 2DQFB 4IOFD 5HYFA 5IVXB 1KELH 1IC5L 4LLYA 3RA7H 3DBXA 4QY8A 3LEXB 4OLYH 4RGNC 3E0GA 4OCRL 2Q8AH 4XMLH 2ZUUA 3DVGA 3OAYK 4Q6IB 5FOJA 1FZOB 3BOVA 7CGTA 4PJBA 1QFWI 3C5ZA 4IJ3C 1W0WB 4I2XB 3FQXB 4NUJB 1WF5A 4QOKB 4AH2A 3QWQB 4L3AA 4Y2DC 2W60A 4QCIA 4YNYB 5E8PB 3SGJA 4HJ0D 1RQ5A 4GKSA 1SBSH 3RNQB 3OL2A 5E2TL 3GK8L 4LNRB 3IKCA 4PJEB 5C0FB 4IDJH 4ONGL 1MSPA 4FQXB 4F37F 5GRXG 3BUYB 1H3VA 2ICWB 1FFPB 4WU7A 3DV6A 3L5WA 4JDZA 3PWJB 5B21A 2YA0A 2XZAH 2W0FA 3QWOA 1WWAX 5HPMB 1KLFA 2EKSA 4GG6E 1TETL 3VD9A 4JVWA 2AGJL 4LU5H 3CFKA 3DX7A 4RA0C 5D7JC 3CSBA 3OZ9L 4NQEB 5IBUB 1S5IL 1EA9C 3UYOD 1BVKA 2XXCB 2HVJB 4Y19B 3GHEL 2FCBA 2UY6A 5J12B 5IWLA 3MRGA 3LAFA 5E2VH 2NW3A 3W9DA 3SQBA 4TNWK 4L9LA 2MNUA 2YZ1A 4BSJA 3BN9C 2HRPL 5GGQL 3MV9E 2VRAA 5J13C 3T0EB 3DVNA 3HI5L 4LLDB 2DLGA 3WJJA 3K2MC 1SEQH 1N64H 2HT2C 4NM4H 1NGXA 1YYML 1PG7L 4CRPA 3OQ3B 1VCAA 4B41A 5DWUH 2PYEB 1OD9A 4U1GC 3X11A 5D6CB 5BRZE 2YPLB 5EO0A 5GGTH 3S4SG 1ZWIA 1V3LA 5IB3B 4HC1A 3CXDH 3MRHB 2Z8SA 5F6HI 1BAFH 4XP9L 1S9XA 1RZ7H 4OQTH 2P4AB 1G7JB 3QQ9C 4MXVF 1TIUA 1EFQA 5C6TH 3ZKNC 2K3TA 1KEMH 2VE6A 3U0TB 1C12B 5DRZB 3KWWB 2CO7B 4HMDA 4K8RC 3VI4E 5I1IL 3I02B 1UM5L 4XVTH 5BZDB 3QJFB 5IV2B 3RI5K 3N06B 3ARGD 4ZXBB 4MA8L 2X4SA 5T5FH 5DTFB 4F7EA 1JFQH 1D5ZA 5DGQA 4LP5A 3HPLB 2CMRH 1IAIM 2Y07L 1PFCA 4UIMB 4P57B 3G5VA 3X13A 1AP2B 4M1CC 1RMFL 1IEHA 3QCVL 4R97B 1HWGB 4NYLA 2CDGB 3MGOA 5JPMA 1NEZG 3HC3L 3RU8H 2ATPB 1I8KB 5J3HC 3MACL 4X7TA 4S0TD 4LEXL 4X0KA 1QNZL 4GAJL 2GTZA 3HNSL 1IGFL 1LD9A 4IOSD 3SDXB 1HQRA 3TYFA 2XTJC 5CIPA 1FG2A 2CLRB 5DJ6B 4O9HH 2V7NB 4CN1A 4O2EA 1I3RB 5E6YA 4PG2A 3TCXA 1AQDA 1TLKA 4N90E 2DM4A 4R8WH 3WNNA 5IHLB 4BFIA 3BD5A 1XR9A 3TVMA 3L95B 5J57B 4DFIA 3PV6B 1SY6H 1VADA 2VXUH 1P6FA 2FX9H 1VACA 4QT5A 2B4CH 5L88H 4H20L 3HNTL 4MA3B 2JIXB 4HGWA 2YUZA 3TT1L 3EYUL 4HWEL 2NY6C 3CH1B 5LJYH 2DI8A 1LE9A 4PTTA 2G2RB 4G6KL 3GBLA 1H8OA 5GGTL 3HR6A 4HF5H 2QQLH 3CAFA 4XPTL 1EUTA 3KPQB 5DO2D 1YY9D 2YD8A 3K46A 3OR6B 4OGAD 1TTFA 2F5AH 5KS9A 5IROA 1HN1A 3QDGA 3MGAA 3LQAL 2FGZA 1AXTL 1IGTA 3GMMA 4TQEL 3TO4D 3LS4H 1FRGH 4RGOH 2CK0H 1EH9A 3LQZA 3RIFK 3UTSD 2AXFB 2EE3A 5DZOA 1A7NH 1WWBX 1PKQA 5FYJD 3RDTB 4QTHA 4F37K 2A1WL 4I0KA 2HAZA 4L8SC 2IALB 3ZKQD 1DR9A 1OAKL 1AXIB 5CLWA 3ROOA 1U91A 4MJ6B 3QCVH 3IS1X 2R69H 5I8KL 5INDB 1NPUA 3BP4A 3DI3B 4GW5A 4LBEB 1FFRA 4OT1L 2CDEB 5ANME 3UBXG 3DETC 4O4YL 5TE7H 5JO5B 1H5BA 1MAKA 3KYKL 5AEAA 3OKLB 3VXRD 1EERB 1OAXL 3F7RA 3Q48A 4HLZG 5J6HA 3OX8A 1W72A 3UTQB 2PYEE 2MFNA 5DD1L 2EE9A 4X99A 3P4NA 1HHHA 3GMOB 2DQTL 4K23H 3QWOB 3RVXC 4K3EL 2CKBB 1R3LA 3CLFH 4NQTA 2AS5M 1ZHLB 3FO2B 3D39A 3S3SA 4KY1L 1YN6A 3SDDA 1YMMD 5BV7H 4LSPL 2A6JA 3G04A 3U9UB 1ZLSH 2E6QA 2J6EH 4XP9H 4PIRF 3EFFA 3C6LA 1NFDA 3G6AA 5K9JH 2DQJH 3F7PC 2VLJE 3F5WA 3RBSA 2M2DA 1PG7W 5FGRA 3ORJA 5DA4A 5E95B 3C9NA 1KB5H 4OI8A 1HHJB 2JJSA 4JFHD 4GQ9L 2V5RA 5F1IA 4MSWA 3VD3A 1EHLH 4RWYL 4LOUC 4HKZB 4MD5A 3MV7E 2O61B 1A5FH 2VLRA 3LN4A 4RNRB 1NCAL 3U83A 3UPRA 5HDOA 2NQCA 5D1ZC 5DQDH 4P4KA 2W1NA 3KYOA 5GSVA 3GB7B 3HFML 3C8KB 2VXQH 3D69B 1NL0H 4ALAL 1NCCL 3F12A 2VDLH 4WW2F 4Y16C 4HS8H 3TJEL 4MWFB 3PWLA 3P0VL 3W39A 4NKIL 3O6FC 1WBXB 1NEZA 2FSEA 2R1YB 1BWMA 3HE6C 4WUUE 2HWZH 4J6RL 1MJJB 1LNUB 2IAMB 3LMJH 4KH2A 1DQJB 4YO0B 2VDML 32C2B 5MERB 4W6YB 1QZ1A 2BVQA 5J12C 5JMRA 4FXLA 1QLEH 5HXMA 2Q76A 1JPTL 4N8VG 5F70A 5HHXH 1FNEA 1JIBA 3JSSA 2EEDA 3ZE0F 2AERT 3ZLQC 4NQEA 1DLHA 1K5NA 4YO0A 4EOWH 3HMXA 3VFVA 1CFQA 3B3IB 3O2WL 4HIXH 5GS1A 4N0CD 1NC2B 1OAUL 4K71C 5TF0A 3QEQE 2CXKA 1MAMH 3MLSL 1ZLSL 2HTKD 3CK0L 3CUPB 3ARED 4JM2C 4PLNC 5EU5B 1NGPL 4Y16A 3WIIL 3CDGA 3IJSA 4NN5B 4RGOL 3BW9B 3RVUC 4JPVL 5CJ8A 1B3JA 2BXYA 5BXFB 5GIRA 3TPKA 2ESVE 3RZCC 4MD4B 2P8MA 5ADPH 1LO3L 3QG7H 3MLTB 1U58B 4APQC 1T89C 5ALBL 3S35L 5J11C 3WBDA 3DVGB 4RMSA 4RAVA 3QIWA 5IQ9A 4LLYB 5LXGH 2R69L 2Y23A 3O6FB 3CMGA 4U1KB 4MNQE 3C9NB 2VDRL 3OGCA 4TQEH 4DZBB 1MCQA 2NY4B 4Y5YC 3TBSA 4POUB 2ZCLL 5GIRB 4UILH 2VDLL 2YPKB 4L4TD 3MRKB 3ZYIA 1IL1A 8FABB 5F7DA 1LO5A 2VERN 2DKUA 1NLBH 1I8LC 4C4KT 4Q9RL 4JJHA 4XWOC 5F3HA 1CCZA 2I07B 5ID1A 4L8SB 4RFEA 3GSOB 4N8VB 4HJJL 1IJ9A 2DDQL 3L3JB 1GPOH 3QP3A 1QRNB 2RFXA 1FFOA 1D9KB 1ZTXL 1WAAE 3QDJB 4U3HA 4JFFE 2XA8L 2Q8AL 1NFIA 4CMMA 5FA3A 2O5ZL 3QDME 4NZTH 5HHMB 3DURA 2GUOB 2NY0C 4K7PH 1T21A 3ARYA 2BNQD 2ZOKA 1J0JA 3OPZH 5HTSA 5C0JB 3IDGB 3QDGD 1JZ8A 4FQHA 3SE9L 3ZTJH 4YE4L 5HD8D 4LPTA 5C7XL 2FBJH 5E2TH 1F90H 3ARGB 3WV0A 1NDMA 5I8EB 4L3CB 3DX6B 5CD3A 1XGRB 5FAAA 2H1PL 4LKXA 1CGWA 3BN9D 2LU4A 3NZHL 1KCUL 4OSUL 4E0RA 2VXVL 4GKZA 4XZUB 1MJ8H 2LQRA 4YHLH 4DN4L 5I1LB 3U9PL 1XCTA 3QAZB 4NGHL 5K9QI 2CLZB 5DJ8B 4UUJB 3UJIL 2ICEB 1IC7H 4FZEL 4I18A 3JWOC 1P4LB 2NTSP 1IFHH 1MCBA 4M02A 1N7MH 1XF1A 5TE4H 1NGQL 3MJ7A 4XNYH 4ZO8A 5CJOH 2EDHA 2HJKA 5L2KB 1RVFH 2DQEH 4X5XA 4M8VA 1GZPA 1OM3H 3V4UH 3W11C 2XTJD 5KVGL 5JA9A 4K3DH 3FAXA 1AO7A 1YC7A 5SWZE 3GSVB 2HFFB 4QHKJ 5J4MA 4U1KA 2VZUA 3GJFH 5IFAH 3LIZL 4XNXL 5HVHB 3FFDA 5EB9A 5I16B 1MEXH 4G8FA 4M1GL 5F89A 25C8L 3WFHB 5CCKH 5KAQF 1S3KL 5C2UB 2V5MA 2DQIL 2YBRB 5CSZA 4EI5C 5B39A 5TE6H 5E2WH 3RWCB 1HHIA 4DVRH 2AJVH 3SN6N 3ARXA 5DYOB 3DUUB 3IDNB 2Y7QA 4Q2ZB 3W9EB 3GM0A 3MLSH 2YC1A 5GISL 3V5DA 3QFJE 2ZOLA 1NCWL 5EO1B 1P9MA 1FYTB 4HUWB 4XBPA 1JNLH 2IBZY 1DEEA 1NKOA 1OAQH 4XWOD 1KJMA 4XC3H 3JTSA 3PGDB 3HCVB 4QXWA 4HIJB 4K94L 4LHQB 4ZUVA 1MQKL 2CIKB 1U8QB 3HPLA 2W65A 4NDMB 4V1DD 1NFDE 1QFOA 2KBGA 1QBLL 3RVTC 5GHWH 2O5XH 2BNQB 2UVFA 5HHMD 4Y1AE 4MNGB 1T04A 3G5ZA 5L8LB 5IJKC 1I8MA 5DJDA 2Z31A 1T4KB 2J8HA 4LRIC 1B0WA 3NH7L 2PR4H 2WUCH 3R1GH 4KK8C 5DHXB 2ARJA 4S11A 3VFTB 4PGBA 4RX4A 4U6VL 3VFPA 4YZFF 2X4RB 1EPFA 4MXQC 5DXWA 2FIKA 4TRPH 2XYCA 1QPXA 2DM7A 5DUBA 4X4XA 2B0SL 1HNFA 4NKOB 5KS9B 3IETB 1CR9L 3AAZA 2GTWB 5L2JA 2UZYB 3IFPB 2QKIB 4XH2B 3RTQA 4ORGB 1U93B 1BBJA 2ZUQB 1BF8A 4L4TE 2DWEB 5JXEA 4PTTB 1NSNH 5IEHA 3RDTD 3CSGA 1X4YA 1OW0C 2PCPB 4LVOC 1KCKA 1XR8A 5D7LA 1BM3L 5BMFL 1Z3GL 4Z95H 3EDKA 4M61A 1KFAH 3SDYL 4KKCD 3T0EA 5DK0B 2EXYD 3FQNA 2X4QB 3MNZB 1V7NH 1E4XI 4EUPB 1TTUA 3LSOA 3L3KB 4HIXL 1I7TB 1EFXD 1T22A 3EZJB 4U6HA 2Y5TA 4LEOA 2UY7A 2H26B 4PGCB 3UX9B 1IGCL 2W0PA 4P59H 1U6AH 5GS1C 5CZVL 5EUKB 4O2EB 5C0AE 2CKBH 1A7QL 2QADD 3FB6A 3V0VA 5DD0H 4P5MB 2B39A 5F6IC 3C5ZD 5EC2B 4IRJC 1BBDH 3CFKB 1F58L 3DX7B 4P2RD 5EU7C 3QUZD 5EIQA 3QDGE 1NBZB 2Q87A 2UV3A 5D1XD 1EHNA 4RAUA 4HK0A 5T1LB 1R3LB 3PGCB 2IBBA 1KYOK 3QRGL 3AC0A 3DV6B 5HJ3A 1KB5B 5EUOF 1J0ZA 4QXUL 1ZA6A 4JQVA 1JGDA 1OTSD 5JW3H 2AXGA 5D96B 5C0GA 4Y5XC 4NPYB 3FB6B 1MCLA 2AK1H 4Y2DA 2GW5A 2HJFA 4C57C 2UZIH 2M26A 4M93B 2VXTL 2IANA 3BGMA 3RQ3A 4OLZL 3PQYA 4Z0BL 3C5ZB 1LP9F 3KWWA 4FTVB 2HFGL 2VDNH 1BQLH 2ERJB 2RHEA 5CMAA 1M7XA 4UDUB 4JFED 5BJTA 1JFQL 3FB7B 4GXVH 4P3CH 5F7MC 3PIQB 5ID0A 5ICXB 1AHWC 3HAEA 1IGJA 1RURH 1A2YA 3U82B 2YR3A 3E6FA 3ARZA 1CDBA 1PKQB 2QKIA 4XH2A 3RTQB 5C08D 4Q9QH 5KSVB 2YWYA 2GY5A 2XXMB 4HWUA 3S36X 4N0YH 4EI6B 2FIKB 4I3SH 3FB7A 4FQJH 1T0NB 1K4DB 1MI5A 3VWKD 5T3ZH 4YHPA 4LLDA 3SE8L 4WTWA 4ZUSB 3INUH 5T1MB 4ELME 5C0CD 4KK8D 4AG4L 1T7WA 3VWJC 2Z91B 2IANB 2R39A 1LE9B 1B0RB 5EUOB 3MRGB 2R15A 4XNUH 1SJEA 1IGYA 3WN5B 4GH7B 3PWUB 3QIBC 1FO0H 4Z77B 3ARDC 3I84A 4NPYA 3O2DL 1JGEA 1CE6A 3GNML 3WFDH 4KKBC 1CGSH 1D6VH 1S7UA 1WT5C 4ALAH 4HULB 2XI9A 1EAJA 5KN5B 3PGCA 4HS8L 3T8XB 2XQYK 3ZHLA 1GCFA 4Q0XL 1RUQH 5CKGA 2ZNWA 5KG9B 4OF7A 1FNLA 4G6MH 3L5WB 2CLRA 3GSNH 3MMEB 1UWXK 2BVOA 4XC3L 1H8SA 1TZGH 3NIFF 5IB1A 4G42B 1TJHH 3I50L 4UV7L 3F6IA 3MQIA 4LLMA 2Y9RT 1QHOA 5I18H 1Q8MA 3BQUC 5J1SC 4NQVA 1G6RH 4R2GD 5IMMA 4W4OC 4NQEE 3WKML 4H1LA 3V4PH 3S7GA 2GCYA 2AI0L 2W60B 3E8UL 1PDKA 4I48B 1C7TA 1ZT4A 2A6KA 3H7LA 5LBSH 1QO3B 1NUNB 1R6VA 1K3IA 3U36A 4GMTL 4Z77A 2V5YA 1FAIH 2XG5A 5EN2A 5HGAA 3H9HB 4KHXL 1A1OA 2NY7H 3O41A 1U8KA 2FHCA 1U93A 2BRRL 4GLRH 2NNAB 2C3VA 4WI8A 4POYA 1EMTH 5GGSB 2YKLH 3S37X 4L8BA 4X4XB 4RFNC 2I5YL 4YEEA 1N6QH 3D3VA 4J3XA 4WI6A 5ACZA 5E2UL 4WO4D 4MJ5B 1J87A 4X98B 1NKRA 4PRIE 3SGDH 3GJFA 1U8LA 2VLRE 1EXUB 3ZYZA 4NZRH 4M4PA 1MCPH 4PRHE 4LGRB 3QEQA 2BNRB 3GKWL 1F42A 1VFMA 1AC6A 1SVZA 3CVIL 5ICYB 2YEZA 3MNWB 3IS0X 5E7FA 5ISZA 4PRNB 3HE6D 1WISA 3V4VH 3U6RB 4OQ1A 2VZSA 2PW2A 1CL7L 4UBDD 3G08B 3WXWH 3BQUB 1WGOA 5KJRH 4ZUVB 2WIMA 1CXHA 4HIEA 3VG0L 3BGFB 1TPXC 1QLRA 4LSQL 4QHLB 4KWUA 2CO6B 3DGGB 4BQ8A 1RFDH 2ZZUT 2PW1B 3P4LA 1U8MA 1DUYB 2J5LC 4YIQA 4X6CE 1UGNA 1MCOL 1YYLL 2F54A 1KENH 4P23A 1T1YB 4LP4A 5I1KH 1T1ZA 5C0EB 1I1AD 3U7YH 1L0XA 2FH8A 3O4OB 4DKAA 4LAQL 4RFEB 3ZHKA 4JDZB 3O2VH 1HHIB 3UPAA 2GAZA 2AKRA 1U2CA 1R3HA 3QI9A 4JFDB 4Z7NF 5D93B 1JI1A 3H9SB 4Z6AT 5F7DB 1AGCA 3CIQA 2Z4QB 5I19H 1JE6A 5GJTL 4ODTL 4Q97A 1HCVA 2HFFA 3F7QA 4KVNH 4PGCA 1MF2L 3KLAA 1FCCA 1OAZH 3FQWA 2FLBT 1YECL 1W0WA 1F58H 1MCIA 4X5XB 4P2OD 5J3HD 3GRWH 5ADOL 5T1DH 1QFPA 1QLEL 1FBIH 4D0DB 3H42H 4KZEH 4QHKI 1UZ8A 2BNQE 1XR8B 4MLIA 4L3EB 3ARBC 1U8HA 4W4OA 3QEUB 5DQ9B 1S9VA 3ZL4H 3DROA 2DIJA 1DUZB 1TTGA 1ZANH 3QUYD 5EOCH 1HH6A 4ZYKB 3GIZH 5HHPB 1HH9A 3ZDYE 2CRZA 2X7LA 4JKPL 4RWHA 1RK1B 2DQGH 5CD3B 3VFPB 4C54A 3V52H 2X05A 1YN7A 3VWKC 4P2QB 2FLRT 4Y5XB 3QIUD 1S5HB 4NSKB 43CAB 3PL6B 3P4OB 3TT3L 5F9WC 4U0QB 1XH3A 4X9BA 1DQLH 2IFFL 2Q76B 3FZUC 4R9HA 5FA4B 4HD9A 4K7FB 2L7JA 4LKCA 4X4MA 2H32A 3O6ML 2XZCL 1K6QL 4PJIF 3PGFH 5BCAA 5H94A 1BGXH 1TQCB 3L3JA 3DTXB 1D6EA 1FZJA 1AIFA 1T03L 5GXBB 1YJDL 4JPIB 2R2HA 3ECBB 1WQVT 4IDLA 3KPSA 5KBNC 1ND0A 2G60H 1G7IB 3L1OL 5DSCB 5EO1A 2J1KA 5J6GA 2GSGA 3JWDL 2R1WA 3P77B 2BSRA 3VXUB 2XN9D 4JHBA 5D2NB 2HVKA 1QD0A 3VRIA 4KJQD 4OZHB 2NYYC 4Z7WF 5C0IB 1UXSB 3WEXA 2YPLE 5TGBA 2C7UA 4HK3N 5B4MD 4D3CH 3VWJB 4Y8AA 1I1YA 5ERWA 2ZUQC 5F1IB 2FEDD 2I60L 1S7XA 2WUCL 3FFDB 4YHKH 2D4DA 5I16A 1NGZB 3NCJH 4IHOA 4WW2A 2J88H 2DI9A 5GS2H 3OXRA 3V79C 3EUUA 4G6AD 4D0CB 1IGMH 3H3PH 3SDXF 3PL6C 2Q86B 1PY4A 1UH2A 3NTCL 3CDGB 3MCG1 1E4WL 3MJ7B 2HJLA 3SJVE 2H1PH 3D1MC 4YGVA 4Y5VC 4S1SH 1AHWA 3OKEA 3HUJA 3GEWB 3Q6GH 4OZIB 3QDMB 1CFBA 1H3XA 2A9NL 1NCAH 5HGGS 3M07A 1ZT7A 2J8UF 2FX7H 1FGNL 1FNSH 2Y72A 4B0MM 3A6CL 3BZFA 3X14A 1JNNH 3VFVB 4LAQH 2AJZB 2WBJC 3PP3H 4M7LH 3TO4B 3NFPB 4Z9KB 3JV5A 5D4QA 2AJUH 1XGRA 3KJ6L 3MODL 2I27N 4U3XA 1H5BB 1AKJB 4XB7A 1FSKB 3HMXL 5F9OH 1T66C 2NR6D 4HIEB 3VXUD 2FRGP 3HAEH 4M00A 4NO2A 2XNAA 1E4KC 1M05B 1MLCB 3HUJF 4MNQB 5GGRY 3WUWB 5KVEL 1AGBA 1RZ8A 2E7LC 3DSFH 4XP1L 2VZTA 4PJ8D 1Y6MR 2EH7H 3O8XC 1JWMB 5SWSD 4Z7VE 3REWA 1G6RA 1XFPA 3OJ2C 3QRGH 3W5MA 3MBEC 5ETUB 5AYQA 4NN6B 2BNUB 3KPNB 3UBXB 2VC2H 5IOPB 3NAAL 2UUDK 3KYOB 3OAZK 4CMHB 3SKMB 1JI2A 1FCGA 1AE6L 4G3YH 2EIBA 3IDXL 4GW4B 4YDVA 1U3HA 5GRUH 3MLXL 2HJLB 5GJTH 1HWHB 1BEYL 5BRZA 3QDGB 1J8HE 3QISA 4XCNA 4J7RA 5D1QC 1EO5A 4K8RL 3QO0A 4JRWA 5AZ2H 2NY2D 1EEQA 3P3YA 3NZHH 4OSUH 4RGMB 5IFJB 1KJ2H 5HDBF 1AD9A 1R24B 2KPNA 4P4KC 5FM8A 4XXDA 3F6LA 3CCHB 4K3JH 4QTIH 3IF1B 1MFCH 3BPLB 3GI8L 1CYGA 2YXMA 2DN7A 3X3FL 3D0VB 3FCTB 3STZA 1Z9LA 4ZXBD 3U1SL 3THMH 3MBXH 5I66A 2X4NB 1F00I 3QFDB 4BFIB 1YN6B 3SDDB 3HTLX 5JIKA 4HUNB 4G8EA 4YFDB 2AV1B 1JNNL 1BGXL 3IKKA 2BCKB 2EDQA 2QADC 3C08H 1LMKA 1U8PB 3ZE0E 4AZ8A 3QNXB 3ARGC 4U1MB 1U92A 4GRLA 1FVDB 5M94B 1MEXL 2AEPH 2EXWD 4N0UE 2FJHA 3F58H 3TN0B 1JK8B 4L8CA 3SDAD 4DEPB 2JK5A 1RAMA 1MRDH 5CKAA 3EO9H 3GIVA 2IFFH 1A4JB 4RIRB 5JORA 3MRNB 3SDCC 1E28A 5F1NB 1HQ4B 4QKXB 1CFNA 4ZFFA 3UTTD 2XN9E 2IALA 4RA3A 4XAWL 5F9JB 1JPFA 3VXSA 4LGSB 5EOCL 5CZXC 3SDCA 4U2YA 5E6ZA 3FMGL 1MWAB 3KXFB 4ONFL 1RJLA 3SJVB 2ITCA 2F8OA 4OCXH 4F3FA 5A1AA 1A5FL 4X6CA 2W92A 1I8IA 4G80A 1UYWL 3MV8E 1ZT1A 5AZ2L 2DBLL 5ECJE 5ESQB 3FN3A 5D7KE 1S7QB 2EDJA 4OFPA 3BX7C 3GB7A 3HZMA 5CAYB 4KK6C 3WFDL 1NGXB 1PZUB 3W0WA 3UZQA 1II4E 5T1KB 1PW3A 2A74B 5HYJB 4KHXH 4N0FA 4DVBA 1BLNA 1VADB 4F2MA 3EYFA 5JOFB 4EDWL 3QEHA 3MRLB 1N0LA 3ARRA 3IU3A 4PJXF 1TJGH 5CINL 4PP1D 1A7BA 4OLZH 1G0XA 1KB9K 2HVJA 4Y19A 5DMIL 2VOTA 5KSUA 3FT3B 1XGQB 2AXGB 1WVZA 3QI9B 1GGBH 4OKDA 1IKNC 3MOQA 2EC9U 4XBEL 1JVKA 4LCYA 4X0KB 1KFAL 4PJ9B 2AAVA 1EUUA 4IMLB 3P9MA 4JZNA 3OZ9H 2IJ0C 1CTOA 3OR7A 5J7CC 3KPRE 4Q74A 1JGLL 2AK4B 4DW2H 3OKOB 1NCDL 3VD5A 3E2HC 2DTML 4YGAB 3DO3A 3PHSA 1UWEL 3V0WL 2EC8A 1H0DB 4DGVH 2EDBA 2ZUYA 3MX0A 1DUYA 5IIEB 3T65A 3LPGA 3S3PA 1IM9B 3CMOH 3WL9A 2X4SB 2LE9A 4DJMA 2JCCB 4JFEA 3WNOA 2CIIA 3RRQA 3MRLA 5FYKU 1W72L 2G75A 3EDDA 4I2XA 3LKPA 3FMGH 1BQHA 1LEIB 4P2OC 1RU9L 4HV8B 1GIGL 4AIZA 1MCHA 1ITBB 1G7JA 2A74A 3U0PA 4TNVK 5D7LB 4PRIB 4MGXA 4KTYA 2FWOA 4MJ4A 2DYPA 3CLEH 3PJSA 5BQ7A 4PJGA 2VKXA 1N5YL 5EBLA 4EIZC 5IMLA 4JREB 5C07B 5D1QA 5TDOA 2BMKB 5LQBH 4E5XB 1HEZA 4YHIA 2AABH 3OKDA 2W9EH 5ACLA 3V5KA 3N9GH 3GBNH 1VDGA 2Y36L 5IR1A 4U05A 5EO9B 3WHE0 2WQRA 2F54D 5AYUL 2RAMA 5IMLB 4LPVA 15C8L 5AAMA 4F9LC 5C0CB 1YMMA 4OD2A 4HZLA 1FE8H 1U8NB 1FH5H 5F72S 1NSNL 4LLWA 5HYQB 3QUXB 4HXAL 4IOIB 2D0GA 4P4RA 5C0BA 2IPKB 1BM3H 3CGTA 4HEME 2Z93B 4M7KH 4LEXH 4Y88A 4Z7OE 3HE6A 5J1TC 2CIIB 4R90H 4XCFL 3PGDA 5DEZA 2RCSL 3HI1A 2GCYB 2Y06L 1YEFH 2CLVB 3RWHB 5KZCB 1A4KB 4XGZB 4ZSOA 4DEPC 5FHBL 5SX5H 1GZQA 4I2XE 5HYSA 4BYHA 5EIIA 3T0EC 1YPZE 2H6PB 3Q1SL 5I1HL 3DUUA 4ZUWA 2Z8WC 4U1HB 2AK4A 3O3EB 2GT9A 4HZAA 3KYNA 2H8PB 4D9LH 5DVOA 3RNKA 2Z31D 4OLVL 2ZCKL 5F8RC 5B38G 5I15H 1CU4H 2QR0B 5CP7B 4TVPL 4HUMB 4NO5B 3BRGC 4WFHD 2Q7NA 5MEQA 1I3GL 5JW4Q 4L1HA 5FDWA 3JVGA 4HZLB 3RJQB 3MA9L 5C0CA 1VFAA 5FUOH 2KQNA 3KYKH 3U0WH 1BFSA 3QUZB 1R0AL 2DQGL 4KKAD 3UBXI 3EJZD 1P1ZA 1S9KC 3UYPA 3L5XH 1DN0A 5DR5L 5TQ0L 5HVGB 1U3HB 2D7MA 3V5KB 3FN9A 4HGKC 2G5BB 1UM5H 2NY3D 3EO9L 3UZVB 4LPXA 3NA9H 4HG4J 1G1YA 4CNIA 2AJVL 5IBLD 1NH6A 5I30H 2VSCA 5DRXB 5CEYB 3QXDA 4KJPC 3BZEA 1FC2D 3QH3B 1T20A 4XNZC 4U1IB 1VESA 3CZJA 2DKMA 3ZT5A 2Q7YA 5LAXA 3EO1B 5E8DL 3NPZB 3BVNA 3PABA 5INCB 5EPMB 2GJZA 4FS0A 5IFAL 1KCRH 3SKOA 4XCFH 3W82A 2G75B 4R4FH 2GYSA 1J11A 3JV6A 2JB6A 1NEUA 4LSTL 3SKJH 3TNNA 4BFGA 4AG4H 1HINH 1MQKH 2XKNA 3QA3A 3GSWA 3ROLA 2W9DH 1KXTB 1UC6A 5H2BA 3K1KC 5MEOA 4PGJA 3CFDA 3GHBH 2KQMA 1I7RA 1NCUA 3DRTA 5JLZB 1WCQA 1P53A 2ZUWA 1KB5A 3CXHJ 1FFOB 3RUGE 5C07E 3VG9C 2DICA 3ZDZE 1GVIA 2X1QA 1CF8H 2EECA 1YMME 4KQ4L 2P8LA 3MR9B 5TF1H 5E99L 1VENA 4RDQF 2J6EA 4OFYA 4TSCL 3MRMB 1R5IA 4L4VB 1CFTA 2VUYA 1TJHL 3I50H 1EHLL 5GRJH 3V52L 5D7IE 4W81A 5BO1L 4LGPB 2XWTA 3CSYB 4MQXC 2HRLA 1W8NA 3BEVB 5L0QB 3NPSC 3TZVC 1T22B 2OR7A 3C5JA 3KJ4C 3L3OA 2LTQB 1G0DA 4X9FA 1YUHA 4LCWA 5E70A 4WTZA 3QUYA 1UXWB 4M3KB 3RFZC 4JEGB 1OP3H 1HHKB 3NIGF 2V2WB 3CCHA 5I75B 1AI1H 1N3NB 2P8MB 4EBQH 2WANA 3IVKA 3RHWK 2X4PA 4EN3B 4OZ4A 1IKFH 4Z5RB 2AW2A 5GRVK 2APVA 4R90L 3WHXA 4F7PA 1H3UA 2AK4D 1S7QA 3VXUA 1GGTA 3MLYL 3TP4A 5HGHB 3BW9A 4HPOH 4OZGA 5IF0B 5LGKA 1F45A 3B2UC 1HZHL 4NJ9H 4XPGL 4G80B 15C8H 1A9EA 4OBSA 4ZNCD 4MNGE 1J0HA 4QOKE 2R8SH 1ND0B 4N1HB 2X4OB 5HGDA 5SV3A 1NC2A 3JWDH 2DD8H 4XC1H 3DHJA 4N9GB 3O6LL 2MKWA 5SWZA 2EXWC 4U0RC 3I3EA 3KPRA 1JHLH 4PJEF 4XT1C 4CVXB 3LEVL 1MLBA 4G43B 4TTGA 5HYJE 1INQA 2DTSA 4M93C 3VXPB 2GKIA 2YN3A 3KPSD 3STBA 4P9HC 5T1KD 3WXVL 3TH3T 2WWMC 2XNAB 5D93C 3TJHD 2WBJA 4ISVA 1UZ6F 4P59L 1L7TH 4UDTA 2IH1A 1IAIL 3QPXL 5FOBA 1T1WB 1M71A 2E5EA 3R0NA 2B5IB 4HIJA 2AABL 1AKJA 1GGUA 4WJ5B 3OB8A 4UILL 4OGAC 3T2OA 3WO3B 4XTRC 4HGMA 4WI7A 2AQ1A 5HI3C 1CXEA 3WDJA 2R2CA 5H37G 1JWSA 4ETQA 3NFPA 5F93C 1IC4H 2E8YA 5E00A 1UJ3A 4G7VL 1X44A 4WWKD 4MVBD 4DCQA 3GGWA 3T1FA 2FJFB 1MFCL 4CW1B 2ADIA 4PS4L 1Q9OB 1FIEA 1MFAL 4YX2L 4CJ0A 4X7SH 4UINH 3WSQH 3N85L 4I5BA 3VXRA 2JB5H 2R1XA 1IT9L 2ORBH 4JO4L 2DS4A 3UPRB 1OQOA 4DAGL 3KPPA 3PP4H 5MP6H 3PUCA 2W0KA 3IDUA 5DFVD 1A6PA 4KV5F 3HC0A 3OAUH 1SYVB 3QO1B 5AZEH 1ETZA 4PRBB 3C60B 3TJEH 1CXKA 1MF2H 2XTLA 3P0VH 1YNLL 2BSTB 3T3PE 1GC1L 3T4AA 4GJTB 4G5ZH 5BZWB 5TJWK 3WLWD 1PQZA 2HT4D 4RZCB 5D1XB 2F53D 1KLGB 4FQQA 4H20H 4LSUH 2F53E 4P23B 2XT1B 1IBGL 5I15L 3IDJA 4KKLD 4GG8A 2IQAB 5GPRA 3GO1H 2VLMD 1XIWB 4BSWB 5DD3L 1NCBH 4XPTH 3EFDH 3SKJL 5HGBB 4L1DA 3UC0H 3IRZA 4JDVA 3LQAH 3KR3L 1HSAA 2EYSB 4JHAL 4UNTA 5JNYA 3TWCH 4M62L 1KTKE 1J1XL 4UDTB 3G08A 2NY2B 5B3JE 1CZ8L 3K1DA 1J8HA 3ARDA 4DTGH 4Z7UE 3QIBA 3O3BB 2VLJD 4KRPB 3P4OA 3PHOA 3S98A 1FDLL 1F02I 4BZ1L 1KPRA 3FQRA 2BXZA 2GITB 4ZS6C 3BT2H 3IGAA 2A6IB 2GFBA 5GZOC 4CNIB 5HY9A 3FO1A 1LVEA 4ZAKC 5F71A 5IBTH 4HPOL 4LRNH 3IDMB 2R56L 2VL5A 1NANI 1EGJH 1HSBA 3SKNA 4DOHE 3CNKA 1ED3A 1G6RL 4JCMA 3MRIB 2EO9A 1HH6B 1KCRL 2VXSH 2Q86A 3OAUL 4LPUA 4U1GB 1SEQL 3ULUD 5EZLA 3VXOA 3ZO0A 5E6IA 6FABL 1RIHH 1MELA 5ANMB 3S88L 4PB0L 1QA9B 4EN3A 3C60A 1S9WA 4JO3H 4NFBA 2XACC 1A14L 4L3EA 1UZ8B 3O45A 2XPGA 4K23L 4HKJB 2C9AA 3CXDL 3PWVB 1YUHB 1A7PL 2ESVB 2N4IA 1PVHA 1MJ7H 3PXJA 4TVSa 3D2UB 2ADGB 3ABZA 4OIIL 4XVSH 5FYLD 3TBYA 3VGGA 4PJHE 3D25B 5KJRL 2DB8A 1KEML 3WCYA 5JQHC 2MQ0A 2GT9B 4WUKL 2FYYA 2H32H 5CUSH 2VMFA 3BWAA 2Z8VC 5C1MB 3LEYL 4OZIE 4XVTL 1AGCB 1KACB 2QSQA 3IRPX 1KIRB 2DD8L 5DC0A 1N6QL 2GTZB 3EOYG 5GS3A 1IEBA 3LRGA 4QTIL 1TVBA 1GOFA 3WLWC 1C5DB 1EBAA 4QRRA 3LPFA 3EIFA 1OCWL 3QQNA 4JRXB 3TPUB 3RHWF 3GKWH 4F9PA 4MB4A 4POZD 3OKKB 4EUPG 5FA4A 3VE0A 3CVHH 4GXUM 2VR4A 3IFOB 2FX9L 4KQ3L 4KUCF 4R4BA 4K7PX 1LEKB 5FYJH 4XP5L 5I6XB 5L2KD 4LSQH 1XGPA 3UTOA 4R26L 1YC8A 1XF3B 2WZPD 1OTSC 1KIQA 2OCFD 5D7JD 5EPMA 3A0OA 5FHBH 1QFWH 5K59E 5HHOA 3QUKB 4M5ZL 4N1EA 1MIML 3F65A 2DQCH 5IBTL 3V6BR 1T0MB 1AGFB 5DD0L 5ISZB 5LG1A 4IRSB 2I24N 2HT3C 1AFVL 4F80A 4MWFA 5KSVA 3BD3A 4ZYKA 3HNTH 1ZWIB 3MROA 2YPLA 3ZE1F 4G6FD 4KRLB 4ZQKB 4M7ZC 2YRZA 5FYKD 3MLUH 1AR1D 4KAQL 3DOSA 4JFHE 5FKPA 3V6ZA 2RBLA 4L8BB 4MNHA 5D7IB 3DVNB 4YQXH 4KTEH 5CZVH 1UB5A 4LCWB 1ONQA 4F7MB 1MWAL 4QRTB 4EI5A 3VGAC 3ALXA 4AL8L 4EEEA 2DM2A 4JN1H 4MXVE 1I85C 2GJ6E 1HHJA 2YK1H 4MQ7A 3RGHA 4J3VA 3WL9B 3VI4F 3KLHC 4WU5A 4G5ZL 1S7WA 3GMLB 3K8LA 3F5WB 3EYVB 4M5YH 2Z4QA 2VLKD 4K3JL 4N5EC 1JTTA 1QRND 4TYUA 4I3RH 4KI5E 4FOMA 4KI5D 2CGRH 4OCYL 5CWSA 2W0FB 3S35H 3RAJH 3L3DB 4FXGA 4Y2OA 4O58H 4PJBE 3S5LB 4ONHB 4YK4C 5AAWA 2PO6C 4NQVB 1A1MA 3BUYA 1IEBB 3P4NB 1FORH 3VA2C 3OF6D 4CADB 2FX8H 1FL5A 5F3BA 1N4XL 1A4KA 5FO8A 3SE8H 1T2XA 4MAYB 4GRMA 4TUKH 4DWHA 1F4WH 4OB5H 1A6ZA 5EUKA 4X80L 5E8PA 3G5YA 3CPLB 2MPAH 2CDEA 3MV9A 4GQPH 5DUMH 5HYSG 3BQUA 1ZHKA 4MA8H 1FE8L 2BFVL 3PWVA 4DW2L 3ROOB 2V17H 4JFEE 2CMRL 3VMPA 2P47B 1OF2A 4J3TA 2Y4SA 1IGYB 3WN5A 5TH2A 2VLLA 2VZVA 3FQTB 2X2YA 4UZGA 4HUUB 3RDTA 2D3VA 2NLJA 4QNPF 1BVLA 2JF1A 5IBLC 1ACZA 1WT5A 2DI7A 3SGEH 3BKML 3OKMA 3KDMB 1PZ5A 5DQJA 4RGMC 1ZLWH 3NTCH 3HG1A 5MHSE 2JJTC 3MUGA 1T66D 4LIQL 4UTBH 5IHBA 1HOCA 1QQDA 5F6IB 4AEHH 4TN9A 4XP6H 1HDMB 2X40A 3VFTA 2NNAA 3KPQA 2NLJB 5T5NF 1FL3B 1XIWC 3P0GB 2YK1L 4EDXB 1GYAA 1F4YL 3FQRB 2JE8A 4Z0XA 3BDBA 5IBUG 5FGSA 4ESKA 5I1AB 1CFVH 4ERSL 4CJ1A 5ID0B 4Y5YA 1WWWX 3MV7A 4UAOC 3LD8B 4LLQB 5DJAB 3FQUA 1I7ZA 3QG6A 2H3NA 3IDIB 3KJ6H 2WINB 4N8PA 3MRNA 3AVEA 1YPZB 3QEGL 4I4WA 4MDIA 4PJXA 2B2XL 1U8IA 5HGBA 3TPUA 1JK8A 5CJOL 4F8QA 3GM8A 3CVHA 1FJ1A 4Y2DB 4PRAB 4PJAA 4GSDL 4NFCA 2OMNA 4WFFE 2D7OA 4HIIB 4O51B 3MOBH 2IQAA 3N50A 3KPMB 3T0ED 1BQSA 2E7MA 2CK0L 5FGCB 4XMKL 1B2WH 4CN6A 3CJJA 3MMEA 2X89D 4JFDE 3NN8A 5JUEH 3ULUF 2V5TA 3EGSB 3H9ZA 4KI5C 4NHCL 2OTUB 3IFNH 3H9YA 3BAEL 3QHZL 3HA0A 1MCKA 3SGKA 4FMFA 2J5LB 2AV7A 1GRWA 3OJDA 1UB6B 3FKUS 2FD6H 3FT3A 1P7QD 4O5LL 5C0BB 5I1GH 1QYGL 5E5RB 4PP1C 1F11B 4JG1L 1B6UA 1WCBB 3FT4A 3L3IB 4LFHG 4WI4A 3VFWA 4YR6A 4OZHF 4OJFH 1UWGH 1RFDL 4ODXA 4FQJL 5A3ID 3F7VA 5T5NG 4NUGL 4R2GB 4HK3J 4LARH 4OM1H 3LKNB 2ZCLH 5T1KA 4NZJA 4L4VE 3NMEA 4G8GA 3Q6FA 1CDGA 1VGEL 3HG1B 4GBXB 5FO7B 2YA2A 5JOPD 1VSCA 2R2EA 4KAQH 4PRID 3T77B 2VZOA 3RWGA 5DJ8A 1KJ2B 3N85H 4RGNB 1CLOH 1BVLB 3MTRA 1AE6H 3G6JF 1KEGH 3PP4L 4MQSB 2PTTA 5TQ2H 2DDQH 2BDNH 4HUUA 5KVFL 3DMMC 3LN9A 1B0GB 5I0DA 4PD4J 5TF1L 3GNMH 3R8QA 4DUXA 1JYXA 2V2XB 4KPHL 1OGTA 1AGFA 1GGCH 2WUBL 3ARFC 3UAJC 4U6VH 4OCWL 2AJYH 3SO3B 2QQNL 4EUPH 3WE6B 3TO4C 4OUOA 3NA9L 1O7SA 5GS0D 5GS0H 4Y16D 4GG6B 2LV4A 4OCYH 1P9MC 1OWWA 4X83A 1SYSA 3O3AA 3AUVA 4CADA 3O0RL 4XNQB 3UTSE 4MYWB 2PXYC 3BPOB 4YBLB 1YEKL 1F13A 1WZMA 1L7IL 4NJAH 5E94A 5FYJE 3S5LA 1AH1A 3MLWH 4PJ5D 3HUJB 3EDJA 4LVEA 1RV6X 2WWKO 3P9MB 5EBWA 4NBXB 2ICWA 4WVRA 4RQQB 3IAPA 4O5LH 4ZUUB 2EH8H 4YH6A 4FP8L 5CBAB 1INDL 2YPKA 1KN4L 1KTRL 4CMHC 4Z7QE 2X4PB 5D70L 1R3KB 1FIGL 3QBTB 4QCIB 4YNYA 5E8OA 5EZOH 1YDPA 4L3ED 2F15A 1HHKA 3QO1A 3UJIH 2PUQT 1EHXA 4HQQH 3VXTB 4D9LL 3ULSB 4Q6IA 5DFVC 5KSAC 3NOIA 4X6CF 2W38A 1DQQB 1TQBB 2BVTA 1W0YT 1RK0B 5D2NE 1KPVA 4P4KD 3GSVA 5EU7E 1RD6A 5HVHC 3S97C 4ZQKA 2FJFA 5KVGH 4FQXC 4HUVA 2IANE 5JXAL 2JTDA 3CVIH 4OCXL 4GSDH 3H9SD 4PJ9C 3MJ6A 4M7JL 1I1CA 4LCIL 1BX2B 4X6DE 4JM4L 3SKNB 2NXZB 5JPNA 1QSFE 1RUKL 1EBPA 1G7IA 4U49A 3SJVA 4KK5C 3I75A 4PGDA 1TZHB 5KVDH 1CFVL 4ERSH 1IC4L 1NGWB 1A21A 1D6EB 1FZJB 1TENA 4XMPH 4XX1G 4K07A 1BZ9B 5FOBB 2HTLC 1G6RB 1WZLA 5DT1L 4X5LA 3TJHC 2BX5A 2C1PB 3JTTB 2QEJA 3CC5B 2YSSA 1XIWD 3MV7D 3T08A 3PGFL 2R2BB 1R3JB 1TVHA 5K9KA 1JRHL 1OAYL 2XKNB 3EDFA 3ZKMD 3TNNB 2ITDA 1NC4A 1NCWH 3GI9L 3U7YL 1KB9J 2IMNA 3LKSA 4J3OC 1T1XB 3BDYH 4D94A 3QIUC 4UT7L 3LV3B 1W8OA 3VGEA 3BVNB 3PABB 3H0TB 2D7NA 5IVZB 4PV9B 3O6FD 4QXGL 4OZFH 1RK1A 5F7HA 1HINL 2AEQL 1QNZH 4GAJH 2XKSA 4PJ7F 4FQ2L 1B0GA 2ZOLB 2YD7A 1QSED 5SX4I 1X5KA 1UJTA 5CEYA 4K3EH 3H7BB 5DC4B 5IMKA 1QRNA 1KJ2A 2WW8A 2VLKA 2DF3A 3J8F7 2G5BA 4OZ4B 4H1LG 3ETBF 2DQHH 3QDMA 4NNYA 4W6WB 2VYRE 2XZQH 1FVEB 5C0RL 3H42L 4KZEL 5KVFH 3QQ4B 2FJGB 4Z76B 3W5NA 3HI6L 2YBRA 5CSZB 3ULSA 3OBAA 3QXAA 1JBJA 1YEDA 3V0AC 2KH2B 1AXSB 4JFXA 4UBDC 5IHUH 5DHYB 3G6JA 35C8H 1AGDB 1QFWL 4AQ1B 1CXIA 3G6DL 1YEJL 2F8XC 2BY0A 3U79A 3UTZB 4UB0H 4GRWH 3GIZL 1JZ2A 2HFEA 4ODSH 3TWCL 5T33L 4RSVA 2F5AL 5C9KA 1U6AL 4HXAH 4JRYA 1F3JA 4U0RB 2EIDA 4JO2L 1TJIL 4TULH 2OTWA 3IXTA 4G6FB 5F9WB 1KULA 1E27A 3PDOA 1HE7A 4JY4A 4OZHA 1IZJA 4PLJD 2CKBA 4FQIL 4ODVH 3LN5B 5L88L 1VGKA 3MA7A 3B9KD 3O4LA 2HN7B 3TF7C 1IKFL 2H45A 2FD6L 4Z7WE 3IFLL 3BPLC 5HHOD 2GITA 1TQCC 2YD3A 1WZKA 4P3DA 4ZPVA 2XFXB 5KVMC 2IWGA 4ORZC 2OZ4A 2BRRH 2WBJD 4NO0D 2R2HB 3ECBA 1IAKA 2AXJA 3DGGA 4UU9A 3FN0H 5FGCE 1KC5H 1YJDH 3B9KC 1SBBA 4NZDA 2APTA 3GMQB 1WTLA 3MFGB 3CFCL 5ICZA 5IB2B 3KPOA 5HHXL 5D2NC 4XHQA 2VAAA 1DE4A 5I1EL 5JNYB 3S88H 2E9WA 5FYKE 3BHBB 1Q72H 4NCDA 4M03A 4NO0B 1S3KH 3K8KA 4NJAL 2NY0D 4U1IA 2QSTA 1XIWA 2AJXH 1MQ8A 3VI3E 4KJPD 3MJ9H 2QQQA 5IB5A 2ADFL 4KRMB 3CLFL 4JFFD 3D6GA 1G7LB 2ERJC 2ZPKL 1UWXH 5J9PA 4JB9H 5F7EH 3FHAA 5JHDE 5C2BL 3AU1B 1GGIH 4S1QH 5M7QA 5IM7A 4G8GB 1J12A 2DMKA 3VG0H 2Q1EA 1NAMB 3FFCB 4E5XA 4L5FH 5E03A 2XQBL 5TDOB 1EEYA 5C08B 1IQWL 8FABA 4UQ2B 2BVPB 3D39D 3QG7L 3ILQC 5KSBF 2C4FU 4Z5RA 3RVWD 2B20A 3KPLB 3FT4B 4ZS7H 2FWOB 1XEDA 4UTAL 2HH0H 3UJJL 2VDOL 1CI5A 3A6BL 3DARA 4XI5C 3PWNB 1YEKH 1KCVH 2NTFB 3X3GH 3MNVA 5E4IA 2NZ9C 3SOBL 1NCTA 1UXSA 5I1JH 1H15A 2G5RA 3RIAK 4GRMB 4QWWD 5JW4N 4PB9H 1XGYH 5IMMB 4LSDA 1V5JA 1P7HL 3BH8B 4FP8H 4ELKB 4G42A 4WUUB 4TRPL 3T2QA 2Q8BH 2CDFB 4U1NA 4MZ3A 3HR5A 4OAWA 4X7TB 4L9DA 4ZO9A 3W0WE 3KHQA 5IW3A 2HLFD 4BH8B 1MJ7L 5E94B 5T1LD 1PKOA 4KGJA 1LEGA 2Z93A 5MENA 4LKCB 1I1FA 1JPTH 3VFUA 3EYVA 3SDDD 5DWUL 4OIAA 5EUOE 3TESA 1JRHI 4HG4K 4LLWB 5HYQA 1MLBB 3MV7B 4G43A 4RAHA 2CJUL 3IYLW 2OQJA 5F7LB 1SM3L 1S5HA 4BKLB 2EDXA 2NX5E 4R0LC 3SDCD 1IARB 1OCWH 3MOBL 2F5BL 2F74B 4PGEB 4FFYL 1PEZA 3VWKA 1RUPL 1WZ1H 1RIVL 1F5WA 3MXWH 4CU6A 4DTGL 1V3JA 3MREA 1EJOH 1HEZB 3BZEB 1UQSA 5FV1L 3N0PB 3NZ8A 5CBEA 1EXUA 4X8JB 3QQ3B 2CUHA 1VHPA 5TE4L 4N0UB 2X09A 3BSZH 2VN7A 3O6MH 2WBKA 4D8PB 1DBBL 5HYEA 3DXAA 4IBLT 1KJVB 2R29L 3T3MF 4NRZA 3TIEA 1UG9A 3ZSTA 2D03H 1PEWA 3LKNA 1Z9OA 4KJWD 3V8CA 4I0CC 1LEIA 3IXAA 3ILQD 3BGMB 5TDPA 4TULL 3X12A 3L3IA 1NDGA 3VFWB 4X6FB 5F9JA 3HE7B 6FABH 2E27L 2QJDA 3ZT6A 2BSED 4H1LH 4MA1B 5IESH 5MENB 2AV7B 3WDIA 1BP3B 4I48A 3OB0H 2V2TB 3EHBC 3D39B 3GSNA 5ALBH 1KENL 5KAQG 4BH8A 1ZMYA 1WICA 4Z7UF 1PX3A 4PJFE 3OJVC 4F33B 1QKZH 1MVUA 3OV6A 1MRFH 4HFUL 3P11H 4WUUA 4I3SL 5HYIA 2J88L 4HUXA 1Y0LA 4Y4FB 5J6HB 5EU3A 3WUZA 4ZTPL 4PJDE 2P49B 1LE5B 4Z78B 4F57L 1H15B 3D25A 4PS4H 5ESVA 2H26A 1YPZA 2G9HA 5TDPB 2VZ3A 1OGAB 1REIA 3TO2B 2DQDL 4Z7VA 5DK0A 4PJFB 3UJTH 1A6WH 3OJMB 4FQ1L 3DBXB 4QY8B 3VDAA 4JQXC 4JY5H 4Y5YB 4WGWB 1UA6L 3D39E 2HG5B 2DQUH 4XMLL 4BH7B 1YMMB 4LASL 4J1UB 5DMKA 4FHBD 3N9GL 4KC3B 5IROC 5DRZA 4C58B 4X8JA 5A2IH 1ZT1B 5EO9A 4YDJB 5D6DA 1HOCB 4TPRH 3HS0A 2EDWA 1T0NA 3MREB 3ARBB 3RX5A 3ZMRA 4A6YB 3Q1SH 1RHHA 4EDWH 1C1EL 4ZS7L 4HWZA 4PGBB 1URLA 1F2XK 3UBXA 1NJ9B 1FP5A 1TJGL 3D85B 4LHUB 3LB6D 5DJDB 1FYTD 4KVCH 3G5ZB 4BH7A 3EOTH 4JM2A 4M6MH 2J7LA 3U4EB 4Y4HB 3DV4A 5IWLC 3VD7A 5IESL 1PD6A 4JZJB 5CSBA 4WHDA 2ARWA 2HMIC 4D9RD 3GKZA 3VXMD 3WIHA 3FJTA 2V7HB 1F4XL 4M6NL 3GFUA 4OCSH 4TOYL 4W6XB 1A6ZB 1K8IB 2D7TH 3KYMB 5CIPB 4IS6B 4ZPVB 1FIGH 1LD9B 3L6FB 5FYKH 1YNTB 4LHUG 2I5YH 1Y6KR 3K2UH 4N8CH 3MBED 5I71C 2H2PD 1UACH 1SHMA 2VB5A 2KKQA 2D2OA 3MGOB 1FAKT 4NYLB 3U1SH 2EIZB 5TE6L 1NBZA 1WFNA 1P69B 4OQTA 4RMQA 5FEBA 2A83A 3CLEL 1CDYA 2ZJSL 5I1JL 5IB4A 4MAYD 4JFYB 4QHMA 3RZCB 4F7TA 4HC1L 5DTFA 5BV7L 2F19H 4Z7OF 2OP4H 3RWEB 5GGTA 1HKLH 1FNFA 2HFGH 3X12B 3RWIB 4OD2B 2OI9C 5CEZL 3FQXA 1A3LH 4NUJA 1GZPB 5E6IB 3PDGA 4JKLA 4F8TA 4QRTA 4EI5B 5I76B 1I1YB 3F58L 2RB8A 2EDEA 1NMAH 2EXYC 3FQNB 4XPBL 3HZYA 2ICWJ 5IQ7H 4M6OH 3V6ZB 3HRZB 3IDMA 4OIIH 4YHIB 4JM2F 1K2DA 3LHPH 1LP9A 3OG6B 2VLKB 5D2NA 5IOPA 2CLZA 2I60H 4YHKL 4LFHD 3QUMH 3GMRB 2BHUA 3H7BA 3X11B 5A2LH 1T7XA 1CD9B 2YZ8A 1IGJB 1JWMA 3REWB 2B4CC 5DUBB 1ZOXA 5BQ7B 3KNBA 2X4RA 4LHJB 4IRSA 4NO0A 2ZUTA 1AIFB 3RPIB 4ONFH 1BIHA 4WWKB 3QUKA 2D7PA 3SY0A 4HV8A 1T4KA 2X4UB 2FR4A 4XNUL 1MHPH 2WLYA 5BO1H 1I8MB 4M6NH 5IB2A 3PQYB 4BKLA 3FL7A 1IGIH 1D5MA 4H26B 1D5BA 3W9DB 2R9HD 4FFVC 3VFRA 5I17B 2D7QA 2BNQA 2DQDH 2Q20A 1KEGL 1HQ4A 3SGDI 3T65B 2C1PA 4XVSL 1N59A 3OWEA 1JPSL 1KNOB 2AJUL 4MNQD 4EVNA 1XF4A 1MAJA 2X4TA 3HCVA 1VGKB 3MA7B 4CUCA 5KANI 2NZ9D 2PNDA 2WMPA 3TIDB 2ZG1A 4HWNA 3GJFK 3PWJA 2XWBB 3WJLC 4LMQI 3I2CL 1QEWB 1EFXB 4JKPH 3IKCB 4PJEA 5C0FA 3MBEB 5DJCA 1F3JB 4JCLA 4KK6D 4ODSL 3U48A 2F9BT 1DUZA 3OXRB 4NQDD 5DGRA 5EU6A 3TA3C 4XC1L 4LLUB 1TJIH 4PGZA 1KPVB 4J3UA 4Z0BH 4RBPH 3EOTL 2CUMA 2V2WA 4CL7A 1U8JA 1UA6H 5DHYA 5CEZE 3GBML 4NHCH 5ERWB 5I74C 5CEZD 1DBJH 1C5CL 1YNKL 3MNZA 2X4QA 1MUJB 5EZIL 3VXMB 2H2PC 3ME0A 4G9DB 2KDGA 4HKBA 1J1PL 4UV4L 1AD9B 3DYPA 4ZDHB 3N1MC 2NY6B 5EU6B 5FFLA 5SWSB 4L4VA 4DCQB 5D1QD 4POZC 3BRFA 1XZ0A 1A3RH 3DX9B 4LHUD 4LQFL 4RQQA 1ZVYA 2GSGB 1DFBH 3FFCA 2DLTA 3BYTA 2P8LB 3MR9A 2C5DC 1CLCA 3N1FC 3O3UN 1JN6A 3ARBD 4JPIA 2C3GA 4RGND 4WJ5A 4XVUC 4DKDC 4O58L 4JFPA 4EVNB 2C4FT 1YA5A 3IJYA 3NABL 3A6BH 4YWGL 1NAKH 1MRDL 3HZVB 4UT9L 1KCUH 2XZQL 2RJMA 1J0YA 1K3ZA 2FECI 1MWAH 2UYLA 2E8ZA 1CGVA 1CD1B 1C08A 1JGVH 1SMAA 2MCPH 5KOVC 5LQBL 4Q9QL 3JTTA 5KSBB 5EOQH 4YZFE 5CD5C 4RIRA 5JORB 1BFVH 4HWEH 1DQJA 4P23C 4YXLH 2EYSA 4FNLH 2IAND 1ZHBA 1KCSH 2FJHB 1RVFL 4EJ1C 2X7LB 5GS0L 1TZGL 3TO4A 1FVDA 4P3DB 4NQDA 4PRPE 1F3DH 2HFTA 2WLZA 5DRXA 1D7FA 2WSKA 5MP6L 3OTTA 3LRSA 5GSVB 4MXQD 4GBXA 5E9DD 5FO7A 5F1OB 4PJEE 4UIKH 1N3NA 1SJVA 3UAJD 3C87A 4DN4H 4NNPH 2XY1A 3CD4A 4YHLL 4S2SA 1T3FA 4HKZA 4MD5B 4HDIA 5EZIH 3V6FB 4C83B 2O61A 1HILA 3D0VA 5CZXD 1YEFL 4NKDB 3OSKA 4ODXB 3VW3H 1J1PH 3C5JB 1I9RH 5GZND 3NCMA 3VU2A 1X5YA 4DZBA 1XF5A 5IQ7L 3TVMD 3OGCB 1DLFH 2XWTB 5DJYB 5ADOH 1KN4H 1XGTB 1F11A 1AO7B 1RULL 1MCNA 3WFEL 2YRPA 3SPVB 2AQ2A 4QRPD 1A6AB 2YKLL 2C3HA 2R8SL 4ZUTA 5E8NB 3FO9A 4LVNC 3U30C 1FDLH 3FB5A 2DJ4A 4BJLA 3Q5YA 1W0VB 4B7LA 4H1LB 5CJ5A 1KOAA 1DJSA 1OQXA 3B8YA 3CDYA 3MV8B 1DBBH 4G9FA 1XCTB 5CP3A 1OP5H 5IW1A 3V9FA 3SGKC 5A43C 3KR3H 3L6FA 5EIIB 3DRTB 3AROA 2NY5C 5T33H 3SCMA 1WSST 3MRCB 3EYSH 1IVLA 1B2WL 3U0WL 5DEGB 5FK9B 2OMBA 5BV7B 4LSRL 3GDBA 3QA3B 4WI9A 3JV4A 1RUKH 3E2HB 4NNXB 4ODWB 5D2LE 3G9AB 3ALPA 4P5TB 3BP4B 1SEBA 1KJ3H 5E5MA 2VDKH 2FZ3B 1NC4B 5D71L 4LVHB 3TYGH 1JYNA 4PRNA 3PWPD 3I6KB 2GUOA 4PJ5B 3CC5A 3SDAB 4Q9CA 4NC2B 2W07A 4F15B 1ZA3A 3KLSA 4JPWL 3BXNA 3D85A 3WSQL 1LNUA 1NJ9A 5JA8B 5E7BA 5ITBH 5E1AA 1T0PB 2AEIT 2R2EB 4XHJD 4KK5D 3I75B 3S4SB 3P73B 4GAFB 5H35B 4DN3L 1U95B 5AZEL 5JIPA 3FOLA 3ISWA 5DURB 3S3JA 1VKXB 3DMMA 4QRQA 3OKMB 5GGSA 1MHPL 5DVMA 1QLFB 3VW3L 4BSVA 2P5ED 4FQ2H 5C07A 3UEZA 1FG9C 2GJ6A 3VXSD 3QWRD 3WNMA 5HVWA 2OL3B 3V6OE 4R7NB 3CH1A 5EBMA 3RX8A 4YC2B 1ZSDB 5CMAB 3MLRH 4WUKH 1MUJA 4ODHH 5IFHL 1B4RA 1YEEH 3TT1H 5JHLL 5D5ME 3ZKND 5IT2H 3FQWB 1I1AB 3MRPB 5DEFB 2DQJL 3KLAB 5DMGD 5DHVB 1Z5LB 1AQDB 1BJ1H 2WV3A 4HEPG 1FVCA 3B4NA 4P46B 5IIEA 2SEBA 1JYVA 2NCMA 4YFLF 1H3GA 1R5IB 1CT8A 4YPGB 5C3LD 1SVCP 4PBXA 4YAQB 1H0DA 3P77A 2R1WB 3Q6GL 2H6PA 2D0FA 5IB1B 3EYSL 3G9VA 3G04B 2FATL 1ZEAH 2P46B 5HHNA 3N1PC 5IG7B 5C09B 3SCMC 1AY1H 3B3IA 5JXED 2OJZH 3K4AA 1T1YA 1CFQB 2X4TB 3UROR 1XMWA 5JW4M 4QRPB 1FFNA 4FQXD 1F97A 2WINA 1GL4B 4I0PD 3AFLA 4WHYG 2FECL 2JJTA 1IFHL 1HI6A 4F7EB 2E9BA 5I8KH 2NY0B 4HF5L 3IU3B 2D9CA 4L8DA 3RVVC 5I6XC 2NXYD 3FT2B 1D5MB 3LKRA 2DIAA 4XPAH 5C86A 5JW5B 3QZWA 5CGTA 4LBEA 2VDQL 1I3GH 2VWEE 3GK8H 5B8CA 4QRUA 2PETA 1PY9A 2EH7L 1QQDB 5IR1B 1FZKA 1ZGLB 4NN7C 4M6AA 5E4EC 3TLRA 3UP1A 1T7YA 1LHZA 3QH3A 4FG6D 1BREA 2DMBA 4NWTH 4OZFA 3MYZA 5BVPL 3WS3A 3QUZC 1M7DB 4NRXA 3AAZB 4QF1B 4QRPE 1A2YB 4OFYD 3JWOL 5C08E 5FIEA 4PJGB 4EZMA 5FCUH 3OGOE 3VWKB 5K9JL 2O5ZH 5KSAA 3T4YA 4PR5A 5JHLH 4QHUB 5DO2C 3DI2B 1RZKC 3MXWL 3S96B 4RMRA 2MPAL 3EJYD 5JW5A 1MH5A 4R4BB 1CLYL 4MZ2A 3RWEA 3DGCR 3X3FH 3DUSA 2XICA 3SHSA 1OSPL 2QR0A 5CP7A 5FO8B 2NPLX 2NX5B 3L3HB 2CIKA 4MDJA 3LDBC 3WMSA 4PLOB 1JGDB 3WKMH 1HNGA 3RZWA 3SO3C 2CSPA 2XN9B 1LO4H 3L95A 3UDWC 4LRIA 2OR9H 4LDLB 4HLJA 1MCJA 2H8PA 2OTUA 5FB8A 4PY8J 3MO1A 1C5BL 1KJMB 4D3CL 4X4YB 1NCCH 3U9PH 1Q94B 2QSCH 1DBMH 4R4FL 3CVHL 5CGYD 4LDEB 2VQUA 5FYJU 4GRLB 3MRQA 2LVEA 4DN3H 1ZAGA 2YC1B 5EC2A 2Y7QB 2J8OA 4Q2ZA 3VI3F 4HIIA 4O51A 2MTPA 1SBSL 4XAKE 1DLFL 4MLSA 4AIXA 4MAYC 4S0SD 3TA3D 2ICES 3RWHA 2VUOA 4U1LA 2R0KH 4X4YA 3I6GB 4IDJL 4ONGH 5EOTB 3QFDA 2LVCA 1QLRB 2V7HA 1U9KA 4HLZH 3D2UA 4F15C 3NCEB 5INDA 4HW6A 2YD6A 4GUPB 2IPKA 4NN6C 4N0FB 1BJ1J 4PV8A 4IM8A 4PJ7B 3GSUB 4JDTL 3U4BL 5TDNB 3LS5L 2I9LB 4TSCH 3U4EA 4BQBA 2Q6WB 1R24A 5DJ0B 1X5JA 3KPRD 3BO8A 4Z0XB 5HPOA 3O2WH 2DWEA 2BVPA 3DECA 1BBJB 3S36L 4YBQC 2VE6B 4PJCF 4QHNB 2OYPA 2OJEA 4GXUN 5CHNA 1I8IB 5AUMA 3VCLB 4X6CB 2X5PA 4EN3C 2HWZL 3S34H 4YDJA 3V2AR 2PXYA 4WNQA 4MA7L 3I6LE 4FMKA 2VDKL 4JY5L 2V9QA 4MQTB 1JZ4A 3DUHA 4HWBL 4HIHB 1U8KB 2ZSVA 4OF5A 5I9QB 4URTB 1VERA 1EDQA 2YD4A 3AXL