5F9WB

Crystal structure of broadly neutralizing vh1-46 germline-derived cd4-binding site-directed antibody ch235 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
223
structure length
220
Chain Sequence
QVQLVQSGAEVKKPGASVTVSCQASGYTFTNYYVHWVRQAPGQGLQLMGWIDPSWGRTNYAQNFQGRITMTRDTSTSTVYMEMRSLRSEDTAVYYCARNVATEGSLLHYDYWGQGTLVTVSAASTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
total genus 38
structure length 220
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f9wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f9wB01
3X11B 4XCNA 4JKLA 2Q6WA 3KPRA 4RGNB 1RU9L 3GSQA 1NJ9B 2WANA 4N0FA 4NQDE 1E4KC 3T0EE 2X6MA 3HKFA 5DLML 1UZ8B 4DUXA 2C7UA 3EFFA 4QCIB 4OZFA 5B3JF 3HCVB 4XC1H 4XMLL 4NRXB 2IADB 2OS7A 1TVBA 3K46A 5LGHH 4KK5C 4MAUL 4BFEA 2YRLA 4IRJC 5DT1L 3D5OF 3RVVC 5B38B 5I1EH 5D2NE 2YKLL 3IFNL 1VEMA 1F58L 1MRFL 4CVWA 3E2HB 1ULVA 1NAKH 3KPQA 1C08A 4CVXA 4DZ8B 4OTXH 4YHLH 4XCFL 5T1KA 5H37H 4M7KL 3S98A 4FABH 2EYSB 4RWYH 3IDGB 4JG0L 4M6NH 4LVOC 5EA0L 5BOZG 4PJAE 5JIHA 1JP5A 4HT1H 3OXRB 3BRGC 1FP5A 1L7IL 4U3CA 3LMJH 1TENA 2HLFD 5KSUA 2D7MA 2JCCA 1IGMH 3DX8B 4CW1A 1CICB 3CFCH 5HYFA 4PJIE 2VDNL 3BZ4B 3MRMA 2W91A 5JXAH 5CILL 2EDQA 3K8KA 3IGAB 1YN6A 2O5ZL 4TYUA 1P5UA 3P0YL 3DUUB 4PJFF 5DWUL 5H8DA 5T3XL 1RZKC 2CK0L 3MOBL 1UJ3C 3HAEB 4HZLA 2Y7QA 4YX2H 4Y4HA 3OV6A 3QULA 3CX5J 4L3AA 5C2UB 1GIGH 4C54A 4FQCH 4EJ1C 4NNYB 1YPZE 4UV4H 3L3IA 2LFGA 5A2LH 5EU7E 5EORL 2C9AA 5T5NF 4ZSOE 5JORA 3FQNA 4E42A 4P5TC 5MEOA 1NCCH 4Y5VC 5D2LF 5TGBA 3EYOA 3UAJC 4WV1A 4ONGH 1QBLH 3IU4H 4YGAB 4C57C 3K2UH 3SDDB 3QUYD 3SCMC 1JRHI 2FX9H 4P23A 2ZG1A 2ZOKB 1MFCH 2V2XA 1A4JA 4KKLD 2GJZA 4OZGE 4JANA 1AC0A 2E9WA 4RGND 2VB5A 2APWA 1BQHG 2J6EH 4UU9B 1YPZA 1AI1L 5IR1B 1JYXA 1O5DT 2WQRA 3FHQA 3J7HA 2B5IB 5FHAH 1I1AA 1ZA3A 5LKNA 4U0RB 3UBXI 4DQOH 5ICYA 5CEZH 4UT7L 3EO9H 1PLGL 1HHIA 4H1LH 4WHTB 4JDZA 4LSTH 2F19H 4JJHA 4XWGL 2JIXB 1ORQB 1TNMA 4JR9L 3KJ6H 3HZKB 4JZJC 1IQWH 5E95B 1NBYA 3HG1B 1AGEB 3QRFM 4UNVA 1MAML 4JGUA 3G6JF 1ZHKB 2W59A 3BXNA 1F45A 1MAMH 2YK1H 1QNZL 2CXGA 3IAPA 1M1SA 3K74B 2GW5A 1A14H 3U4EB 5J6HA 4MAUH 1TVBB 2Q8BL 1FO0B 1MFCL 1RVFL 2N1KA 4FQXB 5D2LA 1VACA 4KRPB 4QHUB 3F12A 4HKBB 4LQ1A 3RGVB 1NGXA 5HPOA 2XRAL 1WWCA 4QRPA 4R7NA 2Q6WB 4KGJA 3TNNA 4PJ5D 4JRYD 3AVEA 5LCVL 4XMLH 3D0VB 4JPKH 4GRMA 4YHPB 3OKEA 4PIRF 4PP2B 2V7HB 4M8VA 5D6CA 2HFGL 1ZGLM 1UWXH 3MJ6A 4AEIH 2DMCA 3H0TA 4OKDA 5INDB 1CXHA 3GNML 1MSPA 4K3HA 3NIFE 5C0GB 4P57A 1N59A 1WIOA 3QZWA 4P2RE 1HE7A 2K9UA 4ZXBA 4QNPE 1XF5A 1P1ZA 5BJTA 5HJ3B 5EPMA 3QIWC 3S88L 1E6OL 3JSSA 5ID1A 1RJYB 3KYKH 4PJGB 3RBGA 3DGGA 3OKNA 3QPQC 1NUFA 4JPKL 3V6OE 2L0DA 3MJ7A 4R26H 2NY6C 5DQDL 5A40E 4IOFD 2Z35A 1UFUA 3SY0B 3FRPG 1OLZA 4O4YH 4NBXB 1U3HC 5I66B 5C0BE 3D69B 3UXFA 1MCHA 1KYOJ 1HI6A 3BT2H 1TJGL 2PTTB 4ISVA 1U93B 3OTTA 3EZJB 4U2ZA 2HVJA 5F9OH 2J4WH 1EUUA 1CFNA 5E6ID 3VXRE 5IHZB 2A6DA 4R2GD 5FYLE 4KI5F 4PTUA 4I8DA 2E7BA 3MNZA 5D70H 4J4PC 3WDIA 5F7DB 2NY1C 1DQDH 1J1OL 3MZGB 3QDMD 4KRPD 1AR2A 2XWTA 4YHIA 2ORBH 3ALWA 4QHMA 5D1QC 4G8GD 1KPRA 3GSOB 2XPGA 1E4KA 1X9QA 3V4PH 4OLYH 1QFWM 1T20A 4XBPB 3GUTB 5CEZL 3CVIH 4PJBF 3UTSB 4J6RH 3VD5A 5KG9A 2APFA 3MBXL 3QXVA 1PJ9A 3B83A 3BEVA 3IU3B 4ZUUB 1YEHL 4U1HA 1N5YL 2ZJSH 4ZUVB 4G6FD 1QBML 1FE8H 3AXLB 3BPOC 1Q38A 2R39A 4KRMB 4I2XB 1P4BH 4MDIA 5ECJE 1BLNB 1JHKH 4P3WA 4FQJL 2HJLB 2FH8A 1G7JB 4HFWA 4KQ3L 3G5VB 4Y19D 3ULUF 15C8H 3L7FB 3VWJA 3U0WL 3EZ8A 3KPRB 1BZQK 3FCTA 2VDRL 5K9OB 4EUPH 4GG6A 1SQ2N 2QHRH 1BD2D 3HZMA 1K4DB 3V9FA 1D9KA 5F7UA 5SWSA 1Z9LA 5DJ2B 1FZOB 4IRSA 1X4XA 5EZJB 1WF5A 4LASH 3X3GH 5T1MA 4F7CA 3DO7A 3P0VL 2PW1A 4RIRA 5I0DA 4X80H 3S36X 1FNHA 3PGCA 5ETUA 1SJEA 1QPPA 3PL6B 4BSWB 4UT6L 5SX5K 2DF3A 4GRLB 5I15H 4PRDB 1OARL 1FNFA 4NQXB 4P3CL 4PBXA 3B5GA 1U0QA 4QT5B 1TQCC 3GO1H 4NRYB 3L1OL 4YNYB 5DJZA 3ZKQD 4PRHD 5EU3B 1QO3B 1A3RH 1IC5L 2X4TB 1HILA 4IOFC 4KKCD 4PR5B 4WV1C 1MI5A 4YHIB 5K9JH 2JJUA 3EDKA 4NCDA 1NGZB 2OZ4A 4CU7A 4ZPTB 4XHQA 4P46D 1T21A 3T0DA 2SEBB 1UZ6E 5C09B 1XF3B 3QHFL 1RZJL 1Z6JT 3KJ4C 4QRQA 5EFIB 1BIIA 2F5AH 1JV5B 2DQTH 5DHVH 1AXSB 5FGCE 3ZHKA 5FM4A 3RX7A 5JW4N 1LP9B 3QP3A 4LSUH 3NMEA 2AJXL 4YHZL 1DANT 5I8OH 5FYJD 2CKBB 4UT6H 1HSBA 3CZFA 4NQDA 5CEYB 4AMKL 1W8OA 5GRJL 2W92A 3HMWL 4XCEA 4HMCA 3LB6C 3PP3H 4JZJA 3RVWC 4F57H 2LTQC 3FQRB 3IS0X 3WNKA 4Z8FL 3A6CL 4PRIB 2EC9U 1R3LB 4Y5YA 5ADOL 2NNAA 4PLJD 4TSCL 2D7QA 1Q72H 1ED3B 3NIGF 1WJ3A 1I1CA 4JCLA 2NY2B 3HMXA 1RPQA 3ILQD 1NGWB 4XNZB 4S0TD 1BFOA 4MB3A 3RGHA 3QDJD 4L8BB 5D72L 2XKUA 3NIDF 3OXRA 4RMQA 5FYJL 4NC1E 2ESVB 4C83B 4LEOB 4GKSB 1WEJH 3MV7D 4MXQC 1S8DA 2XT1B 3AREB 3JTSB 1MQKH 4OFPA 4JHBA 3TVMA 3RZCD 4O2CA 5AWNL 3KPSB 4FQQA 1G9EA 3SY0A 5HVWA 5I1CH 3RKDD 4K7FA 4NQXA 4XNUL 3EDFA 4Z7QF 5IFAL 3LS4L 1CD8A 4HCRH 4HWZA 3T2QA 2EC9T 5IWLA 1D5MB 4LMQI 5IMKB 2IANB 2AK4E 2BNRA 1MH5A 4WHYH 3WYRA 1WCBB 2Y06H 5D7KD 3HAEA 4NJ9L 5I19H 5C0ND 4MQ7A 2DQUL 1MCJA 4IRSB 3KPNB 3KWWB 3B2VH 4WUUE 3NPSC 5JIKA 2AJUH 5J11B 5F3BB 3KG5A 4XP4H 5CD3B 4O51A 5IW3A 2V7NA 1ITCA 1QFHA 4J3SA 1JWUA 4WW1A 1PG7X 4XX1E 3DSNA 2YEZA 1BZ9A 5L2KD 3KPTA 2EDBA 2KZWA 1NC2A 1TTGA 2V2WB 4Q58C 3QDGE 2OTUB 3C08L 1LK3L 5F93C 4TPRH 5CWSB 1LEIA 4D8PB 3WIFA 3KPMB 3U30B 3AS2A 4NQEE 1OAKH 4UU9A 3QNXA 3BN9D 5DT1H 2FYYA 4H25B 4R4FH 1EHLL 1KTDB 5I15L 5F97E 3QO0A 5ID1B 1S7RB 1WVZA 2ICWI 4RMRA 1GH7A 5I2IB 3GI8H 5E1AB 2H6PA 3TVMC 1II4E 1KCRH 1SYSB 4OF8A 2R0ZH 4G8EA 3BDBA 3NCJL 5JW4M 5EBWB 3RL2A 4ELME 1K4CA 4NQVA 4HGMA 4K3EL 4OUUB 2Y23A 1Y6KR 4DN3H 1B2WL 4YHPA 5DK3A 4DGYL 2HJFB 4GQPH 4K3EH 1H3PH 4O02L 2D0HA 3MUY1 1CIUA 3LKPA 3DXAE 2VXSH 4LLDB 2NYYC 4X6DB 3WSQH 3ZE1E 3O6MH 2UZIH 2NCMA 1S7QA 2BZDA 2AJYH 4AL8L 4E0RA 3CX2A 5DWUH 4OZIB 2ESVE 4U31A 5D2LB 3DROA 4RIRB 3PHQA 5DMKA 4PP1C 4DEPC 3HI1A 1KCUH 3LEXB 2CQVA 2G5RA 4PJFA 3QPQD 4OZGA 3MPCA 5IP4A 1FAKT 5JA8B 5FO7A 2HKHH 1YECH 3O6KL 2B1AL 5CIPA 1IAKB 5DI8A 4V2CB 4C58B 3BP6A 2NY4C 2V6HA 4NGHL 5ANME 4EUPA 1S5HB 5FFLA 4Y4FA 1XF2B 1I7UA 2VQUA 4XC3H 4NRZB 3ARBB 1GIGL 3ROOA 3TH4T 5DO2D 3LSOA 4J2XA 2B1HL 4ZO9A 3TPUB 3O3BA 4NO0B 3VCLB 1RQ5A 1JZ4A 1NGZA 3Q0HA 1JNLH 5JW5A 4GRWB 4NUJB 4KJWD 4RSVA 3TBTB 4HUVA 2IANE 4FFVC 2EH8H 4UIKL 1F2XK 1BBDH 1SMOA 4CDGC 4YHKL 3C60B 5CILH 4I48A 2DQGH 4EDWL 3I6KA 3ZLQC 4Z7WE 3TEUA 3G6JB 5D1ZA 2EDEA 4F80A 4U49A 1D5IH 3BVNB 1NMBL 2R1WA 2ZNWA 1IKNA 3QUXB 5FHAL 5TF1H 2VSDA 5E4IA 4GW1B 4WVRA 5CAYB 3FB5B 1J1PH 1JNNL 3BDYH 4K3DH 1UEYA 4ZO7A 4HCRA 2IH3B 3DYOA 3JWDC 3VMNA 5IGXH 5HYSB 3ARED 2VDOH 2HLAA 4OCWL 4RDQF 2Z92B 5DD1H 1JI1A 3BN9C 4MX7B 4FQ2H 3MLRH 1IM3A 1VERA 3MBEC 2EICA 1D5ZA 4OKVB 5EUOA 5HYJA 1EBPA 2H2PD 4X6EB 3VXSE 5KSAA 2FYYB 3ARVA 3DARA 4ZXBD 3T4YB 1H3WM 3D2UA 4YO0B 2BNQE 3TT1H 4K3DL 2WBJA 3BWAA 3T1WA 2Z0BA 4CGTA 1FVEA 5ILTH 4Y16C 2DQGL 5IB3B 1NLDL 1I3UA 4U6VL 5IVNA 4LCWA 5I71B 5E5MA 2WWMD 3FZUC 2XFXA 3BJ91 2BY3A 1QHPA 4N1CA 1P4IH 1U3JA 3GSUA 1DN0A 4PJIB 3V5HA 4HJ0C 5JMOC 1KIRA 2P1YA 1MCPH 3GJEB 3MROB 4R96A 4HIJA 2QJDA 4OM1H 4ZFOA 1JV5A 1DEDA 3SGDI 2BFVH 5KVGL 2ESVD 1UJ3B 4BQBA 2Z8RA 2PF6A 4R97B 3RIAK 1MCNA 4OZIE 4PJEE 4PFEA 1BREA 3DXAD 2LVCA 4LEXL 1QQDA 3DTXA 3CDGA 3GMRA 3SJVB 1IFHH 3C5JA 2ITDB 4HZLB 2AEIT 2CIIB 4N0RA 3RI5K 3VWJC 1AC6A 1CR9L 1EFXD 3SGKA 1INQA 1A5FL 1YNTA 5F9WB 2YMXH 3MFFB 2EDRA 4PGEB 3WFBH 3RX5A 2C3HA 4GRLA 3G5VA 4RDQG 4XWOC 4ZAKC 4XVTH 1J86A 2IBBA 4L3CB 1FPTL 1KJMA 2LV4A 1DDHA 4RQQB 3RUGA 4R4BA 3ZKXB 2BNQD 2Y25A 4LLMB 2HFGH 5D7IA 4P2OC 4ZQKB 4OCNC 1WIUA 1Y18B 3MV8B 3QJHA 3EOAB 3ULUL 4JFYA 3WNPA 5IJKC 2I5YH 4LDEB 4LLUB 2O5YH 3T0ED 2VDNH 4KZEL 2NY1D 4ODUA 5E2JA 3RL2B 3RX8A 5GZND 5EUKA 4Q9CA 3TNMA 3NACL 4P5MB 5BS0B 2EE6A 4LPUA 4UDUA 1ZGLP 4TRPL 1A8JH 5JNYB 1QUNA 5BZWA 4OBRA 3LSOB 1HIML 3D39A 1VFMA 2X40A 1K4DA 3JTTB 2AABH 3LRHA 2Y36L 3V5KB 3DURB 2IPUG 2QQNH 3MLXL 5IMOB 4L4VD 5JQHC 1T4KA 4NRYA 3TH2T 3I85A 5DEFB 4IRJB 4ZYKB 3IJYB 2NY3D 4CUCA 4NNPH 4NQUA 2GTZB 3NGBB 4PRPA 5IIEB 1A9BB 4XCEB 4HK3J 3MLVH 4ZUWB 2RR3A 3F7YA 1HKLL 1SJEB 1X5HA 4I9WE 4P59L 2V2TB 4QXUL 3U0PA 4FQJH 3U48A 2XQYG 4X99B 3INUL 5J4MA 4JFZL 5IVXE 1QRKA 1NDMA 1MFEL 2OSLB 1YEGL 4E41A 4UAOC 3QUML 4Y4FC 4A2LA 1N7MH 5DTFB 2VLRD 3VRJA 4PJ8A 1KV3A 3ULUE 4O2EB 4DAGH 4ODWB 2AJUL 5ICZA 3RRQA 4G43A 1ZTXH 1BLNA 1FNSH 4KK6D 4QXGH 5CP3A 1G9ML 3EO1B 3C60C 1JTPA 5C0CA 1MCOH 2DM4A 3MV7A 3WFZA 3DX8A 4HWZB 3F65A 3G5XB 1PZUB 1AQDA 3QPXH 1LP9F 4ALAL 4PRIE 2FGWL 1TCRB 3MACL 5F7EL 3OKNB 1JF6A 2Y6SD 1CL7H 4PB9H 2CKNA 1GCFA 2BNQB 3O6FD 2VITA 2NX5D 1KPVB 3IFLH 3KHOA 1DBML 4G6JL 1CE1H 4KROB 3HPLA 5EULV 3L1OH 2YR3A 5MEPB 2GJ6A 1I7TA 3MO1B 1TJIH 1BZ9B 3QG6A 1U8LA 3MV01 2XOTA 2YPLB 3LV3B 2R0ZL 4U6TA 3IDYB 5H2BB 3B9KD 5ADPH 2P8LA 4RGMC 5L2KA 3RWFA 2BY1A 4YHZH 4MXVE 2VDRH 2IPTH 4Y16A 5FO8B 2Z8VC 4HX1B 5GRJH 1U92A 4GG6F 1X4ZA 4QRPE 1T04B 3HMXH 2JJSA 4IS6B 3QPXL 3KLAB 4D0CB 1YPZB 2OL3L 5EBLA 5ISZD 2EE3A 4ZO8A 4HHAA 3AMKA 5T1LA 3FAWA 1BIIB 1JGVH 1I85C 1I9JH 1FBIL 4D3CH 1EHNA 4LCYA 3G08A 4X5WA 3CFBA 4TUKL 4KROD 1R5IB 4M7ZC 1ETZB 2AJVL 1JNJA 5JHDA 1SEQH 4PJCB 3MR9A 1YEFH 4ELMF 5FCUL 2GK0B 4CL7A 3UYRH 4HAGA 2GT9B 3BDXA 3TZVA 1MY5A 3WJJA 4KJYA 2ICWB 3MRFB 3OKDA 1GPOL 1A1NA 2F74B 3EFDL 4OZHE 3F58L 2DQEL 5E8PA 3QO0B 5CFHA 1N64H 1LE5A 4XCCL 4P5MA 5BS0A 1DBAL 4ZTOL 2VISA 4YAQA 3STLB 4ENEC 5JO5A 4ONOA 4ZD3H 1QFUL 2NXZB 1BECA 1L9MA 2YUWA 3GKZA 1CXLA 4XBEH 4U33A 5JDSA 4PY8I 2X4PB 3PWVA 3HI5H 4YWGL 3QWRD 5D93B 4XCYA 5C86A 1WC7A 1T2QH 4GO6B 1IM9D 2E5EA 4YUEL 1BOGB 2DAVA 4TVPD 1KEGL 5AG9A 1OSPL 3OKEB 2IBZX 1ZHLA 3RWEA 1XF1A 5GS0D 3M8OH 4QHLA 1F4WL 3V7AG 5C0EA 3S97C 5JOPE 3HZKA 1CDHA 1KPUA 1FE8L 1N59B 4G8GE 1S9XA 4UTAL 3LOWA 1K4CB 4JY5L 1YDPA 3DVNA 3DHJA 3LD8B 3OHXA 3HB3D 2EIDA 5C0FB 3AREC 5CJOL 4GLRH 4W4NA 1OB1B 1NMAL 2F54E 1N6QH 1KC5L 1FNAA 1H3TA 2ZG3A 1JGDB 1OVZA 4DVRH 3IDNA 1S7SA 5IVZA 5GS3A 4NZRL 3W0WB 4PGJA 3F6LA 1AHWC 3ROLA 4OZ4B 5EO1B 3IDXL 4PREA 2MCPH 3O9WB 1OAXL 4JHAL 4R6UA 1RZ7H 2OJEA 1IGJA 2FBJH 1F5WA 4NUJA 5GRXG 2AQ1A 1T03H 5CKGA 4X9GA 3FOMB 1EJOL 3KXFB 3TBSB 5EU6D 3MNVA 2WWKO 5DJ2A 3HAEG 1QVOB 5DR5L 5AZ2H 4TSAH 1KELH 3PV6A 4PRHB 4N5EC 4MSWB 4R7NB 3E2HC 4KRLB 1LE9B 1URLA 4KTEH 3MUGA 5FKPB 2BVOA 1NFDF 4XMPL 1E28A 4N9OB 4OF5A 1T7ZA 3QISA 4S11A 1Q0YL 5E7BA 3PQYE 4HUWB 4X5XA 2BSRB 1JRHH 2JB5H 5IR1A 1GZQA 3DLQR 3C6LB 2O61B 5JPNA 5HHQB 5ESQB 4KRNA 1U8JA 2R29L 1FH5L 3DMMC 4MVBD 2CJUH 4K7PX 4KVCL 1NJ9A 4NZJA 2HWZL 4JZNB 1HINL 2JIXA 5TGBB 3TBYB 5I8OL 1XF3A 2IAMC 4TSBL 1N8ZA 3V5DB 3KR3L 5DJDA 4JO1L 3V52H 1IAMA 4NFDA 5HDBF 1NGWA 2M2DA 4X7TB 1T0PB 1D3CA 4KKLC 3TNNB 4FP8L 4UTBL 2OYPA 5IK3A 4NNXB 3RL1A 2PO6C 2A6DB 3QIWA 1XGUB 3FO9B 1BBJB 4BQ6A 2OQJA 2AP2A 2WUBH 2EZ0C 4RBPK 4KKAD 3S3PA 2PNDA 1JZ6A 2D03H 4P9HH 1AGCA 3O6LL 1SVCP 4Z0BH 3VG0H 5J06A 2EIEA 1G0XA 4LRIA 4NQCA 2WP3T 4XPAL 1P7HL 1IBGH 3KPSE 1FNEB 4HHAB 5T1LB 4JFXB 1OCWL 2GJ6D 1CFVL 2A6KA 5JW4Q 2FZ3A 3ZTNH 2FEDD 3IDIA 3FN0H 4I3SH 5DA4A 5DK0A 3D3VD 3VFGL 1UWGH 2RFXA 1R3KB 3CFDB 3KDMB 3WFHB 1T0MB 1I8KA 3CPLA 1PZ5A 3WL9A 4GBXC 5EZLB 1KBGH 2X70B 1GRWA 5IW6B 1TDQA 1G7HA 1HWGB 3T65A 4FFWC 3DMMA 3NCYP 3ZL4H 5FYKL 2A1WL 5FA4B 4FABL 4ZSOB 3AC0A 2CLVA 3GSNB 2RAMA 3DI2B 4MZ3A 4EQ2A 4F3FB 4NO5A 5GXBB 5DC0A 5FM5O 3QUYB 3QQ4A 4LPYA 3I75B 1DSFL 1BVLB 4E5XB 1Y6MR 1UB5A 2Y07H 3DRQA 5GS2D 5HDQL 3RU8L 4N5ED 1FFPA 2CO6B 4H1LB 4I0KA 2A74B 3T0EB 3QH3B 5B22A 5CZVH 5I1AA 2CRYA 3IDXH 1CT8B 4J3OC 1FV1A 1EHXA 4U1NB 4DGIL 3OR6B 2AXHA 4PJDA 5C07A 4FN0A 1NAMH 3DYMA 4HQQL 4G6KH 5JW3L 3FT2B 1H3PL 3MX0A 4H1LG 2XQYK 3CFEA 1OAZH 1QSEE 1TQBC 2C3VB 4LU5H 4YBQD 4D8PA 1S9VA 3WD5H 3BISA 3PWLA 5CJXA 1OHQA 2R29H 3GK8L 1ORQA 3OHXB 5C0FA 5GIRA 5JHDE 4PBVC 2OX5A 3C6SA 3HR6A 2YA1A 1P4IL 5T3XH 1I9IL 1R24B 2NW2B 4JRYA 3I02B 5IMOA 4XHJD 2CD0A 2BMKB 4ZDHB 3TCLB 4OM0H 3GMMA 5EIIB 3T8XB 3PXJA 1QLFA 5DJ0A 1I1RA 3TPKA 3ZDXE 1KXTB 3GSRA 3VFNB 4KHXL 4OTXL 4MXWL 2XV6B 4L9LB 4LVNB 3SKMB 5IUSA 4HEME 2XN9A 3F5WB 4KTDL 4X6BA 1UB6B 1IGTB 2CGRH 3G9VA 3WO4C 3BP5A 3H3PL 5D4QA 3G9AB 1LO0H 4DKEH 4DN4H 2XG5A 2EECA 2NX5A 1G6RL 3L3IB 1AIFB 1J0IA 3QG7L 3OJDB 5INDA 3SGJA 1MCWM 1XZ0B 5BMFH 1AXIB 5DJ6B 3BDYL 1AJ7H 1HXYB 3G5XA 4PP2A 5J3HC 1HHGB 3GK8H 1I1FA 1NPUA 2ESVA 2KDGA 3W0WD 2CDGB 2HT4D 5T1DH 2NY7L 3TZVB 2XWBA 3SO5A 5I73C 1MVUB 3LKNB 4AH2A 3Q3GA 4M1CD 3IF1A 5CP3H 3FO2B 4JGMA 1YYMH 2VZVA 4G9DB 1FZMA 5ICXB 5C0CE 4MXVF 3TA3A 7CGTA 5J11C 1T1ZB 4WI2A 3SBWC 2JK5B 3FO9A 5CJ8A 2UVFA 4LCIL 4P9MH 5LXGL 1J0ZA 4NQED 4U6HA 3JV6B 3MV9B 2ADJA 5H37G 4K7PH 3VA6A 3WFEL 4HGWA 4IM8A 3LVEA 4N0CC 3LN9A 4LPWA 1W72A 3P9MA 3U9UB 4EOWL 5DJAA 1EGJA 3O3EA 1QRNB 3L5JA 1T6WA 1CU4L 4JRXD 3MCKA 4P3DA 5CBAB 1BQLH 1WISA 4YHOH 3WFEH 1LP9E 1WUNT 1U3YA 3NIGE 3C60D 3BZFA 3S37H 3LN5A 4WEBL 4NYLB 5FGCB 4MAYB 3FTGB 4LLQA 5E94A 4Z6AT 3OB8A 1KTLA 1NANI 2ZWLT 4YEFA 1NSNL 3CDYA 4GAJH 2ZUXA 4EI5B 4PR5A 3HLAB 4X4XA 3UTSA 4QTIL 3O2DH 4PRAA 2VOTA 43C9A 4GUPA 1RHHA 2Z92A 4ZFOB 3K8MA 1MCCA 1S5HA 4XAKE 2FGWH 1WZ1L 1NCDH 2QQLH 4N0UA 4QGTA 5JOFB 2YPLE 1IT9L 4HG4J 2Z8WC 1U6AL 2OL3H 3MBEA 4YZFF 5CJ5A 3HUJF 1J87A 4JM2A 4MAYC 2Q1EA 1H3GA 2BMKA 1YEKL 3GSVA 5EPMB 4ZDHA 5D9SA 4NCC2 4MA7L 1KB9K 1OL0A 1A6TA 4NPYB 2NR6D 5EIQA 3DBXA 1NCNA 4K2UH 3Q3GB 3NA9L 4OLWH 4LCWE 1CLOH 1DQJA 5BRZB 1K8IA 3QXDA 1S7QB 2QQLL 4HJ0D 2QHLA 1A1NB 2F74A 3IDNB 4PJ8D 4N0UE 2CRZA 3A6CH 4G8IB 1M7IB 4PGBB 4RZCA 1WTGT 3PNWA 3V6FA 2GIYA 5FCSH 5BZWB 1RUMH 1V3KA 3CC5B 4K71C 1SJHA 1YQ2A 3PP4H 2XI9A 3DX6A 1U9KA 4HIXL 1MNUH 2G9HA 4CVZB 5GGRB 5HHME 2WBJC 3MLSL 3QQ9C 3OJMB 1B0RB 4KWUA 4P2CG 4EEEA 1E27B 3JUYA 4XVSL 2Q86A 4UOW1 3EOAA 5DRWA 1YEEL 5DSCA 5I1JL 5D71H 5KVEL 4RA0C 4BH8B 3S34H 1P9MC 3DPBA 2OI9B 1QRND 4D9LL 1DQMH 1FL3A 4XVJH 3QEHB 2WV3A 4G7VH 4ZD3L 4PJGF 2CR6A 1IEAA 3AS3A 4KMTH 4P2QB 2ERJC 5CJXC 3GKWH 1S9KC 3ULVC 2EIBA 1RZFL 4HKBA 4HGWB 4WU7A 4I0PA 2XZQL 4FG6D 1VKXA 1V3JA 3DSFL 2NLJB 5KVMC 1XGUA 2DMBA 2DQHL 4KDWA 1G6RA 5GRUH 1WV7T 4NJAL 4KI5D 4RMWA 3CLFL 4PJXE 4WRLA 3KYMA 4L9LC 2IGFH 1BHGA 4Y19A 4G9DA 4HBCH 3MGOA 5DK2B 1SBSL 4Q2ZB 2PO6B 4R90L 5C0BA 5CLWA 3NFPB 4XNYL 3MLYH 4GAYB 12E8H 2F9BT 4XVSH 3RIFF 2J88L 4CMMB 4LPXA 4NKIH 1U8HB 5ESAA 2D0FA 4PGDB 3MSPA 1XGQA 2LU3A 5DZOA 3NN8B 1MH5B 5GRUL 1DLFH 4GMTH 5E2UH 2JJTA 3BOVA 3P0VH 5C08A 4JDZB 4U7KA 3FN0L 4I3SL 4F33A 5I75B 4FOMA 5C2BH 2EC8A 1RK1A 4G6FB 4YHNA 1A7OL 3BP4A 3K8LA 1JK8B 3FQWB 1T7VA 1E28B 5TQ2L 1JHKL 5TDPB 4JGJA 5J6GB 1J7VR 3H9SB 5IMLB 4XGZA 4NKDB 5I1DB 4UUJB 1E4WH 1ZTXL 4DTGL 1YEJL 5L8JB 1DBJL 2HJFA 3MV8A 3QHFH 3VRJB 4YDJB 3MV9D 4YDLB 1Y0LB 4DK3A 1G9NL 2BVPA 2EXWC 1YJDH 1BVKA 2H9GB 4PJ8C 5HHXH 2BX5A 3GEWB 4LSQH 2IEPA 4D0CA 2ZKHL 5AYUH 2R56H 5B8CC 1Q9WB 1UM4H 2AKRB 5GGUB 3CFKA 4XB7A 1UYWH 2Y9RT 4XXCC 3V8CA 4CVXB 4JRXB 2DN7A 1M7XA 2AGJH 2VUOA 1SEQL 4AENB 4CKVX 5J7CC 4X98B 4MQXC 4LKCB 2YSSA 1CI5A 2M26A 2QQKL 2H26A 2YPLD 3OF6D 3MRGB 4M4PA 5IHUL 2XZAH 1FFPB 4XNZC 4YXLL 5KN5B 5D5MF 4HCRL 1BD2E 3OAYH 2ZUVA 4BUHA 5I16A 3VCLA 2UYLA 3D3VE 3HAEH 3OAYK 4R0LA 3MJ9H 1LE9A 1JTOA 4LKXA 2W9DL 5FDWB 1ED3A 3HN3A 2IAMD 5SWZE 1HHHA 3DUHA 4DZ8A 1NAKL 3ARDB 3EDEA 2DQJH 4Z7UA 4OI8A 3VGFA 5I1JH 4S1RH 2UWEE 5FKAB 3W9EB 4GKZB 1BGXH 4P2RD 1J8HB 5GGVL 1A7NH 1GZQB 4MB5A 1NQBA 2KL6A 3NFNA 3ZDXF 3BYYA 1S8DB 3FT3B 3LB6D 4ODVH 4QF1B 2JLLA 2V5YA 4L8CA 3KNBB 4Z77B 4HLJA 2EZ0D 2XACC 3FQNB 1U3HA 3V52L 3QAZB 3PGFH 5LQBL 2UZIL 5TE7H 3LPGA 3O0RL 3IFOB 3U83A 1QP1A 3OL2A 4OF6A 4Q6IB 2A6JB 3QDME 1CFTA 2AQ2A 5IVOA 1X5KA 3N1GC 1MAJA 2DQFA 3QHZL 4JDVA 1LGVA 2HN7B 4GSDH 1IAIL 3BMVA 3DUSA 4Y2DA 4GS7C 1F42A 2NXYB 3QQNA 3UTZA 1MQKL 1F3JA 3BX7C 4I9WD 4GBXD 4ZUWA 5EORH 2ZUWA 4WO4C 4HS6B 4A6YA 4HC1A 3P11L 4YQXH 5DVKA 1V7ML 1M4KA 3GSWA 5C0BD 2ITCB 4JDTL 4O2FA 4NKMB 4YDIL 3GMOA 4M7LH 1KIPB 5BO1H 2HTKC 5EO9A 2DLGA 3ESUF 5DR5H 1KCKA 4JPVL 1SEBB 3WJLC 1BQHA 5HI3D 3O4LD 3EYQD 5BVJA 5KVGH 2XXMB 4TULH 5F7LB 2W07A 5IKCB 4NUGH 5E1AA 1GZPA 1I8IB 2HH0L 1W2KT 4W6YB 5CBEA 4QRUB 1KFAL 4XP4L 8CGTA 5EB9A 5IF0B 4X6DF 4LHUA 1EEUA 1D6VH 2VMFA 3OB0K 3SDAD 3PJSA 3B9DA 1MPAL 2VZ3A 3FQXB 2B2XH 1EUTA 2HFFB 2VLRB 2J8HA 1U8PB 4LNVA 4Z18A 4HWBH 4NQDB 1FL5B 3BGMB 4NDMB 5E8DH 1YZZA 5BVPL 1KB5L 3E3QE 4HK3N 3WXWH 5A2KH 5LAXA 5HD8D 3VFOA 1MCKA 1JVKA 5L2KB 2EDKA 4NO2A 4Z7QE 1IZKA 2NXYD 4HWUA 4XHJC 4X6FA 2XTJB 3ISWA 4PJGA 4KVNH 4U3HA 4F2MB 3DTXB 4H8WH 4M1DL 2WIIB 3NCYS 5IB5B 4XT1C 1BJ8A 4WU5B 3IJHA 1FZMB 4OCRL 4QXWA 3QXUA 4I2XE 1ZS8B 4HPOL 1IEHA 1BD2A 4IDJH 4MCYA 5IJVB 4N9GB 4HLZH 2DI7A 2APBA 4NQEA 4Y1AB 4R3SA 4WGWB 4F7TA 5I74B 3DRTA 4LCYB 2MSPA 4DN3L 2PN5A 3CMOH 4CRPA 3ARDC 4ZTPL 1BBDL 4JO3H 1CLCA 3MA9L 4S2SA 3QQ9D 5DQJA 3AB0B 3GRWH 4O9HH 1ZHBB 4X4ZA 5DRXB 1YNKL 4H0GA 1KB5H 2WAHA 5TJWK 3K4DA 1EAJA 3H9SD 3BKJH 4JVPA 1QRNE 3HFMH 3O6KH 5CEXA 4KK8D 4KXZI 5C6TH 2VKXA 1BJMA 3EOTL 2FATL 3P0GB 1AP2A 5DHVA 1EXUB 4G80B 1E6JH 5CP7B 2B1AH 1Q9OA 3KLHD 4BFIA 1UACL 4QRUA 4Z7UF 3ZKMD 1YNKH 3MC0A 2JJSC 2MFNA 3U4AA 4N90E 4X7EC 1MFAL 3GBNH 3LD8C 2NY0B 4OM1L 4PY8J 3AU1B 1NBVL 1I8MA 3CMOL 2BNRB 1PKQE 2CMRL 3K1DA 4U1SB 1JK8A 1Q94A 3MLPA 2CDEA 3T4AA 3PWNB 3B2VL 4N68A 1TLKA 4EKXA 2FX7H 4F15B 1KG0B 2VUYA 4YXHL 5E00A 1NCUA 3NOIA 4H5SA 3P11H 5KG9B 4XP9L 5J56B 2YD5A 3NABL 5GGRA 4R0LC 2BSSB 2DOCA 4HMDA 5F72S 5IWLC 2FGZA 4DCQB 2XA3A 3LKSA 5C6WH 2AXFB 4ZUTB 3QCVL 4JFXA 3QQ4B 1T4KB 4D9QE 3KYMB 2A6JA 2VSCA 5MP6L 2DQIL 1ZA6A 2X4RA 4EOWH 3VWJB 2A9NH 5TF1L 3VXUB 1MCEA 3QDJE 5J6GA 2FECI 3ZE2E 3BE1H 2OMBA 4KUCF 1B4JH 5H35B 3QCTL 4F7PB 2P44B 5JUEL 3FTGA 1EO5A 3QEQD 3QT2A 3WUZA 4F2MA 2GUOA 5KOMC 1A0QL 2XICA 1HXMB 5K33A 3SQOH 2VIRB 4ZODA 3NZHL 4YC2B 5B39G 2NX5B 4HIXH 5ALCH 2Q3AA 4M62H 4QRQB 3DVFA 2HT3D 1AO7D 1J05A 2AW2A 3UMTA 2HG5B 2Z31B 4ORGA 5GISL 2SEBA 3GI9L 2HAZA 7FABH 3UBXG 3UTPD 3MRCA 5DMIH 4CMMA 2BVQB 3MGTB 4APQD 3L9RA 4RAVB 2JJWA 2IMNA 4C4KT 1FL6A 3Q6FB 1AHWA 3H3PH 1RJZB 3IFPA 2W9EL 2BVPB 4JHWH 1UKQA 2XZAL 3NH7H 1D7FA 4LAQL 1TZGL 1T66D 1ES0B 4ZPVA 1HKFA 1FN4A 1GC1H 2HLAB 4PJHB 3SHSA 4MD0B 5J1SC 3RAJH 3MV8D 1ZANL 3SDCD 1IAII 4UNTA 3VJ6B 1I8LA 4S1SL 1MRDH 4G42A 4ETYA 4XX1G 4MQTB 1UJTA 5EZLA 5CEZE 3LIZL 1P7QB 2K3TA 1XGTB 4NC0B 4O9HL 4K94L 5MEND 1JWMA 5IK3B 3H3KA 5FUOL 4OM0L 3SKNB 1I9RL 3MYJA 2P5WB 2UV3A 3AS0A 4LRNH 4TQEH 4D0DA 4X8JA 4KU1A 3FONB 1XGYL 5DSCB 2QHRL 3SGKC 4XXCA 5I1KH 4LCIH 2O26U 2VQTA 3ZHDA 4PJ9B 1W0VB 1V7NH 1W72L 3OKDB 3VH8B 4LARH 1NCWH 3IFOA 5HGDB 1G1YA 2GY7B 3VDCA 3TZVD 4NN5B 3QFDA 3UC0L 4LCWD 3V0VA 2E9BA 2VO5A 1PY4A 3FB6B 4GKOA 3BD5A 3TYGL 3TBVB 3P9WB 4JREC 5I0ZA 1JPSH 1YY8A 3TGXA 1J8HA 1Z0MA 2R0KH 4POYA 2NLJA 1DBAH 4P0DA 1UC6A 2X1PA 4HDIB 1WWWX 2NY1B 3MCKB 2OR8A 2ERJB 2V9TA 3KNBA 4O2CB 3QUKA 5ACZA 5AZEH 1MFNA 2DIAA 5D1QB 3RWGA 1A14L 1VENA 4TNWF 3WO4B 1PX4A 1QG3A 3TA3C 1BQUA 4R0LB 3NABH 5EOTA 1YEGH 1FO0L 1DL7H 4Y16D 3JV6A 1DQDL 2V2WA 3LH2H 3VD3A 5CSZB 2ED8A 1N26A 3ARDA 3C9NB 2PYFB 4WO4B 1JZ2A 4EVNA 1B3JA 3RWCB 3QUZC 3L5HA 5J12C 1T83A 4GG6B 5C0NC 1D6EB 1VGKA 4U1JB 1V5JA 5JO5B 3RVXD 4LSQL 1OP5K 3DSFH 2DBLH 3KPNA 3KWWA 5GHWH 3IVKB 4JFZH 4GW5A 3I3EA 4CN4A 2PTTA 3N1QC 4GFTB 2BK8A 4ISVB 1ZVSA 4RBPH 3CFIC 5E99H 4L3EA 2R0KL 4JLRA 4NKOB 5B4MC 2YD1A 4FFYL 1ZHLB 4U1HB 3RIAF 3ZYOA 1MCRA 1N6VA 5C0IB 3MLUL 1VHPA 5LGJA 1U3HD 5KSVB 3KDMA 3SO3B 2XA8L 4MA3B 4OD1H 3ARRA 4JFPA 1J10A 1A47A 4WY7H 3UJJH 2IH1A 4WHCA 2Z93A 4HZAA 1YQVL 3GSRB 1S3KH 4ZAKD 2A0LC 2W0FB 4JO1H 1JGDA 2UY6A 4OAWB 4OF3A 3W0WE 4ZS7L 4WW1B 4PJ8B 1JWMB 5FUOH 2NW2A 1CL7L 5DTFA 3CCHB 3I02A 4OUUA 1QSVA 4P2OD 2NR6C 4P9HC 1FYTB 1TXKA 3VFMB 1CLYH 3B3IB 5D96C 4ODVL 2DWDA 3P4NA 1CTOA 1QBAA 3MYZA 5GZNC 3JWOH 4G6ML 4PJEF 1FL3B 2D4FA 3T0AA 1S7TA 3VI4F 3MLUH 4JFQA 2OXGA 2YC1B 3CGTA 1H15A 3HE6D 5DJDB 3HRPA 4M6ML 2FLRT 3U36A 4Z78B 5K9JL 2BCKB 2C4FU 4X7CC 1JPSL 1R0AH 3EYVA 4H1LA 3W5MA 2FEDC 3FKUS 4HW6A 1MJJB 5E4EB 1A6WL 4L5FH 5DEZA 3MRBA 2RBLA 4M03A 2BSTB 3EYFB 4M02A 3DYPA 2IFFL 1LDPL 5SX4I 4KHTL 5C9JA 1GPOH 2B4CL 5FXCH 1FN4B 5KAQF 1OY3B 1HDMB 3D87B 1QSED 4W70A 4F7EB 1CGSL 5HDLA 2J3SA 4UNUA 3E8UH 2HKFH 2ZUYA 3C09B 1AE6L 4WEUD 4N0FB 3H9ZA 3QCUL 5IOPA 1DEEA 3RHWF 5F3HB 3BGMA 4NDMA 2BNQA 1AI1H 2X1WL 2X4SB 2DQHH 3WFHA 5HI3C 4OCXL 2NMSA 2VWEE 1OAQL 2E7CA 1PKOA 5M94B 1QEWA 1QSZA 2XYCA 4HSQA 2EIZB 3BEWA 5CSBA 1ZEAL 5EBLB 5SV4A 5C8JB 2C1PA 3D85A 5IG7A 1JWSA 1S5IH 1OM3H 2ITDA 1J0KA 1G7MB 1OSPH 1X5ZA 4B7LA 4OQTA 4MYWB 2VQ1A 4K8RH 3UTQA 3KAAA 2D31B 2AXGB 1ZS8A 3VXRD 3OX8A 4JQIH 1U2CA 1NDGA 3BKMH 5I17B 1UB5B 4MA1C 3VRIA 2LAGB 4Z7VA 3PV6B 3SDYL 2JCCF 1CFQA 4FQPA 1MHHB 3U82B 3QHZH 2JELH 3MZTA 1L0YA 1T6VN 2E27L 5KSUB 1MCQA 1IM9A 4Y2DD 5E2WH 2MKWA 4AM0A 4JZOA 5EG6C 3GIVA 1G9NH 1MHEA 2X42A 1MLBB 3NCJH 3O9WD 5BRZE 1NLDH 4Y4KB 2X70A 5EA0H 5DD5H 3QDGD 2ADFL 3U9UA 1R5IA 5GGVH 3ARSA 3CZJA 4B53A 3BP5B 1CD0A 2YWYA 1C08B 2CKBL 2VL4A 5HYSG 1WGOA 1N2RB 3BPCA 3BPLC 5DHVB 1OTSC 1QFWI 1RMFH 3K2MC 1F58H 1MRFH 1ITBB 1JYWA 2H32B 3B9EA 4TSAL 4KHXH 1CGYA 4U6YB 3QB7C 1JGLL 4XVUC 3QULB 2OL3B 2PXYB 5EOQL 3U7WL 2F15A 1WBZB 1T04A 5A2JH 2DQTL 3TCLA 3BKCL 4XTRD 3VGAC 3UYPA 5C3TA 3S36H 4NQTA 4YHML 4XNXH 1HWHB 2GTZA 1I9IH 3OKOA 4OGXH 2AK4D 4KGLA 5DEGB 2GEEA 5DDHA 1I9JL 2UVEA 3WLBA 4H0IA 4G6AD 3I50H 2ZSWB 3FFDB 1VACB 4OLEA 1DVFA 4WI8A 2DM2A 4UMGA 2WMPA 3DUUA 4ZTPH 4KJPD 3WE6A 3QIWB 3JVGC 3ULUH 3GMRB 3U79A 2IJ0C 3C5SA 4YBLB 4N9GA 3GGWB 5FYKH 2K1MA 1TQCB 5JOFA 3QYCA 3MV7E 3ARBD 4MDJA 3LAFA 3JUZA 3KPPA 2VABA 3SDXA 1TZIB 1FG9C 4MNQB 5E1HB 4FMKA 5GJTL 3D18A 4HWBA 3WHXA 3U30C 5HY9B 2OJEB 1W72B 1HCFX 3E8UL 3PQYD 2EDNA 3QUMA 3EBAA 4OLZH 3QZWB 2AK1L 1JNLL 5BMFL 1G7IB 3OKMA 1MVUA 5DUMH 4AH2B 4LSVL 1BJ1J 3JZ7A 3S7GA 3IJYA 4MJIE 1IJ9A 4MDIB 4N8PA 3I6LE 3JV4A 3MV7B 1A1OA 2RHEA 5TFSH 3MRKB 1YYLL 5GRYA 3QEGH 4YHMH 4KXZH 3VXSA 4RFEB 4A2MA 4K3GA 5I6XB 2WNGA 5JNYA 2HTLD 1FNGB 1NMBH 3IDJB 1QLEL 2QTEA 2D3VA 3DBXB 4N5UA 2B39A 1IQWL 1U93A 5CGMA 4YHKH 3PL6C 3B5TA 1VGKB 4U1JA 4K8RL 2GTWA 1NCBH 3R1GH 5ALBL 3K0WA 3K81A 2LTQB 1IGCL 3SOBL 4A6YL 1T1WA 1WWAX 2Q3ZA 4X7DC 5IMMB 1ZT4A 1DQQA 1Q1JH 1RUKH 3MNVB 5IEHB 4C55A 3NCCB 4YJZL 3WMSA 4N0YH 1OAUL 1UA6L 1A1MA 2Q87A 1CFQB 3QH3A 3JVGA 4PRNA 2F54D 4Y2DC 2RGSA 2NY0C 3QUXC 2CMRH 4ZXBB 5FK9B 5GS0H 1KPRB 1MWAA 2ICWJ 1P7QA 1OGTA 3EYSL 3O9WC 3OKOB 3GIVB 1KTLB 4GG6E 2X4OB 4WJ5A 4PRHE 5HYQA 3L5XH 4PB0L 4WEBH 2KQNA 1V7MH 3R0NA 3S35L 3MLRL 2BVYA 4I48B 3F8UB 3RL1B 5IB3A 3DHMA 2C26A 3NBNA 3P9LA 5L0QC 5F1NA 3SDXE 2Z35B 1YN7A 3EKCA 2AXJA 4JVUA 3O2WH 4P46A 1CQYA 4X9BA 4J3VA 3ZHLA 2GJJA 1LD9B 3BP7A 5JHDB 3X3FH 4P4KA 1F4YL 2I24N 2Z91B 4J1UB 4MCZA 1TCRA 5JQ6H 4S10A 4WO4A 2PYED 2EIZA 3BEWB 5F7EH 5I1HH 2YRZA 4NBYB 5FGBA 1FNEA 4RAUA 5B21A 1RJYA 3S34L 1MQ8A 3KLAA 3MLSH 2XIDA 3BRDA 2VAAB 3QA3B 3CFCL 1FGVL 4KV5F 4LLYB 3WFDH 1ZVSB 1MRDL 5CMAB 1UCTA 5AAMA 3V4UH 5ICZB 1G7HB 4WW2B 3HNSH 1YNTB 3EDDA 5CINL 2XKNA 5IHBA 4XVTL 1NFKA 4L4VE 4K94H 1MJJA 2AV1B 5HHMD 3QNYA 4KJWC 5D7SH 4L1HA 1A6UH 1P7KA 4HJGB 1C5CH 4LF3B 5ERWB 4XXDA 2J5LC 4TUKH 2J7LA 4S1SH 4NJAH 5SWQA 1MEXL 3EO0B 3IFPB 5KBNC 2Z31C 2NW3B 1IGFH 4YIQB 3IXAA 3EIFA 1C1EH 2VXVL 2GK0A 1NGYA 2WUCH 4JFPB 2GSIA 4RMTA 3TVMB 3SE9H 1KPUB 2VH5L 5A3ID 5MENE 4QRPD 5ISZB 5FGRA 1R5WA 4ZUSA 2C3XA 3GZKA 1K5NB 4KZDH 5CEZD 4Z7OE 3QXWA 5D7KE 5E9DB 3JBG7 5DJYB 3BW9B 2ZUTA 3TYGH 6FABH 4G9FA 1HZHH 1V7NL 1ZMYA 4UIKH 4JFDA 3MYJB 2QR0B 3ES6B 5A1AA 4XNMB 1F3JB 1BFVH 1Q9KB 2EYRB 2Y7QB 5EUOF 3TJHC 1AFVH 4K71B 1ZLSH 3ZTJG 5I1LB 4GW5B 3INUH 1F6AA 1I9RH 5FHBH 3ULSA 1VGEL 3SKJH 5I1CL 5DRZB 4G8GA 4Z0XB 1I1AC 4PLKD 3VXUA 4J8RA 2RQ8A 1IKNC 2NX5E 2HYMA 1G0DA 4OLVH 4YC2C 4JCMA 4XPBL 5GGTH 2PXYD 1F4WH 3OAUL 4BFIB 2W0FA 1E4WL 3OKLA 5D7IB 3FB6A 5C07B 3ZDYF 5L6YH 3EOBB 3T0WA 2HVKA 4IMLB 1M6OB 5F9OL 4AT6A 5DC9B 9CGTA 1K6QL 1N5AB 3HI5L 3NGBC 5I8EA 2CSPA 4FFZH 2VN4A 3QEQE 4ONHB 2CO7B 1U8QB 1DSFH 2ZNXA 3TH3T 1DVFC 1MCWW 4Y89A 5MI0C 1UM5H 3O11B 4LOUD 1OQOA 3I6GA 2XNAB 5JZ7C 1A7BA 2UWEB 1XR9A 1P4BL 3OGCA 3VGEA 1OP9A 3EGSA 1PGRB 2AI0H 3VG9C 4H8WC 3VMOA 5DVOA 1SY6A 4WJ5B 1AO7A 3DUSB 3D0LB 4KK9C 2R1YB 1TNNA 1AD9B 4H88H 4M48H 2BNRD 4H20L 4U1MA 2V7HA 3PABA 2XZCH 5EBMA 3QBTB 1KC5H 2YA0A 3FO1B 1OP3H 3WFBL 2VAAA 1F6LL 1OP3K 5DGRA 4YE4H 3L3JB 2C1PB 4OZ4A 1X5JA 3ZTJH 5CD3A 4JY6A 2DICA 5I75C 1C7SA 1YJDC 3V6OC 3IAGC 2A0LD 3QEUA 3SN6N 3LQAH 4WW2F 3VGBA 2DQJL 2W1NA 3U7YL 3Q1SL 3MGTA 1B4JL 2YUXA 4AEHH 4OFIA 1FZJA 5L2JA 2QSVA 2A9MH 2H41A 4ODSH 1J0YA 2R2CA 2BHUA 1P69B 3IF1B 3O45B 2VIRA 4YDJA 1LDSA 4JM4H 2HT3C 1I8IA 3LN5B 1U58A 4OFYA 3C2AH 1JE6A 1YEKH 1HIMH 2CR3A 1E4XL 4OCYH 3JXAA 3ARXA 3TIDA 3BIAX 3V5DA 3ARFA 1H5BB 4PD4K 3S5LG 2YZ8A 5IKCA 1MJ7L 3O2DA 3S88H 4IHOB 2AJ3B 1DUYA 4ODHL 3O9WA 4B0MM 4NQSA 2YPKB 4XNMA 2IPKA 4J3TA 2O5XL 1HQ4B 3P73B 4ZS7H 3FONA 1I7RA 3VFTB 1KNOA 4OLUL 5DMJB 4R8WH 1CXIA 3SDCB 2BRRL 2DM7A 1R5WB 1QACA 3PHOA 3H42H 4ZUSB 5EBGA 3RUGB 3MRFA 3ULVH 5M7QA 1A6TB 3BMWA 2BNUA 1RUAH 4GRWF 1S7UB 3F7QA 2NPLX 1MWAH 5GGSA 3VRIB 4YLQT 2K7QA 5DMGC 2BVOB 3VFVB 2EYTA 5EC1A 4L29B 2NTFB 4F37K 2Z9TA 4BH7B 4IMKA 1UKSA 5SWZD 4BM7A 4M61B 2DWEA 4LF3A 5ERWA 3CVIL 4X6EA 3L3DB 2J5LB 1DVFD 2P43B 4G8IA 5E2VH 1RHHB 1HOCA 4PGCB 1M05A 3M45A 2JJVA 3S96B 1B6UA 3WUWA 3WNNA 4KPHH 1L0XA 1T5XB 5C0DB 1JZ3A 3QIUA 4MJ4A 5D6DC 5BQ7A 1R3IL 1A21A 4UDUB 1JPTH 3BIKB 3LKSB 5KTEL 3GMLA 2AAVA 2VDPH 2H8PA 5DD3L 4GBXB 3B9AA 5ALBH 2JE8A 4WWKB 5KTEH 3VXOB 2X9YA 3SDAC 4EBQL 1RIUH 1UT9A 4I77L 3O6FC 4EBQH 4PYHA 4XMPH 2JCCB 2C1OB 3MROA 3LKOA 3U1SH 1WT5C 4HS8L 5HHNB 1UYWL 2FB4H 2PR4H 1CE1L 4PJHA 4LHQB 4WTZA 4HG4K 2Z91A 4HH9A 1XCQA 5HHXL 1MFBL 2X09A 5J1TC 5DFTA 1FFOB 4MAYD 3S36L 4OLXL 1PD6A 4YXLH 1PG7H 1J5OH 1A3QA 5GSRB 2BDNL 5I8KH 2CIIA 1OGAB 2F8VA 1T3FA 3L5WB 3MRGA 4MB4A 2PYFA 4EUPB 1Q9OB 5I8KL 4PJHE 4PJDF 4F7TB 3ARBA 4FNLH 1IQDB 1RUPH 2F53A 3HR5B 1OTSD 4WFHD 3ARGC 1DQJB 5BRZA 4WUUD 1EHAA 3K4ZA 5CUSH 2MWCA 1AGBB 2Y5TA 1KENH 3PP3K 4POZD 5JA9A 4OI9A 4HAFA 4OCSH 4WIQA 3VGGA 4MA8H 2GAZB 4KMQA 2ZUQC 4YFDB 2VISB 5HI4C 1HINH 3E6FB 4RAUB 4JM2C 3DROB 3LEYH 4UI2A 5E2TH 1A7QH 1MIEH 5MEQA 2J2ZA 5BZDA 2DYPA 3GI8L 4WY7L 2Z4QA 2XFXB 2HRPH 2O5ZH 4GLRI 5D7IF 2FIKA 4OV5B 1K3IA 3WD5L 1WICA 2H45A 4Z5RA 3U2SA 3FB8B 3MREA 2OI9C 1EZVY 1LO0L 1QSFA 2VLRA 4HF5L 5JHLH 5B8CA 1H9VA 4U1MB 4JQVC 3FQWA 5D7LE 4YDIH 1RV6X 4R4FL 4U7SA 1UJ3A 3EOTH 3MRLA 5J9PA 4NO0A 1VFAA 3VWKA 4FZEL 3VXUE 4Q6IA 3GMMB 4P4KD 2X1OA 1W0VA 4FG6C 4KVNL 4Z78A 4IIQC 1ADQL 3O2VH 1JBJA 2YS4A 1R3JB 2DRUA 4L29A 4HD9A 1C8PA 1X4YA 5LJYH 4NWUH 3EFDH 3N06B 3RDTB 1KJ2H 5HXMA 3PGDA 1PVHA 4R3SB 4TSBH 3RVWD 4O02H 1VFBA 1BD2B 1ODAA 2X5PA 3QXAA 2NTSP 5AEAA 5L88H 1DANU 4Q2ZA 4UDTA 1C5BH 5IW1A 4GAYA 4ODWA 4OQTH 1K9TA 3MV9A 4WWID 4PJAA 2NY3C 2H1PL 2F53E 4GXUN 3GSXB 2VE6B 1T3FB 3L5WA 2Q8AL 5DUBB 4HUUA 3V4VL 1KLGA 1CF8H 2ICCA 1LEKA 1UWGL 1LO2L 4ZFFA 3GJFA 1QVOA 3B43A 4EZMA 3OPZH 3BHBB 2EH7H 4AYFA 2BXYA 3GHEL 4DGVL 4XNQB 2GYSA 1BQLL 3CVHB 5B39B 3H0TB 2EDOA 4PS4H 2DJ4A 4DVBA 4X4MA 1KCRL 4ODBD 4WFGE 4KH2A 5T5FH 4E9LA 4BSVA 3F62A 3TBWA 5IQ7H 1NFIB 1FIEA 5SWZB 5C0RH 5JOPD 4CN1A 3G6DH 4Z7WA 3DMMB 3HNTL 4V1DD 3HE6B 3TV3L 5L2KE 3L3JA 4GRLD 5KOVC 3WKML 4I18B 1CFBA 5IM7A 4U1SA 1GAFL 3PUCA 3IJSB 4OF0A 3PIQA 4LEOA 4R97C 3GNMH 4HIEA 2GSIB 4GOSA 1GL4B 3C08H 4TVPH 1FLRH 4C59B 5B8CB 5EZOH 3GRWL 4NUGL 4FQLH 1UZ6F 2VLLA 4TNVF 1IC4L 4DKFH 2D7TH 2OLDA 4JDTH 2EKJA 1GGCH 1W0WB 4XB8A 3U36B 4RX4D 4GAJL 4NN7B 1GGCL 3NCBB 3O45A 4BZ2L 3MNWB 3L6FA 4MQXD 2Y4SA 2DKUA 1INEL 2R2BA 2ZCLL 1AGFB 4TUOB 1RUPL 4RRPG 3ARYA 4Y19E 1NEZB 3QEQA 4PRID 1RZKH 1T0MA 2VXVH 4NFCA 4FRWA 3EUUA 3STBA 4RGOL 3IGAA 3LZFL 4LEXH 4OCWH 2DD8L 5EZIH 3VD7A 1IAOB 4K9EC 5C0RL 5I2IA 2VH5H 3GJEA 1OAYH 3PF2A 1U95A 4QGYA 4P4RB 3UBXB 4PY7A 1HYSC 5IBTH 3V5KA 4RNRB 3VFUB 5DMIL 3ME0A 3MRJB 2VXSL 3OG4B 4U6XA 2ZPKL 5HJ3A 2VRAA 2V9RA 3MQIA 4U1GB 5KJRH 3MXVH 5I1KL 3T77A 4MWFB 1DEEB 5TFSL 1NH6A 4KRPC 4XP6L 3BAEL 4HFUH 4G8GB 3VA2C 3SDAA 5KVEH 1WFNA 5F6IC 2VLRE 5BVJB 3HTLX 2AJZB 4UQ3A 3O6FA 4JKPH 1OOAA 5I74C 1NLBH 1SJHB 4L1DA 3FFCE 1Q9LA 4JKPL 2H2SC 3MREB 4YDVB 1MCIA 2AERT 1D5XB 3EYUL 1Z9SA 4NNPL 2P24B 1F8TL 3DECA 2FJHB 3B6SB 5E8NA 4CMHC 2YXMA 4D0BB 5AUMB 3VD4A 1T7YA 5A2IH 4WU7B 4PJXA 4HIIB 4M6NL 3O4OB 1ZV5A 4OGZA 3BP4B 5F8QC 4F9PA 5DQ9A 1NCCL 1PYWA 4L8SB 5DRNA 1PY9A 3LS5H 3RUGE 4FQIL 4C56E 3HI6L 4I3GA 3QI9A 2X1XR 4PLKC 5L0QB 1YMMD 1UQSA 2O5YL 4P5TD 3R1GL 1LO5A 2JK5A 4J3WA 4KTDH 2PXYC 3MLWH 1B9ZA 3QNZB 4X9IA 3FB7A 2I07B 1AD9A 2HVJB 3ALXA 4I0PB 4JKWA 4LL9A 4LGSB 5I73B 2KH2B 3N1FC 1YEHH 4YFEA 1YN7B 4XPBH 5EO9B 3MUHL 1KPVA 4F9LC 3DJ9A 4FTVA 2J8UA 3O2DL 1RK1B 4YHNB 3CUPA 5FYKD 1FLRL 1VCAA 4QRTA 3L3HB 1UG9A 5MERB 3RGVA 1IC4H 3E3QC 4DKFL 5T3ZD 5E08H 1XGQB 1ZGLB 2B4CC 3SKMA 1HSBB 4R4ND 1GAFH 1IGTA 6FABL 5JLZB 3QSKB 4FZ8L 3O4LA 3U9PL 3SDAB 2J6EL 5ENWA 3SE4C 3WUWB 1ZT4B 4QOKA 1WC7B 1AD0A 1J1XH 3JWDH 1BM3H 2HT2D 1CD1A 4XAWH 5D5ME 1KLUB 3LQAC 4KY1L 3RVTD 1N0LA 4NHCH 1CG9A 3VXMD 3D48R 1OGTB 1S7UA 4Y5XA 3CK0L 2ZCLH 1YMHB 4OBSA 4QF1A 5HVGB 3GI9H 4EI5C 4Y88A 1PFCA 3CFJB 4XBGA 5LWYH 3T1FA 4KMTL 4LVEA 1RUQH 1HI6B 1MJ7H 4OJFL 1MY7A 2G5BA 2C3WA 4RGNE 1CGXA 1AGBA 1AGFA 3QRGH 3SDCA 2FL5A 1C7TA 4OCYL 5IQ9B 2YBRB 4LDOB 4KTYA 1RFDH 3BPCB 1U8NB 4MJ2A 1X5AA 4BKLB 4X6CA 1LO3H 4YDVA 5J3HD 3KVQA 4LFHD 4NO3B 4NIKB 3OB0H 1F3DJ 1CLZH 1JGEB 1RZJH 3ILQC 1QYGH 1A5FH 4PJBA 4Y2DB 2HT4C 5C0CD 1XEDA 1A6WH 3UZQA 3DIFA 5J8OA 4HFUL 3U46B 3PWJB 2XZQH 1V3MA 4Y5YC 4LPVA 1OF2A 3DMMD 4YPJA 1RUML 1DQML 4FTVB 1FJ1A 1CR9H 1XIWB 5HGHA 1DQTA 2CXKA 2V7NB 3BUYA 3SGDH 3C6LC 2AABL 5E2VL 3X12B 5D72H 2WLYA 1SM3L 3TT3H 3H9YA 4O4YL 4XVJL 4QYOB 4LIQL 4M43H 1MWAB 1W72H 1OPGL 4JPWH 5CZXD 3BO8A 1BEYH 3SO3C 3KYNA 5CWSA 2GCYB 5IVXA 3MRKA 2CRMA 1TJHH 4OFDA 4AT6B 4GKZA 5EH1A 4LRNL 4TQEL 1J8HD 1A9EA 3WIHL 2HA1A 1VGEH 3VFSA 1DJSA 3TF7C 1MF2H 3S4SG 1G7IA 3VI3E 5C7XH 3PWVB 4RZCB 4RGNC 2ARJQ 1PYWB 4L8SA 4BZ1L 4GKSA 3S3JA 1IC1A 4PJ5E 1OSZB 1G7PB 3O3UN 5TDNA 3I2CH 3ROLB 4GQ9H 1EA9C 4I0PC 5I16B 4YQXL 4ELKB 3W9DB 3UJIH 4KDVA 3WN5B 2CDGA 4I2XA 1FC2D 3AAZB 4XP1H 5J0BA 1L6ZA 1QBMH 4FQXD 3RA7L 5T3ZH 2GJZB 4J7RA 4NZTL 3IDYC 4G7YL 1S78C 3ZT7A 2VXUH 3WV0A 1EVTC 3IAQA 2XWJA 3LRGA 4WHDA 4JO2L 1L9NA 4S0SD 1JGUH 4J6RL 2DTMH 4HULB 4FTVD 1FQ9C 2DYPD 3N1PC 3ESVF 2MPAH 3RDTD 3BKYL 2H8PB 3FQXA 4MNHA 4PJAF 2X89A 4LLWA 25C8H 3S6CA 3VXQB 1T03L 3GGWA 4DZBA 4FXLA 4ZFFB 3BI9X 4NQCD 5D7JA 5J12B 3U2SB 2JB5L 1F4HA 4YGVB 3K7UA 1FRGL 1G7LB 2NYYD 3QIBD 5HVHB 2C7UB 3EFFB 2FHBA 1BZ7B 2ICES 1CGWA 2OM5A 3D3VA 4DGIH 2VZSA 2X4NA 4POZC 5IEKB 2X2YA 1VFBB 6CGTA 1DL7L 2IPUK 1NCAL 1N6QL 4G6KL 3FRUB 1JCKA 3MUGB 4MAYA 3CZFB 3IFLL 4KKBC 3ZKSD 1C5DA 1JUFA 4AK1A 3QDAA 3EGSB 4ZOBA 2HKHL 4G7YH 2JCCE 2AI0L 5IG7B 1NC4B 1T0NB 3MACH 3JWOL 1DQQB 2PKDA 1NDGB 2E9JA 4XNXL 1AIFA 4JQIL 2BRQA 3KPSD 4XI5D 2QSTA 2F5BH 5E6YA 1T1XB 5BXFB 5IBLD 1TQBB 4GMSL 3ULVL 3L7FA 4E42B 4V2BA 1U41A 2FCBA 4HKJB 3TM6A 4JZOB 2DL9A 3G5YB 1BAFL 3QWOA 3TBWB 1C5BL 4FFVD 4OZHA 4TTDC 5E6IC 1B88A 1T5WB 3SE8H 5HYJB 1FIGH 4WI4A 1UENA 2IG2L 4K23H 3GM0A 4I5BA 3MRRA 2R56L 1BF2A 3C8KA 1OCWH 1RJLB 3IDUA 5ICXA 3CVHA 5B39A 3I50L 1UXSA 4YR6A 2APTA 3ZKND 2BOBB 1KUMA 5IW6A 1YQVH 1CN4A 1U8QA 3ZE2F 3PGCB 3UTOA 1BBJA 3ARTA 3ARUA 1NC4D 5J13B 4Z0BL 4F7EA 2WSKA 4LIQH 1HN1A 3ARDD 5FYJH 3GJFH 2J88H 4V1DA 1CXEA 4S1RL 4IRSD 4JN1L 3DV6A 5D1ZC 3VXQA 4PG2C 5I18L 3RFZC 3FO0L 4O58L 2MNUA 3HRZB 3M07A 3BW9A 1Y0LA 1N8ZB 1NBYB 2GCYA 5IVXB 2X4SA 1PW3A 4GKNA 3P40A 5EC2A 1KIQA 4JM2F 1OM3L 4IHOA 3UTSE 3T2NH 5C0AA 3HI6H 3PABB 5DK0B 5EDXA 2ATPA 4JFOB 1FNGA 2XQBL 4UV4L 5I9QC 3W81A 4TULL 4U4BA 1XCQB 4L4TD 5I1LA 1ZA3B 5D2NA 3MCG1 3RUGF 1QO3A 2GKIA 1CFSB 3O8XC 3AMLA 1V3LA 1J88A 1QQDB 4HKZA 3L95A 1NAML 4ZSOA 3VDAA 4AG4L 4IJ3B 3OKMB 1FGNH 4X4ME 5IFJA 1T2XA 3MR9B 4R9HA 2HJKA 4MMXC 5FOBB 4AG4H 1C12A 8FABA 4LCCB 1WITA 1Z3GH 1EPFA 5D2LE 1S7XA 1A1MB 2W65B 5I19L 4WCYH 5D9SB 4LSSL 1KEGH 3HNTH 4OZIF 1EZVX 5CSGA 1PG7L 3QIUB 1Q0YH 1IAIH 4KKBD 1R3IH 1E4XI 1FV1B 5EIIA 1RVFH 3H9HB 5D6DA 1KJ3H 3U4BL 2MHAA 3QDGA 5IBTL 4WTWA 1U8KA 1EEZB 3ZL4L 2JTDA 1U3ZA 3O41A 1ZLWH 4MNGE 2EE2A 4YBQC 1INQB 4MD4B 4L8CB 4XWOD 4ORZC 5FKPA 1OAXH 1KFAH 4NO5B 3GSNL 4PD4J 2D2OA 5KSBE 5HYIA 2FR4A 2HT2C 5D5MB 4K9EL 1D5BA 5DJXB 3WNOA 3D39B 2QR0A 1JMXA 5HHPB 1XZ0A 1RJZA 3G5YA 4WTXA 3BAEH 1XH3A 5EUOE 3FOMA 3KXFA 1CT8A 5F6HI 4S1DC 1NEUA 3K80A 1X7QB 4CBPA 5C6PB 4RRPA 4OCSL 1MI5D 1WCQA 1GOFA 5I71C 2DLTA 4Z7VE 1WZLA 3NCFB 1JF5A 3MRNB 3WS3B 5ACLA 4JY4B 1B0GA 1IL1B 4Z7OF 1AGEA 3HC0B 4OGYL 3Q6GL 4QHKI 4G6MH 3L3GA 4L3CA 1ZXQA 5IFHH 4DEPB 1HHKA 1P53A 1UACH 2DLHA 1BJ1H 3RZCB 3UPRA 1NGQL 4AENA 2NXZC 4G43B 5H35A 1A6VH 3RY6C 2J8UE 5K59F 2F54A 5HGGS 3Q5YA 3T0XA 2Y36H 2HFTA 3BUYB 2P42B 4M1CC 1KJVB 3MRRB 1MEXH 5JPMA 3VXSB 3OGCB 5MEOB 1IGYB 3CJJA 3B8YA 3ARBC 4QOKB 4OLVL 5D7JC 3BXNB 5CSZA 4XRCA 4BK4A 2NY4B 4QEGA 1LWRA 5ISZE 3QFJB 4P23B 5CIPH 5CINH 3SKNA 1GGTA 5DFVD 3CH1B 1SYSA 3TV3H 2MCG1 5C0GA 1CL7I 1Z0NA 1M7DB 3S9DB 1IGML 4L8BA 4ZYKA 4J4PD 5IFJB 3NPSB 2PO6D 2D4DA 5ESQA 5FYLD 1RD6A 1DLHA 2GHWB 2VDQH 4KQ4H 2N56A 3BZ4A 2P8PA 2CDEB 3FMGH 1IAIM 2D7OA 5MP6H 4HIHB 4WNQB 3W9DA 3PL6D 3QFDB 3V0VB 4TN9A 1JNNH 3CDFA 5C09D 4KY1H 3GSQB 4NKQB 1EFXB 3AGVA 1OTUD 3FB7B 5K93A 5KS9A 4OSUL 4KK9D 3ES6A 2VDQL 4Y8AA 4MA1B 1QLRB 2FX7L 5HGAA 4Q6YA 4R4NC 3GSXA 1CICA 4RFNB 1KEML 2H2PC 5IQ9A 4LSPL 5GRZA 4JY4A 1I3RA 2VLME 3S35H 4NNYA 1NAMA 4IMKC 3VG9B 1S9WA 4ODTH 1JL8A 2NXYC 3TCXA 4XWGH 3H8NA 3TA3D 3T09A 3QO1A 4HKXA 3RDTC 5L8LB 1TZHA 1CVSC 5DRXA 4WI5A 3O3DA 1NBZA 2FEEL 4M5ZH 2EXYC 4H26A 4JRYE 5DDHB 1CS6A 4PGEA 1KGCE 1UCBH 3RWFB 2A6IA 4EDXB 2H3NB 3JWDL 3I75A 1P4LA 1RUKL 4LLQB 4MNGA 4F8QA 5JIIA 1SMAA 3FMGL 4JG0H 1EO8H 1XR8B 2YD9A 3BFOA 5JQ6L 4XAWL 1ZHNA 3GSNH 3JWNC 1A1OB 4X6DE 4CW1B 3E0GA 4FFZL 3RWJB 3ZDYE 3AM8C 4IOIA 1X5FA 4K2UL 1KB9J 4UT9H 5DUPH 1RURL 1GGYA 4KZEH 3MRBB 2E3VA 3WHXB 1FG2B 5H2BA 4X5WB 5I1IH 2XN9B 3F5WA 3GSUB 3LZFH 4EIZC 5D2NC 5MI0B 4WFEE 5C0IA 3KYKL 3I84A 3KYOB 4XH2A 1AQDB 5GS1C 4LSRH 5BQ7B 1HK6A 1UWEL 4FQIH 3PWNA 4YX2L 4E41D 4EN3B 3KPRE 3P4NB 1U92B 1DDHB 3HCVA 3VWKB 4AJ0A 1RJCA 4JO4L 4H0HB 3NFPA 4F7PA 2FRGP 3HHRB 4UILH 3SQOL 5ID0B 5FA3B 1F00I 3V4UL 1NUGA 3VRLE 5HPMA 1AXSA 1FYTA 3ETBF 4LDLB 1F97A 5FV2A 3SQBA 1TJHL 1MHPH 2VNCA 1FYHB 3R0MA 1S7WA 5IESL 1VFAB 2W0LA 1AY1H 3MRDB 3OXSA 1MCDA 5C8JA 3VXMA 3CK0H 3SBWA 2EDWA 3ULSB 5I8CB 2WUCL 1MREH 4HUNB 2XTJC 5FUCE 1AGDB 1IGFL 1BF8A 1ZSDB 1CGTA 1P1ZB 3R06A 4PJCE 5BJTB 3F7VA 1SYVA 1P6FA 3BSZH 5DD6A 3AM8A 4CADB 1CCZA 4Z95H 1KULA 3MLZL 1DN0B 4PJIA 4DUWA 5CKAA 1QOKA 3LKOB 3MRHA 1S7VB 3U9PH 5F7NC 2DQCL 5C0CB 2GK2A 1UEMA 3C60A 3PDOB 3RGVD 1KCVH 2DQDL 1YYML 2DIBA 2X4NB 3B9KA 5IEKA 4OI7A 4JN2A 3RNQA 4LASL 3NFSL 5AYUL 4CAGA 5SWSB 1KLUA 3O8XD 2YEZB 5F1OB 3V6BR 1P7KB 4XCNB 3BQUD 3LEVH 3OF6A 4OV5A 2JB6A 5F88B 3DWTA 5TH2A 2H32A 1Y18A 1YC7A 1YC8A 2XN9E 5DVMA 4M93C 3KYOA 4XH2B 1JZ7A 4JJ5A 4P99A 3D1MC 3V0WH 4KAQH 4ETQB 4KK6C 2A77L 3BN3B 1QLRA 2YPVL 3QQ3A 1PDKA 1I7ZA 3QIBC 1K6QH 2OR7A 32C2B 3REVA 1MCOL 4BKLA 4ZFZA 5I76B 1A7PH 1MHEB 4H5SB 4NO2B 4JG1H 1FNSL 4OF7A 4QXGL 4NM8H 5E5RB 3ZE0F 4HKZB 3VXSD 2P7TB 5KSBF 5ANMA 1HHHB 4TPRL 1LQSR 2LU4A 2B0SH 1CK0H 4N8VA 2DBLL 3U46A 3PWJA 2ZG2A 1RHFA 2ZUUA 4XNQA 3TNMB 1N2RA 1VB9A 3NAAL 1T7WA 3CC5A 1QHOA 4MHHG 5FF6A 4OD1L 1R3HA 4WW2C 1WZKA 2YRPA 5KSVA 1WBZA 3LIZH 4U6XB 2OSLA 4FXKB 5KZCB 2C3GA 5E8EB 2PYEA 4P4KC 3TYFB 3WDHA 5CEXB 1YUHB 4NSKB 3MUJA 5E0QA 4Q9QH 5DS8A 1J5OL 4ZG1A 1HQ4A 3EJZC 2BSRA 3OR7A 3PWPE 3HC3H 2IAND 3BYTA 3OG6B 4AQ1B 3T0VA 4PJ9D 4XVUD 5AUMA 1A7RL 1D9KB 1HHKB 2IG2H 2CIKA 2X9WA 4K23L 1MHHA 4M7JL 2R23B 5F1KC 3U1SL 4TUJB 5ID0A 2ZJSL 4NHUA 5EC1B 5FECB 5GSVA 4P2RA 4BYHA 5MENA 4HV8B 4HFWB 2WIIA 1AE6H 4PJFE 4QHNA 3VWKD 1WAAF 4LLUA 3VGHA 4U1KA 1MOEA 3QFJE 5ADOH 1NCWL 2A74A 3KS0J 4YDKL 4AIOA 2YD3A 5CD5D 2XQBH 3NFSH 5CJOH 1WIPA 2X9XA 1U8JB 3BKYH 3X12A 4LP4A 1OD7A 3U6RB 5EU4B 3AREA 3QUMB 2PW2A 4AMKH 5C08B 4QLRA 3LN4B 5GGVY 5FYJE 2Z8SA 2W9DH 3C5ZB 3M8OL 3PHQB 4IOSD 3RVXC 2ZSVB 3ARZA 2CUHA 4FQHA 4YHYC 2OXHA 2XTLA 1ZA6B 4AIZB 3I6KB 4OKVA 3T8XA 4LLDA 1CBVH 4NNXA 5GS1A 2UZXB 3CLEH 1MIEL 3HC0A 3KXFD 1XT5A 1OD9A 2COQA 4O00A 4D9RE 5GS2H 4ZTOH 2I26N 4PJ7A 3SKOA 3MLTA 4HUMB 1ZT7B 3O4LB 4PJEB 3R8QA 2DIJA 2FO4B 4XPAH 3HZVA 4NT6B 3MRIA 5DQ9B 4KVCH 3CFEB 3IJSA 4JO2H 2Q76B 1S7RA 3MFFA 1C12B 2RJMA 4JFDD 5DI8B 5SWSD 4TOYH 1B2WH 2GSGA 3L3KA 1ZLWK 2FJHA 3B6SA 5HD8C 1JRHL 2ZZUT 4UV7H 4I3RL 4TVPE 2DLFH 1IEBB 3UJTH 4RMSA 4FNLL 2YD8A 2D9CA 3HG1E 4XGZB 1AR1C 2WBJB 4RFOH 1EFXA 3B9KC 3RP1A 1OW0A 5J13C 4WHTA 5ITBH 4P2RB 3WXWL 2F5BL 3C8HA 4GW1A 2IQ9H 1ROWA 4IBLT 4KKNA 35C8L 1YEJH 4PRHA 2IQ9L 4N8VB 1HQRA 1WT5A 4X6CB 1MJUH 4TVSa 2EEBA 3UZEA 1NEZG 1JPST 4UT9L 4HMEA 2H2SD 5MERA 4G80A 2DB8A 3C09C 4JAMB 2XG4A 3SE4A 1DBKH 4IRZH 2BSED 1WWBX 4OD2B 4HH8A 4MQ7B 4HIEB 4JLRB 3TESA 4GAGL 3VXOA 4LSSH 1MVFA 3BJLA 3P0YH 2ILLA 2CDFA 1KXQE 3HC4H 1KCUL 2CKBA 2NY6D 4OZIA 1NKOA 4U1LB 1A9BA 1VEOA 3W11C 1LK2A 1IGIH 4JFHE 3L3HA 5E2WL 1A7QL 4AL8H 5FEBA 4FQQB 3V6ZA 1XMWA 3DETC 3L3DA 3T4AB 5C07E 3MRQB 5T1DL 1ACZA 5GS1B 1Q9LB 2GQHA 4LRIC 3TBVA 2Q20A 4RWYL 1IAKA 5ITBL 2ZCHH 2ZOLB 3QJFA 3TIEA 4NWUL 5JDJA 3HLAA 1ZT7A 3BPNC 4PRPD 2FX8H 2GFBA 1BFOB 3ARFD 3TPUA 5KW9H 2MJWA 5SWQB 2E8YA 3HA0A 3O6LH 1QR1B 1E6JL 2YKLH 3IFNH 3T2NL 4HJGA 3BH9B 3TWCL 4LKCA 2YSSB 2R1WB 2X44D 5D93C 4O51B 4OIIL 4F37F 4BFBD 1JZ8A 3I3DA 4HS3B 4Q7DA 3W0WA 4AY0A 4QRTB 5JHLL 4GAFB 3IB4A 4LHUG 1P84J 5SX4H 1NBVH 4JR9H 1N0XH 3GSVB 4UQ3B 3N50A 4LSVH 4JFED 3H7LA 3AFLA 3O0RH 1RIHL 4ETQA 3MLTB 4F58H 1D9KD 4X6DA 3PWUA 5E6IA 3V4VH 2AQ3A 1NCBL 3U7AA 1TETL 4UB0H 5IT2L 1HQRB 1BPVA 4PG2A 3MNZB 4XPFH 5GGSY 5T3XE 1TETH 2IH3A 1NGPL 3MO1A 4JQXC 5DFWH 1MRCH 1FVCB 2FJGB 4L4VB 1FO0H 3WUWG 5DRNB 4G8EB 5E7FA 2OZ4H 1FZJB 2OJZL 3E1F1 3BH8A 3WLWC 5HDQH 1I75A 4UQ2A 2I9TB 4O2FB 2AJSL 2X4TA 2IANA 3GMQB 4YXKH 2R2BB 1FCCA 2A83A 5K9QG 2HTKD 5BVPH 3ULUD 1MJ8H 2CPCA 1R3JA 1WFUA 4R26L 3QNXB 2R0WL 1DE4A 5F7FA 2DJSA 4X4YA 1A6PA 3FO1A 2V5MA 5DJAB 4X6CF 3QDJB 1VPOH 4EXPX 3LQZA 4UBDD 4NSKA 1TVHA 3EW3B 4PG9B 1MCLA 1WZ1H 1NC2B 5HHPA 1X5LA 5IB5A 1YPZF 3W39B 5EWIH 1OAUH 4WENB 1NLBL 1TIUA 3WKMH 1G6RB 1G6RH 5F71A 4YFLF 2A6IB 4PV8B 2YN3A 4LSTL 4QCIA 4QHUA 1QSEA 1H8OA 2R1XB 1F4XH 4G6JH 3CX5K 3SGJC 1CDBA 3B4NA 1F4YH 3RBSA 3MXWH 4U6VH 5E4EC 3BKCH 5I8EB 1EGJH 2PW1B 4FXGA 4DVBB 1UH2A 4ZS6C 3S5LA 2DQIH 4ZOAA 4JQXA 4D0BA 2AV7A 5ITFB 3BKJL 2Y1VA 2FX9L 5FGBC 2YOCA 4ZUUA 4R2GC 4MXWH 3L7EB 4QKXB 1SHMA 2YD7A 3GMNB 2KKQA 2X4PA 2BHYA 3SDXF 4P9ML 2E6JA 1U42A 5BS0E 3SE3A 1X7QA 4NQEB 2IPKB 4F57L 4JKMA 4DW2H 1AH1A 2ADIA 2NW3A 4Q0XH 5EU6A 4XP6H 2P5WD 4OLYL 5TDOB 4JFEE 2UY7A 5FHBL 5GJTH 4QRRE 5HHOA 4F7MA 3VXPA 5DJ0B 1HZHL 4QWWD 5IMKA 2N7AA 4XCCH 1JNHA 5EU3A 4X6FB 1P2CA 5KANI 2P7TA 1U8NA 4LLAA 4MD5B 4OQTL 1EMTH 4HXAH 3VGAB 2DQDH 2V5RA 1YEFL 3KHQA 1MIML 2ATPB 2EDDA 2VLJA 4PJCA 4LCCC 2B4CH 5IB2B 1FO0A 5L2JB 1T21B 3SJVD 2BOCA 3M17B 2DWDB 5GGQL 4PRPB 5D70L 5IIEA 3GMLB 5IJKA 2G60H 3HS0B 3QCTH 2WW8A 4MNQE 3KLHC 1G84A 4RX4A 4FS0A 5T5FL 4XP5H 5IB1B 2AJSH 1TMCB 4GUPB 5IMLA 1T20B 3GUTA 1N7ML 4UUJA 3H7BA 4YAQB 4FQHB 3QUYC 1PQZA 1N4XH 3U0WH 5GGQH 1T89C 5ADPL 1EDQA 4UT7H 5EUKB 3RY6A 3PV7A 1LO3L 5EIVA 2N7BA 2XTJE 1N6UA 1Q0XH 4J3UA 5FUCC 5C08D 2IBZY 4P49A 3NAAH 1AY1L 3AXLA 1QA9A 4PRBB 5TPWH 1T22B 3QUXA 4NZRH 3S37L 3U6RA 2ZCKH 1XF4B 1FFNA 2VDPL 3W9EA 2V17H 3KLSA 4TNVK 4YHOL 2VN7A 4LLWB 1KEMH 5DEFA 4AQOA 4NQDD 5DURB 2I60H 3QRGL 4YH6A 5LCVH 3O3DB 1ETZA 1QRNA 1GGUA 43C9B 1CU4H 1U8HA 5ESAB 1UWEH 4GKNB 2BXZA 4HWEL 3FCTB 3P4OA 1I8MB 3NN8A 1NGYB 4HV8A 4RCAA 4WV1B 2NY5L 3PWPB 2QADB 1KCLA 3GBMH 3PQYA 1JF1A 4P46C 2YC1A 4NYLA 4Y0GA 4ALAH 1R3LA 1AR1D 2DKSA 5GJSL 1JMZA 4OCLC 1Q8MA 5HPMB 2DYPB 2MOVA 4PG9A 4RWHA 2CKBH 3TO2B 1FFOA 3C5ZA 3RY4A 3T0EC 3UTQB 4KUZH 3DX9A 3FT4B 1DBBL 4Y4KC 3RIFK 1CIDA 1I8LC 4YPGB 5AZ2L 2Y5TB 3PGFL 4L4JA 5D7JB 4PJ5B 4Q0XL 2ATKB 2AEQL 4NM4H 5EU4A 4BUGA 1BVKB 2H9GA 3KPSA 3PP4L 3BD3A 3GIZL 4QWWC 1H0DB 4K7FB 1SYVB 5DQDH 1YEDA 5KAQG 2B20A 1YY9D 2ID5A 5TQ0L 4CDHA 1D5XA 4FQXA 3KYNB 4J1UA 2DDQH 4MCZB 5J9PB 8FABB 3LEYL 5E2TL 2E7LA 5F3HA 4JM2D 1T1YB 3G5ZA 4EI5A 1JPTL 2OR9L 1J9CT 4L9LA 2XWTB 5HVFB 1PSKL 3TIDB 12E8L 3A67H 4ZNCD 2J8UF 3MLVL 4JHZA 1UM6L 5K59E 2CLZB 3ZT5A 2Q7NA 4NQCE 5HGDA 2EDFA 3MRPB 1M7IA 2O61A 1GC1L 1XIWD 4BJLA 1CK0L 4GRMB 1WFTA 4G3YL 2VDKL 2P5EE 3LS5L 3IKCA 1CFSA 1XR9B 1KN4L 1ZE3C 4PUBL 5EU6B 4OLZL 5EN2B 1YNLH 2R0LH 4BA8A 1MWAL 3SEPA 3T3PE 4QTHB 1TZHB 4NPYA 1N3NB 3OMZA 1BMGA 1CZ8L 1ZWIB 2Q76A 3I2CL 4Z7VF 3QCUH 2H1PH 4ZO6A 1I1YB 1Z3GL 1JHLL 4MJIA 1MFBH 3WIFB 4JFYB 5C70A 3WXVL 1JI2A 3CH1A 4PRNB 3ILPB 3FQUB 1D5IL 4L4VA 2VERN 5DYOB 5FM5M 2QSCL 1MF2L 5C0BB 4F9PC 4U2YA 4HLZG 1IL1A 3VJ6A 1NMAH 1OP5H 1OARH 5TF0A 4LOUC 4G8FB 3C6LA 2AGJL 1U58B 5D8JH 3QI9D 5K9OA 1GVIA 1K5NA 2QKIB 1FDLL 3TZVC 4KFZC 1ORSB 2EDHA 4M00A 2GITB 4P5TB 2DQCH 4W68A 3O81A 3UDWA 4LHJB 3U0TA 3X14A 4FMFA 4JY5H 1JNHB 1Q9KA 2EYRA 3GFUA 2X41A 1S9WB 2E7LC 4PGBA 4WI3A 4I18A 5IM7B 1I7UB 2FR4B 3SJVE 2VXUL 2FB4L 2PR4L 1HNFA 4P4RA 3UBXA 5D1ZB 1XGPA 2C1OA 3F6IA 3VH8G 4FFYH 4NP4H 5I1EL 5T3ZL 32C2A 4WDIA 3REVB 1QR4A 3WLWD 1AQKH 4XBPA 3TBYA 4NO3A 4BZYA 3QDGB 2GFBB 3BQUC 2MCPL 1INDL 5LGJB 3MOAH 4MA7H 1M6OA